F488071
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1008 | 520 | 2016 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300046538|Ga0495609_0066467|Ga0495609_0066467_356_1399 |
| Length | 347 |
| Sequence | MRSLPIQKPLKLMAFTALALLIVSCSSNSPTRSKPQGGGIVRAQPGLDINRAHKDGAPWWDVDVSRIPDAVPTLHTGPYKANPYTVLGKTYFPLNDSATYAQTGTASWYGTKFHGQNTANGEVYDLYGMSAAHKTLPLPSYVRVTNLDNNRTVILRVNDRGPFYSDRIIDLSYAAAKKLGYAEIGTARVKVEGIDPAQYWAQRGKPAPLMLDQPQVASSAPVRAQAAPVITASAGTIEQWTPPPQQHAAPVAPVPVQIDAKKNVSGQASGLFLQVGAFANPDAAELLRSKLSGMVRAPVFVSSIARNQQTLYRVRLGPVDTPGEAQQLQNSVRSANLGSPSVVTSDQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 40 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 43 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 44 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 45 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 110 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 111 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 115 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 117 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 118 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 119 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 120 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 122 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 123 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 124 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 125 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 128 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 130 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 131 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 134 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 135 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 136 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 137 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 138 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 139 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 140 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 141 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 142 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 143 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 144 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 145 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 146 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 147 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 148 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 149 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 150 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 151 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 152 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 153 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 154 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 155 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 156 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 157 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 158 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 159 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 160 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 161 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 162 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 163 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 164 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 165 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 166 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 167 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 168 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 169 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 170 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 171 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 228 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 229 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 230 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 233 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 234 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 235 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 236 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 237 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 238 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 239 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 240 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 241 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 242 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 243 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 250 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 251 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 252 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 253 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 254 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 255 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 256 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 257 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 258 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 259 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 260 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 261 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 262 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 263 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 264 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 265 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 266 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 267 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 268 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 269 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 270 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 271 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 272 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 273 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 274 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 275 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 276 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 277 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 278 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 279 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 280 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 281 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 282 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 283 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 284 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 285 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 286 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 287 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 288 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 289 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 290 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 291 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 292 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 293 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 294 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 295 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 296 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 297 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 298 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 299 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 300 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 301 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 302 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 303 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 304 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 305 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 306 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 307 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 308 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 309 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 310 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 311 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 312 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 313 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 314 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 315 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 316 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 317 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 318 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 319 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 320 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 321 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 322 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 323 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 324 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 325 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 326 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 327 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 328 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 329 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 330 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 331 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 332 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 333 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 334 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 335 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 336 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 337 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 338 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 339 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 340 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 341 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 342 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 343 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 344 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 345 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 346 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 347 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 348 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 349 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 350 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 351 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 352 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 353 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 354 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 355 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 356 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 357 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 358 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 359 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 360 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 361 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 362 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 363 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 364 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 365 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 366 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 367 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 368 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 369 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 370 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 371 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 372 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 373 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 374 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 375 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 376 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 377 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 378 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 379 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 380 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 381 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 382 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 383 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 384 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 385 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 386 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 387 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 388 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 389 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 390 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 391 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 392 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 393 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 394 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 395 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 396 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 397 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 398 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 399 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 400 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 401 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 402 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 403 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 404 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 405 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 406 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 407 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 408 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 409 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 410 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 411 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 412 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 413 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 414 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 415 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 416 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 417 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 418 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 419 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 420 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 421 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 422 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 423 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 424 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 425 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 426 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 427 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 428 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 429 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 430 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 431 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 432 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 433 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 434 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 435 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 436 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 437 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 438 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 439 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 440 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 441 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 442 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 443 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 444 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 445 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 446 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 447 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 448 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 449 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 450 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 451 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 452 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 453 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 454 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 455 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 456 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 457 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 458 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 459 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 460 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 461 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 462 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 463 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 464 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 465 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 466 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 467 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 468 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 469 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 470 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 471 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 472 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 473 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 474 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 475 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 476 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 477 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 478 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 479 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 480 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 481 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 482 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 483 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 484 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 485 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 486 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 487 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 488 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 489 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 490 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 491 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 492 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 493 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 494 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 495 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 496 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 497 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 498 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 499 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 500 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 501 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 502 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 503 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 504 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 505 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 506 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 507 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 508 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 509 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 510 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 511 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 512 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 513 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 514 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 515 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 516 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 517 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 518 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 519 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 520 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.61 |
| Metatranscriptomes | 0.2 |
| Isolates | 26.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 6.75 |
| Nodule | 2.68 |
| Rhizoplane | 7.44 |
| Rhizosphere | 68.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495609_0066467 | 3300046538 | Bacteria | 1588 |
| 2 | SwRhRL2b_contig_1994375 | 2162886007 | Bacteria | 1315 |
| 3 | JGI25162J39368_1000122 | 3300002737 | Bacteria | 85129 |
| 4 | JGI25162J39368_1000233 | 3300002737 | Bacteria | 56224 |
| 5 | JGI25164J39214_1000099 | 3300002772 | Bacteria | 85129 |
| 6 | JGI25164J39214_1000180 | 3300002772 | Bacteria | 56224 |
| 7 | JGI25165J46597_1000205 | 3300003214 | Bacteria | 85129 |
| 8 | JGI25165J46597_1000331 | 3300003214 | Bacteria | 56224 |
| 9 | Ga0006562J51391_1020668 | 3300003578 | Bacteria | 3209 |
| 10 | Ga0055538_1000042 | 3300003751 | Bacteria | 164754 |
| 11 | Ga0055539_1000055 | 3300003752 | Bacteria | 164754 |
| 12 | Ga0055533_1000067 | 3300003756 | Bacteria | 164754 |
| 13 | Ga0055532_1000053 | 3300003758 | Bacteria | 164751 |
| 14 | Ga0055525_1000103 | 3300003759 | Bacteria | 134778 |
| 15 | Ga0055525_1002283 | 3300003759 | Bacteria | 2082 |
| 16 | Ga0055536_1001766 | 3300003781 | Bacteria | 12745 |
| 17 | Ga0055536_1003363 | 3300003781 | Bacteria | 8635 |
| 18 | Ga0055536_1008077 | 3300003781 | Bacteria | 4592 |
| 19 | Ga0055536_1021178 | 3300003781 | Bacteria | 1982 |
| 20 | Ga0055530_10000884 | 3300003791 | Bacteria | 24615 |
| 21 | Ga0055530_10001431 | 3300003791 | Bacteria | 17475 |
| 22 | Ga0055530_10002933 | 3300003791 | Bacteria | 10326 |
| 23 | Ga0055530_10008959 | 3300003791 | Bacteria | 3917 |
| 24 | Ga0055540_1000333 | 3300003792 | Bacteria | 40988 |
| 25 | Ga0055540_1000455 | 3300003792 | Bacteria | 31894 |
| 26 | Ga0055540_1002283 | 3300003792 | Bacteria | 10326 |
| 27 | Ga0055531_10001360 | 3300003794 | Bacteria | 18185 |
| 28 | Ga0055541_1000042 | 3300003841 | Bacteria | 164754 |
| 29 | Ga0058692_1002717 | 3300003856 | Bacteria | 5818 |
| 30 | Ga0065714_10000379 | 3300005288 | Bacteria | 5607 |
| 31 | Ga0065714_10003289 | 3300005288 | Bacteria | 12364 |
| 32 | Ga0065714_10003418 | 3300005288 | Bacteria | 10099 |
| 33 | Ga0065714_10025053 | 3300005288 | Bacteria | 2304 |
| 34 | Ga0065714_10076102 | 3300005288 | Bacteria | 2829 |
| 35 | Ga0065714_10082099 | 3300005288 | Bacteria | 2320 |
| 36 | Ga0065714_10119037 | 3300005288 | Bacteria | 1363 |
| 37 | Ga0065714_10147869 | 3300005288 | Bacteria | 1124 |
| 38 | Ga0065704_10006960 | 3300005289 | Bacteria | 2883 |
| 39 | Ga0065704_10009829 | 3300005289 | Bacteria | 3529 |
| 40 | Ga0065704_10072683 | 3300005289 | Bacteria | 8151 |
| 41 | Ga0065712_10000936 | 3300005290 | Bacteria | 8326 |
| 42 | Ga0065712_10002123 | 3300005290 | Bacteria | 8891 |
| 43 | Ga0065712_10068547 | 3300005290 | Bacteria | 9950 |
| 44 | Ga0070670_100000002 | 3300005331 | Bacteria | 568775 |
| 45 | Ga0070670_100004982 | 3300005331 | Bacteria | 11175 |
| 46 | Ga0070680_100003483 | 3300005336 | Bacteria | 11750 |
| 47 | Ga0070682_100108166 | 3300005337 | Bacteria | 1848 |
| 48 | Ga0070661_100000729 | 3300005344 | Bacteria | 24032 |
| 49 | Ga0070669_100000218 | 3300005353 | Bacteria | 47769 |
| 50 | Ga0070669_100062268 | 3300005353 | Bacteria | 2743 |
| 51 | Ga0070671_100000022 | 3300005355 | Bacteria | 124364 |
| 52 | Ga0070713_100181425 | 3300005436 | Bacteria | 1892 |
| 53 | Ga0070662_100002371 | 3300005457 | Bacteria | 11576 |
| 54 | Ga0070681_10096046 | 3300005458 | Bacteria | 2912 |
| 55 | Ga0070679_100002393 | 3300005530 | Bacteria | 17004 |
| 56 | Ga0070679_100028256 | 3300005530 | Bacteria | 5529 |
| 57 | Ga0068853_100000414 | 3300005539 | Bacteria | 29409 |
| 58 | Ga0070665_100024188 | 3300005548 | Bacteria | 6117 |
| 59 | Ga0070665_100118858 | 3300005548 | Bacteria | 2645 |
| 60 | Ga0070665_100486116 | 3300005548 | Bacteria | 1245 |
| 61 | Ga0068855_100010801 | 3300005563 | Bacteria | 11024 |
| 62 | Ga0068855_100070916 | 3300005563 | Bacteria | 4052 |
| 63 | Ga0070664_100012726 | 3300005564 | Bacteria | 6849 |
| 64 | Ga0070664_100226216 | 3300005564 | Bacteria | 1675 |
| 65 | Ga0068854_100001639 | 3300005578 | Bacteria | 13614 |
| 66 | Ga0068856_100589436 | 3300005614 | Bacteria | 1133 |
| 67 | Ga0068852_100451808 | 3300005616 | Bacteria | 1272 |
| 68 | Ga0068851_10000002 | 3300005834 | Bacteria | 302756 |
| 69 | Ga0075364_10055660 | 3300006051 | Bacteria | 2588 |
| 70 | Ga0075364_10074023 | 3300006051 | Bacteria | 2246 |
| 71 | Ga0075364_10121238 | 3300006051 | Bacteria | 1750 |
| 72 | Ga0075432_10035384 | 3300006058 | Bacteria | 1735 |
| 73 | Ga0075432_10063712 | 3300006058 | Bacteria | 1316 |
| 74 | Ga0075432_10072561 | 3300006058 | Bacteria | 1238 |
| 75 | Ga0075362_10105567 | 3300006177 | Bacteria | 1321 |
| 76 | Ga0075369_10100356 | 3300006186 | Bacteria | 1298 |
| 77 | Ga0099823_1019967 | 3300006944 | Bacteria | 6362 |
| 78 | Ga0079104_1000116 | 3300006946 | Bacteria | 114868 |
| 79 | Ga0079104_1002609 | 3300006946 | Bacteria | 9443 |
| 80 | Ga0105251_10000011 | 3300009011 | Bacteria | 180176 |
| 81 | Ga0105251_10002219 | 3300009011 | Bacteria | 15495 |
| 82 | Ga0105251_10004234 | 3300009011 | Bacteria | 9909 |
| 83 | Ga0105251_10008203 | 3300009011 | Bacteria | 6314 |
| 84 | Ga0105251_10009460 | 3300009011 | Bacteria | 5753 |
| 85 | Ga0105251_10021111 | 3300009011 | Bacteria | 3407 |
| 86 | Ga0105251_10024384 | 3300009011 | Bacteria | 3107 |
| 87 | Ga0105251_10031139 | 3300009011 | Bacteria | 2672 |
| 88 | Ga0105251_10051625 | 3300009011 | Bacteria | 1960 |
| 89 | Ga0105251_10080024 | 3300009011 | Bacteria | 1511 |
| 90 | Ga0105244_10001066 | 3300009036 | Bacteria | 22914 |
| 91 | Ga0105244_10006436 | 3300009036 | Bacteria | 7603 |
| 92 | Ga0105244_10008892 | 3300009036 | Bacteria | 6226 |
| 93 | Ga0105244_10011041 | 3300009036 | Bacteria | 5443 |
| 94 | Ga0105244_10011294 | 3300009036 | Bacteria | 5370 |
| 95 | Ga0105244_10011431 | 3300009036 | Bacteria | 5326 |
| 96 | Ga0105244_10019152 | 3300009036 | Bacteria | 3828 |
| 97 | Ga0105244_10028204 | 3300009036 | Bacteria | 3015 |
| 98 | Ga0105244_10029959 | 3300009036 | Bacteria | 2900 |
| 99 | Ga0105244_10038231 | 3300009036 | Bacteria | 2503 |
| 100 | Ga0105244_10038927 | 3300009036 | Bacteria | 2477 |
| 101 | Ga0105250_10000657 | 3300009092 | Bacteria | 21923 |
| 102 | Ga0105250_10004400 | 3300009092 | Bacteria | 6488 |
| 103 | Ga0105250_10055693 | 3300009092 | Bacteria | 1587 |
| 104 | Ga0105240_10000960 | 3300009093 | Bacteria | 51436 |
| 105 | Ga0105240_10012712 | 3300009093 | Bacteria | 11604 |
| 106 | Ga0105240_10256444 | 3300009093 | Bacteria | 2020 |
| 107 | Ga0105240_10686944 | 3300009093 | Bacteria | 1118 |
| 108 | Ga0105243_10000188 | 3300009148 | Bacteria | 71863 |
| 109 | Ga0105243_10001577 | 3300009148 | Bacteria | 19929 |
| 110 | Ga0105243_10059100 | 3300009148 | Bacteria | 3058 |
| 111 | Ga0105243_10115022 | 3300009148 | Bacteria | 2258 |
| 112 | Ga0105242_10000442 | 3300009176 | Bacteria | 32971 |
| 113 | Ga0105248_10014418 | 3300009177 | Bacteria | 8699 |
| 114 | Ga0105248_10710898 | 3300009177 | Bacteria | 1134 |
| 115 | Ga0105237_10001803 | 3300009545 | Bacteria | 27640 |
| 116 | Ga0105237_10011832 | 3300009545 | Bacteria | 9228 |
| 117 | Ga0105238_10001357 | 3300009551 | Bacteria | 24558 |
| 118 | Ga0105238_10590346 | 3300009551 | Bacteria | 1118 |
| 119 | Ga0105249_10187816 | 3300009553 | Bacteria | 2015 |
| 120 | Ga0105246_10000552 | 3300011119 | Bacteria | 20625 |
| 121 | Ga0105246_10000905 | 3300011119 | Bacteria | 17012 |
| 122 | Ga0105246_10010477 | 3300011119 | Bacteria | 5737 |
| 123 | Ga0157345_1001221 | 3300012498 | Bacteria | 1822 |
| 124 | Ga0157373_10003549 | 3300013100 | Bacteria | 11782 |
| 125 | Ga0157373_10024113 | 3300013100 | Bacteria | 4409 |
| 126 | Ga0157373_10111642 | 3300013100 | Bacteria | 1922 |
| 127 | Ga0157373_10144477 | 3300013100 | Bacteria | 1673 |
| 128 | Ga0157373_10173169 | 3300013100 | Bacteria | 1519 |
| 129 | Ga0157373_10247884 | 3300013100 | Bacteria | 1259 |
| 130 | Ga0157373_10250491 | 3300013100 | Bacteria | 1253 |
| 131 | Ga0157371_10000243 | 3300013102 | Bacteria | 77959 |
| 132 | Ga0157371_10001094 | 3300013102 | Bacteria | 29390 |
| 133 | Ga0157371_10011353 | 3300013102 | Bacteria | 6871 |
| 134 | Ga0157371_10011506 | 3300013102 | Bacteria | 6808 |
| 135 | Ga0157371_10033069 | 3300013102 | Bacteria | 3718 |
| 136 | Ga0157370_10000388 | 3300013104 | Bacteria | 55229 |
| 137 | Ga0157370_10001514 | 3300013104 | Bacteria | 28723 |
| 138 | Ga0157370_10066193 | 3300013104 | Bacteria | 3418 |
| 139 | Ga0157370_10116589 | 3300013104 | Unclassified | 2495 |
| 140 | Ga0157370_10144054 | 3300013104 | Bacteria | 2219 |
| 141 | Ga0157370_10167000 | 3300013104 | Bacteria | 2046 |
| 142 | Ga0157370_10347488 | 3300013104 | Bacteria | 1367 |
| 143 | Ga0157369_10000818 | 3300013105 | Bacteria | 39768 |
| 144 | Ga0157369_10006101 | 3300013105 | Bacteria | 13991 |
| 145 | Ga0157369_10148184 | 3300013105 | Bacteria | 2481 |
| 146 | Ga0157369_10167030 | 3300013105 | Bacteria | 2320 |
| 147 | Ga0157369_10169975 | 3300013105 | Bacteria | 2297 |
| 148 | Ga0157369_10173827 | 3300013105 | Bacteria | 2268 |
| 149 | Ga0157369_10564407 | 3300013105 | Bacteria | 1176 |
| 150 | Ga0163162_10012103 | 3300013306 | Bacteria | 8417 |
| 151 | Ga0163162_10587354 | 3300013306 | Bacteria | 1241 |
| 152 | Ga0163162_10768447 | 3300013306 | Bacteria | 1082 |
| 153 | Ga0157372_10001236 | 3300013307 | Bacteria | 27666 |
| 154 | Ga0157372_10045650 | 3300013307 | Bacteria | 4861 |
| 155 | Ga0157372_10101121 | 3300013307 | Bacteria | 3290 |
| 156 | Ga0157375_10115247 | 3300013308 | Bacteria | 2790 |
| 157 | Ga0182008_10000900 | 3300014497 | Bacteria | 20656 |
| 158 | Ga0182008_10039844 | 3300014497 | Bacteria | 2347 |
| 159 | Ga0182008_10040155 | 3300014497 | Bacteria | 2337 |
| 160 | Ga0182008_10042578 | 3300014497 | Bacteria | 2262 |
| 161 | Ga0182008_10056097 | 3300014497 | Bacteria | 1947 |
| 162 | Ga0182008_10109988 | 3300014497 | Bacteria | 1365 |
| 163 | Ga0182008_10135026 | 3300014497 | Bacteria | 1232 |
| 164 | Ga0157379_10034328 | 3300014968 | Bacteria | 4523 |
| 165 | Ga0157379_10316654 | 3300014968 | Bacteria | 1424 |
| 166 | Ga0182006_1037239 | 3300015261 | Bacteria | 1929 |
| 167 | Ga0182006_1072752 | 3300015261 | Bacteria | 1270 |
| 168 | Ga0182006_1080464 | 3300015261 | Bacteria | 1190 |
| 169 | Ga0182007_10002788 | 3300015262 | Bacteria | 8518 |
| 170 | Ga0182005_1007407 | 3300015265 | Bacteria | 3294 |
| 171 | Ga0163161_10127654 | 3300017792 | Bacteria | 1916 |
| 172 | Ga0163161_10309887 | 3300017792 | Bacteria | 1245 |
| 173 | Ga0163161_10310227 | 3300017792 | Bacteria | 1245 |
| 174 | Ga0163161_10397654 | 3300017792 | Bacteria | 1104 |
| 175 | Ga0209435_100900 | 3300025206 | Bacteria | 4520 |
| 176 | Ga0209760_100058 | 3300025207 | Bacteria | 98827 |
| 177 | Ga0209760_100060 | 3300025207 | Bacteria | 97274 |
| 178 | Ga0209784_100060 | 3300025224 | Bacteria | 164838 |
| 179 | Ga0209566_100075 | 3300025225 | Bacteria | 164838 |
| 180 | Ga0209674_100100 | 3300025226 | Bacteria | 164838 |
| 181 | Ga0209147_100096 | 3300025229 | Bacteria | 164838 |
| 182 | Ga0209563_100118 | 3300025230 | Bacteria | 131627 |
| 183 | Ga0209563_101016 | 3300025230 | Bacteria | 8182 |
| 184 | Ga0207427_100056 | 3300025231 | Bacteria | 204343 |
| 185 | Ga0207427_100063 | 3300025231 | Bacteria | 177711 |
| 186 | Ga0209437_100065 | 3300025233 | Bacteria | 332417 |
| 187 | Ga0209437_100133 | 3300025233 | Bacteria | 178493 |
| 188 | Ga0209258_100221 | 3300025242 | Bacteria | 108497 |
| 189 | Ga0209646_1000474 | 3300025246 | Bacteria | 20163 |
| 190 | Ga0209677_100057 | 3300025253 | Bacteria | 164838 |
| 191 | Ga0209759_1015683 | 3300025256 | Bacteria | 1945 |
| 192 | Ga0209233_1000085 | 3300025261 | Bacteria | 333078 |
| 193 | Ga0209233_1000133 | 3300025261 | Bacteria | 202716 |
| 194 | Ga0209676_1000076 | 3300025292 | Bacteria | 301393 |
| 195 | Ga0209676_1000264 | 3300025292 | Bacteria | 110593 |
| 196 | Ga0209676_1000822 | 3300025292 | Bacteria | 40365 |
| 197 | Ga0209676_1000952 | 3300025292 | Bacteria | 35453 |
| 198 | Ga0209676_1003131 | 3300025292 | Bacteria | 10579 |
| 199 | Ga0209676_1015731 | 3300025292 | Bacteria | 2769 |
| 200 | Ga0209050_1000063 | 3300025298 | Bacteria | 314955 |
| 201 | Ga0209050_1000080 | 3300025298 | Bacteria | 275154 |
| 202 | Ga0209050_1000106 | 3300025298 | Bacteria | 224396 |
| 203 | Ga0209050_1002243 | 3300025298 | Bacteria | 17249 |
| 204 | Ga0209051_1000045 | 3300025303 | Bacteria | 297882 |
| 205 | Ga0209051_1000082 | 3300025303 | Bacteria | 193133 |
| 206 | Ga0209051_1000139 | 3300025303 | Bacteria | 136281 |
| 207 | Ga0209257_1000185 | 3300025304 | Bacteria | 155047 |
| 208 | Ga0209257_1012213 | 3300025304 | Bacteria | 4006 |
| 209 | Ga0207656_10000010 | 3300025321 | Bacteria | 192224 |
| 210 | Ga0207696_1000047 | 3300025711 | Bacteria | 285005 |
| 211 | Ga0207696_1000065 | 3300025711 | Bacteria | 231818 |
| 212 | Ga0207696_1000126 | 3300025711 | Bacteria | 136197 |
| 213 | Ga0207696_1000168 | 3300025711 | Bacteria | 103496 |
| 214 | Ga0207696_1009597 | 3300025711 | Bacteria | 3602 |
| 215 | Ga0207696_1017805 | 3300025711 | Bacteria | 2345 |
| 216 | Ga0207696_1037936 | 3300025711 | Bacteria | 1424 |
| 217 | Ga0207655_1000120 | 3300025728 | Bacteria | 157018 |
| 218 | Ga0207655_1000213 | 3300025728 | Bacteria | 101587 |
| 219 | Ga0207655_1000214 | 3300025728 | Bacteria | 101123 |
| 220 | Ga0207655_1000742 | 3300025728 | Bacteria | 36636 |
| 221 | Ga0207655_1000810 | 3300025728 | Bacteria | 33884 |
| 222 | Ga0207655_1001105 | 3300025728 | Bacteria | 26398 |
| 223 | Ga0207655_1001674 | 3300025728 | Bacteria | 19532 |
| 224 | Ga0207655_1004177 | 3300025728 | Bacteria | 10364 |
| 225 | Ga0207655_1006183 | 3300025728 | Bacteria | 7978 |
| 226 | Ga0207655_1009815 | 3300025728 | Bacteria | 5896 |
| 227 | Ga0207655_1011058 | 3300025728 | Bacteria | 5413 |
| 228 | Ga0207655_1011644 | 3300025728 | Bacteria | 5215 |
| 229 | Ga0207655_1024689 | 3300025728 | Bacteria | 2938 |
| 230 | Ga0207655_1035864 | 3300025728 | Bacteria | 2208 |
| 231 | Ga0207655_1063911 | 3300025728 | Bacteria | 1407 |
| 232 | Ga0207713_1000049 | 3300025735 | Bacteria | 227882 |
| 233 | Ga0207713_1000073 | 3300025735 | Bacteria | 181519 |
| 234 | Ga0207713_1000337 | 3300025735 | Bacteria | 52167 |
| 235 | Ga0207713_1000467 | 3300025735 | Bacteria | 42199 |
| 236 | Ga0207713_1000799 | 3300025735 | Bacteria | 29154 |
| 237 | Ga0207713_1000862 | 3300025735 | Bacteria | 27758 |
| 238 | Ga0207713_1002385 | 3300025735 | Bacteria | 13726 |
| 239 | Ga0207713_1003051 | 3300025735 | Bacteria | 11656 |
| 240 | Ga0207713_1004156 | 3300025735 | Bacteria | 9500 |
| 241 | Ga0207713_1005188 | 3300025735 | Bacteria | 8226 |
| 242 | Ga0207713_1006295 | 3300025735 | Bacteria | 7258 |
| 243 | Ga0207713_1009274 | 3300025735 | Bacteria | 5571 |
| 244 | Ga0207713_1019085 | 3300025735 | Bacteria | 3369 |
| 245 | Ga0207713_1022056 | 3300025735 | Bacteria | 3035 |
| 246 | Ga0207713_1023984 | 3300025735 | Bacteria | 2856 |
| 247 | Ga0207713_1029733 | 3300025735 | Bacteria | 2442 |
| 248 | Ga0207707_10000165 | 3300025912 | Bacteria | 69371 |
| 249 | Ga0207695_10008884 | 3300025913 | Bacteria | 12509 |
| 250 | Ga0207695_10009284 | 3300025913 | Bacteria | 12178 |
| 251 | Ga0207695_10100317 | 3300025913 | Bacteria | 2891 |
| 252 | Ga0207695_10518162 | 3300025913 | Bacteria | 1074 |
| 253 | Ga0207671_10000373 | 3300025914 | Bacteria | 63578 |
| 254 | Ga0207660_10003867 | 3300025917 | Bacteria | 9756 |
| 255 | Ga0207660_10080199 | 3300025917 | Bacteria | 2396 |
| 256 | Ga0207649_10000126 | 3300025920 | Bacteria | 64678 |
| 257 | Ga0207652_10005936 | 3300025921 | Bacteria | 9878 |
| 258 | Ga0207652_10022224 | 3300025921 | Bacteria | 5244 |
| 259 | Ga0207652_10123589 | 3300025921 | Bacteria | 2304 |
| 260 | Ga0207681_10000148 | 3300025923 | Bacteria | 58793 |
| 261 | Ga0207681_10008503 | 3300025923 | Bacteria | 6272 |
| 262 | Ga0207650_10000409 | 3300025925 | Bacteria | 38344 |
| 263 | Ga0207650_10000620 | 3300025925 | Bacteria | 28400 |
| 264 | Ga0207644_10000037 | 3300025931 | Bacteria | 124306 |
| 265 | Ga0207706_10000871 | 3300025933 | Bacteria | 31040 |
| 266 | Ga0207706_10014846 | 3300025933 | Bacteria | 7052 |
| 267 | Ga0207686_10003589 | 3300025934 | Bacteria | 8323 |
| 268 | Ga0207709_10000030 | 3300025935 | Bacteria | 331710 |
| 269 | Ga0207709_10000265 | 3300025935 | Bacteria | 61850 |
| 270 | Ga0207709_10005530 | 3300025935 | Bacteria | 7167 |
| 271 | Ga0207709_10059153 | 3300025935 | Bacteria | 2384 |
| 272 | Ga0207709_10071874 | 3300025935 | Bacteria | 2199 |
| 273 | Ga0207709_10093172 | 3300025935 | Bacteria | 1974 |
| 274 | Ga0207711_10090221 | 3300025941 | Bacteria | 2694 |
| 275 | Ga0207679_10000017 | 3300025945 | Bacteria | 253004 |
| 276 | Ga0207679_10116066 | 3300025945 | Bacteria | 2122 |
| 277 | Ga0207667_10002663 | 3300025949 | Bacteria | 22069 |
| 278 | Ga0207667_10010320 | 3300025949 | Bacteria | 10925 |
| 279 | Ga0207667_10235358 | 3300025949 | Bacteria | 1875 |
| 280 | Ga0207667_10363270 | 3300025949 | Bacteria | 1476 |
| 281 | Ga0207639_10000418 | 3300026041 | Bacteria | 29438 |
| 282 | Ga0207702_10481031 | 3300026078 | Bacteria | 1208 |
| 283 | Ga0209281_1000070 | 3300027111 | Bacteria | 277098 |
| 284 | Ga0209281_1000127 | 3300027111 | Bacteria | 200036 |
| 285 | Ga0209281_1003227 | 3300027111 | Bacteria | 5558 |
| 286 | Ga0209389_1000171 | 3300027296 | Bacteria | 52288 |
| 287 | Ga0209371_1000094 | 3300027312 | Bacteria | 170815 |
| 288 | Ga0209371_1000219 | 3300027312 | Bacteria | 76557 |
| 289 | Ga0209995_1001312 | 3300027471 | Bacteria | 3830 |
| 290 | Ga0209983_1002129 | 3300027665 | Bacteria | 4363 |
| 291 | Ga0207428_10003468 | 3300027907 | Bacteria | 15304 |
| 292 | Ga0268266_10000246 | 3300028379 | Bacteria | 91633 |
| 293 | Ga0268266_10057991 | 3300028379 | Bacteria | 3333 |
| 294 | Ga0268266_10176726 | 3300028379 | Bacteria | 1941 |
| 295 | Ga0268256_1000083 | 3300030500 | Bacteria | 170829 |
| 296 | Ga0268256_1000356 | 3300030500 | Bacteria | 43790 |
| 297 | Ga0314311_1250128 | 3300030733 | Bacteria | 4937 |
| 298 | Ga0316178_1105767 | 3300030735 | Bacteria | 15950 |
| 299 | Ga0316181_1098368 | 3300030744 | Bacteria | 2006 |
| 300 | Ga0316181_1105230 | 3300030744 | Bacteria | 1709 |
| 301 | Ga0265316_10207768 | 3300031344 | Bacteria | 1449 |
| 302 | Ga0307408_100000013 | 3300031548 | Bacteria | 386212 |
| 303 | Ga0307408_100157661 | 3300031548 | Bacteria | 1799 |
| 304 | Ga0307408_100188021 | 3300031548 | Bacteria | 1661 |
| 305 | Ga0316575_10109859 | 3300031665 | Bacteria | 1125 |
| 306 | Ga0316579_10000205 | 3300031691 | Bacteria | 17584 |
| 307 | Ga0316578_10014339 | 3300031728 | Bacteria | 4231 |
| 308 | Ga0316577_10003841 | 3300031733 | Bacteria | 7656 |
| 309 | Ga0307409_100191685 | 3300031995 | Bacteria | 1820 |
| 310 | Ga0316585_10004574 | 3300032137 | Bacteria | 3861 |
| 311 | Ga0316593_10017867 | 3300032168 | Bacteria | 2169 |
| 312 | Ga0307510_10164030 | 3300033180 | Bacteria | 1813 |
| 313 | Ga0316574_0034538 | 3300035398 | Bacteria | 3084 |
| 314 | Ga0316581_0000481 | 3300037588 | Bacteria | 7661 |
| 315 | Ga0436365_0833723 | 3300039437 | Bacteria | 1624 |
| 316 | Ga0439436_0000216 | 3300041404 | Bacteria | 13822 |
| 317 | Ga0439438_000980 | 3300041405 | Bacteria | 12761 |
| 318 | Ga0439438_005907 | 3300041405 | Bacteria | 4424 |
| 319 | Ga0439438_009913 | 3300041405 | Bacteria | 3053 |
| 320 | Ga0439438_012665 | 3300041405 | Bacteria | 2577 |
| 321 | Ga0439447_001011 | 3300041407 | Bacteria | 10243 |
| 322 | Ga0439447_004964 | 3300041407 | Bacteria | 4491 |
| 323 | Ga0439447_006926 | 3300041407 | Bacteria | 3634 |
| 324 | Ga0439447_010943 | 3300041407 | Bacteria | 2671 |
| 325 | Ga0439447_015002 | 3300041407 | Bacteria | 2159 |
| 326 | Ga0439447_015739 | 3300041407 | Bacteria | 2092 |
| 327 | Ga0439466_0000892 | 3300041411 | Bacteria | 11370 |
| 328 | Ga0439466_0003444 | 3300041411 | Bacteria | 6137 |
| 329 | Ga0439466_0005529 | 3300041411 | Bacteria | 4821 |
| 330 | Ga0439466_0006397 | 3300041411 | Bacteria | 4479 |
| 331 | Ga0439466_0009496 | 3300041411 | Bacteria | 3633 |
| 332 | Ga0439466_0010716 | 3300041411 | Bacteria | 3404 |
| 333 | Ga0439466_0017178 | 3300041411 | Bacteria | 2609 |
| 334 | Ga0451789_0974815 | 3300041443 | Bacteria | 1635 |
| 335 | Ga0439431_0001116 | 3300041997 | Bacteria | 5834 |
| 336 | Ga0439431_0007794 | 3300041997 | Bacteria | 2394 |
| 337 | Ga0439437_000227 | 3300042000 | Bacteria | 5054 |
| 338 | Ga0439432_007057 | 3300042006 | Bacteria | 3995 |
| 339 | Ga0439432_011529 | 3300042006 | Bacteria | 3046 |
| 340 | Ga0439432_017521 | 3300042006 | Bacteria | 2403 |
| 341 | Ga0439432_020578 | 3300042006 | Bacteria | 2192 |
| 342 | Ga0439451_002551 | 3300042009 | Bacteria | 3704 |
| 343 | Ga0439451_013598 | 3300042009 | Bacteria | 1644 |
| 344 | Ga0439452_000418 | 3300042010 | Bacteria | 24826 |
| 345 | Ga0439452_003004 | 3300042010 | Bacteria | 5995 |
| 346 | Ga0439452_004529 | 3300042010 | Bacteria | 4646 |
| 347 | Ga0439452_013156 | 3300042010 | Bacteria | 2330 |
| 348 | Ga0439452_019675 | 3300042010 | Bacteria | 1781 |
| 349 | Ga0439456_000131 | 3300042013 | Bacteria | 23552 |
| 350 | Ga0439456_003575 | 3300042013 | Bacteria | 3154 |
| 351 | Ga0439456_005080 | 3300042013 | Bacteria | 2672 |
| 352 | Ga0439456_024479 | 3300042013 | Bacteria | 1280 |
| 353 | Ga0439463_005854 | 3300042016 | Bacteria | 3051 |
| 354 | Ga0439463_006630 | 3300042016 | Bacteria | 2867 |
| 355 | Ga0439463_015614 | 3300042016 | Bacteria | 1878 |
| 356 | Ga0450911_000012 | 3300042115 | Bacteria | 129546 |
| 357 | Ga0450911_003690 | 3300042115 | Bacteria | 2645 |
| 358 | Ga0450911_004361 | 3300042115 | Bacteria | 2326 |
| 359 | Ga0450923_004056 | 3300042125 | Bacteria | 2271 |
| 360 | Ga0450890_003834 | 3300042127 | Bacteria | 1982 |
| 361 | Ga0450898_003444 | 3300042134 | Bacteria | 2275 |
| 362 | Ga0450900_001014 | 3300042136 | Bacteria | 2563 |
| 363 | Ga0450902_003971 | 3300042137 | Bacteria | 2187 |
| 364 | Ga0450904_000453 | 3300042139 | Bacteria | 8173 |
| 365 | Ga0450905_000731 | 3300042142 | Bacteria | 4020 |
| 366 | Ga0450906_007780 | 3300042145 | Bacteria | 2102 |
| 367 | Ga0450906_020115 | 3300042145 | Bacteria | 1195 |
| 368 | Ga0450907_000827 | 3300042146 | Bacteria | 7613 |
| 369 | Ga0450907_003188 | 3300042146 | Bacteria | 2965 |
| 370 | Ga0450910_001431 | 3300042147 | Bacteria | 3004 |
| 371 | Ga0439446_0000270 | 3300042156 | Bacteria | 9731 |
| 372 | Ga0439446_0004766 | 3300042156 | Bacteria | 3453 |
| 373 | Ga0439446_0011069 | 3300042156 | Bacteria | 2442 |
| 374 | Ga0450908_012048 | 3300042184 | Bacteria | 1574 |
| 375 | Ga0450909_000842 | 3300042185 | Bacteria | 4160 |
| 376 | Ga0439434_0002762 | 3300042435 | Bacteria | 5115 |
| 377 | Ga0439459_0004312 | 3300042438 | Bacteria | 2286 |
| 378 | Ga0439464_0012870 | 3300042439 | Bacteria | 2233 |
| 379 | Ga0439464_0036442 | 3300042439 | Bacteria | 1391 |
| 380 | Ga0450916_002789 | 3300042530 | Bacteria | 1881 |
| 381 | Ga0450918_005874 | 3300042531 | Bacteria | 2197 |
| 382 | Ga0450893_0000237 | 3300042532 | Bacteria | 7411 |
| 383 | Ga0450901_001790 | 3300042533 | Bacteria | 2411 |
| 384 | Ga0451577_0360142 | 3300042876 | Bacteria | 1319 |
| 385 | Ga0439440_0003584 | 3300042993 | Bacteria | 3005 |
| 386 | Ga0466969_0002332 | 3300044656 | Bacteria | 10138 |
| 387 | Ga0453684_0002021 | 3300044712 | Bacteria | 51836 |
| 388 | Ga0453684_0144229 | 3300044712 | Bacteria | 2839 |
| 389 | Ga0466959_0001286 | 3300045049 | Bacteria | 15187 |
| 390 | Ga0466959_0013335 | 3300045049 | Bacteria | 5957 |
| 391 | Ga0495617_006136 | 3300046452 | Bacteria | 4231 |
| 392 | Ga0495617_026908 | 3300046452 | Bacteria | 1936 |
| 393 | Ga0495627_000037 | 3300046453 | Bacteria | 198542 |
| 394 | Ga0495627_003242 | 3300046453 | Bacteria | 7304 |
| 395 | Ga0495627_011888 | 3300046453 | Bacteria | 3106 |
| 396 | Ga0495627_014626 | 3300046453 | Bacteria | 2732 |
| 397 | Ga0495627_020892 | 3300046453 | Bacteria | 2175 |
| 398 | Ga0495591_000036 | 3300046458 | Bacteria | 167479 |
| 399 | Ga0495591_000571 | 3300046458 | Bacteria | 28201 |
| 400 | Ga0495591_002368 | 3300046458 | Bacteria | 10588 |
| 401 | Ga0495591_003076 | 3300046458 | Bacteria | 8840 |
| 402 | Ga0495591_005316 | 3300046458 | Bacteria | 5994 |
| 403 | Ga0495591_005675 | 3300046458 | Bacteria | 5714 |
| 404 | Ga0495591_007513 | 3300046458 | Bacteria | 4622 |
| 405 | Ga0495591_009824 | 3300046458 | Bacteria | 3767 |
| 406 | Ga0495591_011543 | 3300046458 | Bacteria | 3339 |
| 407 | Ga0495591_011647 | 3300046458 | Bacteria | 3314 |
| 408 | Ga0495591_014947 | 3300046458 | Bacteria | 2762 |
| 409 | Ga0495591_048402 | 3300046458 | Bacteria | 1172 |
| 410 | Ga0495638_0041214 | 3300046460 | Bacteria | 2922 |
| 411 | Ga0495653_0060776 | 3300046463 | Bacteria | 2861 |
| 412 | Ga0495653_0069895 | 3300046463 | Bacteria | 2628 |
| 413 | Ga0495653_0093187 | 3300046463 | Bacteria | 2198 |
| 414 | Ga0495653_0098835 | 3300046463 | Bacteria | 2118 |
| 415 | Ga0495650_0019791 | 3300046471 | Bacteria | 3299 |
| 416 | Ga0495650_0031597 | 3300046471 | Bacteria | 2379 |
| 417 | Ga0495650_0075575 | 3300046471 | Bacteria | 1311 |
| 418 | Ga0495605_0000033 | 3300046474 | Bacteria | 209203 |
| 419 | Ga0495605_0000442 | 3300046474 | Bacteria | 37385 |
| 420 | Ga0495605_0000453 | 3300046474 | Bacteria | 36766 |
| 421 | Ga0495605_0006045 | 3300046474 | Bacteria | 6993 |
| 422 | Ga0495605_0034365 | 3300046474 | Bacteria | 2567 |
| 423 | Ga0495605_0037682 | 3300046474 | Bacteria | 2430 |
| 424 | Ga0495605_0040672 | 3300046474 | Bacteria | 2320 |
| 425 | Ga0495639_0004168 | 3300046475 | Bacteria | 6198 |
| 426 | Ga0495584_0006054 | 3300046491 | Bacteria | 6369 |
| 427 | Ga0495584_0006365 | 3300046491 | Bacteria | 6185 |
| 428 | Ga0495584_0017395 | 3300046491 | Bacteria | 3660 |
| 429 | Ga0495584_0022204 | 3300046491 | Bacteria | 3221 |
| 430 | Ga0495584_0058306 | 3300046491 | Bacteria | 1942 |
| 431 | Ga0495584_0062519 | 3300046491 | Bacteria | 1871 |
| 432 | Ga0495584_0062525 | 3300046491 | Bacteria | 1871 |
| 433 | Ga0495584_0076807 | 3300046491 | Bacteria | 1679 |
| 434 | Ga0495584_0088122 | 3300046491 | Bacteria | 1564 |
| 435 | Ga0495585_0010926 | 3300046492 | Bacteria | 5395 |
| 436 | Ga0495585_0012667 | 3300046492 | Bacteria | 4963 |
| 437 | Ga0495585_0015984 | 3300046492 | Bacteria | 4352 |
| 438 | Ga0495585_0031496 | 3300046492 | Bacteria | 3010 |
| 439 | Ga0495594_0009324 | 3300046499 | Bacteria | 5070 |
| 440 | Ga0495596_0001043 | 3300046500 | Bacteria | 16455 |
| 441 | Ga0495596_0014076 | 3300046500 | Bacteria | 3374 |
| 442 | Ga0495607_0000385 | 3300046501 | Bacteria | 45205 |
| 443 | Ga0495607_0000614 | 3300046501 | Bacteria | 34704 |
| 444 | Ga0495607_0000674 | 3300046501 | Bacteria | 32994 |
| 445 | Ga0495607_0001352 | 3300046501 | Bacteria | 21875 |
| 446 | Ga0495607_0004283 | 3300046501 | Bacteria | 10542 |
| 447 | Ga0495607_0017751 | 3300046501 | Bacteria | 4555 |
| 448 | Ga0495607_0053435 | 3300046501 | Bacteria | 2334 |
| 449 | Ga0495607_0067797 | 3300046501 | Bacteria | 2003 |
| 450 | Ga0495607_0082345 | 3300046501 | Bacteria | 1766 |
| 451 | Ga0495607_0135260 | 3300046501 | Bacteria | 1277 |
| 452 | Ga0495583_0000031 | 3300046506 | Bacteria | 253982 |
| 453 | Ga0495583_0003664 | 3300046506 | Bacteria | 11444 |
| 454 | Ga0495583_0005049 | 3300046506 | Bacteria | 9117 |
| 455 | Ga0495583_0013177 | 3300046506 | Bacteria | 4628 |
| 456 | Ga0495583_0032092 | 3300046506 | Bacteria | 2538 |
| 457 | Ga0495583_0041293 | 3300046506 | Bacteria | 2162 |
| 458 | Ga0495583_0054817 | 3300046506 | Bacteria | 1804 |
| 459 | Ga0495606_0000722 | 3300046507 | Bacteria | 51115 |
| 460 | Ga0495606_0001283 | 3300046507 | Bacteria | 34807 |
| 461 | Ga0495606_0001919 | 3300046507 | Bacteria | 25814 |
| 462 | Ga0495606_0011936 | 3300046507 | Bacteria | 7024 |
| 463 | Ga0495606_0036936 | 3300046507 | Bacteria | 3322 |
| 464 | Ga0495606_0048624 | 3300046507 | Bacteria | 2787 |
| 465 | Ga0495606_0051326 | 3300046507 | Bacteria | 2691 |
| 466 | Ga0495606_0112998 | 3300046507 | Bacteria | 1635 |
| 467 | Ga0495606_0187822 | 3300046507 | Bacteria | 1187 |
| 468 | Ga0495610_0009189 | 3300046512 | Bacteria | 6274 |
| 469 | Ga0495610_0011481 | 3300046512 | Bacteria | 5415 |
| 470 | Ga0495610_0058517 | 3300046512 | Bacteria | 1843 |
| 471 | Ga0495616_0015598 | 3300046513 | Bacteria | 4221 |
| 472 | Ga0495616_0019488 | 3300046513 | Bacteria | 3701 |
| 473 | Ga0495616_0029577 | 3300046513 | Bacteria | 2890 |
| 474 | Ga0495616_0051249 | 3300046513 | Bacteria | 2059 |
| 475 | Ga0495616_0052584 | 3300046513 | Bacteria | 2028 |
| 476 | Ga0495620_0000007 | 3300046515 | Bacteria | 191058 |
| 477 | Ga0495620_0000038 | 3300046515 | Bacteria | 114064 |
| 478 | Ga0495620_0005117 | 3300046515 | Bacteria | 7343 |
| 479 | Ga0495620_0006559 | 3300046515 | Bacteria | 6382 |
| 480 | Ga0495620_0006731 | 3300046515 | Bacteria | 6290 |
| 481 | Ga0495620_0022344 | 3300046515 | Bacteria | 3047 |
| 482 | Ga0495620_0046724 | 3300046515 | Bacteria | 1868 |
| 483 | Ga0495631_0005175 | 3300046518 | Bacteria | 6870 |
| 484 | Ga0495631_0006650 | 3300046518 | Bacteria | 5944 |
| 485 | Ga0495631_0019960 | 3300046518 | Bacteria | 3136 |
| 486 | Ga0495631_0022969 | 3300046518 | Bacteria | 2896 |
| 487 | Ga0495631_0032643 | 3300046518 | Bacteria | 2346 |
| 488 | Ga0495631_0052481 | 3300046518 | Bacteria | 1781 |
| 489 | Ga0495632_0006732 | 3300046519 | Bacteria | 7346 |
| 490 | Ga0495632_0009692 | 3300046519 | Bacteria | 5781 |
| 491 | Ga0495632_0012800 | 3300046519 | Bacteria | 4815 |
| 492 | Ga0495632_0023244 | 3300046519 | Bacteria | 3313 |
| 493 | Ga0495632_0027149 | 3300046519 | Bacteria | 3001 |
| 494 | Ga0495632_0033446 | 3300046519 | Bacteria | 2639 |
| 495 | Ga0495632_0039664 | 3300046519 | Bacteria | 2375 |
| 496 | Ga0495632_0043150 | 3300046519 | Bacteria | 2256 |
| 497 | Ga0495632_0053872 | 3300046519 | Bacteria | 1973 |
| 498 | Ga0495632_0062583 | 3300046519 | Bacteria | 1804 |
| 499 | Ga0495632_0130720 | 3300046519 | Bacteria | 1168 |
| 500 | Ga0495637_0000064 | 3300046520 | Bacteria | 92793 |
| 501 | Ga0495637_0000610 | 3300046520 | Bacteria | 25464 |
| 502 | Ga0495637_0006010 | 3300046520 | Bacteria | 6133 |
| 503 | Ga0495637_0007118 | 3300046520 | Bacteria | 5569 |
| 504 | Ga0495637_0023874 | 3300046520 | Bacteria | 2770 |
| 505 | Ga0495637_0024152 | 3300046520 | Bacteria | 2751 |
| 506 | Ga0495637_0024415 | 3300046520 | Bacteria | 2735 |
| 507 | Ga0495637_0031839 | 3300046520 | Bacteria | 2329 |
| 508 | Ga0495637_0032684 | 3300046520 | Bacteria | 2290 |
| 509 | Ga0495637_0037617 | 3300046520 | Bacteria | 2099 |
| 510 | Ga0495637_0063521 | 3300046520 | Bacteria | 1508 |
| 511 | Ga0495637_0066098 | 3300046520 | Bacteria | 1470 |
| 512 | Ga0495643_0000159 | 3300046522 | Bacteria | 108642 |
| 513 | Ga0495643_0002175 | 3300046522 | Bacteria | 16050 |
| 514 | Ga0495643_0014724 | 3300046522 | Bacteria | 4646 |
| 515 | Ga0495643_0032701 | 3300046522 | Bacteria | 2884 |
| 516 | Ga0495643_0051633 | 3300046522 | Bacteria | 2210 |
| 517 | Ga0495643_0074767 | 3300046522 | Bacteria | 1773 |
| 518 | Ga0495644_0006044 | 3300046523 | Bacteria | 4715 |
| 519 | Ga0495644_0018656 | 3300046523 | Bacteria | 2648 |
| 520 | Ga0495644_0045882 | 3300046523 | Bacteria | 1643 |
| 521 | Ga0495648_0028708 | 3300046524 | Bacteria | 3701 |
| 522 | Ga0495648_0028764 | 3300046524 | Bacteria | 3697 |
| 523 | Ga0495648_0031832 | 3300046524 | Bacteria | 3469 |
| 524 | Ga0495648_0041970 | 3300046524 | Bacteria | 2883 |
| 525 | Ga0495648_0056618 | 3300046524 | Bacteria | 2357 |
| 526 | Ga0495648_0064373 | 3300046524 | Bacteria | 2160 |
| 527 | Ga0495648_0073707 | 3300046524 | Bacteria | 1969 |
| 528 | Ga0495648_0085923 | 3300046524 | Bacteria | 1775 |
| 529 | Ga0495648_0108286 | 3300046524 | Bacteria | 1517 |
| 530 | Ga0495648_0134843 | 3300046524 | Bacteria | 1307 |
| 531 | Ga0495666_0061529 | 3300046526 | Bacteria | 1793 |
| 532 | Ga0495642_0003319 | 3300046528 | Bacteria | 6357 |
| 533 | Ga0495654_0002905 | 3300046530 | Bacteria | 10740 |
| 534 | Ga0495654_0004835 | 3300046530 | Bacteria | 7927 |
| 535 | Ga0495654_0018079 | 3300046530 | Bacteria | 3697 |
| 536 | Ga0495654_0030115 | 3300046530 | Bacteria | 2763 |
| 537 | Ga0495654_0032189 | 3300046530 | Bacteria | 2658 |
| 538 | Ga0495654_0063050 | 3300046530 | Bacteria | 1775 |
| 539 | Ga0495654_0072908 | 3300046530 | Bacteria | 1624 |
| 540 | Ga0495609_0000018 | 3300046538 | Bacteria | 302609 |
| 541 | Ga0495609_0000056 | 3300046538 | Bacteria | 146060 |
| 542 | Ga0495609_0002274 | 3300046538 | Bacteria | 11976 |
| 543 | Ga0495609_0101947 | 3300046538 | Bacteria | 1243 |
| 544 | Ga0495597_0000026 | 3300046542 | Bacteria | 139551 |
| 545 | Ga0495597_0013450 | 3300046542 | Bacteria | 3920 |
| 546 | Ga0495597_0050026 | 3300046542 | Bacteria | 1846 |
| 547 | Ga0495597_0057126 | 3300046542 | Bacteria | 1708 |
| 548 | Ga0495622_0008113 | 3300046557 | Bacteria | 4866 |
| 549 | Ga0495622_0060299 | 3300046557 | Bacteria | 1756 |
| 550 | Ga0495622_0089808 | 3300046557 | Bacteria | 1412 |
| 551 | Ga0495633_0000062 | 3300046558 | Bacteria | 142101 |
| 552 | Ga0495633_0021810 | 3300046558 | Bacteria | 3197 |
| 553 | Ga0495668_0025234 | 3300046616 | Bacteria | 3378 |
| 554 | Ga0495634_0061358 | 3300046642 | Bacteria | 2499 |
| 555 | Ga0495611_0001689 | 3300046648 | Bacteria | 10708 |
| 556 | Ga0495611_0006048 | 3300046648 | Bacteria | 5162 |
| 557 | Ga0495611_0019824 | 3300046648 | Bacteria | 2890 |
| 558 | Ga0495611_0020800 | 3300046648 | Bacteria | 2828 |
| 559 | Ga0495625_0000194 | 3300046660 | Bacteria | 96964 |
| 560 | Ga0495625_0016515 | 3300046660 | Bacteria | 5806 |
| 561 | Ga0495625_0066288 | 3300046660 | Bacteria | 2543 |
| 562 | Ga0495625_0109977 | 3300046660 | Bacteria | 1884 |
| 563 | Ga0495661_0000016 | 3300046665 | Bacteria | 213593 |
| 564 | Ga0495661_0000093 | 3300046665 | Bacteria | 109808 |
| 565 | Ga0495661_0000662 | 3300046665 | Bacteria | 34527 |
| 566 | Ga0495661_0001069 | 3300046665 | Bacteria | 24134 |
| 567 | Ga0495661_0008953 | 3300046665 | Bacteria | 6887 |
| 568 | Ga0495661_0068742 | 3300046665 | Bacteria | 2077 |
| 569 | Ga0495623_0038158 | 3300046679 | Bacteria | 3072 |
| 570 | Ga0495646_0032496 | 3300046680 | Bacteria | 3247 |
| 571 | Ga0495624_0018070 | 3300046690 | Bacteria | 4720 |
| 572 | Ga0495670_0005692 | 3300046691 | Bacteria | 6111 |
| 573 | Ga0495670_0006112 | 3300046691 | Bacteria | 5908 |
| 574 | Ga0495670_0040183 | 3300046691 | Bacteria | 2333 |
| 575 | Ga0495671_0003081 | 3300046692 | Bacteria | 10357 |
| 576 | Ga0495671_0010355 | 3300046692 | Bacteria | 5170 |
| 577 | Ga0495671_0011925 | 3300046692 | Bacteria | 4761 |
| 578 | Ga0495671_0021917 | 3300046692 | Bacteria | 3350 |
| 579 | Ga0495671_0022635 | 3300046692 | Bacteria | 3290 |
| 580 | Ga0495671_0043571 | 3300046692 | Bacteria | 2252 |
| 581 | Ga0495671_0044986 | 3300046692 | Bacteria | 2211 |
| 582 | Ga0495671_0050759 | 3300046692 | Bacteria | 2064 |
| 583 | Ga0495671_0050843 | 3300046692 | Bacteria | 2062 |
| 584 | Ga0495671_0078991 | 3300046692 | Bacteria | 1613 |
| 585 | Ga0495671_0107603 | 3300046692 | Bacteria | 1361 |
| 586 | Ga0495671_0162099 | 3300046692 | Bacteria | 1087 |
| 587 | Ga0495649_0002195 | 3300046694 | Bacteria | 13944 |
| 588 | Ga0495649_0005784 | 3300046694 | Bacteria | 7789 |
| 589 | Ga0495649_0008308 | 3300046694 | Bacteria | 6249 |
| 590 | Ga0495649_0030107 | 3300046694 | Bacteria | 2998 |
| 591 | Ga0495649_0070199 | 3300046694 | Bacteria | 1878 |
| 592 | Ga0495649_0156515 | 3300046694 | Bacteria | 1195 |
| 593 | Ga0495589_0005691 | 3300046794 | Bacteria | 6569 |
| 594 | Ga0495589_0006010 | 3300046794 | Bacteria | 6410 |
| 595 | Ga0495589_0021071 | 3300046794 | Bacteria | 3332 |
| 596 | Ga0495589_0041601 | 3300046794 | Bacteria | 2292 |
| 597 | Ga0495589_0065881 | 3300046794 | Bacteria | 1775 |
| 598 | Ga0495589_0125669 | 3300046794 | Bacteria | 1233 |
| 599 | Ga0495660_0001019 | 3300046810 | Bacteria | 20347 |
| 600 | Ga0495660_0006561 | 3300046810 | Bacteria | 6873 |
| 601 | Ga0495660_0007816 | 3300046810 | Bacteria | 6280 |
| 602 | Ga0495660_0042921 | 3300046810 | Bacteria | 2496 |
| 603 | Ga0495660_0145369 | 3300046810 | Bacteria | 1175 |
| 604 | Ga0495604_0072323 | 3300047317 | Bacteria | 2606 |
| 605 | Ga0495604_0072324 | 3300047317 | Bacteria | 2606 |
| 606 | Ga0495636_0073632 | 3300047318 | Bacteria | 1461 |
| 607 | Ga0495672_0020098 | 3300047320 | Bacteria | 4384 |
| 608 | Ga0495672_0029740 | 3300047320 | Bacteria | 3435 |
| 609 | Ga0495672_0030758 | 3300047320 | Bacteria | 3360 |
| 610 | Ga0495672_0031137 | 3300047320 | Bacteria | 3334 |
| 611 | Ga0495672_0034800 | 3300047320 | Bacteria | 3108 |
| 612 | Ga0495672_0040424 | 3300047320 | Bacteria | 2828 |
| 613 | Ga0495672_0058275 | 3300047320 | Bacteria | 2239 |
| 614 | Ga0495672_0091221 | 3300047320 | Bacteria | 1672 |
| 615 | Ga0495676_0000052 | 3300047321 | Bacteria | 97049 |
| 616 | Ga0495676_0000957 | 3300047321 | Bacteria | 24239 |
| 617 | Ga0495680_0014017 | 3300047322 | Bacteria | 6966 |
| 618 | Ga0495680_0063462 | 3300047322 | Bacteria | 2837 |
| 619 | Ga0495683_0000043 | 3300047323 | Bacteria | 136876 |
| 620 | Ga0495683_0000092 | 3300047323 | Bacteria | 91056 |
| 621 | Ga0495683_0007850 | 3300047323 | Bacteria | 5724 |
| 622 | Ga0495683_0021391 | 3300047323 | Bacteria | 3333 |
| 623 | Ga0495683_0021571 | 3300047323 | Bacteria | 3319 |
| 624 | Ga0495683_0089315 | 3300047323 | Bacteria | 1495 |
| 625 | Ga0495683_0107579 | 3300047323 | Bacteria | 1334 |
| 626 | Ga0495687_047763 | 3300047443 | Bacteria | 1840 |
| 627 | Ga0495675_0016370 | 3300047444 | Bacteria | 4690 |
| 628 | Ga0495679_000504 | 3300047446 | Bacteria | 27741 |
| 629 | Ga0495679_002108 | 3300047446 | Bacteria | 10486 |
| 630 | Ga0495679_022097 | 3300047446 | Bacteria | 2183 |
| 631 | Ga0495679_023322 | 3300047446 | Bacteria | 2100 |
| 632 | Ga0495673_0000667 | 3300047469 | Bacteria | 33805 |
| 633 | Ga0495673_0003353 | 3300047469 | Bacteria | 10594 |
| 634 | Ga0495673_0013566 | 3300047469 | Bacteria | 4275 |
| 635 | Ga0495673_0026694 | 3300047469 | Bacteria | 2757 |
| 636 | Ga0495673_0027169 | 3300047469 | Bacteria | 2727 |
| 637 | Ga0495673_0027763 | 3300047469 | Bacteria | 2688 |
| 638 | Ga0495681_0008574 | 3300047470 | Bacteria | 6394 |
| 639 | Ga0495681_0010639 | 3300047470 | Bacteria | 5557 |
| 640 | Ga0495681_0016573 | 3300047470 | Bacteria | 4122 |
| 641 | Ga0495681_0025986 | 3300047470 | Bacteria | 3057 |
| 642 | Ga0495681_0035834 | 3300047470 | Bacteria | 2460 |
| 643 | Ga0495681_0043624 | 3300047470 | Bacteria | 2160 |
| 644 | Ga0495681_0051267 | 3300047470 | Bacteria | 1941 |
| 645 | Ga0495681_0055628 | 3300047470 | Bacteria | 1844 |
| 646 | Ga0495686_0074342 | 3300047472 | Bacteria | 2085 |
| 647 | Ga0495686_0128609 | 3300047472 | Bacteria | 1503 |
| 648 | Ga0495626_0000126 | 3300048091 | Bacteria | 99054 |
| 649 | Ga0495626_0001308 | 3300048091 | Bacteria | 20262 |
| 650 | Ga0495626_0022816 | 3300048091 | Bacteria | 3088 |
| 651 | Ga0495626_0051716 | 3300048091 | Bacteria | 1894 |
| 652 | Ga0495626_0058676 | 3300048091 | Bacteria | 1757 |
| 653 | Ga0496102_0109735 | 3300048905 | Bacteria | 2571 |
| 654 | Ga0496103_0119864 | 3300048906 | Bacteria | 1675 |
| 655 | Ga0496110_0069686 | 3300048913 | Bacteria | 3115 |
| 656 | Ga0496111_0144924 | 3300048914 | Bacteria | 1760 |
| 657 | Ga0496114_0143281 | 3300048917 | Bacteria | 2070 |
| 658 | Ga0496116_0000398 | 3300048919 | Bacteria | 63093 |
| 659 | Ga0496116_0014823 | 3300048919 | Bacteria | 6197 |
| 660 | Ga0496116_0050996 | 3300048919 | Bacteria | 2752 |
| 661 | Ga0496116_0114506 | 3300048919 | Bacteria | 1575 |
| 662 | Ga0496117_0003966 | 3300048920 | Bacteria | 16725 |
| 663 | Ga0496117_0014254 | 3300048920 | Bacteria | 6860 |
| 664 | Ga0496117_0014409 | 3300048920 | Bacteria | 6812 |
| 665 | Ga0496117_0054268 | 3300048920 | Bacteria | 2808 |
| 666 | Ga0496117_0067264 | 3300048920 | Bacteria | 2425 |
| 667 | Ga0496117_0077593 | 3300048920 | Bacteria | 2197 |
| 668 | Ga0496117_0177882 | 3300048920 | Bacteria | 1227 |
| 669 | Ga0496117_0178719 | 3300048920 | Bacteria | 1222 |
| 670 | Ga0496117_0181424 | 3300048920 | Bacteria | 1209 |
| 671 | Ga0496118_0004770 | 3300048921 | Bacteria | 15859 |
| 672 | Ga0496118_0030664 | 3300048921 | Bacteria | 4479 |
| 673 | Ga0496118_0051762 | 3300048921 | Bacteria | 3138 |
| 674 | Ga0496118_0087202 | 3300048921 | Bacteria | 2166 |
| 675 | Ga0496119_0000479 | 3300048922 | Bacteria | 54626 |
| 676 | Ga0496119_0070874 | 3300048922 | Bacteria | 2042 |
| 677 | Ga0496120_0002540 | 3300048923 | Bacteria | 18213 |
| 678 | Ga0496120_0060164 | 3300048923 | Bacteria | 2125 |
| 679 | Ga0496120_0065231 | 3300048923 | Bacteria | 2018 |
| 680 | Ga0496121_0000412 | 3300048924 | Bacteria | 84946 |
| 681 | Ga0496121_0002869 | 3300048924 | Bacteria | 25394 |
| 682 | Ga0496121_0011455 | 3300048924 | Bacteria | 9844 |
| 683 | Ga0496121_0090665 | 3300048924 | Bacteria | 2389 |
| 684 | Ga0496121_0109648 | 3300048924 | Bacteria | 2108 |
| 685 | Ga0496121_0126103 | 3300048924 | Bacteria | 1924 |
| 686 | Ga0496121_0202101 | 3300048924 | Bacteria | 1415 |
| 687 | Ga0496122_0000434 | 3300048925 | Bacteria | 87536 |
| 688 | Ga0496122_0013063 | 3300048925 | Bacteria | 8176 |
| 689 | Ga0496122_0072134 | 3300048925 | Bacteria | 2456 |
| 690 | Ga0496122_0150341 | 3300048925 | Bacteria | 1438 |
| 691 | Ga0496122_0179936 | 3300048925 | Bacteria | 1263 |
| 692 | Ga0496122_0193974 | 3300048925 | Bacteria | 1195 |
| 693 | Ga0496122_0209813 | 3300048925 | Bacteria | 1129 |
| 694 | Ga0496123_0000207 | 3300048926 | Bacteria | 120277 |
| 695 | Ga0496123_0000318 | 3300048926 | Bacteria | 91911 |
| 696 | Ga0496123_0003681 | 3300048926 | Bacteria | 16905 |
| 697 | Ga0496123_0006979 | 3300048926 | Bacteria | 10775 |
| 698 | Ga0496123_0068055 | 3300048926 | Bacteria | 2245 |
| 699 | Ga0496123_0136878 | 3300048926 | Bacteria | 1346 |
| 700 | Ga0496124_0000689 | 3300048927 | Bacteria | 55376 |
| 701 | Ga0496124_0007409 | 3300048927 | Bacteria | 11672 |
| 702 | Ga0496124_0014442 | 3300048927 | Bacteria | 7636 |
| 703 | Ga0496124_0017267 | 3300048927 | Bacteria | 6807 |
| 704 | Ga0496124_0018115 | 3300048927 | Bacteria | 6610 |
| 705 | Ga0496124_0057530 | 3300048927 | Bacteria | 3275 |
| 706 | Ga0496124_0062514 | 3300048927 | Bacteria | 3115 |
| 707 | Ga0496124_0067621 | 3300048927 | Bacteria | 2972 |
| 708 | Ga0496124_0240262 | 3300048927 | Bacteria | 1347 |
| 709 | Ga0496124_0269553 | 3300048927 | Bacteria | 1247 |
| 710 | Ga0496125_0001906 | 3300048928 | Bacteria | 28542 |
| 711 | Ga0496125_0004964 | 3300048928 | Bacteria | 15045 |
| 712 | Ga0496125_0017882 | 3300048928 | Bacteria | 6743 |
| 713 | Ga0496125_0020043 | 3300048928 | Bacteria | 6287 |
| 714 | Ga0496125_0043957 | 3300048928 | Bacteria | 3785 |
| 715 | Ga0496125_0076692 | 3300048928 | Bacteria | 2580 |
| 716 | Ga0496125_0140000 | 3300048928 | Bacteria | 1684 |
| 717 | Ga0496125_0224104 | 3300048928 | Bacteria | 1209 |
| 718 | Ga0496125_0242815 | 3300048928 | Bacteria | 1142 |
| 719 | Ga0496126_0072293 | 3300048929 | Bacteria | 3068 |
| 720 | Ga0496126_0215908 | 3300048929 | Bacteria | 1613 |
| 721 | Ga0496126_0217998 | 3300048929 | Bacteria | 1604 |
| 722 | Ga0496126_0417412 | 3300048929 | Bacteria | 1085 |
| 723 | Ga0495678_000021 | 3300049459 | Bacteria | 239150 |
| 724 | Ga0495678_002247 | 3300049459 | Bacteria | 13440 |
| 725 | Ga0495678_007216 | 3300049459 | Bacteria | 5789 |
| 726 | Ga0495678_017098 | 3300049459 | Bacteria | 3295 |
| 727 | Ga0495678_041030 | 3300049459 | Bacteria | 1855 |
| 728 | Ga0495682_0000697 | 3300049460 | Bacteria | 22057 |
| 729 | Ga0495682_0000959 | 3300049460 | Bacteria | 17383 |
| 730 | Ga0495682_0024842 | 3300049460 | Bacteria | 2231 |
| 731 | Ga0501032_0035566 | 3300049569 | Bacteria | 3404 |
| 732 | Ga0501034_0000085 | 3300049571 | Bacteria | 166893 |
| 733 | Ga0501034_0040103 | 3300049571 | Bacteria | 4741 |
| 734 | Ga0501034_0172263 | 3300049571 | Bacteria | 2131 |
| 735 | Ga0501037_0136144 | 3300049573 | Bacteria | 1759 |
| 736 | Ga0501039_0087342 | 3300049575 | Bacteria | 2429 |
| 737 | Ga0501226_000002 | 3300049853 | Bacteria | 426935 |
| 738 | nmdc:mga0sz30_100952_c1 | 3300050516 | Bacteria | 1260 |
| 739 | Ga0500558_114090 | 3300053106 | Bacteria | 1056 |
| 740 | Ga0500618_007870 | 3300053125 | Bacteria | 3009 |
| 741 | Ga0500659_0011592 | 3300053135 | Bacteria | 4812 |
| 742 | Ga0500573_0043944 | 3300053140 | Bacteria | 2577 |
| 743 | Ga0500634_0060015 | 3300053161 | Bacteria | 2020 |
| 744 | Ga0500636_0185532 | 3300053177 | Bacteria | 1113 |
| 745 | 2510283260 | 2510065053 | Bacteria | 5005518 |
| 746 | 2510292909 | 2510065055 | Bacteria | 5037935 |
| 747 | 2510313382 | 2510065058 | Bacteria | 5005894 |
| 748 | 2511252548 | 2511231004 | Bacteria | 6669789 |
| 749 | 2511266255 | 2511231006 | Bacteria | 6794709 |
| 750 | 2511271434 | 2511231007 | Bacteria | 6306603 |
| 751 | 2511278566 | 2511231008 | Bacteria | 6624100 |
| 752 | 2511292247 | 2511231010 | Bacteria | 6373152 |
| 753 | 2511293215 | 2511231011 | Bacteria | 6149768 |
| 754 | 2511302609 | 2511231012 | Bacteria | 6738011 |
| 755 | 2511315921 | 2511231014 | Bacteria | 6462302 |
| 756 | 2511320440 | 2511231015 | Bacteria | 6598026 |
| 757 | 2511325970 | 2511231016 | Bacteria | 6704427 |
| 758 | 2511335226 | 2511231017 | Bacteria | 6503007 |
| 759 | 2511341350 | 2511231018 | Bacteria | 6436256 |
| 760 | 2511347276 | 2511231019 | Bacteria | 6520662 |
| 761 | 2511351914 | 2511231020 | Bacteria | 6115223 |
| 762 | 2511359831 | 2511231021 | Bacteria | 7302637 |
| 763 | 2511362126 | 2511231022 | Bacteria | 6719296 |
| 764 | 2511372223 | 2511231023 | Bacteria | 6808468 |
| 765 | 2511373285 | 2511231024 | Bacteria | 5835885 |
| 766 | 2511411365 | 2511231031 | Bacteria | 6558529 |
| 767 | 2511827152 | 2511231156 | Bacteria | 6845832 |
| 768 | 2512328029 | 2512047018 | Bacteria | 6663241 |
| 769 | 2554813281 | 2554235132 | Bacteria | 6772433 |
| 770 | 2555247061 | 2554235231 | Bacteria | 5215788 |
| 771 | 2555672363 | 2554235341 | Bacteria | 6867980 |
| 772 | 2583794939 | 2582580891 | Bacteria | 6800976 |
| 773 | 2597860434 | 2597489887 | Bacteria | 6666321 |
| 774 | 2597866177 | 2597489888 | Bacteria | 6179543 |
| 775 | 2597872014 | 2597489889 | Bacteria | 6297495 |
| 776 | 2599329397 | 2599185155 | Bacteria | 5827168 |
| 777 | 2599358194 | 2599185160 | Bacteria | 6844013 |
| 778 | 2599364548 | 2599185161 | Bacteria | 6960462 |
| 779 | 2599370916 | 2599185162 | Bacteria | 6957254 |
| 780 | 2599376938 | 2599185163 | Bacteria | 6995158 |
| 781 | 2599383359 | 2599185164 | Bacteria | 6841688 |
| 782 | 2599389806 | 2599185165 | Bacteria | 6843250 |
| 783 | 2599396094 | 2599185166 | Bacteria | 6959206 |
| 784 | 2599401330 | 2599185167 | Bacteria | 6353609 |
| 785 | 2599407934 | 2599185168 | Bacteria | 6997636 |
| 786 | 2599453055 | 2599185179 | Bacteria | 6611171 |
| 787 | 2599465009 | 2599185181 | Bacteria | 6844519 |
| 788 | 2599471325 | 2599185182 | Bacteria | 6883168 |
| 789 | 2599486725 | 2599185185 | Bacteria | 6652270 |
| 790 | 2599494076 | 2599185186 | Bacteria | 6831633 |
| 791 | 2599504893 | 2599185188 | Bacteria | 6164180 |
| 792 | 2599509809 | 2599185189 | Bacteria | 5862825 |
| 793 | 2599515060 | 2599185190 | Bacteria | 6285678 |
| 794 | 2599520221 | 2599185191 | Bacteria | 6297582 |
| 795 | 2599616575 | 2599185212 | Bacteria | 6765997 |
| 796 | 2599772939 | 2599185248 | Bacteria | 6696816 |
| 797 | 2599807151 | 2599185257 | Bacteria | 6492581 |
| 798 | 2599881660 | 2599185288 | Bacteria | 6666191 |
| 799 | 2599888252 | 2599185289 | Bacteria | 6778765 |
| 800 | 2599894440 | 2599185290 | Bacteria | 6289611 |
| 801 | 2599900966 | 2599185291 | Bacteria | 6775623 |
| 802 | 2599930442 | 2599185300 | Bacteria | 6062622 |
| 803 | 2599945030 | 2599185302 | Bacteria | 5954930 |
| 804 | 2599949285 | 2599185303 | Bacteria | 6512725 |
| 805 | 2599955241 | 2599185304 | Bacteria | 5951361 |
| 806 | 2599962696 | 2599185305 | Bacteria | 6748700 |
| 807 | 2599967102 | 2599185306 | Bacteria | 6637356 |
| 808 | 2599974678 | 2599185307 | Bacteria | 6194719 |
| 809 | 2599981005 | 2599185308 | Bacteria | 6621546 |
| 810 | 2599983974 | 2599185309 | Bacteria | 5969593 |
| 811 | 2599990308 | 2599185310 | Bacteria | 6014457 |
| 812 | 2599997710 | 2599185311 | Bacteria | 6354990 |
| 813 | 2600001750 | 2599185312 | Bacteria | 5912071 |
| 814 | 2600009287 | 2599185313 | Bacteria | 6658188 |
| 815 | 2600013881 | 2599185314 | Bacteria | 6621749 |
| 816 | 2600021203 | 2599185315 | Bacteria | 6771107 |
| 817 | 2600026843 | 2599185316 | Bacteria | 6320029 |
| 818 | 2600032825 | 2599185317 | Bacteria | 6435722 |
| 819 | 2600039073 | 2599185318 | Bacteria | 6961590 |
| 820 | 2600044719 | 2599185319 | Bacteria | 6637840 |
| 821 | 2600048842 | 2599185320 | Bacteria | 5963263 |
| 822 | 2600056199 | 2599185321 | Bacteria | 6764560 |
| 823 | 2600062294 | 2599185322 | Bacteria | 6763055 |
| 824 | 2600068770 | 2599185323 | Bacteria | 6688755 |
| 825 | 2600074504 | 2599185324 | Bacteria | 6590677 |
| 826 | 2600079586 | 2599185325 | Bacteria | 6324919 |
| 827 | 2600217741 | 2599185356 | Bacteria | 6843884 |
| 828 | 2600360391 | 2600254930 | Bacteria | 6431253 |
| 829 | 2600367816 | 2600254931 | Bacteria | 6734225 |
| 830 | 2600445207 | 2600254954 | Bacteria | 5100516 |
| 831 | 2601628695 | 2600255283 | Bacteria | 6061572 |
| 832 | 2601693886 | 2600255296 | Bacteria | 5784754 |
| 833 | 2601777908 | 2600255313 | Bacteria | 6842543 |
| 834 | 2601800532 | 2600255318 | Bacteria | 6383414 |
| 835 | 2602012313 | 2600255389 | Bacteria | 5275336 |
| 836 | 2606078660 | 2603880185 | Bacteria | 6379190 |
| 837 | 2606125680 | 2603880199 | Bacteria | 6377649 |
| 838 | 2608381539 | 2606217733 | Bacteria | 6360972 |
| 839 | 2621297284 | 2619619299 | Bacteria | 6649820 |
| 840 | 2624482949 | 2623620443 | Bacteria | 6427864 |
| 841 | 2624494483 | 2623620446 | Bacteria | 6500345 |
| 842 | 2643844922 | 2643221565 | Bacteria | 6216018 |
| 843 | 2643870887 | 2643221571 | Bacteria | 6228673 |
| 844 | 2643957633 | 2643221589 | Bacteria | 6250934 |
| 845 | 2644025747 | 2643221602 | Bacteria | 6249926 |
| 846 | 2644189001 | 2643221633 | Bacteria | 6733554 |
| 847 | 2644286552 | 2643221650 | Bacteria | 7029547 |
| 848 | 2644625272 | 2643221713 | Bacteria | 6554480 |
| 849 | 2652546014 | 2651869719 | Bacteria | 6047974 |
| 850 | 2671093860 | 2667528170 | Bacteria | 6786960 |
| 851 | 2671100722 | 2667528171 | Bacteria | 6900659 |
| 852 | 2671129938 | 2667528176 | Bacteria | 6724917 |
| 853 | 2671773289 | 2671180172 | Bacteria | 6495783 |
| 854 | 2677898444 | 2675903420 | Bacteria | 6247433 |
| 855 | 2678265665 | 2675903515 | Bacteria | 6580491 |
| 856 | 2715752371 | 2713897148 | Bacteria | 5883533 |
| 857 | 2715759122 | 2713897149 | Bacteria | 6506249 |
| 858 | 2718636156 | 2718217725 | Bacteria | 5758958 |
| 859 | 2723250914 | 2721755607 | Bacteria | 5841722 |
| 860 | 2729146080 | 2728369097 | Bacteria | 4333476 |
| 861 | 2738672972 | 2738541265 | Bacteria | 6594665 |
| 862 | 2738691051 | 2738541271 | Bacteria | 5657310 |
| 863 | 2738751365 | 2738541282 | Bacteria | 6593925 |
| 864 | 2738810212 | 2738541294 | Bacteria | 6925949 |
| 865 | 2738860406 | 2738541303 | Bacteria | 6591772 |
| 866 | 2738897572 | 2738541309 | Bacteria | 6926455 |
| 867 | 2739198117 | 2738543004 | Bacteria | 6381073 |
| 868 | 2739260883 | 2738543015 | Bacteria | 6750701 |
| 869 | 2739266812 | 2738543016 | Bacteria | 5657564 |
| 870 | 2739289545 | 2738543020 | Bacteria | 5718238 |
| 871 | 2739294857 | 2738543021 | Bacteria | 5718241 |
| 872 | 2739314902 | 2738543025 | Bacteria | 6600348 |
| 873 | 2743739981 | 2740892503 | Bacteria | 6855563 |
| 874 | 2745006900 | 2744054620 | Bacteria | 6551379 |
| 875 | 2765586170 | 2765235841 | Bacteria | 6137024 |
| 876 | 2774121855 | 2773857670 | Bacteria | 6407454 |
| 877 | 2774132567 | 2773857672 | Bacteria | 4993178 |
| 878 | 2774137094 | 2773857673 | Bacteria | 6513460 |
| 879 | 2784262282 | 2784132063 | Bacteria | 6262788 |
| 880 | 2784314518 | 2784132072 | Bacteria | 6596533 |
| 881 | 2794595249 | 2791355520 | Bacteria | 5948615 |
| 882 | 2807410398 | 2806310737 | Bacteria | 5751088 |
| 883 | 2807458743 | 2806310745 | Bacteria | 5742165 |
| 884 | 2808857296 | 2808606361 | Bacteria | 6136259 |
| 885 | 2808905308 | 2808606373 | Bacteria | 4423627 |
| 886 | 2808926397 | 2808606376 | Bacteria | 6248667 |
| 887 | 2808930917 | 2808606377 | Bacteria | 6646337 |
| 888 | 2808937400 | 2808606378 | Bacteria | 6177535 |
| 889 | 2808941257 | 2808606379 | Bacteria | 5022697 |
| 890 | 2808948558 | 2808606380 | Bacteria | 6248705 |
| 891 | 2808953039 | 2808606381 | Bacteria | 6646461 |
| 892 | 2808961262 | 2808606382 | Bacteria | 6841132 |
| 893 | 2808965730 | 2808606383 | Bacteria | 6138645 |
| 894 | 2808977542 | 2808606385 | Bacteria | 6711065 |
| 895 | 2808992800 | 2808606388 | Bacteria | 6706662 |
| 896 | 2809000671 | 2808606389 | Bacteria | 6138126 |
| 897 | 2809219235 | 2808606445 | Bacteria | 6057339 |
| 898 | 2812368854 | 2811994881 | Bacteria | 6298475 |
| 899 | 2817493591 | 2816332298 | Bacteria | 6852809 |
| 900 | 2819659246 | 2818991456 | Bacteria | 6123676 |
| 901 | 2819706389 | 2818991464 | Bacteria | 6907494 |
| 902 | 2823422161 | 2823421272 | Bacteria | 5372474 |
| 903 | 2825655587 | 2825651385 | Bacteria | 6715909 |
| 904 | 2826582865 | 2826581358 | Bacteria | 5963467 |
| 905 | 2834033199 | 2834028612 | Bacteria | 6354979 |
| 906 | 2842809941 | 2842805378 | Bacteria | 5385175 |
| 907 | 2842819915 | 2842815866 | Bacteria | 5947510 |
| 908 | 2842829099 | 2842826826 | Bacteria | 5974129 |
| 909 | 2842836931 | 2842832357 | Bacteria | 5959113 |
| 910 | 2842840468 | 2842837860 | Bacteria | 6066181 |
| 911 | 2842847668 | 2842843487 | Bacteria | 6004777 |
| 912 | 2842852841 | 2842849001 | Bacteria | 5924277 |
| 913 | 2842859617 | 2842854478 | Bacteria | 6143501 |
| 914 | 2844666531 | 2844665904 | Bacteria | 6817974 |
| 915 | 2852618104 | 2852612431 | Bacteria | 6885235 |
| 916 | 2852661067 | 2852657418 | Bacteria | 6472974 |
| 917 | 2852673162 | 2852667396 | Bacteria | 6885555 |
| 918 | 2860343937 | 2860339153 | Bacteria | 6846989 |
| 919 | 2860872587 | 2860867994 | Bacteria | 5645326 |
| 920 | 2878034882 | 2878029506 | Bacteria | 6418441 |
| 921 | 2880235520 | 2880230671 | Bacteria | 6140320 |
| 922 | 2904522609 | 2904518522 | Bacteria | 6068986 |
| 923 | 2904554100 | 2904550169 | Bacteria | 6221258 |
| 924 | 2908452109 | 2908446538 | Bacteria | 6829095 |
| 925 | 2912968428 | 2912963787 | Bacteria | 5646108 |
| 926 | 2913042076 | 2913036834 | Bacteria | 6704877 |
| 927 | 2917076244 | 2917070673 | Bacteria | 6868303 |
| 928 | 2917832892 | 2917832318 | Bacteria | 5346010 |
| 929 | 2919067738 | 2919063839 | Bacteria | 6302690 |
| 930 | 2919128592 | 2919125081 | Bacteria | 5385106 |
| 931 | 2919158268 | 2919155634 | Bacteria | 4860545 |
| 932 | 2919390601 | 2919385768 | Bacteria | 5897293 |
| 933 | 2919461700 | 2919456309 | Bacteria | 6586567 |
| 934 | 2919485909 | 2919481497 | Bacteria | 6907839 |
| 935 | 2919490915 | 2919487758 | Bacteria | 5929766 |
| 936 | 2919505989 | 2919501602 | Bacteria | 5286340 |
| 937 | 2919701417 | 2919697872 | Bacteria | 6553725 |
| 938 | 2923159072 | 2923153595 | Bacteria | 6870622 |
| 939 | 2923522923 | 2923519811 | Bacteria | 6298479 |
| 940 | 2923591027 | 2923586266 | Bacteria | 6565975 |
| 941 | 2926067484 | 2926063275 | Bacteria | 5285848 |
| 942 | 2929149450 | 2929144301 | Bacteria | 6622272 |
| 943 | 2929194696 | 2929189879 | Bacteria | 5930554 |
| 944 | 2931373138 | 2931369376 | Bacteria | 6847892 |
| 945 | 2931395973 | 2931390751 | Bacteria | 6273349 |
| 946 | 2931397606 | 2931396565 | Bacteria | 7251677 |
| 947 | 2935359668 | 2935353572 | Unclassified | 6955622 |
| 948 | 2939641870 | 2939636861 | Bacteria | 6297853 |
| 949 | 2939654653 | 2939651529 | Bacteria | 5895393 |
| 950 | 2945931359 | 2945928738 | Bacteria | 6053221 |
| 951 | 2945966324 | 2945961074 | Bacteria | 7342064 |
| 952 | 2946007410 | 2946006987 | Bacteria | 6705746 |
| 953 | 2946033189 | 2946027586 | Bacteria | 6049274 |
| 954 | 2947233959 | 2947233263 | Bacteria | 6439278 |
| 955 | 2969309694 | 2969304461 | Bacteria | 6601805 |
| 956 | 2974294574 | 2974289157 | Bacteria | 6080362 |
| 957 | 2974298910 | 2974298342 | Bacteria | 4840922 |
| 958 | 2984287098 | 2984286254 | Bacteria | 6702062 |
| 959 | 2984501216 | 2984499530 | Bacteria | 5020881 |
| 960 | 2984505327 | 2984504281 | Bacteria | 5262371 |
| 961 | 2988730991 | 2988728565 | Bacteria | 6124362 |
| 962 | 2990198158 | 2990196909 | Bacteria | 4054280 |
| 963 | 2998144939 | 2998139840 | Bacteria | 6073514 |
| 964 | 3007254128 | 3007252601 | Bacteria | 4559114 |
| 965 | 3007317134 | 3007315729 | Bacteria | 5076637 |
| 966 | 3007398697 | 3007395558 | Bacteria | 6755444 |
| 967 | 3007420303 | 3007419365 | Bacteria | 7026924 |
| 968 | 3007516729 | 3007511990 | Bacteria | 6481491 |
| 969 | 3007614644 | 3007614139 | Bacteria | 6053559 |
| 970 | 3007621157 | 3007619802 | Bacteria | 6411688 |
| 971 | 3007721359 | 3007718800 | Bacteria | 5971527 |
| 972 | 3007803619 | 3007803356 | Bacteria | 5931491 |
| 973 | 3007860142 | 3007855910 | Bacteria | 5637581 |
| 974 | 3007866396 | 3007861166 | Bacteria | 6045338 |
| 975 | 3007867230 | 3007866637 | Bacteria | 5899198 |
| 976 | 3007873601 | 3007872151 | Bacteria | 5268868 |
| 977 | 637322784 | 637000220 | Bacteria | 7074893 |
| 978 | 640489720 | 640427133 | Bacteria | 4567418 |
| 979 | 651177733 | 651053060 | Bacteria | 4689946 |
| 980 | 8011355908 | 8011350971 | Bacteria | 6158957 |
| 981 | 8015693149 | 8015687852 | Bacteria | 6613826 |
| 982 | 8016732778 | 8016728285 | Bacteria | 5263933 |
| 983 | 8019771288 | 8019769354 | Bacteria | 6924660 |
| 984 | 8019780417 | 8019775933 | Bacteria | 6858656 |
| 985 | 8029995959 | 8029995093 | Bacteria | 5990776 |
| 986 | 8034966973 | 8034962539 | Bacteria | 4884839 |
| 987 | 8052495231 | 8052494512 | Bacteria | 5765634 |
| 988 | 8054289461 | 8054285046 | Bacteria | 6919322 |
| 989 | 8054352975 | 8054347763 | Bacteria | 5901107 |
| 990 | 8054508477 | 8054503363 | Bacteria | 6101651 |
| 991 | 8054933614 | 8054929484 | Bacteria | 5599761 |
| 992 | 8055776398 | 8055770955 | Bacteria | 6827675 |
| 993 | 8055823433 | 8055817908 | Bacteria | 6609162 |
| 994 | 8055882295 | 8055878733 | Bacteria | 5907058 |
| 995 | 8056115695 | 8056115690 | Bacteria | 5527654 |
| 996 | 8056121355 | 8056120720 | Bacteria | 5758328 |
| 997 | 8056131156 | 8056125926 | Bacteria | 6228218 |
| 998 | 8056136876 | 8056131705 | Bacteria | 6107031 |
| 999 | 8056138070 | 8056137416 | Bacteria | 6147080 |
| 1000 | 8056148272 | 8056143049 | Bacteria | 6307666 |
| 1001 | 8056150188 | 8056148874 | Bacteria | 6479865 |
| 1002 | 8056156350 | 8056155041 | Bacteria | 6486948 |
| 1003 | 8056163147 | 8056161164 | Bacteria | 6106669 |
| 1004 | 8056171627 | 8056166840 | Bacteria | 5820959 |
| 1005 | 8056172304 | 8056172158 | Bacteria | 6133900 |
| 1006 | 8056179232 | 8056177738 | Bacteria | 6748268 |
| 1007 | 8056571987 | 8056569372 | Bacteria | 5997322 |
| 1008 | 8057805242 | 8057798959 | Bacteria | 6713499 |
| 1009 | Ga0495609_0066467 | |||
| 1010 | SwRhRL2b_contig_1994375 | |||
| 1011 | JGI25162J39368_1000122 | |||
| 1012 | JGI25162J39368_1000233 | |||
| 1013 | JGI25164J39214_1000099 | |||
| 1014 | JGI25164J39214_1000180 | |||
| 1015 | JGI25165J46597_1000205 | |||
| 1016 | JGI25165J46597_1000331 | |||
| 1017 | Ga0006562J51391_1020668 | |||
| 1018 | Ga0055538_1000042 | |||
| 1019 | Ga0055539_1000055 | |||
| 1020 | Ga0055533_1000067 | |||
| 1021 | Ga0055532_1000053 | |||
| 1022 | Ga0055525_1000103 | |||
| 1023 | Ga0055525_1002283 | |||
| 1024 | Ga0055536_1001766 | |||
| 1025 | Ga0055536_1003363 | |||
| 1026 | Ga0055536_1008077 | |||
| 1027 | Ga0055536_1021178 | |||
| 1028 | Ga0055530_10000884 | |||
| 1029 | Ga0055530_10001431 | |||
| 1030 | Ga0055530_10002933 | |||
| 1031 | Ga0055530_10008959 | |||
| 1032 | Ga0055540_1000333 | |||
| 1033 | Ga0055540_1000455 | |||
| 1034 | Ga0055540_1002283 | |||
| 1035 | Ga0055531_10001360 | |||
| 1036 | Ga0055541_1000042 | |||
| 1037 | Ga0058692_1002717 | |||
| 1038 | Ga0065714_10000379 | |||
| 1039 | Ga0065714_10003289 | |||
| 1040 | Ga0065714_10003418 | |||
| 1041 | Ga0065714_10025053 | |||
| 1042 | Ga0065714_10076102 | |||
| 1043 | Ga0065714_10082099 | |||
| 1044 | Ga0065714_10119037 | |||
| 1045 | Ga0065714_10147869 | |||
| 1046 | Ga0065704_10006960 | |||
| 1047 | Ga0065704_10009829 | |||
| 1048 | Ga0065704_10072683 | |||
| 1049 | Ga0065712_10000936 | |||
| 1050 | Ga0065712_10002123 | |||
| 1051 | Ga0065712_10068547 | |||
| 1052 | Ga0070670_100000002 | |||
| 1053 | Ga0070670_100004982 | |||
| 1054 | Ga0070680_100003483 | |||
| 1055 | Ga0070682_100108166 | |||
| 1056 | Ga0070661_100000729 | |||
| 1057 | Ga0070669_100000218 | |||
| 1058 | Ga0070669_100062268 | |||
| 1059 | Ga0070671_100000022 | |||
| 1060 | Ga0070713_100181425 | |||
| 1061 | Ga0070662_100002371 | |||
| 1062 | Ga0070681_10096046 | |||
| 1063 | Ga0070679_100002393 | |||
| 1064 | Ga0070679_100028256 | |||
| 1065 | Ga0068853_100000414 | |||
| 1066 | Ga0070665_100024188 | |||
| 1067 | Ga0070665_100118858 | |||
| 1068 | Ga0070665_100486116 | |||
| 1069 | Ga0068855_100010801 | |||
| 1070 | Ga0068855_100070916 | |||
| 1071 | Ga0070664_100012726 | |||
| 1072 | Ga0070664_100226216 | |||
| 1073 | Ga0068854_100001639 | |||
| 1074 | Ga0068856_100589436 | |||
| 1075 | Ga0068852_100451808 | |||
| 1076 | Ga0068851_10000002 | |||
| 1077 | Ga0075364_10055660 | |||
| 1078 | Ga0075364_10074023 | |||
| 1079 | Ga0075364_10121238 | |||
| 1080 | Ga0075432_10035384 | |||
| 1081 | Ga0075432_10063712 | |||
| 1082 | Ga0075432_10072561 | |||
| 1083 | Ga0075362_10105567 | |||
| 1084 | Ga0075369_10100356 | |||
| 1085 | Ga0099823_1019967 | |||
| 1086 | Ga0079104_1000116 | |||
| 1087 | Ga0079104_1002609 | |||
| 1088 | Ga0105251_10000011 | |||
| 1089 | Ga0105251_10002219 | |||
| 1090 | Ga0105251_10004234 | |||
| 1091 | Ga0105251_10008203 | |||
| 1092 | Ga0105251_10009460 | |||
| 1093 | Ga0105251_10021111 | |||
| 1094 | Ga0105251_10024384 | |||
| 1095 | Ga0105251_10031139 | |||
| 1096 | Ga0105251_10051625 | |||
| 1097 | Ga0105251_10080024 | |||
| 1098 | Ga0105244_10001066 | |||
| 1099 | Ga0105244_10006436 | |||
| 1100 | Ga0105244_10008892 | |||
| 1101 | Ga0105244_10011041 | |||
| 1102 | Ga0105244_10011294 | |||
| 1103 | Ga0105244_10011431 | |||
| 1104 | Ga0105244_10019152 | |||
| 1105 | Ga0105244_10028204 | |||
| 1106 | Ga0105244_10029959 | |||
| 1107 | Ga0105244_10038231 | |||
| 1108 | Ga0105244_10038927 | |||
| 1109 | Ga0105250_10000657 | |||
| 1110 | Ga0105250_10004400 | |||
| 1111 | Ga0105250_10055693 | |||
| 1112 | Ga0105240_10000960 | |||
| 1113 | Ga0105240_10012712 | |||
| 1114 | Ga0105240_10256444 | |||
| 1115 | Ga0105240_10686944 | |||
| 1116 | Ga0105243_10000188 | |||
| 1117 | Ga0105243_10001577 | |||
| 1118 | Ga0105243_10059100 | |||
| 1119 | Ga0105243_10115022 | |||
| 1120 | Ga0105242_10000442 | |||
| 1121 | Ga0105248_10014418 | |||
| 1122 | Ga0105248_10710898 | |||
| 1123 | Ga0105237_10001803 | |||
| 1124 | Ga0105237_10011832 | |||
| 1125 | Ga0105238_10001357 | |||
| 1126 | Ga0105238_10590346 | |||
| 1127 | Ga0105249_10187816 | |||
| 1128 | Ga0105246_10000552 | |||
| 1129 | Ga0105246_10000905 | |||
| 1130 | Ga0105246_10010477 | |||
| 1131 | Ga0157345_1001221 | |||
| 1132 | Ga0157373_10003549 | |||
| 1133 | Ga0157373_10024113 | |||
| 1134 | Ga0157373_10111642 | |||
| 1135 | Ga0157373_10144477 | |||
| 1136 | Ga0157373_10173169 | |||
| 1137 | Ga0157373_10247884 | |||
| 1138 | Ga0157373_10250491 | |||
| 1139 | Ga0157371_10000243 | |||
| 1140 | Ga0157371_10001094 | |||
| 1141 | Ga0157371_10011353 | |||
| 1142 | Ga0157371_10011506 | |||
| 1143 | Ga0157371_10033069 | |||
| 1144 | Ga0157370_10000388 | |||
| 1145 | Ga0157370_10001514 | |||
| 1146 | Ga0157370_10066193 | |||
| 1147 | Ga0157370_10116589 | |||
| 1148 | Ga0157370_10144054 | |||
| 1149 | Ga0157370_10167000 | |||
| 1150 | Ga0157370_10347488 | |||
| 1151 | Ga0157369_10000818 | |||
| 1152 | Ga0157369_10006101 | |||
| 1153 | Ga0157369_10148184 | |||
| 1154 | Ga0157369_10167030 | |||
| 1155 | Ga0157369_10169975 | |||
| 1156 | Ga0157369_10173827 | |||
| 1157 | Ga0157369_10564407 | |||
| 1158 | Ga0163162_10012103 | |||
| 1159 | Ga0163162_10587354 | |||
| 1160 | Ga0163162_10768447 | |||
| 1161 | Ga0157372_10001236 | |||
| 1162 | Ga0157372_10045650 | |||
| 1163 | Ga0157372_10101121 | |||
| 1164 | Ga0157375_10115247 | |||
| 1165 | Ga0182008_10000900 | |||
| 1166 | Ga0182008_10039844 | |||
| 1167 | Ga0182008_10040155 | |||
| 1168 | Ga0182008_10042578 | |||
| 1169 | Ga0182008_10056097 | |||
| 1170 | Ga0182008_10109988 | |||
| 1171 | Ga0182008_10135026 | |||
| 1172 | Ga0157379_10034328 | |||
| 1173 | Ga0157379_10316654 | |||
| 1174 | Ga0182006_1037239 | |||
| 1175 | Ga0182006_1072752 | |||
| 1176 | Ga0182006_1080464 | |||
| 1177 | Ga0182007_10002788 | |||
| 1178 | Ga0182005_1007407 | |||
| 1179 | Ga0163161_10127654 | |||
| 1180 | Ga0163161_10309887 | |||
| 1181 | Ga0163161_10310227 | |||
| 1182 | Ga0163161_10397654 | |||
| 1183 | Ga0209435_100900 | |||
| 1184 | Ga0209760_100058 | |||
| 1185 | Ga0209760_100060 | |||
| 1186 | Ga0209784_100060 | |||
| 1187 | Ga0209566_100075 | |||
| 1188 | Ga0209674_100100 | |||
| 1189 | Ga0209147_100096 | |||
| 1190 | Ga0209563_100118 | |||
| 1191 | Ga0209563_101016 | |||
| 1192 | Ga0207427_100056 | |||
| 1193 | Ga0207427_100063 | |||
| 1194 | Ga0209437_100065 | |||
| 1195 | Ga0209437_100133 | |||
| 1196 | Ga0209258_100221 | |||
| 1197 | Ga0209646_1000474 | |||
| 1198 | Ga0209677_100057 | |||
| 1199 | Ga0209759_1015683 | |||
| 1200 | Ga0209233_1000085 | |||
| 1201 | Ga0209233_1000133 | |||
| 1202 | Ga0209676_1000076 | |||
| 1203 | Ga0209676_1000264 | |||
| 1204 | Ga0209676_1000822 | |||
| 1205 | Ga0209676_1000952 | |||
| 1206 | Ga0209676_1003131 | |||
| 1207 | Ga0209676_1015731 | |||
| 1208 | Ga0209050_1000063 | |||
| 1209 | Ga0209050_1000080 | |||
| 1210 | Ga0209050_1000106 | |||
| 1211 | Ga0209050_1002243 | |||
| 1212 | Ga0209051_1000045 | |||
| 1213 | Ga0209051_1000082 | |||
| 1214 | Ga0209051_1000139 | |||
| 1215 | Ga0209257_1000185 | |||
| 1216 | Ga0209257_1012213 | |||
| 1217 | Ga0207656_10000010 | |||
| 1218 | Ga0207696_1000047 | |||
| 1219 | Ga0207696_1000065 | |||
| 1220 | Ga0207696_1000126 | |||
| 1221 | Ga0207696_1000168 | |||
| 1222 | Ga0207696_1009597 | |||
| 1223 | Ga0207696_1017805 | |||
| 1224 | Ga0207696_1037936 | |||
| 1225 | Ga0207655_1000120 | |||
| 1226 | Ga0207655_1000213 | |||
| 1227 | Ga0207655_1000214 | |||
| 1228 | Ga0207655_1000742 | |||
| 1229 | Ga0207655_1000810 | |||
| 1230 | Ga0207655_1001105 | |||
| 1231 | Ga0207655_1001674 | |||
| 1232 | Ga0207655_1004177 | |||
| 1233 | Ga0207655_1006183 | |||
| 1234 | Ga0207655_1009815 | |||
| 1235 | Ga0207655_1011058 | |||
| 1236 | Ga0207655_1011644 | |||
| 1237 | Ga0207655_1024689 | |||
| 1238 | Ga0207655_1035864 | |||
| 1239 | Ga0207655_1063911 | |||
| 1240 | Ga0207713_1000049 | |||
| 1241 | Ga0207713_1000073 | |||
| 1242 | Ga0207713_1000337 | |||
| 1243 | Ga0207713_1000467 | |||
| 1244 | Ga0207713_1000799 | |||
| 1245 | Ga0207713_1000862 | |||
| 1246 | Ga0207713_1002385 | |||
| 1247 | Ga0207713_1003051 | |||
| 1248 | Ga0207713_1004156 | |||
| 1249 | Ga0207713_1005188 | |||
| 1250 | Ga0207713_1006295 | |||
| 1251 | Ga0207713_1009274 | |||
| 1252 | Ga0207713_1019085 | |||
| 1253 | Ga0207713_1022056 | |||
| 1254 | Ga0207713_1023984 | |||
| 1255 | Ga0207713_1029733 | |||
| 1256 | Ga0207707_10000165 | |||
| 1257 | Ga0207695_10008884 | |||
| 1258 | Ga0207695_10009284 | |||
| 1259 | Ga0207695_10100317 | |||
| 1260 | Ga0207695_10518162 | |||
| 1261 | Ga0207671_10000373 | |||
| 1262 | Ga0207660_10003867 | |||
| 1263 | Ga0207660_10080199 | |||
| 1264 | Ga0207649_10000126 | |||
| 1265 | Ga0207652_10005936 | |||
| 1266 | Ga0207652_10022224 | |||
| 1267 | Ga0207652_10123589 | |||
| 1268 | Ga0207681_10000148 | |||
| 1269 | Ga0207681_10008503 | |||
| 1270 | Ga0207650_10000409 | |||
| 1271 | Ga0207650_10000620 | |||
| 1272 | Ga0207644_10000037 | |||
| 1273 | Ga0207706_10000871 | |||
| 1274 | Ga0207706_10014846 | |||
| 1275 | Ga0207686_10003589 | |||
| 1276 | Ga0207709_10000030 | |||
| 1277 | Ga0207709_10000265 | |||
| 1278 | Ga0207709_10005530 | |||
| 1279 | Ga0207709_10059153 | |||
| 1280 | Ga0207709_10071874 | |||
| 1281 | Ga0207709_10093172 | |||
| 1282 | Ga0207711_10090221 | |||
| 1283 | Ga0207679_10000017 | |||
| 1284 | Ga0207679_10116066 | |||
| 1285 | Ga0207667_10002663 | |||
| 1286 | Ga0207667_10010320 | |||
| 1287 | Ga0207667_10235358 | |||
| 1288 | Ga0207667_10363270 | |||
| 1289 | Ga0207639_10000418 | |||
| 1290 | Ga0207702_10481031 | |||
| 1291 | Ga0209281_1000070 | |||
| 1292 | Ga0209281_1000127 | |||
| 1293 | Ga0209281_1003227 | |||
| 1294 | Ga0209389_1000171 | |||
| 1295 | Ga0209371_1000094 | |||
| 1296 | Ga0209371_1000219 | |||
| 1297 | Ga0209995_1001312 | |||
| 1298 | Ga0209983_1002129 | |||
| 1299 | Ga0207428_10003468 | |||
| 1300 | Ga0268266_10000246 | |||
| 1301 | Ga0268266_10057991 | |||
| 1302 | Ga0268266_10176726 | |||
| 1303 | Ga0268256_1000083 | |||
| 1304 | Ga0268256_1000356 | |||
| 1305 | Ga0314311_1250128 | |||
| 1306 | Ga0316178_1105767 | |||
| 1307 | Ga0316181_1098368 | |||
| 1308 | Ga0316181_1105230 | |||
| 1309 | Ga0265316_10207768 | |||
| 1310 | Ga0307408_100000013 | |||
| 1311 | Ga0307408_100157661 | |||
| 1312 | Ga0307408_100188021 | |||
| 1313 | Ga0316575_10109859 | |||
| 1314 | Ga0316579_10000205 | |||
| 1315 | Ga0316578_10014339 | |||
| 1316 | Ga0316577_10003841 | |||
| 1317 | Ga0307409_100191685 | |||
| 1318 | Ga0316585_10004574 | |||
| 1319 | Ga0316593_10017867 | |||
| 1320 | Ga0307510_10164030 | |||
| 1321 | Ga0316574_0034538 | |||
| 1322 | Ga0316581_0000481 | |||
| 1323 | Ga0436365_0833723 | |||
| 1324 | Ga0439436_0000216 | |||
| 1325 | Ga0439438_000980 | |||
| 1326 | Ga0439438_005907 | |||
| 1327 | Ga0439438_009913 | |||
| 1328 | Ga0439438_012665 | |||
| 1329 | Ga0439447_001011 | |||
| 1330 | Ga0439447_004964 | |||
| 1331 | Ga0439447_006926 | |||
| 1332 | Ga0439447_010943 | |||
| 1333 | Ga0439447_015002 | |||
| 1334 | Ga0439447_015739 | |||
| 1335 | Ga0439466_0000892 | |||
| 1336 | Ga0439466_0003444 | |||
| 1337 | Ga0439466_0005529 | |||
| 1338 | Ga0439466_0006397 | |||
| 1339 | Ga0439466_0009496 | |||
| 1340 | Ga0439466_0010716 | |||
| 1341 | Ga0439466_0017178 | |||
| 1342 | Ga0451789_0974815 | |||
| 1343 | Ga0439431_0001116 | |||
| 1344 | Ga0439431_0007794 | |||
| 1345 | Ga0439437_000227 | |||
| 1346 | Ga0439432_007057 | |||
| 1347 | Ga0439432_011529 | |||
| 1348 | Ga0439432_017521 | |||
| 1349 | Ga0439432_020578 | |||
| 1350 | Ga0439451_002551 | |||
| 1351 | Ga0439451_013598 | |||
| 1352 | Ga0439452_000418 | |||
| 1353 | Ga0439452_003004 | |||
| 1354 | Ga0439452_004529 | |||
| 1355 | Ga0439452_013156 | |||
| 1356 | Ga0439452_019675 | |||
| 1357 | Ga0439456_000131 | |||
| 1358 | Ga0439456_003575 | |||
| 1359 | Ga0439456_005080 | |||
| 1360 | Ga0439456_024479 | |||
| 1361 | Ga0439463_005854 | |||
| 1362 | Ga0439463_006630 | |||
| 1363 | Ga0439463_015614 | |||
| 1364 | Ga0450911_000012 | |||
| 1365 | Ga0450911_003690 | |||
| 1366 | Ga0450911_004361 | |||
| 1367 | Ga0450923_004056 | |||
| 1368 | Ga0450890_003834 | |||
| 1369 | Ga0450898_003444 | |||
| 1370 | Ga0450900_001014 | |||
| 1371 | Ga0450902_003971 | |||
| 1372 | Ga0450904_000453 | |||
| 1373 | Ga0450905_000731 | |||
| 1374 | Ga0450906_007780 | |||
| 1375 | Ga0450906_020115 | |||
| 1376 | Ga0450907_000827 | |||
| 1377 | Ga0450907_003188 | |||
| 1378 | Ga0450910_001431 | |||
| 1379 | Ga0439446_0000270 | |||
| 1380 | Ga0439446_0004766 | |||
| 1381 | Ga0439446_0011069 | |||
| 1382 | Ga0450908_012048 | |||
| 1383 | Ga0450909_000842 | |||
| 1384 | Ga0439434_0002762 | |||
| 1385 | Ga0439459_0004312 | |||
| 1386 | Ga0439464_0012870 | |||
| 1387 | Ga0439464_0036442 | |||
| 1388 | Ga0450916_002789 | |||
| 1389 | Ga0450918_005874 | |||
| 1390 | Ga0450893_0000237 | |||
| 1391 | Ga0450901_001790 | |||
| 1392 | Ga0451577_0360142 | |||
| 1393 | Ga0439440_0003584 | |||
| 1394 | Ga0466969_0002332 | |||
| 1395 | Ga0453684_0002021 | |||
| 1396 | Ga0453684_0144229 | |||
| 1397 | Ga0466959_0001286 | |||
| 1398 | Ga0466959_0013335 | |||
| 1399 | Ga0495617_006136 | |||
| 1400 | Ga0495617_026908 | |||
| 1401 | Ga0495627_000037 | |||
| 1402 | Ga0495627_003242 | |||
| 1403 | Ga0495627_011888 | |||
| 1404 | Ga0495627_014626 | |||
| 1405 | Ga0495627_020892 | |||
| 1406 | Ga0495591_000036 | |||
| 1407 | Ga0495591_000571 | |||
| 1408 | Ga0495591_002368 | |||
| 1409 | Ga0495591_003076 | |||
| 1410 | Ga0495591_005316 | |||
| 1411 | Ga0495591_005675 | |||
| 1412 | Ga0495591_007513 | |||
| 1413 | Ga0495591_009824 | |||
| 1414 | Ga0495591_011543 | |||
| 1415 | Ga0495591_011647 | |||
| 1416 | Ga0495591_014947 | |||
| 1417 | Ga0495591_048402 | |||
| 1418 | Ga0495638_0041214 | |||
| 1419 | Ga0495653_0060776 | |||
| 1420 | Ga0495653_0069895 | |||
| 1421 | Ga0495653_0093187 | |||
| 1422 | Ga0495653_0098835 | |||
| 1423 | Ga0495650_0019791 | |||
| 1424 | Ga0495650_0031597 | |||
| 1425 | Ga0495650_0075575 | |||
| 1426 | Ga0495605_0000033 | |||
| 1427 | Ga0495605_0000442 | |||
| 1428 | Ga0495605_0000453 | |||
| 1429 | Ga0495605_0006045 | |||
| 1430 | Ga0495605_0034365 | |||
| 1431 | Ga0495605_0037682 | |||
| 1432 | Ga0495605_0040672 | |||
| 1433 | Ga0495639_0004168 | |||
| 1434 | Ga0495584_0006054 | |||
| 1435 | Ga0495584_0006365 | |||
| 1436 | Ga0495584_0017395 | |||
| 1437 | Ga0495584_0022204 | |||
| 1438 | Ga0495584_0058306 | |||
| 1439 | Ga0495584_0062519 | |||
| 1440 | Ga0495584_0062525 | |||
| 1441 | Ga0495584_0076807 | |||
| 1442 | Ga0495584_0088122 | |||
| 1443 | Ga0495585_0010926 | |||
| 1444 | Ga0495585_0012667 | |||
| 1445 | Ga0495585_0015984 | |||
| 1446 | Ga0495585_0031496 | |||
| 1447 | Ga0495594_0009324 | |||
| 1448 | Ga0495596_0001043 | |||
| 1449 | Ga0495596_0014076 | |||
| 1450 | Ga0495607_0000385 | |||
| 1451 | Ga0495607_0000614 | |||
| 1452 | Ga0495607_0000674 | |||
| 1453 | Ga0495607_0001352 | |||
| 1454 | Ga0495607_0004283 | |||
| 1455 | Ga0495607_0017751 | |||
| 1456 | Ga0495607_0053435 | |||
| 1457 | Ga0495607_0067797 | |||
| 1458 | Ga0495607_0082345 | |||
| 1459 | Ga0495607_0135260 | |||
| 1460 | Ga0495583_0000031 | |||
| 1461 | Ga0495583_0003664 | |||
| 1462 | Ga0495583_0005049 | |||
| 1463 | Ga0495583_0013177 | |||
| 1464 | Ga0495583_0032092 | |||
| 1465 | Ga0495583_0041293 | |||
| 1466 | Ga0495583_0054817 | |||
| 1467 | Ga0495606_0000722 | |||
| 1468 | Ga0495606_0001283 | |||
| 1469 | Ga0495606_0001919 | |||
| 1470 | Ga0495606_0011936 | |||
| 1471 | Ga0495606_0036936 | |||
| 1472 | Ga0495606_0048624 | |||
| 1473 | Ga0495606_0051326 | |||
| 1474 | Ga0495606_0112998 | |||
| 1475 | Ga0495606_0187822 | |||
| 1476 | Ga0495610_0009189 | |||
| 1477 | Ga0495610_0011481 | |||
| 1478 | Ga0495610_0058517 | |||
| 1479 | Ga0495616_0015598 | |||
| 1480 | Ga0495616_0019488 | |||
| 1481 | Ga0495616_0029577 | |||
| 1482 | Ga0495616_0051249 | |||
| 1483 | Ga0495616_0052584 | |||
| 1484 | Ga0495620_0000007 | |||
| 1485 | Ga0495620_0000038 | |||
| 1486 | Ga0495620_0005117 | |||
| 1487 | Ga0495620_0006559 | |||
| 1488 | Ga0495620_0006731 | |||
| 1489 | Ga0495620_0022344 | |||
| 1490 | Ga0495620_0046724 | |||
| 1491 | Ga0495631_0005175 | |||
| 1492 | Ga0495631_0006650 | |||
| 1493 | Ga0495631_0019960 | |||
| 1494 | Ga0495631_0022969 | |||
| 1495 | Ga0495631_0032643 | |||
| 1496 | Ga0495631_0052481 | |||
| 1497 | Ga0495632_0006732 | |||
| 1498 | Ga0495632_0009692 | |||
| 1499 | Ga0495632_0012800 | |||
| 1500 | Ga0495632_0023244 | |||
| 1501 | Ga0495632_0027149 | |||
| 1502 | Ga0495632_0033446 | |||
| 1503 | Ga0495632_0039664 | |||
| 1504 | Ga0495632_0043150 | |||
| 1505 | Ga0495632_0053872 | |||
| 1506 | Ga0495632_0062583 | |||
| 1507 | Ga0495632_0130720 | |||
| 1508 | Ga0495637_0000064 | |||
| 1509 | Ga0495637_0000610 | |||
| 1510 | Ga0495637_0006010 | |||
| 1511 | Ga0495637_0007118 | |||
| 1512 | Ga0495637_0023874 | |||
| 1513 | Ga0495637_0024152 | |||
| 1514 | Ga0495637_0024415 | |||
| 1515 | Ga0495637_0031839 | |||
| 1516 | Ga0495637_0032684 | |||
| 1517 | Ga0495637_0037617 | |||
| 1518 | Ga0495637_0063521 | |||
| 1519 | Ga0495637_0066098 | |||
| 1520 | Ga0495643_0000159 | |||
| 1521 | Ga0495643_0002175 | |||
| 1522 | Ga0495643_0014724 | |||
| 1523 | Ga0495643_0032701 | |||
| 1524 | Ga0495643_0051633 | |||
| 1525 | Ga0495643_0074767 | |||
| 1526 | Ga0495644_0006044 | |||
| 1527 | Ga0495644_0018656 | |||
| 1528 | Ga0495644_0045882 | |||
| 1529 | Ga0495648_0028708 | |||
| 1530 | Ga0495648_0028764 | |||
| 1531 | Ga0495648_0031832 | |||
| 1532 | Ga0495648_0041970 | |||
| 1533 | Ga0495648_0056618 | |||
| 1534 | Ga0495648_0064373 | |||
| 1535 | Ga0495648_0073707 | |||
| 1536 | Ga0495648_0085923 | |||
| 1537 | Ga0495648_0108286 | |||
| 1538 | Ga0495648_0134843 | |||
| 1539 | Ga0495666_0061529 | |||
| 1540 | Ga0495642_0003319 | |||
| 1541 | Ga0495654_0002905 | |||
| 1542 | Ga0495654_0004835 | |||
| 1543 | Ga0495654_0018079 | |||
| 1544 | Ga0495654_0030115 | |||
| 1545 | Ga0495654_0032189 | |||
| 1546 | Ga0495654_0063050 | |||
| 1547 | Ga0495654_0072908 | |||
| 1548 | Ga0495609_0000018 | |||
| 1549 | Ga0495609_0000056 | |||
| 1550 | Ga0495609_0002274 | |||
| 1551 | Ga0495609_0101947 | |||
| 1552 | Ga0495597_0000026 | |||
| 1553 | Ga0495597_0013450 | |||
| 1554 | Ga0495597_0050026 | |||
| 1555 | Ga0495597_0057126 | |||
| 1556 | Ga0495622_0008113 | |||
| 1557 | Ga0495622_0060299 | |||
| 1558 | Ga0495622_0089808 | |||
| 1559 | Ga0495633_0000062 | |||
| 1560 | Ga0495633_0021810 | |||
| 1561 | Ga0495668_0025234 | |||
| 1562 | Ga0495634_0061358 | |||
| 1563 | Ga0495611_0001689 | |||
| 1564 | Ga0495611_0006048 | |||
| 1565 | Ga0495611_0019824 | |||
| 1566 | Ga0495611_0020800 | |||
| 1567 | Ga0495625_0000194 | |||
| 1568 | Ga0495625_0016515 | |||
| 1569 | Ga0495625_0066288 | |||
| 1570 | Ga0495625_0109977 | |||
| 1571 | Ga0495661_0000016 | |||
| 1572 | Ga0495661_0000093 | |||
| 1573 | Ga0495661_0000662 | |||
| 1574 | Ga0495661_0001069 | |||
| 1575 | Ga0495661_0008953 | |||
| 1576 | Ga0495661_0068742 | |||
| 1577 | Ga0495623_0038158 | |||
| 1578 | Ga0495646_0032496 | |||
| 1579 | Ga0495624_0018070 | |||
| 1580 | Ga0495670_0005692 | |||
| 1581 | Ga0495670_0006112 | |||
| 1582 | Ga0495670_0040183 | |||
| 1583 | Ga0495671_0003081 | |||
| 1584 | Ga0495671_0010355 | |||
| 1585 | Ga0495671_0011925 | |||
| 1586 | Ga0495671_0021917 | |||
| 1587 | Ga0495671_0022635 | |||
| 1588 | Ga0495671_0043571 | |||
| 1589 | Ga0495671_0044986 | |||
| 1590 | Ga0495671_0050759 | |||
| 1591 | Ga0495671_0050843 | |||
| 1592 | Ga0495671_0078991 | |||
| 1593 | Ga0495671_0107603 | |||
| 1594 | Ga0495671_0162099 | |||
| 1595 | Ga0495649_0002195 | |||
| 1596 | Ga0495649_0005784 | |||
| 1597 | Ga0495649_0008308 | |||
| 1598 | Ga0495649_0030107 | |||
| 1599 | Ga0495649_0070199 | |||
| 1600 | Ga0495649_0156515 | |||
| 1601 | Ga0495589_0005691 | |||
| 1602 | Ga0495589_0006010 | |||
| 1603 | Ga0495589_0021071 | |||
| 1604 | Ga0495589_0041601 | |||
| 1605 | Ga0495589_0065881 | |||
| 1606 | Ga0495589_0125669 | |||
| 1607 | Ga0495660_0001019 | |||
| 1608 | Ga0495660_0006561 | |||
| 1609 | Ga0495660_0007816 | |||
| 1610 | Ga0495660_0042921 | |||
| 1611 | Ga0495660_0145369 | |||
| 1612 | Ga0495604_0072323 | |||
| 1613 | Ga0495604_0072324 | |||
| 1614 | Ga0495636_0073632 | |||
| 1615 | Ga0495672_0020098 | |||
| 1616 | Ga0495672_0029740 | |||
| 1617 | Ga0495672_0030758 | |||
| 1618 | Ga0495672_0031137 | |||
| 1619 | Ga0495672_0034800 | |||
| 1620 | Ga0495672_0040424 | |||
| 1621 | Ga0495672_0058275 | |||
| 1622 | Ga0495672_0091221 | |||
| 1623 | Ga0495676_0000052 | |||
| 1624 | Ga0495676_0000957 | |||
| 1625 | Ga0495680_0014017 | |||
| 1626 | Ga0495680_0063462 | |||
| 1627 | Ga0495683_0000043 | |||
| 1628 | Ga0495683_0000092 | |||
| 1629 | Ga0495683_0007850 | |||
| 1630 | Ga0495683_0021391 | |||
| 1631 | Ga0495683_0021571 | |||
| 1632 | Ga0495683_0089315 | |||
| 1633 | Ga0495683_0107579 | |||
| 1634 | Ga0495687_047763 | |||
| 1635 | Ga0495675_0016370 | |||
| 1636 | Ga0495679_000504 | |||
| 1637 | Ga0495679_002108 | |||
| 1638 | Ga0495679_022097 | |||
| 1639 | Ga0495679_023322 | |||
| 1640 | Ga0495673_0000667 | |||
| 1641 | Ga0495673_0003353 | |||
| 1642 | Ga0495673_0013566 | |||
| 1643 | Ga0495673_0026694 | |||
| 1644 | Ga0495673_0027169 | |||
| 1645 | Ga0495673_0027763 | |||
| 1646 | Ga0495681_0008574 | |||
| 1647 | Ga0495681_0010639 | |||
| 1648 | Ga0495681_0016573 | |||
| 1649 | Ga0495681_0025986 | |||
| 1650 | Ga0495681_0035834 | |||
| 1651 | Ga0495681_0043624 | |||
| 1652 | Ga0495681_0051267 | |||
| 1653 | Ga0495681_0055628 | |||
| 1654 | Ga0495686_0074342 | |||
| 1655 | Ga0495686_0128609 | |||
| 1656 | Ga0495626_0000126 | |||
| 1657 | Ga0495626_0001308 | |||
| 1658 | Ga0495626_0022816 | |||
| 1659 | Ga0495626_0051716 | |||
| 1660 | Ga0495626_0058676 | |||
| 1661 | Ga0496102_0109735 | |||
| 1662 | Ga0496103_0119864 | |||
| 1663 | Ga0496110_0069686 | |||
| 1664 | Ga0496111_0144924 | |||
| 1665 | Ga0496114_0143281 | |||
| 1666 | Ga0496116_0000398 | |||
| 1667 | Ga0496116_0014823 | |||
| 1668 | Ga0496116_0050996 | |||
| 1669 | Ga0496116_0114506 | |||
| 1670 | Ga0496117_0003966 | |||
| 1671 | Ga0496117_0014254 | |||
| 1672 | Ga0496117_0014409 | |||
| 1673 | Ga0496117_0054268 | |||
| 1674 | Ga0496117_0067264 | |||
| 1675 | Ga0496117_0077593 | |||
| 1676 | Ga0496117_0177882 | |||
| 1677 | Ga0496117_0178719 | |||
| 1678 | Ga0496117_0181424 | |||
| 1679 | Ga0496118_0004770 | |||
| 1680 | Ga0496118_0030664 | |||
| 1681 | Ga0496118_0051762 | |||
| 1682 | Ga0496118_0087202 | |||
| 1683 | Ga0496119_0000479 | |||
| 1684 | Ga0496119_0070874 | |||
| 1685 | Ga0496120_0002540 | |||
| 1686 | Ga0496120_0060164 | |||
| 1687 | Ga0496120_0065231 | |||
| 1688 | Ga0496121_0000412 | |||
| 1689 | Ga0496121_0002869 | |||
| 1690 | Ga0496121_0011455 | |||
| 1691 | Ga0496121_0090665 | |||
| 1692 | Ga0496121_0109648 | |||
| 1693 | Ga0496121_0126103 | |||
| 1694 | Ga0496121_0202101 | |||
| 1695 | Ga0496122_0000434 | |||
| 1696 | Ga0496122_0013063 | |||
| 1697 | Ga0496122_0072134 | |||
| 1698 | Ga0496122_0150341 | |||
| 1699 | Ga0496122_0179936 | |||
| 1700 | Ga0496122_0193974 | |||
| 1701 | Ga0496122_0209813 | |||
| 1702 | Ga0496123_0000207 | |||
| 1703 | Ga0496123_0000318 | |||
| 1704 | Ga0496123_0003681 | |||
| 1705 | Ga0496123_0006979 | |||
| 1706 | Ga0496123_0068055 | |||
| 1707 | Ga0496123_0136878 | |||
| 1708 | Ga0496124_0000689 | |||
| 1709 | Ga0496124_0007409 | |||
| 1710 | Ga0496124_0014442 | |||
| 1711 | Ga0496124_0017267 | |||
| 1712 | Ga0496124_0018115 | |||
| 1713 | Ga0496124_0057530 | |||
| 1714 | Ga0496124_0062514 | |||
| 1715 | Ga0496124_0067621 | |||
| 1716 | Ga0496124_0240262 | |||
| 1717 | Ga0496124_0269553 | |||
| 1718 | Ga0496125_0001906 | |||
| 1719 | Ga0496125_0004964 | |||
| 1720 | Ga0496125_0017882 | |||
| 1721 | Ga0496125_0020043 | |||
| 1722 | Ga0496125_0043957 | |||
| 1723 | Ga0496125_0076692 | |||
| 1724 | Ga0496125_0140000 | |||
| 1725 | Ga0496125_0224104 | |||
| 1726 | Ga0496125_0242815 | |||
| 1727 | Ga0496126_0072293 | |||
| 1728 | Ga0496126_0215908 | |||
| 1729 | Ga0496126_0217998 | |||
| 1730 | Ga0496126_0417412 | |||
| 1731 | Ga0495678_000021 | |||
| 1732 | Ga0495678_002247 | |||
| 1733 | Ga0495678_007216 | |||
| 1734 | Ga0495678_017098 | |||
| 1735 | Ga0495678_041030 | |||
| 1736 | Ga0495682_0000697 | |||
| 1737 | Ga0495682_0000959 | |||
| 1738 | Ga0495682_0024842 | |||
| 1739 | Ga0501032_0035566 | |||
| 1740 | Ga0501034_0000085 | |||
| 1741 | Ga0501034_0040103 | |||
| 1742 | Ga0501034_0172263 | |||
| 1743 | Ga0501037_0136144 | |||
| 1744 | Ga0501039_0087342 | |||
| 1745 | Ga0501226_000002 | |||
| 1746 | nmdc:mga0sz30_100952_c1 | |||
| 1747 | Ga0500558_114090 | |||
| 1748 | Ga0500618_007870 | |||
| 1749 | Ga0500659_0011592 | |||
| 1750 | Ga0500573_0043944 | |||
| 1751 | Ga0500634_0060015 | |||
| 1752 | Ga0500636_0185532 | |||
| 1753 | 2510283260 | |||
| 1754 | 2510292909 | |||
| 1755 | 2510313382 | |||
| 1756 | 2511252548 | |||
| 1757 | 2511266255 | |||
| 1758 | 2511271434 | |||
| 1759 | 2511278566 | |||
| 1760 | 2511292247 | |||
| 1761 | 2511293215 | |||
| 1762 | 2511302609 | |||
| 1763 | 2511315921 | |||
| 1764 | 2511320440 | |||
| 1765 | 2511325970 | |||
| 1766 | 2511335226 | |||
| 1767 | 2511341350 | |||
| 1768 | 2511347276 | |||
| 1769 | 2511351914 | |||
| 1770 | 2511359831 | |||
| 1771 | 2511362126 | |||
| 1772 | 2511372223 | |||
| 1773 | 2511373285 | |||
| 1774 | 2511411365 | |||
| 1775 | 2511827152 | |||
| 1776 | 2512328029 | |||
| 1777 | 2554813281 | |||
| 1778 | 2555247061 | |||
| 1779 | 2555672363 | |||
| 1780 | 2583794939 | |||
| 1781 | 2597860434 | |||
| 1782 | 2597866177 | |||
| 1783 | 2597872014 | |||
| 1784 | 2599329397 | |||
| 1785 | 2599358194 | |||
| 1786 | 2599364548 | |||
| 1787 | 2599370916 | |||
| 1788 | 2599376938 | |||
| 1789 | 2599383359 | |||
| 1790 | 2599389806 | |||
| 1791 | 2599396094 | |||
| 1792 | 2599401330 | |||
| 1793 | 2599407934 | |||
| 1794 | 2599453055 | |||
| 1795 | 2599465009 | |||
| 1796 | 2599471325 | |||
| 1797 | 2599486725 | |||
| 1798 | 2599494076 | |||
| 1799 | 2599504893 | |||
| 1800 | 2599509809 | |||
| 1801 | 2599515060 | |||
| 1802 | 2599520221 | |||
| 1803 | 2599616575 | |||
| 1804 | 2599772939 | |||
| 1805 | 2599807151 | |||
| 1806 | 2599881660 | |||
| 1807 | 2599888252 | |||
| 1808 | 2599894440 | |||
| 1809 | 2599900966 | |||
| 1810 | 2599930442 | |||
| 1811 | 2599945030 | |||
| 1812 | 2599949285 | |||
| 1813 | 2599955241 | |||
| 1814 | 2599962696 | |||
| 1815 | 2599967102 | |||
| 1816 | 2599974678 | |||
| 1817 | 2599981005 | |||
| 1818 | 2599983974 | |||
| 1819 | 2599990308 | |||
| 1820 | 2599997710 | |||
| 1821 | 2600001750 | |||
| 1822 | 2600009287 | |||
| 1823 | 2600013881 | |||
| 1824 | 2600021203 | |||
| 1825 | 2600026843 | |||
| 1826 | 2600032825 | |||
| 1827 | 2600039073 | |||
| 1828 | 2600044719 | |||
| 1829 | 2600048842 | |||
| 1830 | 2600056199 | |||
| 1831 | 2600062294 | |||
| 1832 | 2600068770 | |||
| 1833 | 2600074504 | |||
| 1834 | 2600079586 | |||
| 1835 | 2600217741 | |||
| 1836 | 2600360391 | |||
| 1837 | 2600367816 | |||
| 1838 | 2600445207 | |||
| 1839 | 2601628695 | |||
| 1840 | 2601693886 | |||
| 1841 | 2601777908 | |||
| 1842 | 2601800532 | |||
| 1843 | 2602012313 | |||
| 1844 | 2606078660 | |||
| 1845 | 2606125680 | |||
| 1846 | 2608381539 | |||
| 1847 | 2621297284 | |||
| 1848 | 2624482949 | |||
| 1849 | 2624494483 | |||
| 1850 | 2643844922 | |||
| 1851 | 2643870887 | |||
| 1852 | 2643957633 | |||
| 1853 | 2644025747 | |||
| 1854 | 2644189001 | |||
| 1855 | 2644286552 | |||
| 1856 | 2644625272 | |||
| 1857 | 2652546014 | |||
| 1858 | 2671093860 | |||
| 1859 | 2671100722 | |||
| 1860 | 2671129938 | |||
| 1861 | 2671773289 | |||
| 1862 | 2677898444 | |||
| 1863 | 2678265665 | |||
| 1864 | 2715752371 | |||
| 1865 | 2715759122 | |||
| 1866 | 2718636156 | |||
| 1867 | 2723250914 | |||
| 1868 | 2729146080 | |||
| 1869 | 2738672972 | |||
| 1870 | 2738691051 | |||
| 1871 | 2738751365 | |||
| 1872 | 2738810212 | |||
| 1873 | 2738860406 | |||
| 1874 | 2738897572 | |||
| 1875 | 2739198117 | |||
| 1876 | 2739260883 | |||
| 1877 | 2739266812 | |||
| 1878 | 2739289545 | |||
| 1879 | 2739294857 | |||
| 1880 | 2739314902 | |||
| 1881 | 2743739981 | |||
| 1882 | 2745006900 | |||
| 1883 | 2765586170 | |||
| 1884 | 2774121855 | |||
| 1885 | 2774132567 | |||
| 1886 | 2774137094 | |||
| 1887 | 2784262282 | |||
| 1888 | 2784314518 | |||
| 1889 | 2794595249 | |||
| 1890 | 2807410398 | |||
| 1891 | 2807458743 | |||
| 1892 | 2808857296 | |||
| 1893 | 2808905308 | |||
| 1894 | 2808926397 | |||
| 1895 | 2808930917 | |||
| 1896 | 2808937400 | |||
| 1897 | 2808941257 | |||
| 1898 | 2808948558 | |||
| 1899 | 2808953039 | |||
| 1900 | 2808961262 | |||
| 1901 | 2808965730 | |||
| 1902 | 2808977542 | |||
| 1903 | 2808992800 | |||
| 1904 | 2809000671 | |||
| 1905 | 2809219235 | |||
| 1906 | 2812368854 | |||
| 1907 | 2817493591 | |||
| 1908 | 2819659246 | |||
| 1909 | 2819706389 | |||
| 1910 | 2823422161 | |||
| 1911 | 2825655587 | |||
| 1912 | 2826582865 | |||
| 1913 | 2834033199 | |||
| 1914 | 2842809941 | |||
| 1915 | 2842819915 | |||
| 1916 | 2842829099 | |||
| 1917 | 2842836931 | |||
| 1918 | 2842840468 | |||
| 1919 | 2842847668 | |||
| 1920 | 2842852841 | |||
| 1921 | 2842859617 | |||
| 1922 | 2844666531 | |||
| 1923 | 2852618104 | |||
| 1924 | 2852661067 | |||
| 1925 | 2852673162 | |||
| 1926 | 2860343937 | |||
| 1927 | 2860872587 | |||
| 1928 | 2878034882 | |||
| 1929 | 2880235520 | |||
| 1930 | 2904522609 | |||
| 1931 | 2904554100 | |||
| 1932 | 2908452109 | |||
| 1933 | 2912968428 | |||
| 1934 | 2913042076 | |||
| 1935 | 2917076244 | |||
| 1936 | 2917832892 | |||
| 1937 | 2919067738 | |||
| 1938 | 2919128592 | |||
| 1939 | 2919158268 | |||
| 1940 | 2919390601 | |||
| 1941 | 2919461700 | |||
| 1942 | 2919485909 | |||
| 1943 | 2919490915 | |||
| 1944 | 2919505989 | |||
| 1945 | 2919701417 | |||
| 1946 | 2923159072 | |||
| 1947 | 2923522923 | |||
| 1948 | 2923591027 | |||
| 1949 | 2926067484 | |||
| 1950 | 2929149450 | |||
| 1951 | 2929194696 | |||
| 1952 | 2931373138 | |||
| 1953 | 2931395973 | |||
| 1954 | 2931397606 | |||
| 1955 | 2935359668 | |||
| 1956 | 2939641870 | |||
| 1957 | 2939654653 | |||
| 1958 | 2945931359 | |||
| 1959 | 2945966324 | |||
| 1960 | 2946007410 | |||
| 1961 | 2946033189 | |||
| 1962 | 2947233959 | |||
| 1963 | 2969309694 | |||
| 1964 | 2974294574 | |||
| 1965 | 2974298910 | |||
| 1966 | 2984287098 | |||
| 1967 | 2984501216 | |||
| 1968 | 2984505327 | |||
| 1969 | 2988730991 | |||
| 1970 | 2990198158 | |||
| 1971 | 2998144939 | |||
| 1972 | 3007254128 | |||
| 1973 | 3007317134 | |||
| 1974 | 3007398697 | |||
| 1975 | 3007420303 | |||
| 1976 | 3007516729 | |||
| 1977 | 3007614644 | |||
| 1978 | 3007621157 | |||
| 1979 | 3007721359 | |||
| 1980 | 3007803619 | |||
| 1981 | 3007860142 | |||
| 1982 | 3007866396 | |||
| 1983 | 3007867230 | |||
| 1984 | 3007873601 | |||
| 1985 | 637322784 | |||
| 1986 | 640489720 | |||
| 1987 | 651177733 | |||
| 1988 | 8011355908 | |||
| 1989 | 8015693149 | |||
| 1990 | 8016732778 | |||
| 1991 | 8019771288 | |||
| 1992 | 8019780417 | |||
| 1993 | 8029995959 | |||
| 1994 | 8034966973 | |||
| 1995 | 8052495231 | |||
| 1996 | 8054289461 | |||
| 1997 | 8054352975 | |||
| 1998 | 8054508477 | |||
| 1999 | 8054933614 | |||
| 2000 | 8055776398 | |||
| 2001 | 8055823433 | |||
| 2002 | 8055882295 | |||
| 2003 | 8056115695 | |||
| 2004 | 8056121355 | |||
| 2005 | 8056131156 | |||
| 2006 | 8056136876 | |||
| 2007 | 8056138070 | |||
| 2008 | 8056148272 | |||
| 2009 | 8056150188 | |||
| 2010 | 8056156350 | |||
| 2011 | 8056163147 | |||
| 2012 | 8056171627 | |||
| 2013 | 8056172304 | |||
| 2014 | 8056179232 | |||
| 2015 | 8056571987 | |||
| 2016 | 8057805242 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6i05-assembly1.cif.gz_A | crystal structure of rlpa spor domain from pseudomonas aeruginosa | 0.9915 | 257 | 331 |
| 4avr-assembly1.cif.gz_B | crystal structure of the hypothetical protein pa4485 from pseudomonas aeruginosa | 0.972 | 100 | 192 |
| 6i05-assembly1.cif.gz_A | crystal structure of rlpa spor domain from pseudomonas aeruginosa | 0.966 | 257 | 331 |
| 4avr-assembly1.cif.gz_B | crystal structure of the hypothetical protein pa4485 from pseudomonas aeruginosa | 0.952 | 100 | 192 |
| 5ntb-assembly2.cif.gz_B | streptomyces papain inhibitor (spi) | 0.773 | 94 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4avrB00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases;RlpA-like domain | 0.9619 | 100 | 193 | 2.40.40.10 |
| 4avrB00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases;RlpA-like domain | 0.9423 | 100 | 193 | 2.40.40.10 |
| af_P10100_78_169_2.40.40.10 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases;RlpA-like domain | 0.916 | 100 | 192 | 2.40.40.10 |
| af_P10100_78_169_2.40.40.10 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases;RlpA-like domain | 0.897 | 100 | 192 | 2.40.40.10 |
| af_A0A0R0HU31_5_119_2.40.40.10 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases;RlpA-like domain | 0.8468 | 138 | 193 | 2.40.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5P0Q1B6-F1-model_v4 | deleted | 0.9916 | 97 | 193 |
|
| AF-A0A382Y0S1-F1-model_v4 | RlpA-like protein double-psi beta-barrel domain-containing protein | 0.9859 | 100 | 193 |
GO:0016829
GO:0071555 |
| AF-A0A2E4BZ23-F1-model_v4 | Probable endolytic peptidoglycan transglycosylase RlpA (EC 4.2.2.-) | 0.9854 | 92 | 194 |
GO:0000270
GO:0008932 GO:0009279 GO:0071555 |
| AF-B6WXT8-F1-model_v4 | Probable endolytic peptidoglycan transglycosylase RlpA (EC 4.2.2.-) | 0.9844 | 99 | 193 |
GO:0000270
GO:0008932 GO:0071555 |
| AF-A0A3M1BK31-F1-model_v4 | Probable endolytic peptidoglycan transglycosylase RlpA (EC 4.2.2.-) | 0.9835 | 99 | 193 |
GO:0000270
GO:0008932 GO:0071555 |