F488079
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1008 | 423 | 2016 | 426 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_32609_c1|nmdc:mga05p37_32609_c1_4980_6212 |
| Length | 410 |
| Sequence | VLFASLIGTTIEFFDFYIYATAAVLVFPRLFFPASDPASATLASLATFAIAFVARPIGSALFGHFGDRIGRKTTLVAALLTMGLSTVTIGLLPTYATIGLAAPLLLAICRFGQGLGLGGEWGGAVLLAVENAPPDRRAWYGMFPQLGAPLGFIFSGSTFLALSAWLTNEQFFAFGWRLPFLASSALVIVGLYVRLTITETPVFRELEKRERVGVPMFVVFTRHTRALLLGVLVSLTAFVIFYLMTVFALSWGTSALGYSRERFLIIQLFGILFFALFIPIAAILAEHGRRRMLMWVNVAIGVFGAVLAPLFTSGTFGATAMMVLGMSLVGLVYGPLGTLLSETFPTAVRYSGSSLTFNLAGIFGASLAPYAATYLAKTYGLQYVGYYLSVAAVLSLAGLAGSRETKDARL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 207 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 208 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 209 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 226 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 227 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 228 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 248 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 249 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 250 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 253 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 254 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 257 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 258 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 338 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 339 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 340 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 345 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 346 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 347 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 348 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 349 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 350 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 351 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 352 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 353 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 355 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 381 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 396 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 397 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 400 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 403 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 404 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 405 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 407 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 408 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 409 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 410 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 411 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 412 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 413 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 414 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 415 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 416 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 417 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 418 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 419 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 420 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 421 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 422 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 423 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.31 |
| Metatranscriptomes | 0 |
| Isolates | 1.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.28 |
| Nodule | 0 |
| Rhizoplane | 2.18 |
| Rhizosphere | 91.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga05p37_32609_c1 | 3300050507 | Bacteria | 6371 |
| 2 | JGI24746J21847_1001222 | 3300001977 | Bacteria | 4081 |
| 3 | JGI25151J46595_10001398 | 3300003187 | Bacteria | 16595 |
| 4 | JGI25406J46586_10000121 | 3300003203 | Bacteria | 34339 |
| 5 | rootH2_10009426 | 3300003320 | Bacteria | 39179 |
| 6 | Ga0055526_1000129 | 3300003771 | Bacteria | 67279 |
| 7 | Ga0055543_1002002 | 3300004625 | Bacteria | 7240 |
| 8 | Ga0065165_1000050 | 3300005262 | Bacteria | 195237 |
| 9 | Ga0065712_10010331 | 3300005290 | Bacteria | 2807 |
| 10 | Ga0065712_10017262 | 3300005290 | Bacteria | 2746 |
| 11 | Ga0065712_10079412 | 3300005290 | Bacteria | 3221 |
| 12 | Ga0065712_10081025 | 3300005290 | Bacteria | 3047 |
| 13 | Ga0065715_10003555 | 3300005293 | Bacteria | 4701 |
| 14 | Ga0065715_10003862 | 3300005293 | Bacteria | 5072 |
| 15 | Ga0065715_10103465 | 3300005293 | Bacteria | 3024 |
| 16 | Ga0065715_10117896 | 3300005293 | Bacteria | 2304 |
| 17 | Ga0065715_10191947 | 3300005293 | Bacteria | 1410 |
| 18 | Ga0065707_10004066 | 3300005295 | Bacteria | 4343 |
| 19 | Ga0065707_10107365 | 3300005295 | Bacteria | 2557 |
| 20 | Ga0070658_10001036 | 3300005327 | Bacteria | 23775 |
| 21 | Ga0070658_10029586 | 3300005327 | Bacteria | 4401 |
| 22 | Ga0070658_10092672 | 3300005327 | Bacteria | 2491 |
| 23 | Ga0070658_10130569 | 3300005327 | Bacteria | 2093 |
| 24 | Ga0070658_10147021 | 3300005327 | Bacteria | 1971 |
| 25 | Ga0070676_10024926 | 3300005328 | Bacteria | 3375 |
| 26 | Ga0070676_10028465 | 3300005328 | Bacteria | 3174 |
| 27 | Ga0070676_10057556 | 3300005328 | Bacteria | 2301 |
| 28 | Ga0070683_100020144 | 3300005329 | Bacteria | 5934 |
| 29 | Ga0070683_100048338 | 3300005329 | Bacteria | 3933 |
| 30 | Ga0070683_100111233 | 3300005329 | Bacteria | 2584 |
| 31 | Ga0070683_100189029 | 3300005329 | Bacteria | 1955 |
| 32 | Ga0070690_100003577 | 3300005330 | Bacteria | 8534 |
| 33 | Ga0070690_100025518 | 3300005330 | Bacteria | 3640 |
| 34 | Ga0070690_100029732 | 3300005330 | Bacteria | 3391 |
| 35 | Ga0070690_100059519 | 3300005330 | Bacteria | 2456 |
| 36 | Ga0070670_100001059 | 3300005331 | Bacteria | 21806 |
| 37 | Ga0070670_100014434 | 3300005331 | Bacteria | 6780 |
| 38 | Ga0070670_100028275 | 3300005331 | Bacteria | 4825 |
| 39 | Ga0070670_100053077 | 3300005331 | Bacteria | 3481 |
| 40 | Ga0070670_100109514 | 3300005331 | Bacteria | 2380 |
| 41 | Ga0070677_10000820 | 3300005333 | Bacteria | 10264 |
| 42 | Ga0068869_100012848 | 3300005334 | Bacteria | 5543 |
| 43 | Ga0068869_100172785 | 3300005334 | Bacteria | 1689 |
| 44 | Ga0070666_10000001 | 3300005335 | Bacteria | 543080 |
| 45 | Ga0070666_10021458 | 3300005335 | Bacteria | 4187 |
| 46 | Ga0070680_100030360 | 3300005336 | Bacteria | 4342 |
| 47 | Ga0070680_100060072 | 3300005336 | Bacteria | 3111 |
| 48 | Ga0070680_100087677 | 3300005336 | Bacteria | 2574 |
| 49 | Ga0070682_100069908 | 3300005337 | Bacteria | 2243 |
| 50 | Ga0068868_100010518 | 3300005338 | Bacteria | 6706 |
| 51 | Ga0068868_100010978 | 3300005338 | Bacteria | 6580 |
| 52 | Ga0070660_100003334 | 3300005339 | Bacteria | 11036 |
| 53 | Ga0070660_100070552 | 3300005339 | Bacteria | 2727 |
| 54 | Ga0070660_100082316 | 3300005339 | Bacteria | 2527 |
| 55 | Ga0070689_100010769 | 3300005340 | Bacteria | 6531 |
| 56 | Ga0070689_100021262 | 3300005340 | Bacteria | 4827 |
| 57 | Ga0070689_100077606 | 3300005340 | Bacteria | 2603 |
| 58 | Ga0070687_100010132 | 3300005343 | Bacteria | 4061 |
| 59 | Ga0070687_100044317 | 3300005343 | Bacteria | 2266 |
| 60 | Ga0070687_100078109 | 3300005343 | Bacteria | 1798 |
| 61 | Ga0070661_100008933 | 3300005344 | Bacteria | 6935 |
| 62 | Ga0070692_10046861 | 3300005345 | Bacteria | 2236 |
| 63 | Ga0070668_100001298 | 3300005347 | Bacteria | 17865 |
| 64 | Ga0070668_100021672 | 3300005347 | Bacteria | 4855 |
| 65 | Ga0070668_100028229 | 3300005347 | Bacteria | 4261 |
| 66 | Ga0070669_100003163 | 3300005353 | Bacteria | 11836 |
| 67 | Ga0070669_100006451 | 3300005353 | Bacteria | 8448 |
| 68 | Ga0070669_100037619 | 3300005353 | Bacteria | 3511 |
| 69 | Ga0070669_100088013 | 3300005353 | Bacteria | 2324 |
| 70 | Ga0070669_100100234 | 3300005353 | Bacteria | 2183 |
| 71 | Ga0070669_100144810 | 3300005353 | Bacteria | 1835 |
| 72 | Ga0070675_100020276 | 3300005354 | Bacteria | 5304 |
| 73 | Ga0070675_100032864 | 3300005354 | Bacteria | 4201 |
| 74 | Ga0070675_100123824 | 3300005354 | Bacteria | 2199 |
| 75 | Ga0070675_100157319 | 3300005354 | Bacteria | 1952 |
| 76 | Ga0070675_100160155 | 3300005354 | Bacteria | 1935 |
| 77 | Ga0070671_100013621 | 3300005355 | Bacteria | 6558 |
| 78 | Ga0070671_100047619 | 3300005355 | Bacteria | 3564 |
| 79 | Ga0070671_100056437 | 3300005355 | Bacteria | 3267 |
| 80 | Ga0070671_100098006 | 3300005355 | Bacteria | 2459 |
| 81 | Ga0070671_100103816 | 3300005355 | Bacteria | 2385 |
| 82 | Ga0070674_100000143 | 3300005356 | Bacteria | 33118 |
| 83 | Ga0070674_100079753 | 3300005356 | Bacteria | 2336 |
| 84 | Ga0070673_100008923 | 3300005364 | Bacteria | 6704 |
| 85 | Ga0070673_100018740 | 3300005364 | Bacteria | 4955 |
| 86 | Ga0070688_100006661 | 3300005365 | Bacteria | 6189 |
| 87 | Ga0070688_100009731 | 3300005365 | Bacteria | 5276 |
| 88 | Ga0070688_100064968 | 3300005365 | Bacteria | 2317 |
| 89 | Ga0070688_100065073 | 3300005365 | Bacteria | 2316 |
| 90 | Ga0070688_100174115 | 3300005365 | Bacteria | 1488 |
| 91 | Ga0070659_100018847 | 3300005366 | Bacteria | 5212 |
| 92 | Ga0070659_100111308 | 3300005366 | Bacteria | 2210 |
| 93 | Ga0070667_100014750 | 3300005367 | Bacteria | 6456 |
| 94 | Ga0070667_100043256 | 3300005367 | Bacteria | 3780 |
| 95 | Ga0070667_100155064 | 3300005367 | Bacteria | 2014 |
| 96 | Ga0070709_10130612 | 3300005434 | Bacteria | 1714 |
| 97 | Ga0070714_100020018 | 3300005435 | Bacteria | 5459 |
| 98 | Ga0070713_100004822 | 3300005436 | Bacteria | 9133 |
| 99 | Ga0070713_100020467 | 3300005436 | Bacteria | 5073 |
| 100 | Ga0070713_100084811 | 3300005436 | Bacteria | 2711 |
| 101 | Ga0070713_100294125 | 3300005436 | Bacteria | 1493 |
| 102 | Ga0070701_10010680 | 3300005438 | Bacteria | 4074 |
| 103 | Ga0070701_10089578 | 3300005438 | Bacteria | 1683 |
| 104 | Ga0070711_100078109 | 3300005439 | Bacteria | 2351 |
| 105 | Ga0070711_100163771 | 3300005439 | Bacteria | 1688 |
| 106 | Ga0070705_100000704 | 3300005440 | Bacteria | 19055 |
| 107 | Ga0070700_100032916 | 3300005441 | Bacteria | 3120 |
| 108 | Ga0070700_100073305 | 3300005441 | Bacteria | 2191 |
| 109 | Ga0070694_100001822 | 3300005444 | Bacteria | 12620 |
| 110 | Ga0070694_100069089 | 3300005444 | Bacteria | 2429 |
| 111 | Ga0070694_100202982 | 3300005444 | Bacteria | 1479 |
| 112 | Ga0070663_100010132 | 3300005455 | Bacteria | 5864 |
| 113 | Ga0070663_100061648 | 3300005455 | Bacteria | 2701 |
| 114 | Ga0070678_100036289 | 3300005456 | Bacteria | 3449 |
| 115 | Ga0070678_100196453 | 3300005456 | Bacteria | 1662 |
| 116 | Ga0070662_100106995 | 3300005457 | Bacteria | 2125 |
| 117 | Ga0070681_10007479 | 3300005458 | Bacteria | 10674 |
| 118 | Ga0070681_10015033 | 3300005458 | Bacteria | 7699 |
| 119 | Ga0070681_10015833 | 3300005458 | Bacteria | 7517 |
| 120 | Ga0070681_10060643 | 3300005458 | Bacteria | 3758 |
| 121 | Ga0070681_10127067 | 3300005458 | Bacteria | 2482 |
| 122 | Ga0068867_100001114 | 3300005459 | Bacteria | 18390 |
| 123 | Ga0068867_100047855 | 3300005459 | Bacteria | 3145 |
| 124 | Ga0068867_100050118 | 3300005459 | Bacteria | 3076 |
| 125 | Ga0068867_100252119 | 3300005459 | Bacteria | 1436 |
| 126 | Ga0070706_100124640 | 3300005467 | Bacteria | 2402 |
| 127 | Ga0070707_100062214 | 3300005468 | Bacteria | 3581 |
| 128 | Ga0070707_100096914 | 3300005468 | Bacteria | 2857 |
| 129 | Ga0070707_100225237 | 3300005468 | Bacteria | 1826 |
| 130 | Ga0070698_100003696 | 3300005471 | Bacteria | 16787 |
| 131 | Ga0070698_100005828 | 3300005471 | Bacteria | 13475 |
| 132 | Ga0070699_100000457 | 3300005518 | Bacteria | 39196 |
| 133 | Ga0070699_100004350 | 3300005518 | Bacteria | 12521 |
| 134 | Ga0070699_100031962 | 3300005518 | Bacteria | 4545 |
| 135 | Ga0070699_100052047 | 3300005518 | Bacteria | 3545 |
| 136 | Ga0070699_100080647 | 3300005518 | Bacteria | 2836 |
| 137 | Ga0070699_100086996 | 3300005518 | Bacteria | 2728 |
| 138 | Ga0070679_100001692 | 3300005530 | Bacteria | 19871 |
| 139 | Ga0070679_100018177 | 3300005530 | Bacteria | 6817 |
| 140 | Ga0070679_100025310 | 3300005530 | Bacteria | 5822 |
| 141 | Ga0070679_100056750 | 3300005530 | Bacteria | 3902 |
| 142 | Ga0070679_100074035 | 3300005530 | Bacteria | 3396 |
| 143 | Ga0070684_100040400 | 3300005535 | Bacteria | 4016 |
| 144 | Ga0068853_100112795 | 3300005539 | Bacteria | 2416 |
| 145 | Ga0068853_100123923 | 3300005539 | Bacteria | 2307 |
| 146 | Ga0068853_100167980 | 3300005539 | Bacteria | 1984 |
| 147 | Ga0070672_100009546 | 3300005543 | Bacteria | 6695 |
| 148 | Ga0070672_100027138 | 3300005543 | Bacteria | 4269 |
| 149 | Ga0070686_100000861 | 3300005544 | Bacteria | 17630 |
| 150 | Ga0070686_100004648 | 3300005544 | Bacteria | 7572 |
| 151 | Ga0070686_100029381 | 3300005544 | Bacteria | 3344 |
| 152 | Ga0070695_100000064 | 3300005545 | Bacteria | 42035 |
| 153 | Ga0070696_100001482 | 3300005546 | Bacteria | 15366 |
| 154 | Ga0070696_100001985 | 3300005546 | Bacteria | 13438 |
| 155 | Ga0070696_100029109 | 3300005546 | Bacteria | 3771 |
| 156 | Ga0070665_100007298 | 3300005548 | Bacteria | 11244 |
| 157 | Ga0070665_100010641 | 3300005548 | Bacteria | 9312 |
| 158 | Ga0070665_100017890 | 3300005548 | Bacteria | 7116 |
| 159 | Ga0070665_100018594 | 3300005548 | Bacteria | 6964 |
| 160 | Ga0070665_100028274 | 3300005548 | Bacteria | 5647 |
| 161 | Ga0070665_100083335 | 3300005548 | Bacteria | 3202 |
| 162 | Ga0070704_100007103 | 3300005549 | Bacteria | 6650 |
| 163 | Ga0070704_100009708 | 3300005549 | Bacteria | 5833 |
| 164 | Ga0070704_100045496 | 3300005549 | Bacteria | 3054 |
| 165 | Ga0070704_100079102 | 3300005549 | Bacteria | 2414 |
| 166 | Ga0070704_100192356 | 3300005549 | Bacteria | 1641 |
| 167 | Ga0068855_100002900 | 3300005563 | Bacteria | 20979 |
| 168 | Ga0068855_100019059 | 3300005563 | Bacteria | 8249 |
| 169 | Ga0068855_100040460 | 3300005563 | Bacteria | 5533 |
| 170 | Ga0068855_100043264 | 3300005563 | Bacteria | 5336 |
| 171 | Ga0068855_100051520 | 3300005563 | Bacteria | 4849 |
| 172 | Ga0068855_100091291 | 3300005563 | Bacteria | 3513 |
| 173 | Ga0068855_100280079 | 3300005563 | Bacteria | 1852 |
| 174 | Ga0070664_100041917 | 3300005564 | Bacteria | 3864 |
| 175 | Ga0070664_100188441 | 3300005564 | Bacteria | 1837 |
| 176 | Ga0070664_100192393 | 3300005564 | Bacteria | 1818 |
| 177 | Ga0068857_100002823 | 3300005577 | Bacteria | 14284 |
| 178 | Ga0068857_100012106 | 3300005577 | Bacteria | 7501 |
| 179 | Ga0068857_100059226 | 3300005577 | Bacteria | 3402 |
| 180 | Ga0068857_100099783 | 3300005577 | Bacteria | 2605 |
| 181 | Ga0068857_100197332 | 3300005577 | Bacteria | 1834 |
| 182 | Ga0068854_100007890 | 3300005578 | Bacteria | 6812 |
| 183 | Ga0068854_100068824 | 3300005578 | Bacteria | 2582 |
| 184 | Ga0068854_100118231 | 3300005578 | Bacteria | 2008 |
| 185 | Ga0068856_100001937 | 3300005614 | Bacteria | 21587 |
| 186 | Ga0068856_100062334 | 3300005614 | Bacteria | 3683 |
| 187 | Ga0068856_100063710 | 3300005614 | Bacteria | 3642 |
| 188 | Ga0070702_100005745 | 3300005615 | Bacteria | 5811 |
| 189 | Ga0068852_100000040 | 3300005616 | Bacteria | 93349 |
| 190 | Ga0068852_100014922 | 3300005616 | Bacteria | 6004 |
| 191 | Ga0068852_100062682 | 3300005616 | Bacteria | 3235 |
| 192 | Ga0068852_100183564 | 3300005616 | Bacteria | 1969 |
| 193 | Ga0068859_100000180 | 3300005617 | Bacteria | 61976 |
| 194 | Ga0068859_100007306 | 3300005617 | Bacteria | 11205 |
| 195 | Ga0068859_100018472 | 3300005617 | Bacteria | 7008 |
| 196 | Ga0068859_100018712 | 3300005617 | Bacteria | 6960 |
| 197 | Ga0068859_100025109 | 3300005617 | Bacteria | 5980 |
| 198 | Ga0068859_100035592 | 3300005617 | Bacteria | 4995 |
| 199 | Ga0068859_100085901 | 3300005617 | Bacteria | 3192 |
| 200 | Ga0068859_100403060 | 3300005617 | Bacteria | 1464 |
| 201 | Ga0068864_100004327 | 3300005618 | Bacteria | 11669 |
| 202 | Ga0068864_100023737 | 3300005618 | Bacteria | 5153 |
| 203 | Ga0068864_100030559 | 3300005618 | Bacteria | 4567 |
| 204 | Ga0068864_100036523 | 3300005618 | Bacteria | 4188 |
| 205 | Ga0068864_100048708 | 3300005618 | Bacteria | 3644 |
| 206 | Ga0068864_100063908 | 3300005618 | Bacteria | 3190 |
| 207 | Ga0068864_100102508 | 3300005618 | Bacteria | 2540 |
| 208 | Ga0068861_100001421 | 3300005719 | Bacteria | 15089 |
| 209 | Ga0068861_100012591 | 3300005719 | Bacteria | 5901 |
| 210 | Ga0068870_10000779 | 3300005840 | Bacteria | 12308 |
| 211 | Ga0068870_10011176 | 3300005840 | Bacteria | 4153 |
| 212 | Ga0068863_100005988 | 3300005841 | Bacteria | 11926 |
| 213 | Ga0068863_100207061 | 3300005841 | Bacteria | 1888 |
| 214 | Ga0068858_100001977 | 3300005842 | Bacteria | 20940 |
| 215 | Ga0068858_100003784 | 3300005842 | Bacteria | 14958 |
| 216 | Ga0068858_100012713 | 3300005842 | Bacteria | 7932 |
| 217 | Ga0068858_100180883 | 3300005842 | Bacteria | 1991 |
| 218 | Ga0068858_100206453 | 3300005842 | Bacteria | 1859 |
| 219 | Ga0068860_100004193 | 3300005843 | Bacteria | 14775 |
| 220 | Ga0068860_100010622 | 3300005843 | Bacteria | 9091 |
| 221 | Ga0068860_100019864 | 3300005843 | Bacteria | 6516 |
| 222 | Ga0068860_100286226 | 3300005843 | Bacteria | 1612 |
| 223 | Ga0068862_100001270 | 3300005844 | Bacteria | 23717 |
| 224 | Ga0068862_100025123 | 3300005844 | Bacteria | 5001 |
| 225 | Ga0068862_100129011 | 3300005844 | Bacteria | 2235 |
| 226 | Ga0081539_10001107 | 3300005985 | Bacteria | 48837 |
| 227 | Ga0081539_10006892 | 3300005985 | Bacteria | 10599 |
| 228 | Ga0070717_10037836 | 3300006028 | Bacteria | 3919 |
| 229 | Ga0075365_10006974 | 3300006038 | Bacteria | 6280 |
| 230 | Ga0070716_100050096 | 3300006173 | Bacteria | 2369 |
| 231 | Ga0097621_100002357 | 3300006237 | Bacteria | 12949 |
| 232 | Ga0097621_100013642 | 3300006237 | Bacteria | 6065 |
| 233 | Ga0097621_100024363 | 3300006237 | Bacteria | 4725 |
| 234 | Ga0068871_100010807 | 3300006358 | Bacteria | 6680 |
| 235 | Ga0068871_100094222 | 3300006358 | Bacteria | 2499 |
| 236 | Ga0068871_100169672 | 3300006358 | Bacteria | 1870 |
| 237 | Ga0075428_100002102 | 3300006844 | Bacteria | 21471 |
| 238 | Ga0075428_100019109 | 3300006844 | Bacteria | 7578 |
| 239 | Ga0075428_100021511 | 3300006844 | Bacteria | 7139 |
| 240 | Ga0075428_100040680 | 3300006844 | Bacteria | 5112 |
| 241 | Ga0075428_100045963 | 3300006844 | Bacteria | 4796 |
| 242 | Ga0075428_100105542 | 3300006844 | Bacteria | 3072 |
| 243 | Ga0075428_100304413 | 3300006844 | Bacteria | 1714 |
| 244 | Ga0075430_100003042 | 3300006846 | Bacteria | 14021 |
| 245 | Ga0075430_100007983 | 3300006846 | Bacteria | 8944 |
| 246 | Ga0075430_100013989 | 3300006846 | Bacteria | 6840 |
| 247 | Ga0075430_100016386 | 3300006846 | Bacteria | 6311 |
| 248 | Ga0075430_100064038 | 3300006846 | Bacteria | 3088 |
| 249 | Ga0075430_100082061 | 3300006846 | Bacteria | 2701 |
| 250 | Ga0075431_100014150 | 3300006847 | Bacteria | 8067 |
| 251 | Ga0075431_100014321 | 3300006847 | Bacteria | 8020 |
| 252 | Ga0075431_100034366 | 3300006847 | Bacteria | 5222 |
| 253 | Ga0075431_100192238 | 3300006847 | Bacteria | 2091 |
| 254 | Ga0075431_100235399 | 3300006847 | Bacteria | 1865 |
| 255 | Ga0075433_10001136 | 3300006852 | Bacteria | 19276 |
| 256 | Ga0075433_10021456 | 3300006852 | Bacteria | 5416 |
| 257 | Ga0075433_10031464 | 3300006852 | Bacteria | 4536 |
| 258 | Ga0075433_10042560 | 3300006852 | Bacteria | 3941 |
| 259 | Ga0075434_100010027 | 3300006871 | Bacteria | 8868 |
| 260 | Ga0075434_100011440 | 3300006871 | Bacteria | 8373 |
| 261 | Ga0075434_100031731 | 3300006871 | Bacteria | 5209 |
| 262 | Ga0075434_100046360 | 3300006871 | Bacteria | 4314 |
| 263 | Ga0075434_100056464 | 3300006871 | Bacteria | 3901 |
| 264 | Ga0075434_100154827 | 3300006871 | Bacteria | 2312 |
| 265 | Ga0075434_100226310 | 3300006871 | Bacteria | 1890 |
| 266 | Ga0075429_100002201 | 3300006880 | Bacteria | 16306 |
| 267 | Ga0075429_100011476 | 3300006880 | Bacteria | 7681 |
| 268 | Ga0075429_100015558 | 3300006880 | Bacteria | 6591 |
| 269 | Ga0075429_100064196 | 3300006880 | Bacteria | 3198 |
| 270 | Ga0075429_100072751 | 3300006880 | Bacteria | 2994 |
| 271 | Ga0075429_100091410 | 3300006880 | Bacteria | 2655 |
| 272 | Ga0075429_100103714 | 3300006880 | Bacteria | 2484 |
| 273 | Ga0068865_100014820 | 3300006881 | Bacteria | 4960 |
| 274 | Ga0068865_100154819 | 3300006881 | Bacteria | 1742 |
| 275 | Ga0068865_100197892 | 3300006881 | Bacteria | 1558 |
| 276 | Ga0075436_100088389 | 3300006914 | Bacteria | 2152 |
| 277 | Ga0097620_100000180 | 3300006931 | Bacteria | 61976 |
| 278 | Ga0097620_100007306 | 3300006931 | Bacteria | 11205 |
| 279 | Ga0097620_100018472 | 3300006931 | Bacteria | 7008 |
| 280 | Ga0097620_100018711 | 3300006931 | Bacteria | 6960 |
| 281 | Ga0097620_100025112 | 3300006931 | Bacteria | 5980 |
| 282 | Ga0097620_100035592 | 3300006931 | Bacteria | 4995 |
| 283 | Ga0097620_100085903 | 3300006931 | Bacteria | 3192 |
| 284 | Ga0097620_100403022 | 3300006931 | Bacteria | 1464 |
| 285 | Ga0075435_100001202 | 3300007076 | Bacteria | 16556 |
| 286 | Ga0075435_100002251 | 3300007076 | Bacteria | 12739 |
| 287 | Ga0075435_100006158 | 3300007076 | Bacteria | 8456 |
| 288 | Ga0075435_100006182 | 3300007076 | Bacteria | 8448 |
| 289 | Ga0075435_100155273 | 3300007076 | Bacteria | 1925 |
| 290 | Ga0105244_10000678 | 3300009036 | Bacteria | 29866 |
| 291 | Ga0105240_10000312 | 3300009093 | Bacteria | 93459 |
| 292 | Ga0105240_10002273 | 3300009093 | Bacteria | 31176 |
| 293 | Ga0105240_10007947 | 3300009093 | Bacteria | 15307 |
| 294 | Ga0105240_10011435 | 3300009093 | Bacteria | 12363 |
| 295 | Ga0105240_10012892 | 3300009093 | Bacteria | 11512 |
| 296 | Ga0105240_10055314 | 3300009093 | Bacteria | 4968 |
| 297 | Ga0105240_10057743 | 3300009093 | Bacteria | 4846 |
| 298 | Ga0105240_10081877 | 3300009093 | Bacteria | 3965 |
| 299 | Ga0105240_10160641 | 3300009093 | Bacteria | 2669 |
| 300 | Ga0105240_10165845 | 3300009093 | Bacteria | 2620 |
| 301 | Ga0111539_10000159 | 3300009094 | Bacteria | 76817 |
| 302 | Ga0111539_10003690 | 3300009094 | Bacteria | 20148 |
| 303 | Ga0111539_10006988 | 3300009094 | Bacteria | 14477 |
| 304 | Ga0111539_10033767 | 3300009094 | Bacteria | 6209 |
| 305 | Ga0111539_10052188 | 3300009094 | Bacteria | 4868 |
| 306 | Ga0111539_10060760 | 3300009094 | Bacteria | 4478 |
| 307 | Ga0111539_10063215 | 3300009094 | Bacteria | 4380 |
| 308 | Ga0111539_10122390 | 3300009094 | Bacteria | 3049 |
| 309 | Ga0111539_10159861 | 3300009094 | Bacteria | 2635 |
| 310 | Ga0111539_10179701 | 3300009094 | Bacteria | 2472 |
| 311 | Ga0111539_10381031 | 3300009094 | Bacteria | 1642 |
| 312 | Ga0105245_10020420 | 3300009098 | Bacteria | 5809 |
| 313 | Ga0105245_10047116 | 3300009098 | Bacteria | 3853 |
| 314 | Ga0105245_10123276 | 3300009098 | Bacteria | 2423 |
| 315 | Ga0105247_10034018 | 3300009101 | Bacteria | 3103 |
| 316 | Ga0105247_10068043 | 3300009101 | Bacteria | 2220 |
| 317 | Ga0105247_10098441 | 3300009101 | Bacteria | 1867 |
| 318 | Ga0114129_10001780 | 3300009147 | Bacteria | 29349 |
| 319 | Ga0114129_10005772 | 3300009147 | Bacteria | 17530 |
| 320 | Ga0114129_10008257 | 3300009147 | Bacteria | 14850 |
| 321 | Ga0114129_10008325 | 3300009147 | Bacteria | 14795 |
| 322 | Ga0114129_10014579 | 3300009147 | Bacteria | 11198 |
| 323 | Ga0114129_10023777 | 3300009147 | Bacteria | 8685 |
| 324 | Ga0114129_10030346 | 3300009147 | Bacteria | 7650 |
| 325 | Ga0114129_10050086 | 3300009147 | Bacteria | 5868 |
| 326 | Ga0114129_10050645 | 3300009147 | Bacteria | 5833 |
| 327 | Ga0114129_10198603 | 3300009147 | Bacteria | 2718 |
| 328 | Ga0114129_10266906 | 3300009147 | Bacteria | 2291 |
| 329 | Ga0114129_10506431 | 3300009147 | Bacteria | 1576 |
| 330 | Ga0105243_10019766 | 3300009148 | Bacteria | 5106 |
| 331 | Ga0105243_10058213 | 3300009148 | Bacteria | 3079 |
| 332 | Ga0105241_10011936 | 3300009174 | Bacteria | 6381 |
| 333 | Ga0105241_10016182 | 3300009174 | Bacteria | 5465 |
| 334 | Ga0105241_10050221 | 3300009174 | Bacteria | 3178 |
| 335 | Ga0105242_10008024 | 3300009176 | Bacteria | 8131 |
| 336 | Ga0105248_10000166 | 3300009177 | Bacteria | 77193 |
| 337 | Ga0105248_10002222 | 3300009177 | Bacteria | 21451 |
| 338 | Ga0105248_10029280 | 3300009177 | Bacteria | 6143 |
| 339 | Ga0105248_10050029 | 3300009177 | Bacteria | 4687 |
| 340 | Ga0105248_10065374 | 3300009177 | Bacteria | 4084 |
| 341 | Ga0105248_10075185 | 3300009177 | Bacteria | 3797 |
| 342 | Ga0105237_10051840 | 3300009545 | Bacteria | 4121 |
| 343 | Ga0105238_10000680 | 3300009551 | Bacteria | 35775 |
| 344 | Ga0105238_10004104 | 3300009551 | Bacteria | 14450 |
| 345 | Ga0105238_10018121 | 3300009551 | Bacteria | 7160 |
| 346 | Ga0105238_10024567 | 3300009551 | Bacteria | 6142 |
| 347 | Ga0105238_10088927 | 3300009551 | Bacteria | 3075 |
| 348 | Ga0105249_10000858 | 3300009553 | Bacteria | 27086 |
| 349 | Ga0105249_10008306 | 3300009553 | Bacteria | 9039 |
| 350 | Ga0105249_10182376 | 3300009553 | Bacteria | 2043 |
| 351 | Ga0105239_10007060 | 3300010375 | Bacteria | 12928 |
| 352 | Ga0105246_10027790 | 3300011119 | Bacteria | 3711 |
| 353 | Ga0157371_10057680 | 3300013102 | Bacteria | 2754 |
| 354 | Ga0157371_10099718 | 3300013102 | Bacteria | 2059 |
| 355 | Ga0157370_10000164 | 3300013104 | Bacteria | 81413 |
| 356 | Ga0157370_10015684 | 3300013104 | Bacteria | 7696 |
| 357 | Ga0157370_10019444 | 3300013104 | Bacteria | 6813 |
| 358 | Ga0157370_10028865 | 3300013104 | Bacteria | 5454 |
| 359 | Ga0157370_10050928 | 3300013104 | Bacteria | 3956 |
| 360 | Ga0157370_10076906 | 3300013104 | Bacteria | 3144 |
| 361 | Ga0157369_10000021 | 3300013105 | Bacteria | 239073 |
| 362 | Ga0157369_10000209 | 3300013105 | Bacteria | 81584 |
| 363 | Ga0157369_10003493 | 3300013105 | Bacteria | 18660 |
| 364 | Ga0157369_10028132 | 3300013105 | Bacteria | 6223 |
| 365 | Ga0157369_10035469 | 3300013105 | Bacteria | 5469 |
| 366 | Ga0157369_10049410 | 3300013105 | Bacteria | 4560 |
| 367 | Ga0157369_10141542 | 3300013105 | Bacteria | 2545 |
| 368 | Ga0157369_10151363 | 3300013105 | Bacteria | 2452 |
| 369 | Ga0171462_1022 | 3300013250 | Bacteria | 141292 |
| 370 | Ga0157374_10009440 | 3300013296 | Bacteria | 8375 |
| 371 | Ga0157374_10010971 | 3300013296 | Bacteria | 7824 |
| 372 | Ga0157374_10019766 | 3300013296 | Bacteria | 5968 |
| 373 | Ga0157378_10012848 | 3300013297 | Bacteria | 7329 |
| 374 | Ga0157378_10019283 | 3300013297 | Bacteria | 5995 |
| 375 | Ga0157378_10113931 | 3300013297 | Bacteria | 2483 |
| 376 | Ga0157378_10135519 | 3300013297 | Bacteria | 2283 |
| 377 | Ga0163162_10008251 | 3300013306 | Bacteria | 10167 |
| 378 | Ga0163162_10013347 | 3300013306 | Bacteria | 8023 |
| 379 | Ga0163162_10042903 | 3300013306 | Bacteria | 4528 |
| 380 | Ga0163162_10078701 | 3300013306 | Bacteria | 3362 |
| 381 | Ga0163162_10147385 | 3300013306 | Bacteria | 2470 |
| 382 | Ga0157372_10000256 | 3300013307 | Bacteria | 58784 |
| 383 | Ga0157372_10006493 | 3300013307 | Bacteria | 12447 |
| 384 | Ga0157372_10033163 | 3300013307 | Bacteria | 5669 |
| 385 | Ga0157372_10034530 | 3300013307 | Bacteria | 5560 |
| 386 | Ga0157372_10038963 | 3300013307 | Bacteria | 5246 |
| 387 | Ga0157375_10000281 | 3300013308 | Bacteria | 46431 |
| 388 | Ga0157375_10027879 | 3300013308 | Bacteria | 5284 |
| 389 | Ga0157375_10343157 | 3300013308 | Bacteria | 1659 |
| 390 | Ga0163163_10027026 | 3300014325 | Bacteria | 5492 |
| 391 | Ga0163163_10059648 | 3300014325 | Bacteria | 3775 |
| 392 | Ga0163163_10073100 | 3300014325 | Bacteria | 3419 |
| 393 | Ga0163163_10145920 | 3300014325 | Bacteria | 2410 |
| 394 | Ga0163163_10197511 | 3300014325 | Bacteria | 2060 |
| 395 | Ga0163163_10211767 | 3300014325 | Bacteria | 1987 |
| 396 | Ga0163163_10234890 | 3300014325 | Bacteria | 1883 |
| 397 | Ga0157380_10008367 | 3300014326 | Bacteria | 7379 |
| 398 | Ga0157380_10341651 | 3300014326 | Bacteria | 1397 |
| 399 | Ga0157380_10369601 | 3300014326 | Bacteria | 1349 |
| 400 | Ga0182008_10001193 | 3300014497 | Bacteria | 17905 |
| 401 | Ga0157377_10005375 | 3300014745 | Bacteria | 6015 |
| 402 | Ga0157377_10015758 | 3300014745 | Bacteria | 3874 |
| 403 | Ga0157379_10004419 | 3300014968 | Bacteria | 12050 |
| 404 | Ga0157379_10054844 | 3300014968 | Bacteria | 3561 |
| 405 | Ga0157376_10001792 | 3300014969 | Bacteria | 14297 |
| 406 | Ga0157376_10105507 | 3300014969 | Bacteria | 2471 |
| 407 | Ga0157376_10113090 | 3300014969 | Bacteria | 2393 |
| 408 | Ga0157376_10229368 | 3300014969 | Bacteria | 1724 |
| 409 | Ga0182006_1000046 | 3300015261 | Bacteria | 189544 |
| 410 | Ga0182007_10000044 | 3300015262 | Bacteria | 106301 |
| 411 | Ga0182005_1000032 | 3300015265 | Bacteria | 188517 |
| 412 | Ga0163161_10008887 | 3300017792 | Bacteria | 6945 |
| 413 | Ga0213876_10002213 | 3300021384 | Bacteria | 11476 |
| 414 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 415 | Ga0209673_1000027 | 3300025273 | Bacteria | 360561 |
| 416 | Ga0209130_1000065 | 3300025284 | Bacteria | 195251 |
| 417 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 418 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 419 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 420 | Ga0209564_1000050 | 3300025295 | Bacteria | 360560 |
| 421 | Ga0209758_1012915 | 3300025297 | Bacteria | 4615 |
| 422 | Ga0209256_1000031 | 3300025299 | Bacteria | 410189 |
| 423 | Ga0207697_10000704 | 3300025315 | Bacteria | 19037 |
| 424 | Ga0207697_10002895 | 3300025315 | Bacteria | 8688 |
| 425 | Ga0207697_10012325 | 3300025315 | Bacteria | 3587 |
| 426 | Ga0207655_1012763 | 3300025728 | Bacteria | 4874 |
| 427 | Ga0207682_10001891 | 3300025893 | Bacteria | 9509 |
| 428 | Ga0207682_10004527 | 3300025893 | Bacteria | 5793 |
| 429 | Ga0207682_10018742 | 3300025893 | Bacteria | 2707 |
| 430 | Ga0207710_10020350 | 3300025900 | Bacteria | 2836 |
| 431 | Ga0207710_10063479 | 3300025900 | Bacteria | 1680 |
| 432 | Ga0207688_10011291 | 3300025901 | Bacteria | 4862 |
| 433 | Ga0207688_10018320 | 3300025901 | Bacteria | 3810 |
| 434 | Ga0207688_10092483 | 3300025901 | Bacteria | 1738 |
| 435 | Ga0207680_10000003 | 3300025903 | Bacteria | 925264 |
| 436 | Ga0207680_10027253 | 3300025903 | Bacteria | 3179 |
| 437 | Ga0207647_10028405 | 3300025904 | Bacteria | 3633 |
| 438 | Ga0207645_10009178 | 3300025907 | Bacteria | 6856 |
| 439 | Ga0207643_10001379 | 3300025908 | Bacteria | 13984 |
| 440 | Ga0207643_10001906 | 3300025908 | Bacteria | 11504 |
| 441 | Ga0207643_10025175 | 3300025908 | Bacteria | 3288 |
| 442 | Ga0207643_10083523 | 3300025908 | Bacteria | 1853 |
| 443 | Ga0207705_10000940 | 3300025909 | Bacteria | 23778 |
| 444 | Ga0207705_10001812 | 3300025909 | Bacteria | 16842 |
| 445 | Ga0207654_10008464 | 3300025911 | Bacteria | 5202 |
| 446 | Ga0207654_10015707 | 3300025911 | Bacteria | 3934 |
| 447 | Ga0207654_10058801 | 3300025911 | Bacteria | 2239 |
| 448 | Ga0207707_10015222 | 3300025912 | Bacteria | 6697 |
| 449 | Ga0207707_10016367 | 3300025912 | Bacteria | 6469 |
| 450 | Ga0207707_10052960 | 3300025912 | Bacteria | 3532 |
| 451 | Ga0207707_10137703 | 3300025912 | Bacteria | 2134 |
| 452 | Ga0207707_10176332 | 3300025912 | Bacteria | 1867 |
| 453 | Ga0207695_10000341 | 3300025913 | Bacteria | 109857 |
| 454 | Ga0207695_10017849 | 3300025913 | Bacteria | 8226 |
| 455 | Ga0207695_10042629 | 3300025913 | Bacteria | 4843 |
| 456 | Ga0207695_10091887 | 3300025913 | Bacteria | 3047 |
| 457 | Ga0207695_10277606 | 3300025913 | Bacteria | 1570 |
| 458 | Ga0207671_10009199 | 3300025914 | Bacteria | 8287 |
| 459 | Ga0207671_10058454 | 3300025914 | Bacteria | 2859 |
| 460 | Ga0207663_10175791 | 3300025916 | Bacteria | 1525 |
| 461 | Ga0207660_10044102 | 3300025917 | Bacteria | 3137 |
| 462 | Ga0207662_10005937 | 3300025918 | Bacteria | 6556 |
| 463 | Ga0207657_10014858 | 3300025919 | Bacteria | 7577 |
| 464 | Ga0207657_10014903 | 3300025919 | Bacteria | 7560 |
| 465 | Ga0207657_10040729 | 3300025919 | Bacteria | 4114 |
| 466 | Ga0207649_10013967 | 3300025920 | Bacteria | 4493 |
| 467 | Ga0207652_10003642 | 3300025921 | Bacteria | 12686 |
| 468 | Ga0207652_10004161 | 3300025921 | Bacteria | 11798 |
| 469 | Ga0207652_10007231 | 3300025921 | Bacteria | 8946 |
| 470 | Ga0207652_10026709 | 3300025921 | Bacteria | 4811 |
| 471 | Ga0207652_10038703 | 3300025921 | Bacteria | 4044 |
| 472 | Ga0207652_10084277 | 3300025921 | Bacteria | 2784 |
| 473 | Ga0207646_10176121 | 3300025922 | Bacteria | 1932 |
| 474 | Ga0207681_10003028 | 3300025923 | Bacteria | 10561 |
| 475 | Ga0207681_10048151 | 3300025923 | Bacteria | 2876 |
| 476 | Ga0207681_10051656 | 3300025923 | Bacteria | 2786 |
| 477 | Ga0207694_10002851 | 3300025924 | Bacteria | 13944 |
| 478 | Ga0207694_10005041 | 3300025924 | Bacteria | 10217 |
| 479 | Ga0207694_10023397 | 3300025924 | Bacteria | 4689 |
| 480 | Ga0207694_10026394 | 3300025924 | Bacteria | 4418 |
| 481 | Ga0207650_10002755 | 3300025925 | Bacteria | 12131 |
| 482 | Ga0207650_10026340 | 3300025925 | Bacteria | 4147 |
| 483 | Ga0207650_10036464 | 3300025925 | Bacteria | 3578 |
| 484 | Ga0207659_10000914 | 3300025926 | Bacteria | 17608 |
| 485 | Ga0207659_10009263 | 3300025926 | Bacteria | 6148 |
| 486 | Ga0207659_10155235 | 3300025926 | Bacteria | 1791 |
| 487 | Ga0207687_10045444 | 3300025927 | Bacteria | 3035 |
| 488 | Ga0207700_10053602 | 3300025928 | Bacteria | 3023 |
| 489 | Ga0207664_10040493 | 3300025929 | Bacteria | 3624 |
| 490 | Ga0207644_10015593 | 3300025931 | Bacteria | 5103 |
| 491 | Ga0207644_10059537 | 3300025931 | Bacteria | 2762 |
| 492 | Ga0207644_10092895 | 3300025931 | Bacteria | 2252 |
| 493 | Ga0207690_10076822 | 3300025932 | Bacteria | 2320 |
| 494 | Ga0207706_10006185 | 3300025933 | Bacteria | 11117 |
| 495 | Ga0207706_10027627 | 3300025933 | Bacteria | 5073 |
| 496 | Ga0207706_10067402 | 3300025933 | Bacteria | 3149 |
| 497 | Ga0207706_10078680 | 3300025933 | Bacteria | 2900 |
| 498 | Ga0207709_10028589 | 3300025935 | Bacteria | 3224 |
| 499 | Ga0207670_10003410 | 3300025936 | Bacteria | 8437 |
| 500 | Ga0207670_10005670 | 3300025936 | Bacteria | 6873 |
| 501 | Ga0207670_10010780 | 3300025936 | Bacteria | 5274 |
| 502 | Ga0207669_10000757 | 3300025937 | Bacteria | 13957 |
| 503 | Ga0207704_10009050 | 3300025938 | Bacteria | 4787 |
| 504 | Ga0207704_10010163 | 3300025938 | Bacteria | 4576 |
| 505 | Ga0207704_10091555 | 3300025938 | Bacteria | 1999 |
| 506 | Ga0207691_10001298 | 3300025940 | Bacteria | 24940 |
| 507 | Ga0207691_10055866 | 3300025940 | Bacteria | 3598 |
| 508 | Ga0207691_10142974 | 3300025940 | Bacteria | 2107 |
| 509 | Ga0207711_10000141 | 3300025941 | Bacteria | 77173 |
| 510 | Ga0207711_10004086 | 3300025941 | Bacteria | 12520 |
| 511 | Ga0207711_10024424 | 3300025941 | Bacteria | 5064 |
| 512 | Ga0207711_10026520 | 3300025941 | Bacteria | 4863 |
| 513 | Ga0207689_10008557 | 3300025942 | Bacteria | 8920 |
| 514 | Ga0207689_10030848 | 3300025942 | Bacteria | 4466 |
| 515 | Ga0207689_10054212 | 3300025942 | Bacteria | 3303 |
| 516 | Ga0207689_10057665 | 3300025942 | Bacteria | 3194 |
| 517 | Ga0207661_10035742 | 3300025944 | Bacteria | 3874 |
| 518 | Ga0207679_10096666 | 3300025945 | Bacteria | 2299 |
| 519 | Ga0207679_10121520 | 3300025945 | Bacteria | 2080 |
| 520 | Ga0207667_10001147 | 3300025949 | Bacteria | 33314 |
| 521 | Ga0207667_10042887 | 3300025949 | Bacteria | 4805 |
| 522 | Ga0207667_10048642 | 3300025949 | Bacteria | 4483 |
| 523 | Ga0207667_10202329 | 3300025949 | Bacteria | 2037 |
| 524 | Ga0207667_10316681 | 3300025949 | Bacteria | 1593 |
| 525 | Ga0207651_10003661 | 3300025960 | Bacteria | 7586 |
| 526 | Ga0207651_10044820 | 3300025960 | Bacteria | 2963 |
| 527 | Ga0207712_10007244 | 3300025961 | Bacteria | 6993 |
| 528 | Ga0207712_10021086 | 3300025961 | Bacteria | 4274 |
| 529 | Ga0207668_10013128 | 3300025972 | Bacteria | 5091 |
| 530 | Ga0207668_10013653 | 3300025972 | Bacteria | 5010 |
| 531 | Ga0207640_10036133 | 3300025981 | Bacteria | 3098 |
| 532 | Ga0207658_10110616 | 3300025986 | Bacteria | 2171 |
| 533 | Ga0207658_10183084 | 3300025986 | Bacteria | 1735 |
| 534 | Ga0207677_10035339 | 3300026023 | Bacteria | 3245 |
| 535 | Ga0207703_10001119 | 3300026035 | Bacteria | 25314 |
| 536 | Ga0207703_10078926 | 3300026035 | Bacteria | 2737 |
| 537 | Ga0207703_10113299 | 3300026035 | Bacteria | 2318 |
| 538 | Ga0207639_10030350 | 3300026041 | Bacteria | 3964 |
| 539 | Ga0207639_10089916 | 3300026041 | Bacteria | 2454 |
| 540 | Ga0207678_10002203 | 3300026067 | Bacteria | 17590 |
| 541 | Ga0207678_10005401 | 3300026067 | Bacteria | 11449 |
| 542 | Ga0207708_10024453 | 3300026075 | Bacteria | 4569 |
| 543 | Ga0207708_10028186 | 3300026075 | Bacteria | 4252 |
| 544 | Ga0207702_10063865 | 3300026078 | Bacteria | 3150 |
| 545 | Ga0207702_10208807 | 3300026078 | Bacteria | 1814 |
| 546 | Ga0207641_10131174 | 3300026088 | Bacteria | 2251 |
| 547 | Ga0207641_10220503 | 3300026088 | Bacteria | 1758 |
| 548 | Ga0207648_10046185 | 3300026089 | Bacteria | 3819 |
| 549 | Ga0207648_10047391 | 3300026089 | Bacteria | 3767 |
| 550 | Ga0207648_10070802 | 3300026089 | Bacteria | 3040 |
| 551 | Ga0207676_10003276 | 3300026095 | Bacteria | 11510 |
| 552 | Ga0207676_10017141 | 3300026095 | Bacteria | 5248 |
| 553 | Ga0207676_10022409 | 3300026095 | Bacteria | 4645 |
| 554 | Ga0207676_10034141 | 3300026095 | Bacteria | 3850 |
| 555 | Ga0207676_10173953 | 3300026095 | Bacteria | 1879 |
| 556 | Ga0207674_10015243 | 3300026116 | Bacteria | 8455 |
| 557 | Ga0207674_10016607 | 3300026116 | Bacteria | 8049 |
| 558 | Ga0207674_10050268 | 3300026116 | Bacteria | 4260 |
| 559 | Ga0207674_10065037 | 3300026116 | Bacteria | 3677 |
| 560 | Ga0207674_10071684 | 3300026116 | Bacteria | 3481 |
| 561 | Ga0207674_10145060 | 3300026116 | Bacteria | 2332 |
| 562 | Ga0207675_100018999 | 3300026118 | Bacteria | 6416 |
| 563 | Ga0207675_100190825 | 3300026118 | Bacteria | 1965 |
| 564 | Ga0207683_10024624 | 3300026121 | Bacteria | 5185 |
| 565 | Ga0207683_10072725 | 3300026121 | Bacteria | 3041 |
| 566 | Ga0207683_10112797 | 3300026121 | Bacteria | 2435 |
| 567 | Ga0207683_10213047 | 3300026121 | Bacteria | 1758 |
| 568 | Ga0207698_10020516 | 3300026142 | Bacteria | 4550 |
| 569 | Ga0207698_10192455 | 3300026142 | Bacteria | 1818 |
| 570 | Ga0207428_10004273 | 3300027907 | Bacteria | 13671 |
| 571 | Ga0207428_10005162 | 3300027907 | Bacteria | 12226 |
| 572 | Ga0207428_10005911 | 3300027907 | Bacteria | 11332 |
| 573 | Ga0207428_10019022 | 3300027907 | Bacteria | 5858 |
| 574 | Ga0207428_10032313 | 3300027907 | Bacteria | 4305 |
| 575 | Ga0268266_10000011 | 3300028379 | Bacteria | 757403 |
| 576 | Ga0268266_10010860 | 3300028379 | Bacteria | 7932 |
| 577 | Ga0268266_10022114 | 3300028379 | Bacteria | 5421 |
| 578 | Ga0268266_10029627 | 3300028379 | Bacteria | 4652 |
| 579 | Ga0268266_10057272 | 3300028379 | Bacteria | 3353 |
| 580 | Ga0268266_10229814 | 3300028379 | Bacteria | 1708 |
| 581 | Ga0268265_10002863 | 3300028380 | Bacteria | 12684 |
| 582 | Ga0268265_10184625 | 3300028380 | Bacteria | 1795 |
| 583 | Ga0268264_10110148 | 3300028381 | Bacteria | 2411 |
| 584 | Ga0268264_10143089 | 3300028381 | Bacteria | 2135 |
| 585 | Ga0265319_1009083 | 3300028563 | Bacteria | 4278 |
| 586 | Ga0265318_10000122 | 3300028577 | Bacteria | 71971 |
| 587 | Ga0265318_10007779 | 3300028577 | Bacteria | 4817 |
| 588 | Ga0265318_10032918 | 3300028577 | Bacteria | 2003 |
| 589 | Ga0307515_10096088 | 3300028794 | Bacteria | 3638 |
| 590 | Ga0265338_10016375 | 3300028800 | Bacteria | 8074 |
| 591 | Ga0265338_10126506 | 3300028800 | Bacteria | 2026 |
| 592 | Ga0265338_10129346 | 3300028800 | Bacteria | 1997 |
| 593 | Ga0265338_10135103 | 3300028800 | Bacteria | 1940 |
| 594 | Ga0265330_10001106 | 3300031235 | Bacteria | 16236 |
| 595 | Ga0265320_10000019 | 3300031240 | Bacteria | 183346 |
| 596 | Ga0265325_10011088 | 3300031241 | Bacteria | 5187 |
| 597 | Ga0265325_10014355 | 3300031241 | Bacteria | 4479 |
| 598 | Ga0265325_10020153 | 3300031241 | Bacteria | 3679 |
| 599 | Ga0265329_10006852 | 3300031242 | Bacteria | 4472 |
| 600 | Ga0265329_10020185 | 3300031242 | Bacteria | 2253 |
| 601 | Ga0265340_10001198 | 3300031247 | Bacteria | 14820 |
| 602 | Ga0265339_10026388 | 3300031249 | Bacteria | 3327 |
| 603 | Ga0265339_10033368 | 3300031249 | Bacteria | 2899 |
| 604 | Ga0265331_10000028 | 3300031250 | Bacteria | 216539 |
| 605 | Ga0265316_10000092 | 3300031344 | Bacteria | 96395 |
| 606 | Ga0307509_10002182 | 3300031507 | Bacteria | 32144 |
| 607 | Ga0307509_10023635 | 3300031507 | Bacteria | 6895 |
| 608 | Ga0307408_100049797 | 3300031548 | Bacteria | 3010 |
| 609 | Ga0265313_10000704 | 3300031595 | Bacteria | 34513 |
| 610 | Ga0265313_10001475 | 3300031595 | Bacteria | 21906 |
| 611 | Ga0265314_10000131 | 3300031711 | Bacteria | 113375 |
| 612 | Ga0265314_10001078 | 3300031711 | Bacteria | 31616 |
| 613 | Ga0265314_10104921 | 3300031711 | Bacteria | 1808 |
| 614 | Ga0265342_10000161 | 3300031712 | Bacteria | 75750 |
| 615 | Ga0265342_10002743 | 3300031712 | Bacteria | 14973 |
| 616 | Ga0307405_10013435 | 3300031731 | Bacteria | 4367 |
| 617 | Ga0307405_10015035 | 3300031731 | Bacteria | 4178 |
| 618 | Ga0307410_10024457 | 3300031852 | Bacteria | 3773 |
| 619 | Ga0307412_10083861 | 3300031911 | Bacteria | 2211 |
| 620 | Ga0307409_100013111 | 3300031995 | Bacteria | 5317 |
| 621 | Ga0307416_100000731 | 3300032002 | Bacteria | 17101 |
| 622 | Ga0307416_100006131 | 3300032002 | Bacteria | 7490 |
| 623 | Ga0307416_100008501 | 3300032002 | Bacteria | 6631 |
| 624 | Ga0307416_100080980 | 3300032002 | Bacteria | 2743 |
| 625 | Ga0307414_10000449 | 3300032004 | Bacteria | 21733 |
| 626 | Ga0307414_10064074 | 3300032004 | Bacteria | 2615 |
| 627 | Ga0307411_10015527 | 3300032005 | Bacteria | 4281 |
| 628 | Ga0307411_10113715 | 3300032005 | Bacteria | 1943 |
| 629 | Ga0307415_100163569 | 3300032126 | Bacteria | 1728 |
| 630 | Ga0373948_0002220 | 3300034817 | Bacteria | 2836 |
| 631 | Ga0373958_0000338 | 3300034819 | Bacteria | 5644 |
| 632 | Ga0373938_0002432 | 3300034957 | Bacteria | 3002 |
| 633 | Ga0373944_0004683 | 3300035089 | Bacteria | 3572 |
| 634 | Ga0373949_0001593 | 3300035090 | Bacteria | 6390 |
| 635 | Ga0373951_0000334 | 3300035091 | Bacteria | 14616 |
| 636 | Ga0373923_0034942 | 3300035111 | Bacteria | 2043 |
| 637 | Ga0373932_0001320 | 3300035112 | Bacteria | 6977 |
| 638 | Ga0373954_0001824 | 3300035118 | Bacteria | 8791 |
| 639 | Ga0373954_0066556 | 3300035118 | Bacteria | 1706 |
| 640 | Ga0373956_0025803 | 3300035119 | Bacteria | 2541 |
| 641 | Ga0373943_0100510 | 3300035170 | Bacteria | 1512 |
| 642 | Ga0373955_0033868 | 3300035172 | Bacteria | 2692 |
| 643 | Ga0373942_0000300 | 3300035207 | Bacteria | 13537 |
| 644 | Ga0373924_0014375 | 3300035410 | Bacteria | 2991 |
| 645 | Ga0373935_0001821 | 3300035692 | Bacteria | 11963 |
| 646 | Ga0373927_0002543 | 3300035695 | Bacteria | 13305 |
| 647 | Ga0373927_0025807 | 3300035695 | Bacteria | 3841 |
| 648 | Ga0373933_0000034 | 3300035724 | Bacteria | 83243 |
| 649 | Ga0373933_0092613 | 3300035724 | Bacteria | 1867 |
| 650 | Ga0373947_0048591 | 3300035725 | Bacteria | 2546 |
| 651 | Ga0373937_0000001 | 3300036401 | Bacteria | 478903 |
| 652 | Ga0373937_0116319 | 3300036401 | Bacteria | 2490 |
| 653 | Ga0373925_0218972 | 3300037068 | Bacteria | 1519 |
| 654 | Ga0373925_0222934 | 3300037068 | Bacteria | 1505 |
| 655 | Ga0395900_0021101 | 3300037418 | Bacteria | 6657 |
| 656 | Ga0395900_0187362 | 3300037418 | Bacteria | 2100 |
| 657 | Ga0395898_0092856 | 3300037466 | Bacteria | 2902 |
| 658 | Ga0395901_0012641 | 3300038443 | Bacteria | 8566 |
| 659 | Ga0395901_0018220 | 3300038443 | Bacteria | 7169 |
| 660 | Ga0436365_1759017 | 3300039437 | Bacteria | 5156 |
| 661 | Ga0436365_1796416 | 3300039437 | Bacteria | 5000 |
| 662 | Ga0439447_001727 | 3300041407 | Bacteria | 8009 |
| 663 | Ga0451797_0723557 | 3300041453 | Bacteria | 2342 |
| 664 | Ga0451807_1802640 | 3300041486 | Bacteria | 3285 |
| 665 | Ga0451807_2035948 | 3300041486 | Bacteria | 4835 |
| 666 | Ga0451843_0291122 | 3300041509 | Bacteria | 1821 |
| 667 | Ga0439431_0026094 | 3300041997 | Bacteria | 1430 |
| 668 | Ga0439446_0018374 | 3300042156 | Bacteria | 1959 |
| 669 | Ga0451577_0054247 | 3300042876 | Bacteria | 3579 |
| 670 | Ga0451577_0097912 | 3300042876 | Bacteria | 2620 |
| 671 | Ga0466969_0033773 | 3300044656 | Bacteria | 2596 |
| 672 | Ga0466961_0022799 | 3300044693 | Bacteria | 4027 |
| 673 | Ga0466961_0039350 | 3300044693 | Bacteria | 3031 |
| 674 | Ga0466959_0007010 | 3300045049 | Bacteria | 7877 |
| 675 | Ga0451576_0090138 | 3300045051 | Bacteria | 3189 |
| 676 | Ga0451576_0101277 | 3300045051 | Bacteria | 2996 |
| 677 | Ga0451576_0255244 | 3300045051 | Bacteria | 1832 |
| 678 | Ga0495617_000007 | 3300046452 | Bacteria | 369986 |
| 679 | Ga0495592_0032891 | 3300046454 | Bacteria | 3912 |
| 680 | Ga0495629_0002811 | 3300046459 | Bacteria | 13280 |
| 681 | Ga0495638_0017261 | 3300046460 | Bacteria | 4818 |
| 682 | Ga0495651_0001343 | 3300046462 | Bacteria | 19044 |
| 683 | Ga0495651_0004152 | 3300046462 | Bacteria | 11094 |
| 684 | Ga0495651_0011894 | 3300046462 | Bacteria | 6694 |
| 685 | Ga0495651_0020556 | 3300046462 | Bacteria | 5126 |
| 686 | Ga0495653_0000297 | 3300046463 | Bacteria | 40421 |
| 687 | Ga0495653_0008111 | 3300046463 | Bacteria | 8601 |
| 688 | Ga0495653_0053088 | 3300046463 | Bacteria | 3102 |
| 689 | Ga0495650_0000357 | 3300046471 | Bacteria | 80726 |
| 690 | Ga0495650_0000852 | 3300046471 | Bacteria | 36650 |
| 691 | Ga0495650_0007439 | 3300046471 | Bacteria | 6583 |
| 692 | Ga0495580_0017641 | 3300046472 | Bacteria | 5332 |
| 693 | Ga0495580_0049246 | 3300046472 | Bacteria | 2981 |
| 694 | Ga0495580_0077173 | 3300046472 | Bacteria | 2323 |
| 695 | Ga0495580_0106816 | 3300046472 | Bacteria | 1944 |
| 696 | Ga0495582_0136186 | 3300046473 | Bacteria | 1390 |
| 697 | Ga0495639_0009371 | 3300046475 | Bacteria | 4199 |
| 698 | Ga0495584_0000343 | 3300046491 | Bacteria | 32238 |
| 699 | Ga0495584_0027742 | 3300046491 | Bacteria | 2869 |
| 700 | Ga0495584_0050909 | 3300046491 | Bacteria | 2086 |
| 701 | Ga0495585_0000257 | 3300046492 | Bacteria | 54605 |
| 702 | Ga0495585_0000364 | 3300046492 | Bacteria | 43911 |
| 703 | Ga0495585_0003059 | 3300046492 | Bacteria | 11508 |
| 704 | Ga0495585_0046711 | 3300046492 | Bacteria | 2414 |
| 705 | Ga0495594_0004342 | 3300046499 | Bacteria | 7295 |
| 706 | Ga0495594_0067014 | 3300046499 | Bacteria | 1992 |
| 707 | Ga0495596_0000578 | 3300046500 | Bacteria | 22865 |
| 708 | Ga0495607_0005633 | 3300046501 | Bacteria | 8928 |
| 709 | Ga0495583_0000318 | 3300046506 | Bacteria | 76178 |
| 710 | Ga0495583_0009533 | 3300046506 | Bacteria | 5789 |
| 711 | Ga0495583_0025898 | 3300046506 | Bacteria | 2920 |
| 712 | Ga0495583_0030315 | 3300046506 | Bacteria | 2636 |
| 713 | Ga0495606_0000037 | 3300046507 | Bacteria | 231282 |
| 714 | Ga0495606_0000331 | 3300046507 | Bacteria | 81871 |
| 715 | Ga0495608_0005483 | 3300046511 | Bacteria | 9067 |
| 716 | Ga0495608_0007458 | 3300046511 | Bacteria | 7726 |
| 717 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 718 | Ga0495610_0028593 | 3300046512 | Bacteria | 2945 |
| 719 | Ga0495610_0053354 | 3300046512 | Bacteria | 1958 |
| 720 | Ga0495616_0018539 | 3300046513 | Bacteria | 3818 |
| 721 | Ga0495628_0006870 | 3300046516 | Bacteria | 9893 |
| 722 | Ga0495630_0002003 | 3300046517 | Bacteria | 14169 |
| 723 | Ga0495637_0001635 | 3300046520 | Bacteria | 12982 |
| 724 | Ga0495643_0000233 | 3300046522 | Bacteria | 84175 |
| 725 | Ga0495643_0003131 | 3300046522 | Bacteria | 12342 |
| 726 | Ga0495643_0006650 | 3300046522 | Bacteria | 7580 |
| 727 | Ga0495644_0007794 | 3300046523 | Bacteria | 4129 |
| 728 | Ga0495644_0008523 | 3300046523 | Bacteria | 3949 |
| 729 | Ga0495648_0001623 | 3300046524 | Bacteria | 21830 |
| 730 | Ga0495648_0019046 | 3300046524 | Bacteria | 4840 |
| 731 | Ga0495648_0081788 | 3300046524 | Bacteria | 1836 |
| 732 | Ga0495642_0026689 | 3300046528 | Bacteria | 2295 |
| 733 | Ga0495652_0009228 | 3300046529 | Bacteria | 8965 |
| 734 | Ga0495652_0042210 | 3300046529 | Bacteria | 3934 |
| 735 | Ga0495654_0000004 | 3300046530 | Bacteria | 515304 |
| 736 | Ga0495665_0000965 | 3300046531 | Bacteria | 15222 |
| 737 | Ga0495665_0002916 | 3300046531 | Bacteria | 9240 |
| 738 | Ga0495665_0096855 | 3300046531 | Bacteria | 1549 |
| 739 | Ga0495587_0000392 | 3300046536 | Bacteria | 31174 |
| 740 | Ga0495587_0004124 | 3300046536 | Bacteria | 9610 |
| 741 | Ga0495609_0003914 | 3300046538 | Bacteria | 8350 |
| 742 | Ga0495609_0011277 | 3300046538 | Bacteria | 4262 |
| 743 | Ga0495609_0020365 | 3300046538 | Bacteria | 3065 |
| 744 | Ga0495609_0026513 | 3300046538 | Bacteria | 2653 |
| 745 | Ga0495621_0010391 | 3300046539 | Bacteria | 2846 |
| 746 | Ga0495621_0015889 | 3300046539 | Bacteria | 2407 |
| 747 | Ga0495621_0019944 | 3300046539 | Bacteria | 2195 |
| 748 | Ga0495621_0025945 | 3300046539 | Bacteria | 1973 |
| 749 | Ga0495645_0048144 | 3300046543 | Bacteria | 3105 |
| 750 | Ga0495622_0005665 | 3300046557 | Bacteria | 5790 |
| 751 | Ga0495622_0051424 | 3300046557 | Bacteria | 1911 |
| 752 | Ga0495633_0000756 | 3300046558 | Bacteria | 29179 |
| 753 | Ga0495667_0010677 | 3300046559 | Bacteria | 6210 |
| 754 | Ga0495667_0024704 | 3300046559 | Bacteria | 4047 |
| 755 | Ga0495656_0005498 | 3300046615 | Bacteria | 4376 |
| 756 | Ga0495668_0002904 | 3300046616 | Bacteria | 13528 |
| 757 | Ga0495668_0005002 | 3300046616 | Bacteria | 9157 |
| 758 | Ga0495668_0008628 | 3300046616 | Bacteria | 6337 |
| 759 | Ga0495668_0011101 | 3300046616 | Bacteria | 5413 |
| 760 | Ga0495611_0030837 | 3300046648 | Bacteria | 2358 |
| 761 | Ga0495625_0042020 | 3300046660 | Bacteria | 3324 |
| 762 | Ga0495635_0189194 | 3300046663 | Bacteria | 1398 |
| 763 | Ga0495659_0001388 | 3300046664 | Bacteria | 8263 |
| 764 | Ga0495659_0011649 | 3300046664 | Bacteria | 2834 |
| 765 | Ga0495661_0004759 | 3300046665 | Bacteria | 9739 |
| 766 | Ga0495661_0010720 | 3300046665 | Bacteria | 6243 |
| 767 | Ga0495661_0015184 | 3300046665 | Bacteria | 5142 |
| 768 | Ga0495661_0034244 | 3300046665 | Bacteria | 3196 |
| 769 | Ga0495588_0005258 | 3300046674 | Bacteria | 5754 |
| 770 | Ga0495588_0017791 | 3300046674 | Bacteria | 3457 |
| 771 | Ga0495657_0020903 | 3300046675 | Bacteria | 4704 |
| 772 | Ga0495657_0098896 | 3300046675 | Bacteria | 1861 |
| 773 | Ga0495599_0079821 | 3300046678 | Bacteria | 2043 |
| 774 | Ga0495623_0014004 | 3300046679 | Bacteria | 5197 |
| 775 | Ga0495646_0003866 | 3300046680 | Bacteria | 9362 |
| 776 | Ga0495658_0001597 | 3300046683 | Bacteria | 11805 |
| 777 | Ga0495669_0008486 | 3300046684 | Bacteria | 4322 |
| 778 | Ga0495613_0018906 | 3300046689 | Bacteria | 5133 |
| 779 | Ga0495624_0023543 | 3300046690 | Bacteria | 4061 |
| 780 | Ga0495670_0002448 | 3300046691 | Bacteria | 9172 |
| 781 | Ga0495671_0000177 | 3300046692 | Bacteria | 56452 |
| 782 | Ga0495649_0008013 | 3300046694 | Bacteria | 6384 |
| 783 | Ga0495600_0018515 | 3300046809 | Bacteria | 4437 |
| 784 | Ga0495660_0001429 | 3300046810 | Bacteria | 16363 |
| 785 | Ga0495581_0002799 | 3300047315 | Bacteria | 9953 |
| 786 | Ga0495581_0060451 | 3300047315 | Bacteria | 2190 |
| 787 | Ga0495604_0006990 | 3300047317 | Bacteria | 8942 |
| 788 | Ga0495604_0009216 | 3300047317 | Bacteria | 7814 |
| 789 | Ga0495636_0004916 | 3300047318 | Bacteria | 5238 |
| 790 | Ga0495674_0011791 | 3300047319 | Bacteria | 8242 |
| 791 | Ga0495674_0027948 | 3300047319 | Bacteria | 5150 |
| 792 | Ga0495674_0071474 | 3300047319 | Bacteria | 2995 |
| 793 | Ga0495672_0000206 | 3300047320 | Bacteria | 84222 |
| 794 | Ga0495672_0000242 | 3300047320 | Bacteria | 76766 |
| 795 | Ga0495672_0096319 | 3300047320 | Bacteria | 1613 |
| 796 | Ga0495676_0030478 | 3300047321 | Bacteria | 4577 |
| 797 | Ga0495676_0055978 | 3300047321 | Bacteria | 3122 |
| 798 | Ga0495676_0125552 | 3300047321 | Bacteria | 1860 |
| 799 | Ga0495680_0000068 | 3300047322 | Bacteria | 89135 |
| 800 | Ga0495680_0005490 | 3300047322 | Bacteria | 11920 |
| 801 | Ga0495680_0034636 | 3300047322 | Bacteria | 4074 |
| 802 | Ga0495683_0000007 | 3300047323 | Bacteria | 268546 |
| 803 | Ga0495675_0000027 | 3300047444 | Bacteria | 106917 |
| 804 | Ga0495675_0001586 | 3300047444 | Bacteria | 13704 |
| 805 | Ga0495675_0047659 | 3300047444 | Bacteria | 2726 |
| 806 | Ga0495673_0000017 | 3300047469 | Bacteria | 574970 |
| 807 | Ga0495673_0000027 | 3300047469 | Bacteria | 475440 |
| 808 | Ga0495681_0004212 | 3300047470 | Bacteria | 9864 |
| 809 | Ga0495684_0001011 | 3300047471 | Bacteria | 22911 |
| 810 | Ga0495686_0000006 | 3300047472 | Bacteria | 770778 |
| 811 | Ga0495686_0002116 | 3300047472 | Bacteria | 19445 |
| 812 | Ga0495686_0002175 | 3300047472 | Bacteria | 19088 |
| 813 | Ga0495686_0009047 | 3300047472 | Bacteria | 7227 |
| 814 | Ga0495593_0007764 | 3300047673 | Bacteria | 6252 |
| 815 | Ga0495593_0028545 | 3300047673 | Bacteria | 3064 |
| 816 | Ga0495602_0013119 | 3300048088 | Bacteria | 8477 |
| 817 | Ga0495614_0038149 | 3300048089 | Bacteria | 2062 |
| 818 | Ga0495626_0004800 | 3300048091 | Bacteria | 8156 |
| 819 | Ga0496100_0030977 | 3300048903 | Bacteria | 3322 |
| 820 | Ga0496102_0041537 | 3300048905 | Bacteria | 4164 |
| 821 | Ga0496102_0233331 | 3300048905 | Bacteria | 1734 |
| 822 | Ga0496104_0000291 | 3300048907 | Bacteria | 44138 |
| 823 | Ga0496104_0119307 | 3300048907 | Bacteria | 2532 |
| 824 | Ga0496105_0000075 | 3300048908 | Bacteria | 75152 |
| 825 | Ga0496105_0255414 | 3300048908 | Bacteria | 1419 |
| 826 | Ga0496106_0129421 | 3300048909 | Bacteria | 1979 |
| 827 | Ga0496108_0103156 | 3300048911 | Bacteria | 2433 |
| 828 | Ga0496110_0172088 | 3300048913 | Bacteria | 1965 |
| 829 | Ga0496112_0078500 | 3300048915 | Bacteria | 3265 |
| 830 | Ga0496112_0119969 | 3300048915 | Bacteria | 2600 |
| 831 | Ga0496112_0164589 | 3300048915 | Bacteria | 2184 |
| 832 | Ga0496112_0237821 | 3300048915 | Bacteria | 1775 |
| 833 | Ga0496114_0020789 | 3300048917 | Bacteria | 5328 |
| 834 | Ga0496114_0163257 | 3300048917 | Bacteria | 1938 |
| 835 | Ga0496115_0077369 | 3300048918 | Bacteria | 2705 |
| 836 | Ga0496115_0128393 | 3300048918 | Bacteria | 2089 |
| 837 | Ga0496116_0045702 | 3300048919 | Bacteria | 2961 |
| 838 | Ga0496117_0000010 | 3300048920 | Bacteria | 611954 |
| 839 | Ga0496117_0130766 | 3300048920 | Bacteria | 1522 |
| 840 | Ga0496118_0000009 | 3300048921 | Bacteria | 611954 |
| 841 | Ga0496118_0000182 | 3300048921 | Bacteria | 110967 |
| 842 | Ga0496121_0006227 | 3300048924 | Bacteria | 14949 |
| 843 | Ga0496121_0012863 | 3300048924 | Bacteria | 9053 |
| 844 | Ga0496121_0023762 | 3300048924 | Bacteria | 5889 |
| 845 | Ga0496121_0076340 | 3300048924 | Bacteria | 2672 |
| 846 | Ga0496122_0002845 | 3300048925 | Bacteria | 23688 |
| 847 | Ga0496122_0012865 | 3300048925 | Bacteria | 8272 |
| 848 | Ga0496122_0020494 | 3300048925 | Bacteria | 5970 |
| 849 | Ga0496123_0007735 | 3300048926 | Bacteria | 10031 |
| 850 | Ga0496123_0024801 | 3300048926 | Bacteria | 4543 |
| 851 | Ga0496124_0024133 | 3300048927 | Bacteria | 5535 |
| 852 | Ga0496126_0000139 | 3300048929 | Bacteria | 167097 |
| 853 | Ga0496126_0002052 | 3300048929 | Bacteria | 28303 |
| 854 | Ga0496126_0020972 | 3300048929 | Bacteria | 6395 |
| 855 | Ga0496126_0115897 | 3300048929 | Bacteria | 2329 |
| 856 | Ga0496126_0234229 | 3300048929 | Bacteria | 1537 |
| 857 | Ga0495678_002205 | 3300049459 | Bacteria | 13652 |
| 858 | Ga0501299_004431 | 3300049522 | Bacteria | 2098 |
| 859 | Ga0501299_005221 | 3300049522 | Bacteria | 1985 |
| 860 | Ga0501033_0014916 | 3300049570 | Bacteria | 5899 |
| 861 | Ga0501033_0031227 | 3300049570 | Bacteria | 4004 |
| 862 | Ga0501034_0004072 | 3300049571 | Bacteria | 16405 |
| 863 | Ga0501034_0012936 | 3300049571 | Bacteria | 8602 |
| 864 | Ga0501034_0023006 | 3300049571 | Bacteria | 6350 |
| 865 | Ga0501034_0067442 | 3300049571 | Bacteria | 3591 |
| 866 | Ga0501034_0068468 | 3300049571 | Bacteria | 3559 |
| 867 | Ga0501034_0210748 | 3300049571 | Bacteria | 1898 |
| 868 | Ga0501036_0008184 | 3300049572 | Bacteria | 8571 |
| 869 | Ga0501036_0008804 | 3300049572 | Bacteria | 8284 |
| 870 | Ga0501037_0001648 | 3300049573 | Bacteria | 16237 |
| 871 | Ga0501037_0009111 | 3300049573 | Bacteria | 7272 |
| 872 | Ga0501037_0034714 | 3300049573 | Bacteria | 3721 |
| 873 | Ga0501038_0007833 | 3300049574 | Bacteria | 9846 |
| 874 | Ga0501038_0013770 | 3300049574 | Bacteria | 7370 |
| 875 | Ga0501042_0192497 | 3300049578 | Bacteria | 1471 |
| 876 | Ga0501043_0031371 | 3300049579 | Bacteria | 4177 |
| 877 | Ga0501043_0072158 | 3300049579 | Bacteria | 2712 |
| 878 | Ga0501046_0000887 | 3300049580 | Bacteria | 29123 |
| 879 | Ga0501046_0020892 | 3300049580 | Bacteria | 5406 |
| 880 | Ga0501047_0014503 | 3300049581 | Bacteria | 7494 |
| 881 | Ga0501047_0018167 | 3300049581 | Bacteria | 6739 |
| 882 | Ga0501047_0058552 | 3300049581 | Bacteria | 3722 |
| 883 | Ga0501047_0070013 | 3300049581 | Bacteria | 3377 |
| 884 | Ga0501047_0309106 | 3300049581 | Bacteria | 1421 |
| 885 | Ga0501048_0036930 | 3300049582 | Bacteria | 3509 |
| 886 | Ga0501048_0060301 | 3300049582 | Bacteria | 2688 |
| 887 | Ga0501067_0009767 | 3300049583 | Bacteria | 5311 |
| 888 | Ga0501067_0029285 | 3300049583 | Bacteria | 3052 |
| 889 | Ga0501067_0075269 | 3300049583 | Bacteria | 1870 |
| 890 | Ga0501068_0020186 | 3300049584 | Bacteria | 3879 |
| 891 | Ga0501069_0001461 | 3300049585 | Bacteria | 11617 |
| 892 | Ga0501070_0017220 | 3300049586 | Bacteria | 6067 |
| 893 | Ga0501071_0120738 | 3300049587 | Bacteria | 1943 |
| 894 | Ga0501071_0225164 | 3300049587 | Bacteria | 1412 |
| 895 | Ga0501072_0016599 | 3300049588 | Bacteria | 5656 |
| 896 | Ga0501073_0016712 | 3300049589 | Bacteria | 5317 |
| 897 | Ga0501073_0035063 | 3300049589 | Bacteria | 3567 |
| 898 | Ga0501074_0016520 | 3300049590 | Bacteria | 5357 |
| 899 | Ga0501074_0095027 | 3300049590 | Bacteria | 2134 |
| 900 | Ga0501074_0096007 | 3300049590 | Bacteria | 2123 |
| 901 | Ga0501075_0032354 | 3300049591 | Bacteria | 3884 |
| 902 | Ga0501076_0081211 | 3300049592 | Bacteria | 2602 |
| 903 | Ga0501077_0063713 | 3300049593 | Bacteria | 2339 |
| 904 | Ga0501079_0008610 | 3300049741 | Bacteria | 7743 |
| 905 | Ga0501079_0024837 | 3300049741 | Bacteria | 4597 |
| 906 | Ga0501080_0080245 | 3300049742 | Bacteria | 3032 |
| 907 | Ga0501081_0019726 | 3300049743 | Bacteria | 4493 |
| 908 | Ga0501081_0066077 | 3300049743 | Bacteria | 2515 |
| 909 | Ga0501081_0088367 | 3300049743 | Bacteria | 2177 |
| 910 | Ga0501083_0006954 | 3300049744 | Bacteria | 8025 |
| 911 | Ga0501083_0014583 | 3300049744 | Bacteria | 5494 |
| 912 | Ga0501269_000024 | 3300049766 | Bacteria | 52180 |
| 913 | Ga0501035_0013386 | 3300049822 | Bacteria | 7574 |
| 914 | Ga0501035_0021497 | 3300049822 | Bacteria | 5931 |
| 915 | Ga0501035_0287566 | 3300049822 | Bacteria | 1388 |
| 916 | Ga0501044_0018895 | 3300049823 | Bacteria | 7379 |
| 917 | Ga0501044_0026431 | 3300049823 | Bacteria | 6142 |
| 918 | Ga0501045_0005367 | 3300049824 | Bacteria | 8881 |
| 919 | Ga0501045_0037400 | 3300049824 | Bacteria | 3528 |
| 920 | nmdc:mga0yw44_42582_c1 | 3300050492 | Bacteria | 2708 |
| 921 | nmdc:mga05p37_14271_c1 | 3300050507 | Bacteria | 9539 |
| 922 | nmdc:mga05p37_263442_c1 | 3300050507 | Bacteria | 2062 |
| 923 | nmdc:mga05p37_288908_c1 | 3300050507 | Bacteria | 1952 |
| 924 | nmdc:mga05p37_3248_c1 | 3300050507 | Bacteria | 18933 |
| 925 | nmdc:mga05p37_33175_c1 | 3300050507 | Bacteria | 6322 |
| 926 | nmdc:mga05p37_339636_c1 | 3300050507 | Bacteria | 1771 |
| 927 | nmdc:mga05p37_5160_c1 | 3300050507 | Bacteria | 15308 |
| 928 | nmdc:mga05p37_63879_c1 | 3300050507 | Bacteria | 4531 |
| 929 | nmdc:mga05p37_73775_c1 | 3300050507 | Bacteria | 4199 |
| 930 | nmdc:mga09592_10440_c1 | 3300050508 | Bacteria | 7556 |
| 931 | nmdc:mga09592_110236_c1 | 3300050508 | Bacteria | 2361 |
| 932 | nmdc:mga09592_32935_c1 | 3300050508 | Bacteria | 4322 |
| 933 | nmdc:mga09592_38094_c1 | 3300050508 | Bacteria | 4035 |
| 934 | nmdc:mga09592_4121_c1 | 3300050508 | Bacteria | 11742 |
| 935 | nmdc:mga09592_91659_c1 | 3300050508 | Bacteria | 2597 |
| 936 | nmdc:mga0qj67_14341_c1 | 3300050509 | Bacteria | 5990 |
| 937 | nmdc:mga0qj67_156522_c1 | 3300050509 | Bacteria | 1850 |
| 938 | nmdc:mga0qj67_2530_c1 | 3300050509 | Bacteria | 13054 |
| 939 | nmdc:mga0qj67_31339_c1 | 3300050509 | Bacteria | 4141 |
| 940 | nmdc:mga0qj67_63098_c1 | 3300050509 | Bacteria | 2946 |
| 941 | nmdc:mga0qj67_66497_c1 | 3300050509 | Bacteria | 2871 |
| 942 | nmdc:mga06r32_112685_c1 | 3300050510 | Bacteria | 2677 |
| 943 | nmdc:mga06r32_167689_c1 | 3300050510 | Bacteria | 2179 |
| 944 | nmdc:mga06r32_24242_c1 | 3300050510 | Bacteria | 5628 |
| 945 | nmdc:mga06r32_24456_c1 | 3300050510 | Bacteria | 5607 |
| 946 | nmdc:mga06r32_69537_c1 | 3300050510 | Bacteria | 3403 |
| 947 | nmdc:mga08y16_1346_c1 | 3300050511 | Bacteria | 24536 |
| 948 | nmdc:mga08y16_141997_c1 | 3300050511 | Bacteria | 2496 |
| 949 | nmdc:mga08y16_30179_c1 | 3300050511 | Bacteria | 5707 |
| 950 | nmdc:mga08y16_371649_c1 | 3300050511 | Bacteria | 1466 |
| 951 | nmdc:mga08y16_49007_c1 | 3300050511 | Bacteria | 4420 |
| 952 | nmdc:mga08y16_5495_c1 | 3300050511 | Bacteria | 13251 |
| 953 | nmdc:mga08y16_73656_c1 | 3300050511 | Bacteria | 3558 |
| 954 | nmdc:mga08y16_81746_c1 | 3300050511 | Bacteria | 3368 |
| 955 | nmdc:mga0n895_11322_c1 | 3300050512 | Bacteria | 7949 |
| 956 | nmdc:mga0n895_142622_c1 | 3300050512 | Bacteria | 2425 |
| 957 | nmdc:mga0n895_220045_c1 | 3300050512 | Bacteria | 1928 |
| 958 | nmdc:mga0n895_3505_c1 | 3300050512 | Bacteria | 12669 |
| 959 | nmdc:mga0n895_358545_c1 | 3300050512 | Bacteria | 1477 |
| 960 | nmdc:mga0n895_4988_c1 | 3300050512 | Bacteria | 11013 |
| 961 | nmdc:mga0rr50_10664_c1 | 3300050513 | Bacteria | 5846 |
| 962 | nmdc:mga0rr50_170372_c1 | 3300050513 | Bacteria | 1774 |
| 963 | nmdc:mga0rr50_72231_c1 | 3300050513 | Bacteria | 2635 |
| 964 | nmdc:mga0a205_12595_c2 | 3300050515 | Bacteria | 6346 |
| 965 | nmdc:mga0a205_186685_c1 | 3300050515 | Bacteria | 1966 |
| 966 | nmdc:mga0a205_20548_c1 | 3300050515 | Bacteria | 6232 |
| 967 | nmdc:mga0a205_302685_c1 | 3300050515 | Bacteria | 1472 |
| 968 | nmdc:mga0a205_30644_c1 | 3300050515 | Bacteria | 5152 |
| 969 | nmdc:mga0a205_8668_c1 | 3300050515 | Bacteria | 8615 |
| 970 | Ga0495612_0006784 | 3300053078 | Bacteria | 4690 |
| 971 | Ga0495619_0145238 | 3300053085 | Bacteria | 1635 |
| 972 | Ga0500644_0010739 | 3300053088 | Bacteria | 2485 |
| 973 | Ga0500651_0000222 | 3300053093 | Bacteria | 35734 |
| 974 | Ga0500555_002778 | 3300053103 | Bacteria | 5024 |
| 975 | Ga0500555_008549 | 3300053103 | Bacteria | 2921 |
| 976 | Ga0500618_001426 | 3300053125 | Bacteria | 10666 |
| 977 | Ga0500616_0000086 | 3300053153 | Bacteria | 192348 |
| 978 | Ga0500645_000044 | 3300053730 | Bacteria | 109705 |
| 979 | Ga0500599_003594 | 3300053736 | Bacteria | 1896 |
| 980 | Ga0501084_0032006 | 3300054114 | Bacteria | 4399 |
| 981 | Ga0501084_0044940 | 3300054114 | Bacteria | 3698 |
| 982 | Ga0501084_0146042 | 3300054114 | Bacteria | 1992 |
| 983 | Ga0590071_001592 | 3300059421 | Bacteria | 5948 |
| 984 | Ga0590075_000138 | 3300059424 | Bacteria | 19114 |
| 985 | Ga0590077_000077 | 3300059426 | Bacteria | 24876 |
| 986 | Ga0590077_001774 | 3300059426 | Bacteria | 4854 |
| 987 | Ga0501082_0012400 | 3300060353 | Bacteria | 7325 |
| 988 | Ga0501082_0013767 | 3300060353 | Bacteria | 6954 |
| 989 | Ga0501082_0028608 | 3300060353 | Bacteria | 4800 |
| 990 | Ga0530510_0006774 | 3300061734 | Bacteria | 7983 |
| 991 | Ga0530510_0136903 | 3300061734 | Bacteria | 1803 |
| 992 | 2601670618 | 2600255292 | Bacteria | 6300551 |
| 993 | 2643976130 | 2643221593 | Bacteria | 6296053 |
| 994 | 2738825483 | 2738541297 | Bacteria | 6549566 |
| 995 | 2739149280 | 2738541357 | Bacteria | 6549408 |
| 996 | 2739191199 | 2738543003 | Bacteria | 6549560 |
| 997 | 2739317676 | 2738543026 | Bacteria | 6549408 |
| 998 | 2739335917 | 2738543029 | Bacteria | 6549249 |
| 999 | 2857548037 | 2857547612 | Bacteria | 6179999 |
| 1000 | 2857561170 | 2857558681 | Bacteria | 6617694 |
| 1001 | 2885082956 | 2885080285 | Bacteria | 6355622 |
| 1002 | 2904429110 | 2904424332 | Bacteria | 7633521 |
| 1003 | 2917705053 | 2917699015 | Bacteria | 7043791 |
| 1004 | 2919514911 | 2919513703 | Bacteria | 3844312 |
| 1005 | 2919679030 | 2919675420 | Bacteria | 3969095 |
| 1006 | 2932412627 | 2932410948 | Bacteria | 6312192 |
| 1007 | 2932420142 | 2932416698 | Bacteria | 6315112 |
| 1008 | 2941492832 | 2941489479 | Bacteria | 6313767 |
| 1009 | nmdc:mga05p37_32609_c1 | |||
| 1010 | JGI24746J21847_1001222 | |||
| 1011 | JGI25151J46595_10001398 | |||
| 1012 | JGI25406J46586_10000121 | |||
| 1013 | rootH2_10009426 | |||
| 1014 | Ga0055526_1000129 | |||
| 1015 | Ga0055543_1002002 | |||
| 1016 | Ga0065165_1000050 | |||
| 1017 | Ga0065712_10010331 | |||
| 1018 | Ga0065712_10017262 | |||
| 1019 | Ga0065712_10079412 | |||
| 1020 | Ga0065712_10081025 | |||
| 1021 | Ga0065715_10003555 | |||
| 1022 | Ga0065715_10003862 | |||
| 1023 | Ga0065715_10103465 | |||
| 1024 | Ga0065715_10117896 | |||
| 1025 | Ga0065715_10191947 | |||
| 1026 | Ga0065707_10004066 | |||
| 1027 | Ga0065707_10107365 | |||
| 1028 | Ga0070658_10001036 | |||
| 1029 | Ga0070658_10029586 | |||
| 1030 | Ga0070658_10092672 | |||
| 1031 | Ga0070658_10130569 | |||
| 1032 | Ga0070658_10147021 | |||
| 1033 | Ga0070676_10024926 | |||
| 1034 | Ga0070676_10028465 | |||
| 1035 | Ga0070676_10057556 | |||
| 1036 | Ga0070683_100020144 | |||
| 1037 | Ga0070683_100048338 | |||
| 1038 | Ga0070683_100111233 | |||
| 1039 | Ga0070683_100189029 | |||
| 1040 | Ga0070690_100003577 | |||
| 1041 | Ga0070690_100025518 | |||
| 1042 | Ga0070690_100029732 | |||
| 1043 | Ga0070690_100059519 | |||
| 1044 | Ga0070670_100001059 | |||
| 1045 | Ga0070670_100014434 | |||
| 1046 | Ga0070670_100028275 | |||
| 1047 | Ga0070670_100053077 | |||
| 1048 | Ga0070670_100109514 | |||
| 1049 | Ga0070677_10000820 | |||
| 1050 | Ga0068869_100012848 | |||
| 1051 | Ga0068869_100172785 | |||
| 1052 | Ga0070666_10000001 | |||
| 1053 | Ga0070666_10021458 | |||
| 1054 | Ga0070680_100030360 | |||
| 1055 | Ga0070680_100060072 | |||
| 1056 | Ga0070680_100087677 | |||
| 1057 | Ga0070682_100069908 | |||
| 1058 | Ga0068868_100010518 | |||
| 1059 | Ga0068868_100010978 | |||
| 1060 | Ga0070660_100003334 | |||
| 1061 | Ga0070660_100070552 | |||
| 1062 | Ga0070660_100082316 | |||
| 1063 | Ga0070689_100010769 | |||
| 1064 | Ga0070689_100021262 | |||
| 1065 | Ga0070689_100077606 | |||
| 1066 | Ga0070687_100010132 | |||
| 1067 | Ga0070687_100044317 | |||
| 1068 | Ga0070687_100078109 | |||
| 1069 | Ga0070661_100008933 | |||
| 1070 | Ga0070692_10046861 | |||
| 1071 | Ga0070668_100001298 | |||
| 1072 | Ga0070668_100021672 | |||
| 1073 | Ga0070668_100028229 | |||
| 1074 | Ga0070669_100003163 | |||
| 1075 | Ga0070669_100006451 | |||
| 1076 | Ga0070669_100037619 | |||
| 1077 | Ga0070669_100088013 | |||
| 1078 | Ga0070669_100100234 | |||
| 1079 | Ga0070669_100144810 | |||
| 1080 | Ga0070675_100020276 | |||
| 1081 | Ga0070675_100032864 | |||
| 1082 | Ga0070675_100123824 | |||
| 1083 | Ga0070675_100157319 | |||
| 1084 | Ga0070675_100160155 | |||
| 1085 | Ga0070671_100013621 | |||
| 1086 | Ga0070671_100047619 | |||
| 1087 | Ga0070671_100056437 | |||
| 1088 | Ga0070671_100098006 | |||
| 1089 | Ga0070671_100103816 | |||
| 1090 | Ga0070674_100000143 | |||
| 1091 | Ga0070674_100079753 | |||
| 1092 | Ga0070673_100008923 | |||
| 1093 | Ga0070673_100018740 | |||
| 1094 | Ga0070688_100006661 | |||
| 1095 | Ga0070688_100009731 | |||
| 1096 | Ga0070688_100064968 | |||
| 1097 | Ga0070688_100065073 | |||
| 1098 | Ga0070688_100174115 | |||
| 1099 | Ga0070659_100018847 | |||
| 1100 | Ga0070659_100111308 | |||
| 1101 | Ga0070667_100014750 | |||
| 1102 | Ga0070667_100043256 | |||
| 1103 | Ga0070667_100155064 | |||
| 1104 | Ga0070709_10130612 | |||
| 1105 | Ga0070714_100020018 | |||
| 1106 | Ga0070713_100004822 | |||
| 1107 | Ga0070713_100020467 | |||
| 1108 | Ga0070713_100084811 | |||
| 1109 | Ga0070713_100294125 | |||
| 1110 | Ga0070701_10010680 | |||
| 1111 | Ga0070701_10089578 | |||
| 1112 | Ga0070711_100078109 | |||
| 1113 | Ga0070711_100163771 | |||
| 1114 | Ga0070705_100000704 | |||
| 1115 | Ga0070700_100032916 | |||
| 1116 | Ga0070700_100073305 | |||
| 1117 | Ga0070694_100001822 | |||
| 1118 | Ga0070694_100069089 | |||
| 1119 | Ga0070694_100202982 | |||
| 1120 | Ga0070663_100010132 | |||
| 1121 | Ga0070663_100061648 | |||
| 1122 | Ga0070678_100036289 | |||
| 1123 | Ga0070678_100196453 | |||
| 1124 | Ga0070662_100106995 | |||
| 1125 | Ga0070681_10007479 | |||
| 1126 | Ga0070681_10015033 | |||
| 1127 | Ga0070681_10015833 | |||
| 1128 | Ga0070681_10060643 | |||
| 1129 | Ga0070681_10127067 | |||
| 1130 | Ga0068867_100001114 | |||
| 1131 | Ga0068867_100047855 | |||
| 1132 | Ga0068867_100050118 | |||
| 1133 | Ga0068867_100252119 | |||
| 1134 | Ga0070706_100124640 | |||
| 1135 | Ga0070707_100062214 | |||
| 1136 | Ga0070707_100096914 | |||
| 1137 | Ga0070707_100225237 | |||
| 1138 | Ga0070698_100003696 | |||
| 1139 | Ga0070698_100005828 | |||
| 1140 | Ga0070699_100000457 | |||
| 1141 | Ga0070699_100004350 | |||
| 1142 | Ga0070699_100031962 | |||
| 1143 | Ga0070699_100052047 | |||
| 1144 | Ga0070699_100080647 | |||
| 1145 | Ga0070699_100086996 | |||
| 1146 | Ga0070679_100001692 | |||
| 1147 | Ga0070679_100018177 | |||
| 1148 | Ga0070679_100025310 | |||
| 1149 | Ga0070679_100056750 | |||
| 1150 | Ga0070679_100074035 | |||
| 1151 | Ga0070684_100040400 | |||
| 1152 | Ga0068853_100112795 | |||
| 1153 | Ga0068853_100123923 | |||
| 1154 | Ga0068853_100167980 | |||
| 1155 | Ga0070672_100009546 | |||
| 1156 | Ga0070672_100027138 | |||
| 1157 | Ga0070686_100000861 | |||
| 1158 | Ga0070686_100004648 | |||
| 1159 | Ga0070686_100029381 | |||
| 1160 | Ga0070695_100000064 | |||
| 1161 | Ga0070696_100001482 | |||
| 1162 | Ga0070696_100001985 | |||
| 1163 | Ga0070696_100029109 | |||
| 1164 | Ga0070665_100007298 | |||
| 1165 | Ga0070665_100010641 | |||
| 1166 | Ga0070665_100017890 | |||
| 1167 | Ga0070665_100018594 | |||
| 1168 | Ga0070665_100028274 | |||
| 1169 | Ga0070665_100083335 | |||
| 1170 | Ga0070704_100007103 | |||
| 1171 | Ga0070704_100009708 | |||
| 1172 | Ga0070704_100045496 | |||
| 1173 | Ga0070704_100079102 | |||
| 1174 | Ga0070704_100192356 | |||
| 1175 | Ga0068855_100002900 | |||
| 1176 | Ga0068855_100019059 | |||
| 1177 | Ga0068855_100040460 | |||
| 1178 | Ga0068855_100043264 | |||
| 1179 | Ga0068855_100051520 | |||
| 1180 | Ga0068855_100091291 | |||
| 1181 | Ga0068855_100280079 | |||
| 1182 | Ga0070664_100041917 | |||
| 1183 | Ga0070664_100188441 | |||
| 1184 | Ga0070664_100192393 | |||
| 1185 | Ga0068857_100002823 | |||
| 1186 | Ga0068857_100012106 | |||
| 1187 | Ga0068857_100059226 | |||
| 1188 | Ga0068857_100099783 | |||
| 1189 | Ga0068857_100197332 | |||
| 1190 | Ga0068854_100007890 | |||
| 1191 | Ga0068854_100068824 | |||
| 1192 | Ga0068854_100118231 | |||
| 1193 | Ga0068856_100001937 | |||
| 1194 | Ga0068856_100062334 | |||
| 1195 | Ga0068856_100063710 | |||
| 1196 | Ga0070702_100005745 | |||
| 1197 | Ga0068852_100000040 | |||
| 1198 | Ga0068852_100014922 | |||
| 1199 | Ga0068852_100062682 | |||
| 1200 | Ga0068852_100183564 | |||
| 1201 | Ga0068859_100000180 | |||
| 1202 | Ga0068859_100007306 | |||
| 1203 | Ga0068859_100018472 | |||
| 1204 | Ga0068859_100018712 | |||
| 1205 | Ga0068859_100025109 | |||
| 1206 | Ga0068859_100035592 | |||
| 1207 | Ga0068859_100085901 | |||
| 1208 | Ga0068859_100403060 | |||
| 1209 | Ga0068864_100004327 | |||
| 1210 | Ga0068864_100023737 | |||
| 1211 | Ga0068864_100030559 | |||
| 1212 | Ga0068864_100036523 | |||
| 1213 | Ga0068864_100048708 | |||
| 1214 | Ga0068864_100063908 | |||
| 1215 | Ga0068864_100102508 | |||
| 1216 | Ga0068861_100001421 | |||
| 1217 | Ga0068861_100012591 | |||
| 1218 | Ga0068870_10000779 | |||
| 1219 | Ga0068870_10011176 | |||
| 1220 | Ga0068863_100005988 | |||
| 1221 | Ga0068863_100207061 | |||
| 1222 | Ga0068858_100001977 | |||
| 1223 | Ga0068858_100003784 | |||
| 1224 | Ga0068858_100012713 | |||
| 1225 | Ga0068858_100180883 | |||
| 1226 | Ga0068858_100206453 | |||
| 1227 | Ga0068860_100004193 | |||
| 1228 | Ga0068860_100010622 | |||
| 1229 | Ga0068860_100019864 | |||
| 1230 | Ga0068860_100286226 | |||
| 1231 | Ga0068862_100001270 | |||
| 1232 | Ga0068862_100025123 | |||
| 1233 | Ga0068862_100129011 | |||
| 1234 | Ga0081539_10001107 | |||
| 1235 | Ga0081539_10006892 | |||
| 1236 | Ga0070717_10037836 | |||
| 1237 | Ga0075365_10006974 | |||
| 1238 | Ga0070716_100050096 | |||
| 1239 | Ga0097621_100002357 | |||
| 1240 | Ga0097621_100013642 | |||
| 1241 | Ga0097621_100024363 | |||
| 1242 | Ga0068871_100010807 | |||
| 1243 | Ga0068871_100094222 | |||
| 1244 | Ga0068871_100169672 | |||
| 1245 | Ga0075428_100002102 | |||
| 1246 | Ga0075428_100019109 | |||
| 1247 | Ga0075428_100021511 | |||
| 1248 | Ga0075428_100040680 | |||
| 1249 | Ga0075428_100045963 | |||
| 1250 | Ga0075428_100105542 | |||
| 1251 | Ga0075428_100304413 | |||
| 1252 | Ga0075430_100003042 | |||
| 1253 | Ga0075430_100007983 | |||
| 1254 | Ga0075430_100013989 | |||
| 1255 | Ga0075430_100016386 | |||
| 1256 | Ga0075430_100064038 | |||
| 1257 | Ga0075430_100082061 | |||
| 1258 | Ga0075431_100014150 | |||
| 1259 | Ga0075431_100014321 | |||
| 1260 | Ga0075431_100034366 | |||
| 1261 | Ga0075431_100192238 | |||
| 1262 | Ga0075431_100235399 | |||
| 1263 | Ga0075433_10001136 | |||
| 1264 | Ga0075433_10021456 | |||
| 1265 | Ga0075433_10031464 | |||
| 1266 | Ga0075433_10042560 | |||
| 1267 | Ga0075434_100010027 | |||
| 1268 | Ga0075434_100011440 | |||
| 1269 | Ga0075434_100031731 | |||
| 1270 | Ga0075434_100046360 | |||
| 1271 | Ga0075434_100056464 | |||
| 1272 | Ga0075434_100154827 | |||
| 1273 | Ga0075434_100226310 | |||
| 1274 | Ga0075429_100002201 | |||
| 1275 | Ga0075429_100011476 | |||
| 1276 | Ga0075429_100015558 | |||
| 1277 | Ga0075429_100064196 | |||
| 1278 | Ga0075429_100072751 | |||
| 1279 | Ga0075429_100091410 | |||
| 1280 | Ga0075429_100103714 | |||
| 1281 | Ga0068865_100014820 | |||
| 1282 | Ga0068865_100154819 | |||
| 1283 | Ga0068865_100197892 | |||
| 1284 | Ga0075436_100088389 | |||
| 1285 | Ga0097620_100000180 | |||
| 1286 | Ga0097620_100007306 | |||
| 1287 | Ga0097620_100018472 | |||
| 1288 | Ga0097620_100018711 | |||
| 1289 | Ga0097620_100025112 | |||
| 1290 | Ga0097620_100035592 | |||
| 1291 | Ga0097620_100085903 | |||
| 1292 | Ga0097620_100403022 | |||
| 1293 | Ga0075435_100001202 | |||
| 1294 | Ga0075435_100002251 | |||
| 1295 | Ga0075435_100006158 | |||
| 1296 | Ga0075435_100006182 | |||
| 1297 | Ga0075435_100155273 | |||
| 1298 | Ga0105244_10000678 | |||
| 1299 | Ga0105240_10000312 | |||
| 1300 | Ga0105240_10002273 | |||
| 1301 | Ga0105240_10007947 | |||
| 1302 | Ga0105240_10011435 | |||
| 1303 | Ga0105240_10012892 | |||
| 1304 | Ga0105240_10055314 | |||
| 1305 | Ga0105240_10057743 | |||
| 1306 | Ga0105240_10081877 | |||
| 1307 | Ga0105240_10160641 | |||
| 1308 | Ga0105240_10165845 | |||
| 1309 | Ga0111539_10000159 | |||
| 1310 | Ga0111539_10003690 | |||
| 1311 | Ga0111539_10006988 | |||
| 1312 | Ga0111539_10033767 | |||
| 1313 | Ga0111539_10052188 | |||
| 1314 | Ga0111539_10060760 | |||
| 1315 | Ga0111539_10063215 | |||
| 1316 | Ga0111539_10122390 | |||
| 1317 | Ga0111539_10159861 | |||
| 1318 | Ga0111539_10179701 | |||
| 1319 | Ga0111539_10381031 | |||
| 1320 | Ga0105245_10020420 | |||
| 1321 | Ga0105245_10047116 | |||
| 1322 | Ga0105245_10123276 | |||
| 1323 | Ga0105247_10034018 | |||
| 1324 | Ga0105247_10068043 | |||
| 1325 | Ga0105247_10098441 | |||
| 1326 | Ga0114129_10001780 | |||
| 1327 | Ga0114129_10005772 | |||
| 1328 | Ga0114129_10008257 | |||
| 1329 | Ga0114129_10008325 | |||
| 1330 | Ga0114129_10014579 | |||
| 1331 | Ga0114129_10023777 | |||
| 1332 | Ga0114129_10030346 | |||
| 1333 | Ga0114129_10050086 | |||
| 1334 | Ga0114129_10050645 | |||
| 1335 | Ga0114129_10198603 | |||
| 1336 | Ga0114129_10266906 | |||
| 1337 | Ga0114129_10506431 | |||
| 1338 | Ga0105243_10019766 | |||
| 1339 | Ga0105243_10058213 | |||
| 1340 | Ga0105241_10011936 | |||
| 1341 | Ga0105241_10016182 | |||
| 1342 | Ga0105241_10050221 | |||
| 1343 | Ga0105242_10008024 | |||
| 1344 | Ga0105248_10000166 | |||
| 1345 | Ga0105248_10002222 | |||
| 1346 | Ga0105248_10029280 | |||
| 1347 | Ga0105248_10050029 | |||
| 1348 | Ga0105248_10065374 | |||
| 1349 | Ga0105248_10075185 | |||
| 1350 | Ga0105237_10051840 | |||
| 1351 | Ga0105238_10000680 | |||
| 1352 | Ga0105238_10004104 | |||
| 1353 | Ga0105238_10018121 | |||
| 1354 | Ga0105238_10024567 | |||
| 1355 | Ga0105238_10088927 | |||
| 1356 | Ga0105249_10000858 | |||
| 1357 | Ga0105249_10008306 | |||
| 1358 | Ga0105249_10182376 | |||
| 1359 | Ga0105239_10007060 | |||
| 1360 | Ga0105246_10027790 | |||
| 1361 | Ga0157371_10057680 | |||
| 1362 | Ga0157371_10099718 | |||
| 1363 | Ga0157370_10000164 | |||
| 1364 | Ga0157370_10015684 | |||
| 1365 | Ga0157370_10019444 | |||
| 1366 | Ga0157370_10028865 | |||
| 1367 | Ga0157370_10050928 | |||
| 1368 | Ga0157370_10076906 | |||
| 1369 | Ga0157369_10000021 | |||
| 1370 | Ga0157369_10000209 | |||
| 1371 | Ga0157369_10003493 | |||
| 1372 | Ga0157369_10028132 | |||
| 1373 | Ga0157369_10035469 | |||
| 1374 | Ga0157369_10049410 | |||
| 1375 | Ga0157369_10141542 | |||
| 1376 | Ga0157369_10151363 | |||
| 1377 | Ga0171462_1022 | |||
| 1378 | Ga0157374_10009440 | |||
| 1379 | Ga0157374_10010971 | |||
| 1380 | Ga0157374_10019766 | |||
| 1381 | Ga0157378_10012848 | |||
| 1382 | Ga0157378_10019283 | |||
| 1383 | Ga0157378_10113931 | |||
| 1384 | Ga0157378_10135519 | |||
| 1385 | Ga0163162_10008251 | |||
| 1386 | Ga0163162_10013347 | |||
| 1387 | Ga0163162_10042903 | |||
| 1388 | Ga0163162_10078701 | |||
| 1389 | Ga0163162_10147385 | |||
| 1390 | Ga0157372_10000256 | |||
| 1391 | Ga0157372_10006493 | |||
| 1392 | Ga0157372_10033163 | |||
| 1393 | Ga0157372_10034530 | |||
| 1394 | Ga0157372_10038963 | |||
| 1395 | Ga0157375_10000281 | |||
| 1396 | Ga0157375_10027879 | |||
| 1397 | Ga0157375_10343157 | |||
| 1398 | Ga0163163_10027026 | |||
| 1399 | Ga0163163_10059648 | |||
| 1400 | Ga0163163_10073100 | |||
| 1401 | Ga0163163_10145920 | |||
| 1402 | Ga0163163_10197511 | |||
| 1403 | Ga0163163_10211767 | |||
| 1404 | Ga0163163_10234890 | |||
| 1405 | Ga0157380_10008367 | |||
| 1406 | Ga0157380_10341651 | |||
| 1407 | Ga0157380_10369601 | |||
| 1408 | Ga0182008_10001193 | |||
| 1409 | Ga0157377_10005375 | |||
| 1410 | Ga0157377_10015758 | |||
| 1411 | Ga0157379_10004419 | |||
| 1412 | Ga0157379_10054844 | |||
| 1413 | Ga0157376_10001792 | |||
| 1414 | Ga0157376_10105507 | |||
| 1415 | Ga0157376_10113090 | |||
| 1416 | Ga0157376_10229368 | |||
| 1417 | Ga0182006_1000046 | |||
| 1418 | Ga0182007_10000044 | |||
| 1419 | Ga0182005_1000032 | |||
| 1420 | Ga0163161_10008887 | |||
| 1421 | Ga0213876_10002213 | |||
| 1422 | Ga0209565_1000005 | |||
| 1423 | Ga0209673_1000027 | |||
| 1424 | Ga0209130_1000065 | |||
| 1425 | Ga0209675_1000004 | |||
| 1426 | Ga0209025_1000005 | |||
| 1427 | Ga0209564_1000006 | |||
| 1428 | Ga0209564_1000050 | |||
| 1429 | Ga0209758_1012915 | |||
| 1430 | Ga0209256_1000031 | |||
| 1431 | Ga0207697_10000704 | |||
| 1432 | Ga0207697_10002895 | |||
| 1433 | Ga0207697_10012325 | |||
| 1434 | Ga0207655_1012763 | |||
| 1435 | Ga0207682_10001891 | |||
| 1436 | Ga0207682_10004527 | |||
| 1437 | Ga0207682_10018742 | |||
| 1438 | Ga0207710_10020350 | |||
| 1439 | Ga0207710_10063479 | |||
| 1440 | Ga0207688_10011291 | |||
| 1441 | Ga0207688_10018320 | |||
| 1442 | Ga0207688_10092483 | |||
| 1443 | Ga0207680_10000003 | |||
| 1444 | Ga0207680_10027253 | |||
| 1445 | Ga0207647_10028405 | |||
| 1446 | Ga0207645_10009178 | |||
| 1447 | Ga0207643_10001379 | |||
| 1448 | Ga0207643_10001906 | |||
| 1449 | Ga0207643_10025175 | |||
| 1450 | Ga0207643_10083523 | |||
| 1451 | Ga0207705_10000940 | |||
| 1452 | Ga0207705_10001812 | |||
| 1453 | Ga0207654_10008464 | |||
| 1454 | Ga0207654_10015707 | |||
| 1455 | Ga0207654_10058801 | |||
| 1456 | Ga0207707_10015222 | |||
| 1457 | Ga0207707_10016367 | |||
| 1458 | Ga0207707_10052960 | |||
| 1459 | Ga0207707_10137703 | |||
| 1460 | Ga0207707_10176332 | |||
| 1461 | Ga0207695_10000341 | |||
| 1462 | Ga0207695_10017849 | |||
| 1463 | Ga0207695_10042629 | |||
| 1464 | Ga0207695_10091887 | |||
| 1465 | Ga0207695_10277606 | |||
| 1466 | Ga0207671_10009199 | |||
| 1467 | Ga0207671_10058454 | |||
| 1468 | Ga0207663_10175791 | |||
| 1469 | Ga0207660_10044102 | |||
| 1470 | Ga0207662_10005937 | |||
| 1471 | Ga0207657_10014858 | |||
| 1472 | Ga0207657_10014903 | |||
| 1473 | Ga0207657_10040729 | |||
| 1474 | Ga0207649_10013967 | |||
| 1475 | Ga0207652_10003642 | |||
| 1476 | Ga0207652_10004161 | |||
| 1477 | Ga0207652_10007231 | |||
| 1478 | Ga0207652_10026709 | |||
| 1479 | Ga0207652_10038703 | |||
| 1480 | Ga0207652_10084277 | |||
| 1481 | Ga0207646_10176121 | |||
| 1482 | Ga0207681_10003028 | |||
| 1483 | Ga0207681_10048151 | |||
| 1484 | Ga0207681_10051656 | |||
| 1485 | Ga0207694_10002851 | |||
| 1486 | Ga0207694_10005041 | |||
| 1487 | Ga0207694_10023397 | |||
| 1488 | Ga0207694_10026394 | |||
| 1489 | Ga0207650_10002755 | |||
| 1490 | Ga0207650_10026340 | |||
| 1491 | Ga0207650_10036464 | |||
| 1492 | Ga0207659_10000914 | |||
| 1493 | Ga0207659_10009263 | |||
| 1494 | Ga0207659_10155235 | |||
| 1495 | Ga0207687_10045444 | |||
| 1496 | Ga0207700_10053602 | |||
| 1497 | Ga0207664_10040493 | |||
| 1498 | Ga0207644_10015593 | |||
| 1499 | Ga0207644_10059537 | |||
| 1500 | Ga0207644_10092895 | |||
| 1501 | Ga0207690_10076822 | |||
| 1502 | Ga0207706_10006185 | |||
| 1503 | Ga0207706_10027627 | |||
| 1504 | Ga0207706_10067402 | |||
| 1505 | Ga0207706_10078680 | |||
| 1506 | Ga0207709_10028589 | |||
| 1507 | Ga0207670_10003410 | |||
| 1508 | Ga0207670_10005670 | |||
| 1509 | Ga0207670_10010780 | |||
| 1510 | Ga0207669_10000757 | |||
| 1511 | Ga0207704_10009050 | |||
| 1512 | Ga0207704_10010163 | |||
| 1513 | Ga0207704_10091555 | |||
| 1514 | Ga0207691_10001298 | |||
| 1515 | Ga0207691_10055866 | |||
| 1516 | Ga0207691_10142974 | |||
| 1517 | Ga0207711_10000141 | |||
| 1518 | Ga0207711_10004086 | |||
| 1519 | Ga0207711_10024424 | |||
| 1520 | Ga0207711_10026520 | |||
| 1521 | Ga0207689_10008557 | |||
| 1522 | Ga0207689_10030848 | |||
| 1523 | Ga0207689_10054212 | |||
| 1524 | Ga0207689_10057665 | |||
| 1525 | Ga0207661_10035742 | |||
| 1526 | Ga0207679_10096666 | |||
| 1527 | Ga0207679_10121520 | |||
| 1528 | Ga0207667_10001147 | |||
| 1529 | Ga0207667_10042887 | |||
| 1530 | Ga0207667_10048642 | |||
| 1531 | Ga0207667_10202329 | |||
| 1532 | Ga0207667_10316681 | |||
| 1533 | Ga0207651_10003661 | |||
| 1534 | Ga0207651_10044820 | |||
| 1535 | Ga0207712_10007244 | |||
| 1536 | Ga0207712_10021086 | |||
| 1537 | Ga0207668_10013128 | |||
| 1538 | Ga0207668_10013653 | |||
| 1539 | Ga0207640_10036133 | |||
| 1540 | Ga0207658_10110616 | |||
| 1541 | Ga0207658_10183084 | |||
| 1542 | Ga0207677_10035339 | |||
| 1543 | Ga0207703_10001119 | |||
| 1544 | Ga0207703_10078926 | |||
| 1545 | Ga0207703_10113299 | |||
| 1546 | Ga0207639_10030350 | |||
| 1547 | Ga0207639_10089916 | |||
| 1548 | Ga0207678_10002203 | |||
| 1549 | Ga0207678_10005401 | |||
| 1550 | Ga0207708_10024453 | |||
| 1551 | Ga0207708_10028186 | |||
| 1552 | Ga0207702_10063865 | |||
| 1553 | Ga0207702_10208807 | |||
| 1554 | Ga0207641_10131174 | |||
| 1555 | Ga0207641_10220503 | |||
| 1556 | Ga0207648_10046185 | |||
| 1557 | Ga0207648_10047391 | |||
| 1558 | Ga0207648_10070802 | |||
| 1559 | Ga0207676_10003276 | |||
| 1560 | Ga0207676_10017141 | |||
| 1561 | Ga0207676_10022409 | |||
| 1562 | Ga0207676_10034141 | |||
| 1563 | Ga0207676_10173953 | |||
| 1564 | Ga0207674_10015243 | |||
| 1565 | Ga0207674_10016607 | |||
| 1566 | Ga0207674_10050268 | |||
| 1567 | Ga0207674_10065037 | |||
| 1568 | Ga0207674_10071684 | |||
| 1569 | Ga0207674_10145060 | |||
| 1570 | Ga0207675_100018999 | |||
| 1571 | Ga0207675_100190825 | |||
| 1572 | Ga0207683_10024624 | |||
| 1573 | Ga0207683_10072725 | |||
| 1574 | Ga0207683_10112797 | |||
| 1575 | Ga0207683_10213047 | |||
| 1576 | Ga0207698_10020516 | |||
| 1577 | Ga0207698_10192455 | |||
| 1578 | Ga0207428_10004273 | |||
| 1579 | Ga0207428_10005162 | |||
| 1580 | Ga0207428_10005911 | |||
| 1581 | Ga0207428_10019022 | |||
| 1582 | Ga0207428_10032313 | |||
| 1583 | Ga0268266_10000011 | |||
| 1584 | Ga0268266_10010860 | |||
| 1585 | Ga0268266_10022114 | |||
| 1586 | Ga0268266_10029627 | |||
| 1587 | Ga0268266_10057272 | |||
| 1588 | Ga0268266_10229814 | |||
| 1589 | Ga0268265_10002863 | |||
| 1590 | Ga0268265_10184625 | |||
| 1591 | Ga0268264_10110148 | |||
| 1592 | Ga0268264_10143089 | |||
| 1593 | Ga0265319_1009083 | |||
| 1594 | Ga0265318_10000122 | |||
| 1595 | Ga0265318_10007779 | |||
| 1596 | Ga0265318_10032918 | |||
| 1597 | Ga0307515_10096088 | |||
| 1598 | Ga0265338_10016375 | |||
| 1599 | Ga0265338_10126506 | |||
| 1600 | Ga0265338_10129346 | |||
| 1601 | Ga0265338_10135103 | |||
| 1602 | Ga0265330_10001106 | |||
| 1603 | Ga0265320_10000019 | |||
| 1604 | Ga0265325_10011088 | |||
| 1605 | Ga0265325_10014355 | |||
| 1606 | Ga0265325_10020153 | |||
| 1607 | Ga0265329_10006852 | |||
| 1608 | Ga0265329_10020185 | |||
| 1609 | Ga0265340_10001198 | |||
| 1610 | Ga0265339_10026388 | |||
| 1611 | Ga0265339_10033368 | |||
| 1612 | Ga0265331_10000028 | |||
| 1613 | Ga0265316_10000092 | |||
| 1614 | Ga0307509_10002182 | |||
| 1615 | Ga0307509_10023635 | |||
| 1616 | Ga0307408_100049797 | |||
| 1617 | Ga0265313_10000704 | |||
| 1618 | Ga0265313_10001475 | |||
| 1619 | Ga0265314_10000131 | |||
| 1620 | Ga0265314_10001078 | |||
| 1621 | Ga0265314_10104921 | |||
| 1622 | Ga0265342_10000161 | |||
| 1623 | Ga0265342_10002743 | |||
| 1624 | Ga0307405_10013435 | |||
| 1625 | Ga0307405_10015035 | |||
| 1626 | Ga0307410_10024457 | |||
| 1627 | Ga0307412_10083861 | |||
| 1628 | Ga0307409_100013111 | |||
| 1629 | Ga0307416_100000731 | |||
| 1630 | Ga0307416_100006131 | |||
| 1631 | Ga0307416_100008501 | |||
| 1632 | Ga0307416_100080980 | |||
| 1633 | Ga0307414_10000449 | |||
| 1634 | Ga0307414_10064074 | |||
| 1635 | Ga0307411_10015527 | |||
| 1636 | Ga0307411_10113715 | |||
| 1637 | Ga0307415_100163569 | |||
| 1638 | Ga0373948_0002220 | |||
| 1639 | Ga0373958_0000338 | |||
| 1640 | Ga0373938_0002432 | |||
| 1641 | Ga0373944_0004683 | |||
| 1642 | Ga0373949_0001593 | |||
| 1643 | Ga0373951_0000334 | |||
| 1644 | Ga0373923_0034942 | |||
| 1645 | Ga0373932_0001320 | |||
| 1646 | Ga0373954_0001824 | |||
| 1647 | Ga0373954_0066556 | |||
| 1648 | Ga0373956_0025803 | |||
| 1649 | Ga0373943_0100510 | |||
| 1650 | Ga0373955_0033868 | |||
| 1651 | Ga0373942_0000300 | |||
| 1652 | Ga0373924_0014375 | |||
| 1653 | Ga0373935_0001821 | |||
| 1654 | Ga0373927_0002543 | |||
| 1655 | Ga0373927_0025807 | |||
| 1656 | Ga0373933_0000034 | |||
| 1657 | Ga0373933_0092613 | |||
| 1658 | Ga0373947_0048591 | |||
| 1659 | Ga0373937_0000001 | |||
| 1660 | Ga0373937_0116319 | |||
| 1661 | Ga0373925_0218972 | |||
| 1662 | Ga0373925_0222934 | |||
| 1663 | Ga0395900_0021101 | |||
| 1664 | Ga0395900_0187362 | |||
| 1665 | Ga0395898_0092856 | |||
| 1666 | Ga0395901_0012641 | |||
| 1667 | Ga0395901_0018220 | |||
| 1668 | Ga0436365_1759017 | |||
| 1669 | Ga0436365_1796416 | |||
| 1670 | Ga0439447_001727 | |||
| 1671 | Ga0451797_0723557 | |||
| 1672 | Ga0451807_1802640 | |||
| 1673 | Ga0451807_2035948 | |||
| 1674 | Ga0451843_0291122 | |||
| 1675 | Ga0439431_0026094 | |||
| 1676 | Ga0439446_0018374 | |||
| 1677 | Ga0451577_0054247 | |||
| 1678 | Ga0451577_0097912 | |||
| 1679 | Ga0466969_0033773 | |||
| 1680 | Ga0466961_0022799 | |||
| 1681 | Ga0466961_0039350 | |||
| 1682 | Ga0466959_0007010 | |||
| 1683 | Ga0451576_0090138 | |||
| 1684 | Ga0451576_0101277 | |||
| 1685 | Ga0451576_0255244 | |||
| 1686 | Ga0495617_000007 | |||
| 1687 | Ga0495592_0032891 | |||
| 1688 | Ga0495629_0002811 | |||
| 1689 | Ga0495638_0017261 | |||
| 1690 | Ga0495651_0001343 | |||
| 1691 | Ga0495651_0004152 | |||
| 1692 | Ga0495651_0011894 | |||
| 1693 | Ga0495651_0020556 | |||
| 1694 | Ga0495653_0000297 | |||
| 1695 | Ga0495653_0008111 | |||
| 1696 | Ga0495653_0053088 | |||
| 1697 | Ga0495650_0000357 | |||
| 1698 | Ga0495650_0000852 | |||
| 1699 | Ga0495650_0007439 | |||
| 1700 | Ga0495580_0017641 | |||
| 1701 | Ga0495580_0049246 | |||
| 1702 | Ga0495580_0077173 | |||
| 1703 | Ga0495580_0106816 | |||
| 1704 | Ga0495582_0136186 | |||
| 1705 | Ga0495639_0009371 | |||
| 1706 | Ga0495584_0000343 | |||
| 1707 | Ga0495584_0027742 | |||
| 1708 | Ga0495584_0050909 | |||
| 1709 | Ga0495585_0000257 | |||
| 1710 | Ga0495585_0000364 | |||
| 1711 | Ga0495585_0003059 | |||
| 1712 | Ga0495585_0046711 | |||
| 1713 | Ga0495594_0004342 | |||
| 1714 | Ga0495594_0067014 | |||
| 1715 | Ga0495596_0000578 | |||
| 1716 | Ga0495607_0005633 | |||
| 1717 | Ga0495583_0000318 | |||
| 1718 | Ga0495583_0009533 | |||
| 1719 | Ga0495583_0025898 | |||
| 1720 | Ga0495583_0030315 | |||
| 1721 | Ga0495606_0000037 | |||
| 1722 | Ga0495606_0000331 | |||
| 1723 | Ga0495608_0005483 | |||
| 1724 | Ga0495608_0007458 | |||
| 1725 | Ga0495610_0000004 | |||
| 1726 | Ga0495610_0028593 | |||
| 1727 | Ga0495610_0053354 | |||
| 1728 | Ga0495616_0018539 | |||
| 1729 | Ga0495628_0006870 | |||
| 1730 | Ga0495630_0002003 | |||
| 1731 | Ga0495637_0001635 | |||
| 1732 | Ga0495643_0000233 | |||
| 1733 | Ga0495643_0003131 | |||
| 1734 | Ga0495643_0006650 | |||
| 1735 | Ga0495644_0007794 | |||
| 1736 | Ga0495644_0008523 | |||
| 1737 | Ga0495648_0001623 | |||
| 1738 | Ga0495648_0019046 | |||
| 1739 | Ga0495648_0081788 | |||
| 1740 | Ga0495642_0026689 | |||
| 1741 | Ga0495652_0009228 | |||
| 1742 | Ga0495652_0042210 | |||
| 1743 | Ga0495654_0000004 | |||
| 1744 | Ga0495665_0000965 | |||
| 1745 | Ga0495665_0002916 | |||
| 1746 | Ga0495665_0096855 | |||
| 1747 | Ga0495587_0000392 | |||
| 1748 | Ga0495587_0004124 | |||
| 1749 | Ga0495609_0003914 | |||
| 1750 | Ga0495609_0011277 | |||
| 1751 | Ga0495609_0020365 | |||
| 1752 | Ga0495609_0026513 | |||
| 1753 | Ga0495621_0010391 | |||
| 1754 | Ga0495621_0015889 | |||
| 1755 | Ga0495621_0019944 | |||
| 1756 | Ga0495621_0025945 | |||
| 1757 | Ga0495645_0048144 | |||
| 1758 | Ga0495622_0005665 | |||
| 1759 | Ga0495622_0051424 | |||
| 1760 | Ga0495633_0000756 | |||
| 1761 | Ga0495667_0010677 | |||
| 1762 | Ga0495667_0024704 | |||
| 1763 | Ga0495656_0005498 | |||
| 1764 | Ga0495668_0002904 | |||
| 1765 | Ga0495668_0005002 | |||
| 1766 | Ga0495668_0008628 | |||
| 1767 | Ga0495668_0011101 | |||
| 1768 | Ga0495611_0030837 | |||
| 1769 | Ga0495625_0042020 | |||
| 1770 | Ga0495635_0189194 | |||
| 1771 | Ga0495659_0001388 | |||
| 1772 | Ga0495659_0011649 | |||
| 1773 | Ga0495661_0004759 | |||
| 1774 | Ga0495661_0010720 | |||
| 1775 | Ga0495661_0015184 | |||
| 1776 | Ga0495661_0034244 | |||
| 1777 | Ga0495588_0005258 | |||
| 1778 | Ga0495588_0017791 | |||
| 1779 | Ga0495657_0020903 | |||
| 1780 | Ga0495657_0098896 | |||
| 1781 | Ga0495599_0079821 | |||
| 1782 | Ga0495623_0014004 | |||
| 1783 | Ga0495646_0003866 | |||
| 1784 | Ga0495658_0001597 | |||
| 1785 | Ga0495669_0008486 | |||
| 1786 | Ga0495613_0018906 | |||
| 1787 | Ga0495624_0023543 | |||
| 1788 | Ga0495670_0002448 | |||
| 1789 | Ga0495671_0000177 | |||
| 1790 | Ga0495649_0008013 | |||
| 1791 | Ga0495600_0018515 | |||
| 1792 | Ga0495660_0001429 | |||
| 1793 | Ga0495581_0002799 | |||
| 1794 | Ga0495581_0060451 | |||
| 1795 | Ga0495604_0006990 | |||
| 1796 | Ga0495604_0009216 | |||
| 1797 | Ga0495636_0004916 | |||
| 1798 | Ga0495674_0011791 | |||
| 1799 | Ga0495674_0027948 | |||
| 1800 | Ga0495674_0071474 | |||
| 1801 | Ga0495672_0000206 | |||
| 1802 | Ga0495672_0000242 | |||
| 1803 | Ga0495672_0096319 | |||
| 1804 | Ga0495676_0030478 | |||
| 1805 | Ga0495676_0055978 | |||
| 1806 | Ga0495676_0125552 | |||
| 1807 | Ga0495680_0000068 | |||
| 1808 | Ga0495680_0005490 | |||
| 1809 | Ga0495680_0034636 | |||
| 1810 | Ga0495683_0000007 | |||
| 1811 | Ga0495675_0000027 | |||
| 1812 | Ga0495675_0001586 | |||
| 1813 | Ga0495675_0047659 | |||
| 1814 | Ga0495673_0000017 | |||
| 1815 | Ga0495673_0000027 | |||
| 1816 | Ga0495681_0004212 | |||
| 1817 | Ga0495684_0001011 | |||
| 1818 | Ga0495686_0000006 | |||
| 1819 | Ga0495686_0002116 | |||
| 1820 | Ga0495686_0002175 | |||
| 1821 | Ga0495686_0009047 | |||
| 1822 | Ga0495593_0007764 | |||
| 1823 | Ga0495593_0028545 | |||
| 1824 | Ga0495602_0013119 | |||
| 1825 | Ga0495614_0038149 | |||
| 1826 | Ga0495626_0004800 | |||
| 1827 | Ga0496100_0030977 | |||
| 1828 | Ga0496102_0041537 | |||
| 1829 | Ga0496102_0233331 | |||
| 1830 | Ga0496104_0000291 | |||
| 1831 | Ga0496104_0119307 | |||
| 1832 | Ga0496105_0000075 | |||
| 1833 | Ga0496105_0255414 | |||
| 1834 | Ga0496106_0129421 | |||
| 1835 | Ga0496108_0103156 | |||
| 1836 | Ga0496110_0172088 | |||
| 1837 | Ga0496112_0078500 | |||
| 1838 | Ga0496112_0119969 | |||
| 1839 | Ga0496112_0164589 | |||
| 1840 | Ga0496112_0237821 | |||
| 1841 | Ga0496114_0020789 | |||
| 1842 | Ga0496114_0163257 | |||
| 1843 | Ga0496115_0077369 | |||
| 1844 | Ga0496115_0128393 | |||
| 1845 | Ga0496116_0045702 | |||
| 1846 | Ga0496117_0000010 | |||
| 1847 | Ga0496117_0130766 | |||
| 1848 | Ga0496118_0000009 | |||
| 1849 | Ga0496118_0000182 | |||
| 1850 | Ga0496121_0006227 | |||
| 1851 | Ga0496121_0012863 | |||
| 1852 | Ga0496121_0023762 | |||
| 1853 | Ga0496121_0076340 | |||
| 1854 | Ga0496122_0002845 | |||
| 1855 | Ga0496122_0012865 | |||
| 1856 | Ga0496122_0020494 | |||
| 1857 | Ga0496123_0007735 | |||
| 1858 | Ga0496123_0024801 | |||
| 1859 | Ga0496124_0024133 | |||
| 1860 | Ga0496126_0000139 | |||
| 1861 | Ga0496126_0002052 | |||
| 1862 | Ga0496126_0020972 | |||
| 1863 | Ga0496126_0115897 | |||
| 1864 | Ga0496126_0234229 | |||
| 1865 | Ga0495678_002205 | |||
| 1866 | Ga0501299_004431 | |||
| 1867 | Ga0501299_005221 | |||
| 1868 | Ga0501033_0014916 | |||
| 1869 | Ga0501033_0031227 | |||
| 1870 | Ga0501034_0004072 | |||
| 1871 | Ga0501034_0012936 | |||
| 1872 | Ga0501034_0023006 | |||
| 1873 | Ga0501034_0067442 | |||
| 1874 | Ga0501034_0068468 | |||
| 1875 | Ga0501034_0210748 | |||
| 1876 | Ga0501036_0008184 | |||
| 1877 | Ga0501036_0008804 | |||
| 1878 | Ga0501037_0001648 | |||
| 1879 | Ga0501037_0009111 | |||
| 1880 | Ga0501037_0034714 | |||
| 1881 | Ga0501038_0007833 | |||
| 1882 | Ga0501038_0013770 | |||
| 1883 | Ga0501042_0192497 | |||
| 1884 | Ga0501043_0031371 | |||
| 1885 | Ga0501043_0072158 | |||
| 1886 | Ga0501046_0000887 | |||
| 1887 | Ga0501046_0020892 | |||
| 1888 | Ga0501047_0014503 | |||
| 1889 | Ga0501047_0018167 | |||
| 1890 | Ga0501047_0058552 | |||
| 1891 | Ga0501047_0070013 | |||
| 1892 | Ga0501047_0309106 | |||
| 1893 | Ga0501048_0036930 | |||
| 1894 | Ga0501048_0060301 | |||
| 1895 | Ga0501067_0009767 | |||
| 1896 | Ga0501067_0029285 | |||
| 1897 | Ga0501067_0075269 | |||
| 1898 | Ga0501068_0020186 | |||
| 1899 | Ga0501069_0001461 | |||
| 1900 | Ga0501070_0017220 | |||
| 1901 | Ga0501071_0120738 | |||
| 1902 | Ga0501071_0225164 | |||
| 1903 | Ga0501072_0016599 | |||
| 1904 | Ga0501073_0016712 | |||
| 1905 | Ga0501073_0035063 | |||
| 1906 | Ga0501074_0016520 | |||
| 1907 | Ga0501074_0095027 | |||
| 1908 | Ga0501074_0096007 | |||
| 1909 | Ga0501075_0032354 | |||
| 1910 | Ga0501076_0081211 | |||
| 1911 | Ga0501077_0063713 | |||
| 1912 | Ga0501079_0008610 | |||
| 1913 | Ga0501079_0024837 | |||
| 1914 | Ga0501080_0080245 | |||
| 1915 | Ga0501081_0019726 | |||
| 1916 | Ga0501081_0066077 | |||
| 1917 | Ga0501081_0088367 | |||
| 1918 | Ga0501083_0006954 | |||
| 1919 | Ga0501083_0014583 | |||
| 1920 | Ga0501269_000024 | |||
| 1921 | Ga0501035_0013386 | |||
| 1922 | Ga0501035_0021497 | |||
| 1923 | Ga0501035_0287566 | |||
| 1924 | Ga0501044_0018895 | |||
| 1925 | Ga0501044_0026431 | |||
| 1926 | Ga0501045_0005367 | |||
| 1927 | Ga0501045_0037400 | |||
| 1928 | nmdc:mga0yw44_42582_c1 | |||
| 1929 | nmdc:mga05p37_14271_c1 | |||
| 1930 | nmdc:mga05p37_263442_c1 | |||
| 1931 | nmdc:mga05p37_288908_c1 | |||
| 1932 | nmdc:mga05p37_3248_c1 | |||
| 1933 | nmdc:mga05p37_33175_c1 | |||
| 1934 | nmdc:mga05p37_339636_c1 | |||
| 1935 | nmdc:mga05p37_5160_c1 | |||
| 1936 | nmdc:mga05p37_63879_c1 | |||
| 1937 | nmdc:mga05p37_73775_c1 | |||
| 1938 | nmdc:mga09592_10440_c1 | |||
| 1939 | nmdc:mga09592_110236_c1 | |||
| 1940 | nmdc:mga09592_32935_c1 | |||
| 1941 | nmdc:mga09592_38094_c1 | |||
| 1942 | nmdc:mga09592_4121_c1 | |||
| 1943 | nmdc:mga09592_91659_c1 | |||
| 1944 | nmdc:mga0qj67_14341_c1 | |||
| 1945 | nmdc:mga0qj67_156522_c1 | |||
| 1946 | nmdc:mga0qj67_2530_c1 | |||
| 1947 | nmdc:mga0qj67_31339_c1 | |||
| 1948 | nmdc:mga0qj67_63098_c1 | |||
| 1949 | nmdc:mga0qj67_66497_c1 | |||
| 1950 | nmdc:mga06r32_112685_c1 | |||
| 1951 | nmdc:mga06r32_167689_c1 | |||
| 1952 | nmdc:mga06r32_24242_c1 | |||
| 1953 | nmdc:mga06r32_24456_c1 | |||
| 1954 | nmdc:mga06r32_69537_c1 | |||
| 1955 | nmdc:mga08y16_1346_c1 | |||
| 1956 | nmdc:mga08y16_141997_c1 | |||
| 1957 | nmdc:mga08y16_30179_c1 | |||
| 1958 | nmdc:mga08y16_371649_c1 | |||
| 1959 | nmdc:mga08y16_49007_c1 | |||
| 1960 | nmdc:mga08y16_5495_c1 | |||
| 1961 | nmdc:mga08y16_73656_c1 | |||
| 1962 | nmdc:mga08y16_81746_c1 | |||
| 1963 | nmdc:mga0n895_11322_c1 | |||
| 1964 | nmdc:mga0n895_142622_c1 | |||
| 1965 | nmdc:mga0n895_220045_c1 | |||
| 1966 | nmdc:mga0n895_3505_c1 | |||
| 1967 | nmdc:mga0n895_358545_c1 | |||
| 1968 | nmdc:mga0n895_4988_c1 | |||
| 1969 | nmdc:mga0rr50_10664_c1 | |||
| 1970 | nmdc:mga0rr50_170372_c1 | |||
| 1971 | nmdc:mga0rr50_72231_c1 | |||
| 1972 | nmdc:mga0a205_12595_c2 | |||
| 1973 | nmdc:mga0a205_186685_c1 | |||
| 1974 | nmdc:mga0a205_20548_c1 | |||
| 1975 | nmdc:mga0a205_302685_c1 | |||
| 1976 | nmdc:mga0a205_30644_c1 | |||
| 1977 | nmdc:mga0a205_8668_c1 | |||
| 1978 | Ga0495612_0006784 | |||
| 1979 | Ga0495619_0145238 | |||
| 1980 | Ga0500644_0010739 | |||
| 1981 | Ga0500651_0000222 | |||
| 1982 | Ga0500555_002778 | |||
| 1983 | Ga0500555_008549 | |||
| 1984 | Ga0500618_001426 | |||
| 1985 | Ga0500616_0000086 | |||
| 1986 | Ga0500645_000044 | |||
| 1987 | Ga0500599_003594 | |||
| 1988 | Ga0501084_0032006 | |||
| 1989 | Ga0501084_0044940 | |||
| 1990 | Ga0501084_0146042 | |||
| 1991 | Ga0590071_001592 | |||
| 1992 | Ga0590075_000138 | |||
| 1993 | Ga0590077_000077 | |||
| 1994 | Ga0590077_001774 | |||
| 1995 | Ga0501082_0012400 | |||
| 1996 | Ga0501082_0013767 | |||
| 1997 | Ga0501082_0028608 | |||
| 1998 | Ga0530510_0006774 | |||
| 1999 | Ga0530510_0136903 | |||
| 2000 | 2601670618 | |||
| 2001 | 2643976130 | |||
| 2002 | 2738825483 | |||
| 2003 | 2739149280 | |||
| 2004 | 2739191199 | |||
| 2005 | 2739317676 | |||
| 2006 | 2739335917 | |||
| 2007 | 2857548037 | |||
| 2008 | 2857561170 | |||
| 2009 | 2885082956 | |||
| 2010 | 2904429110 | |||
| 2011 | 2917705053 | |||
| 2012 | 2919514911 | |||
| 2013 | 2919679030 | |||
| 2014 | 2932412627 | |||
| 2015 | 2932420142 | |||
| 2016 | 2941492832 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lo8-assembly1.cif.gz_Z | nora in complex with fab36 | 0.8168 | 19 | 421 |
| 6zgr-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution | 0.8127 | 21 | 424 |
| 6rw3-assembly3.cif.gz_C | the molecular basis for sugar import in malaria parasites. | 0.8097 | 18 | 427 |
| 6zgr-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution | 0.8027 | 21 | 424 |
| 8jt9-assembly1.cif.gz_A | human vmat2 complex with ketanserin | 0.802 | 17 | 420 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37643_22_237_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9958 | 21 | 235 | 1.20.1250.20 |
| af_P37643_245_439_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9928 | 243 | 430 | 1.20.1250.20 |
| af_P37643_22_237_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9867 | 21 | 235 | 1.20.1250.20 |
| af_O05301_232_420_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9665 | 246 | 429 | 1.20.1250.20 |
| af_Q2G0K4_17_228_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9638 | 20 | 229 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6D1I932-F1-model_v4 | deleted | 0.9729 | 18 | 431 |
|
| AF-A0A1C2B6B9-F1-model_v4 | deleted | 0.9704 | 24 | 431 |
|
| AF-A0A3D0VG45-F1-model_v4 | MFS transporter | 0.9613 | 19 | 382 |
GO:0005886
GO:0022857 |
| AF-A0A3D0Q216-F1-model_v4 | MFS transporter | 0.9562 | 12 | 246 |
GO:0005886
GO:0022857 |
| AF-A0A809WQV5-F1-model_v4 | deleted | 0.9561 | 20 | 220 |
|