F488079

General Info

Members Datasets Scaffolds Average Seq Length
1008 423 2016 426

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_32609_c1|nmdc:mga05p37_32609_c1_4980_6212
Length 410
Sequence VLFASLIGTTIEFFDFYIYATAAVLVFPRLFFPASDPASATLASLATFAIAFVARPIGSALFGHFGDRIGRKTTLVAALLTMGLSTVTIGLLPTYATIGLAAPLLLAICRFGQGLGLGGEWGGAVLLAVENAPPDRRAWYGMFPQLGAPLGFIFSGSTFLALSAWLTNEQFFAFGWRLPFLASSALVIVGLYVRLTITETPVFRELEKRERVGVPMFVVFTRHTRALLLGVLVSLTAFVIFYLMTVFALSWGTSALGYSRERFLIIQLFGILFFALFIPIAAILAEHGRRRMLMWVNVAIGVFGAVLAPLFTSGTFGATAMMVLGMSLVGLVYGPLGTLLSETFPTAVRYSGSSLTFNLAGIFGASLAPYAATYLAKTYGLQYVGYYLSVAAVLSLAGLAGSRETKDARL

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
201 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
202 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
205 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
206 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
207 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
208 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
226 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
227 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
228 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
229 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
230 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
233 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
234 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
249 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
250 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
251 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
252 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
253 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
254 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
261 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
276 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
277 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
283 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
284 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
298 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
303 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
316 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
317 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
320 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
328 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
338 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
339 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
346 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
347 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
348 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
349 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
350 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
351 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
354 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
355 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
366 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
367 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
368 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
369 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
370 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
371 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
374 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
386 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
387 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
388 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
389 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
390 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
393 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
394 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
395 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
396 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
397 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
398 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
399 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
400 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
403 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
404 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
407 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
408 2643221593 Lysobacter sp. Root690 Isolate Unclassified
409 2738541297 Duganella sp. GV083 Isolate Unclassified
410 2738541357 Duganella sp. GV053 Isolate Unclassified
411 2738543003 Duganella sp. GV066 Isolate Unclassified
412 2738543026 Duganella sp. GV089 Isolate Unclassified
413 2738543029 Duganella sp. GV039 Isolate Unclassified
414 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
415 2857558681 Duganella sp. R-74565 Isolate Unclassified
416 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
417 2904424332 Duganella sp. 1411 Isolate Rhizosphere
418 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
419 2919513703 Luteimonas sp. 3794 Isolate Unclassified
420 2919675420 Luteimonas terrae 4099 Isolate Unclassified
421 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
422 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
423 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0
Isolates 1.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.28
Nodule 0
Rhizoplane 2.18
Rhizosphere 91.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_32609_c1 3300050507 Bacteria 6371
2 JGI24746J21847_1001222 3300001977 Bacteria 4081
3 JGI25151J46595_10001398 3300003187 Bacteria 16595
4 JGI25406J46586_10000121 3300003203 Bacteria 34339
5 rootH2_10009426 3300003320 Bacteria 39179
6 Ga0055526_1000129 3300003771 Bacteria 67279
7 Ga0055543_1002002 3300004625 Bacteria 7240
8 Ga0065165_1000050 3300005262 Bacteria 195237
9 Ga0065712_10010331 3300005290 Bacteria 2807
10 Ga0065712_10017262 3300005290 Bacteria 2746
11 Ga0065712_10079412 3300005290 Bacteria 3221
12 Ga0065712_10081025 3300005290 Bacteria 3047
13 Ga0065715_10003555 3300005293 Bacteria 4701
14 Ga0065715_10003862 3300005293 Bacteria 5072
15 Ga0065715_10103465 3300005293 Bacteria 3024
16 Ga0065715_10117896 3300005293 Bacteria 2304
17 Ga0065715_10191947 3300005293 Bacteria 1410
18 Ga0065707_10004066 3300005295 Bacteria 4343
19 Ga0065707_10107365 3300005295 Bacteria 2557
20 Ga0070658_10001036 3300005327 Bacteria 23775
21 Ga0070658_10029586 3300005327 Bacteria 4401
22 Ga0070658_10092672 3300005327 Bacteria 2491
23 Ga0070658_10130569 3300005327 Bacteria 2093
24 Ga0070658_10147021 3300005327 Bacteria 1971
25 Ga0070676_10024926 3300005328 Bacteria 3375
26 Ga0070676_10028465 3300005328 Bacteria 3174
27 Ga0070676_10057556 3300005328 Bacteria 2301
28 Ga0070683_100020144 3300005329 Bacteria 5934
29 Ga0070683_100048338 3300005329 Bacteria 3933
30 Ga0070683_100111233 3300005329 Bacteria 2584
31 Ga0070683_100189029 3300005329 Bacteria 1955
32 Ga0070690_100003577 3300005330 Bacteria 8534
33 Ga0070690_100025518 3300005330 Bacteria 3640
34 Ga0070690_100029732 3300005330 Bacteria 3391
35 Ga0070690_100059519 3300005330 Bacteria 2456
36 Ga0070670_100001059 3300005331 Bacteria 21806
37 Ga0070670_100014434 3300005331 Bacteria 6780
38 Ga0070670_100028275 3300005331 Bacteria 4825
39 Ga0070670_100053077 3300005331 Bacteria 3481
40 Ga0070670_100109514 3300005331 Bacteria 2380
41 Ga0070677_10000820 3300005333 Bacteria 10264
42 Ga0068869_100012848 3300005334 Bacteria 5543
43 Ga0068869_100172785 3300005334 Bacteria 1689
44 Ga0070666_10000001 3300005335 Bacteria 543080
45 Ga0070666_10021458 3300005335 Bacteria 4187
46 Ga0070680_100030360 3300005336 Bacteria 4342
47 Ga0070680_100060072 3300005336 Bacteria 3111
48 Ga0070680_100087677 3300005336 Bacteria 2574
49 Ga0070682_100069908 3300005337 Bacteria 2243
50 Ga0068868_100010518 3300005338 Bacteria 6706
51 Ga0068868_100010978 3300005338 Bacteria 6580
52 Ga0070660_100003334 3300005339 Bacteria 11036
53 Ga0070660_100070552 3300005339 Bacteria 2727
54 Ga0070660_100082316 3300005339 Bacteria 2527
55 Ga0070689_100010769 3300005340 Bacteria 6531
56 Ga0070689_100021262 3300005340 Bacteria 4827
57 Ga0070689_100077606 3300005340 Bacteria 2603
58 Ga0070687_100010132 3300005343 Bacteria 4061
59 Ga0070687_100044317 3300005343 Bacteria 2266
60 Ga0070687_100078109 3300005343 Bacteria 1798
61 Ga0070661_100008933 3300005344 Bacteria 6935
62 Ga0070692_10046861 3300005345 Bacteria 2236
63 Ga0070668_100001298 3300005347 Bacteria 17865
64 Ga0070668_100021672 3300005347 Bacteria 4855
65 Ga0070668_100028229 3300005347 Bacteria 4261
66 Ga0070669_100003163 3300005353 Bacteria 11836
67 Ga0070669_100006451 3300005353 Bacteria 8448
68 Ga0070669_100037619 3300005353 Bacteria 3511
69 Ga0070669_100088013 3300005353 Bacteria 2324
70 Ga0070669_100100234 3300005353 Bacteria 2183
71 Ga0070669_100144810 3300005353 Bacteria 1835
72 Ga0070675_100020276 3300005354 Bacteria 5304
73 Ga0070675_100032864 3300005354 Bacteria 4201
74 Ga0070675_100123824 3300005354 Bacteria 2199
75 Ga0070675_100157319 3300005354 Bacteria 1952
76 Ga0070675_100160155 3300005354 Bacteria 1935
77 Ga0070671_100013621 3300005355 Bacteria 6558
78 Ga0070671_100047619 3300005355 Bacteria 3564
79 Ga0070671_100056437 3300005355 Bacteria 3267
80 Ga0070671_100098006 3300005355 Bacteria 2459
81 Ga0070671_100103816 3300005355 Bacteria 2385
82 Ga0070674_100000143 3300005356 Bacteria 33118
83 Ga0070674_100079753 3300005356 Bacteria 2336
84 Ga0070673_100008923 3300005364 Bacteria 6704
85 Ga0070673_100018740 3300005364 Bacteria 4955
86 Ga0070688_100006661 3300005365 Bacteria 6189
87 Ga0070688_100009731 3300005365 Bacteria 5276
88 Ga0070688_100064968 3300005365 Bacteria 2317
89 Ga0070688_100065073 3300005365 Bacteria 2316
90 Ga0070688_100174115 3300005365 Bacteria 1488
91 Ga0070659_100018847 3300005366 Bacteria 5212
92 Ga0070659_100111308 3300005366 Bacteria 2210
93 Ga0070667_100014750 3300005367 Bacteria 6456
94 Ga0070667_100043256 3300005367 Bacteria 3780
95 Ga0070667_100155064 3300005367 Bacteria 2014
96 Ga0070709_10130612 3300005434 Bacteria 1714
97 Ga0070714_100020018 3300005435 Bacteria 5459
98 Ga0070713_100004822 3300005436 Bacteria 9133
99 Ga0070713_100020467 3300005436 Bacteria 5073
100 Ga0070713_100084811 3300005436 Bacteria 2711
101 Ga0070713_100294125 3300005436 Bacteria 1493
102 Ga0070701_10010680 3300005438 Bacteria 4074
103 Ga0070701_10089578 3300005438 Bacteria 1683
104 Ga0070711_100078109 3300005439 Bacteria 2351
105 Ga0070711_100163771 3300005439 Bacteria 1688
106 Ga0070705_100000704 3300005440 Bacteria 19055
107 Ga0070700_100032916 3300005441 Bacteria 3120
108 Ga0070700_100073305 3300005441 Bacteria 2191
109 Ga0070694_100001822 3300005444 Bacteria 12620
110 Ga0070694_100069089 3300005444 Bacteria 2429
111 Ga0070694_100202982 3300005444 Bacteria 1479
112 Ga0070663_100010132 3300005455 Bacteria 5864
113 Ga0070663_100061648 3300005455 Bacteria 2701
114 Ga0070678_100036289 3300005456 Bacteria 3449
115 Ga0070678_100196453 3300005456 Bacteria 1662
116 Ga0070662_100106995 3300005457 Bacteria 2125
117 Ga0070681_10007479 3300005458 Bacteria 10674
118 Ga0070681_10015033 3300005458 Bacteria 7699
119 Ga0070681_10015833 3300005458 Bacteria 7517
120 Ga0070681_10060643 3300005458 Bacteria 3758
121 Ga0070681_10127067 3300005458 Bacteria 2482
122 Ga0068867_100001114 3300005459 Bacteria 18390
123 Ga0068867_100047855 3300005459 Bacteria 3145
124 Ga0068867_100050118 3300005459 Bacteria 3076
125 Ga0068867_100252119 3300005459 Bacteria 1436
126 Ga0070706_100124640 3300005467 Bacteria 2402
127 Ga0070707_100062214 3300005468 Bacteria 3581
128 Ga0070707_100096914 3300005468 Bacteria 2857
129 Ga0070707_100225237 3300005468 Bacteria 1826
130 Ga0070698_100003696 3300005471 Bacteria 16787
131 Ga0070698_100005828 3300005471 Bacteria 13475
132 Ga0070699_100000457 3300005518 Bacteria 39196
133 Ga0070699_100004350 3300005518 Bacteria 12521
134 Ga0070699_100031962 3300005518 Bacteria 4545
135 Ga0070699_100052047 3300005518 Bacteria 3545
136 Ga0070699_100080647 3300005518 Bacteria 2836
137 Ga0070699_100086996 3300005518 Bacteria 2728
138 Ga0070679_100001692 3300005530 Bacteria 19871
139 Ga0070679_100018177 3300005530 Bacteria 6817
140 Ga0070679_100025310 3300005530 Bacteria 5822
141 Ga0070679_100056750 3300005530 Bacteria 3902
142 Ga0070679_100074035 3300005530 Bacteria 3396
143 Ga0070684_100040400 3300005535 Bacteria 4016
144 Ga0068853_100112795 3300005539 Bacteria 2416
145 Ga0068853_100123923 3300005539 Bacteria 2307
146 Ga0068853_100167980 3300005539 Bacteria 1984
147 Ga0070672_100009546 3300005543 Bacteria 6695
148 Ga0070672_100027138 3300005543 Bacteria 4269
149 Ga0070686_100000861 3300005544 Bacteria 17630
150 Ga0070686_100004648 3300005544 Bacteria 7572
151 Ga0070686_100029381 3300005544 Bacteria 3344
152 Ga0070695_100000064 3300005545 Bacteria 42035
153 Ga0070696_100001482 3300005546 Bacteria 15366
154 Ga0070696_100001985 3300005546 Bacteria 13438
155 Ga0070696_100029109 3300005546 Bacteria 3771
156 Ga0070665_100007298 3300005548 Bacteria 11244
157 Ga0070665_100010641 3300005548 Bacteria 9312
158 Ga0070665_100017890 3300005548 Bacteria 7116
159 Ga0070665_100018594 3300005548 Bacteria 6964
160 Ga0070665_100028274 3300005548 Bacteria 5647
161 Ga0070665_100083335 3300005548 Bacteria 3202
162 Ga0070704_100007103 3300005549 Bacteria 6650
163 Ga0070704_100009708 3300005549 Bacteria 5833
164 Ga0070704_100045496 3300005549 Bacteria 3054
165 Ga0070704_100079102 3300005549 Bacteria 2414
166 Ga0070704_100192356 3300005549 Bacteria 1641
167 Ga0068855_100002900 3300005563 Bacteria 20979
168 Ga0068855_100019059 3300005563 Bacteria 8249
169 Ga0068855_100040460 3300005563 Bacteria 5533
170 Ga0068855_100043264 3300005563 Bacteria 5336
171 Ga0068855_100051520 3300005563 Bacteria 4849
172 Ga0068855_100091291 3300005563 Bacteria 3513
173 Ga0068855_100280079 3300005563 Bacteria 1852
174 Ga0070664_100041917 3300005564 Bacteria 3864
175 Ga0070664_100188441 3300005564 Bacteria 1837
176 Ga0070664_100192393 3300005564 Bacteria 1818
177 Ga0068857_100002823 3300005577 Bacteria 14284
178 Ga0068857_100012106 3300005577 Bacteria 7501
179 Ga0068857_100059226 3300005577 Bacteria 3402
180 Ga0068857_100099783 3300005577 Bacteria 2605
181 Ga0068857_100197332 3300005577 Bacteria 1834
182 Ga0068854_100007890 3300005578 Bacteria 6812
183 Ga0068854_100068824 3300005578 Bacteria 2582
184 Ga0068854_100118231 3300005578 Bacteria 2008
185 Ga0068856_100001937 3300005614 Bacteria 21587
186 Ga0068856_100062334 3300005614 Bacteria 3683
187 Ga0068856_100063710 3300005614 Bacteria 3642
188 Ga0070702_100005745 3300005615 Bacteria 5811
189 Ga0068852_100000040 3300005616 Bacteria 93349
190 Ga0068852_100014922 3300005616 Bacteria 6004
191 Ga0068852_100062682 3300005616 Bacteria 3235
192 Ga0068852_100183564 3300005616 Bacteria 1969
193 Ga0068859_100000180 3300005617 Bacteria 61976
194 Ga0068859_100007306 3300005617 Bacteria 11205
195 Ga0068859_100018472 3300005617 Bacteria 7008
196 Ga0068859_100018712 3300005617 Bacteria 6960
197 Ga0068859_100025109 3300005617 Bacteria 5980
198 Ga0068859_100035592 3300005617 Bacteria 4995
199 Ga0068859_100085901 3300005617 Bacteria 3192
200 Ga0068859_100403060 3300005617 Bacteria 1464
201 Ga0068864_100004327 3300005618 Bacteria 11669
202 Ga0068864_100023737 3300005618 Bacteria 5153
203 Ga0068864_100030559 3300005618 Bacteria 4567
204 Ga0068864_100036523 3300005618 Bacteria 4188
205 Ga0068864_100048708 3300005618 Bacteria 3644
206 Ga0068864_100063908 3300005618 Bacteria 3190
207 Ga0068864_100102508 3300005618 Bacteria 2540
208 Ga0068861_100001421 3300005719 Bacteria 15089
209 Ga0068861_100012591 3300005719 Bacteria 5901
210 Ga0068870_10000779 3300005840 Bacteria 12308
211 Ga0068870_10011176 3300005840 Bacteria 4153
212 Ga0068863_100005988 3300005841 Bacteria 11926
213 Ga0068863_100207061 3300005841 Bacteria 1888
214 Ga0068858_100001977 3300005842 Bacteria 20940
215 Ga0068858_100003784 3300005842 Bacteria 14958
216 Ga0068858_100012713 3300005842 Bacteria 7932
217 Ga0068858_100180883 3300005842 Bacteria 1991
218 Ga0068858_100206453 3300005842 Bacteria 1859
219 Ga0068860_100004193 3300005843 Bacteria 14775
220 Ga0068860_100010622 3300005843 Bacteria 9091
221 Ga0068860_100019864 3300005843 Bacteria 6516
222 Ga0068860_100286226 3300005843 Bacteria 1612
223 Ga0068862_100001270 3300005844 Bacteria 23717
224 Ga0068862_100025123 3300005844 Bacteria 5001
225 Ga0068862_100129011 3300005844 Bacteria 2235
226 Ga0081539_10001107 3300005985 Bacteria 48837
227 Ga0081539_10006892 3300005985 Bacteria 10599
228 Ga0070717_10037836 3300006028 Bacteria 3919
229 Ga0075365_10006974 3300006038 Bacteria 6280
230 Ga0070716_100050096 3300006173 Bacteria 2369
231 Ga0097621_100002357 3300006237 Bacteria 12949
232 Ga0097621_100013642 3300006237 Bacteria 6065
233 Ga0097621_100024363 3300006237 Bacteria 4725
234 Ga0068871_100010807 3300006358 Bacteria 6680
235 Ga0068871_100094222 3300006358 Bacteria 2499
236 Ga0068871_100169672 3300006358 Bacteria 1870
237 Ga0075428_100002102 3300006844 Bacteria 21471
238 Ga0075428_100019109 3300006844 Bacteria 7578
239 Ga0075428_100021511 3300006844 Bacteria 7139
240 Ga0075428_100040680 3300006844 Bacteria 5112
241 Ga0075428_100045963 3300006844 Bacteria 4796
242 Ga0075428_100105542 3300006844 Bacteria 3072
243 Ga0075428_100304413 3300006844 Bacteria 1714
244 Ga0075430_100003042 3300006846 Bacteria 14021
245 Ga0075430_100007983 3300006846 Bacteria 8944
246 Ga0075430_100013989 3300006846 Bacteria 6840
247 Ga0075430_100016386 3300006846 Bacteria 6311
248 Ga0075430_100064038 3300006846 Bacteria 3088
249 Ga0075430_100082061 3300006846 Bacteria 2701
250 Ga0075431_100014150 3300006847 Bacteria 8067
251 Ga0075431_100014321 3300006847 Bacteria 8020
252 Ga0075431_100034366 3300006847 Bacteria 5222
253 Ga0075431_100192238 3300006847 Bacteria 2091
254 Ga0075431_100235399 3300006847 Bacteria 1865
255 Ga0075433_10001136 3300006852 Bacteria 19276
256 Ga0075433_10021456 3300006852 Bacteria 5416
257 Ga0075433_10031464 3300006852 Bacteria 4536
258 Ga0075433_10042560 3300006852 Bacteria 3941
259 Ga0075434_100010027 3300006871 Bacteria 8868
260 Ga0075434_100011440 3300006871 Bacteria 8373
261 Ga0075434_100031731 3300006871 Bacteria 5209
262 Ga0075434_100046360 3300006871 Bacteria 4314
263 Ga0075434_100056464 3300006871 Bacteria 3901
264 Ga0075434_100154827 3300006871 Bacteria 2312
265 Ga0075434_100226310 3300006871 Bacteria 1890
266 Ga0075429_100002201 3300006880 Bacteria 16306
267 Ga0075429_100011476 3300006880 Bacteria 7681
268 Ga0075429_100015558 3300006880 Bacteria 6591
269 Ga0075429_100064196 3300006880 Bacteria 3198
270 Ga0075429_100072751 3300006880 Bacteria 2994
271 Ga0075429_100091410 3300006880 Bacteria 2655
272 Ga0075429_100103714 3300006880 Bacteria 2484
273 Ga0068865_100014820 3300006881 Bacteria 4960
274 Ga0068865_100154819 3300006881 Bacteria 1742
275 Ga0068865_100197892 3300006881 Bacteria 1558
276 Ga0075436_100088389 3300006914 Bacteria 2152
277 Ga0097620_100000180 3300006931 Bacteria 61976
278 Ga0097620_100007306 3300006931 Bacteria 11205
279 Ga0097620_100018472 3300006931 Bacteria 7008
280 Ga0097620_100018711 3300006931 Bacteria 6960
281 Ga0097620_100025112 3300006931 Bacteria 5980
282 Ga0097620_100035592 3300006931 Bacteria 4995
283 Ga0097620_100085903 3300006931 Bacteria 3192
284 Ga0097620_100403022 3300006931 Bacteria 1464
285 Ga0075435_100001202 3300007076 Bacteria 16556
286 Ga0075435_100002251 3300007076 Bacteria 12739
287 Ga0075435_100006158 3300007076 Bacteria 8456
288 Ga0075435_100006182 3300007076 Bacteria 8448
289 Ga0075435_100155273 3300007076 Bacteria 1925
290 Ga0105244_10000678 3300009036 Bacteria 29866
291 Ga0105240_10000312 3300009093 Bacteria 93459
292 Ga0105240_10002273 3300009093 Bacteria 31176
293 Ga0105240_10007947 3300009093 Bacteria 15307
294 Ga0105240_10011435 3300009093 Bacteria 12363
295 Ga0105240_10012892 3300009093 Bacteria 11512
296 Ga0105240_10055314 3300009093 Bacteria 4968
297 Ga0105240_10057743 3300009093 Bacteria 4846
298 Ga0105240_10081877 3300009093 Bacteria 3965
299 Ga0105240_10160641 3300009093 Bacteria 2669
300 Ga0105240_10165845 3300009093 Bacteria 2620
301 Ga0111539_10000159 3300009094 Bacteria 76817
302 Ga0111539_10003690 3300009094 Bacteria 20148
303 Ga0111539_10006988 3300009094 Bacteria 14477
304 Ga0111539_10033767 3300009094 Bacteria 6209
305 Ga0111539_10052188 3300009094 Bacteria 4868
306 Ga0111539_10060760 3300009094 Bacteria 4478
307 Ga0111539_10063215 3300009094 Bacteria 4380
308 Ga0111539_10122390 3300009094 Bacteria 3049
309 Ga0111539_10159861 3300009094 Bacteria 2635
310 Ga0111539_10179701 3300009094 Bacteria 2472
311 Ga0111539_10381031 3300009094 Bacteria 1642
312 Ga0105245_10020420 3300009098 Bacteria 5809
313 Ga0105245_10047116 3300009098 Bacteria 3853
314 Ga0105245_10123276 3300009098 Bacteria 2423
315 Ga0105247_10034018 3300009101 Bacteria 3103
316 Ga0105247_10068043 3300009101 Bacteria 2220
317 Ga0105247_10098441 3300009101 Bacteria 1867
318 Ga0114129_10001780 3300009147 Bacteria 29349
319 Ga0114129_10005772 3300009147 Bacteria 17530
320 Ga0114129_10008257 3300009147 Bacteria 14850
321 Ga0114129_10008325 3300009147 Bacteria 14795
322 Ga0114129_10014579 3300009147 Bacteria 11198
323 Ga0114129_10023777 3300009147 Bacteria 8685
324 Ga0114129_10030346 3300009147 Bacteria 7650
325 Ga0114129_10050086 3300009147 Bacteria 5868
326 Ga0114129_10050645 3300009147 Bacteria 5833
327 Ga0114129_10198603 3300009147 Bacteria 2718
328 Ga0114129_10266906 3300009147 Bacteria 2291
329 Ga0114129_10506431 3300009147 Bacteria 1576
330 Ga0105243_10019766 3300009148 Bacteria 5106
331 Ga0105243_10058213 3300009148 Bacteria 3079
332 Ga0105241_10011936 3300009174 Bacteria 6381
333 Ga0105241_10016182 3300009174 Bacteria 5465
334 Ga0105241_10050221 3300009174 Bacteria 3178
335 Ga0105242_10008024 3300009176 Bacteria 8131
336 Ga0105248_10000166 3300009177 Bacteria 77193
337 Ga0105248_10002222 3300009177 Bacteria 21451
338 Ga0105248_10029280 3300009177 Bacteria 6143
339 Ga0105248_10050029 3300009177 Bacteria 4687
340 Ga0105248_10065374 3300009177 Bacteria 4084
341 Ga0105248_10075185 3300009177 Bacteria 3797
342 Ga0105237_10051840 3300009545 Bacteria 4121
343 Ga0105238_10000680 3300009551 Bacteria 35775
344 Ga0105238_10004104 3300009551 Bacteria 14450
345 Ga0105238_10018121 3300009551 Bacteria 7160
346 Ga0105238_10024567 3300009551 Bacteria 6142
347 Ga0105238_10088927 3300009551 Bacteria 3075
348 Ga0105249_10000858 3300009553 Bacteria 27086
349 Ga0105249_10008306 3300009553 Bacteria 9039
350 Ga0105249_10182376 3300009553 Bacteria 2043
351 Ga0105239_10007060 3300010375 Bacteria 12928
352 Ga0105246_10027790 3300011119 Bacteria 3711
353 Ga0157371_10057680 3300013102 Bacteria 2754
354 Ga0157371_10099718 3300013102 Bacteria 2059
355 Ga0157370_10000164 3300013104 Bacteria 81413
356 Ga0157370_10015684 3300013104 Bacteria 7696
357 Ga0157370_10019444 3300013104 Bacteria 6813
358 Ga0157370_10028865 3300013104 Bacteria 5454
359 Ga0157370_10050928 3300013104 Bacteria 3956
360 Ga0157370_10076906 3300013104 Bacteria 3144
361 Ga0157369_10000021 3300013105 Bacteria 239073
362 Ga0157369_10000209 3300013105 Bacteria 81584
363 Ga0157369_10003493 3300013105 Bacteria 18660
364 Ga0157369_10028132 3300013105 Bacteria 6223
365 Ga0157369_10035469 3300013105 Bacteria 5469
366 Ga0157369_10049410 3300013105 Bacteria 4560
367 Ga0157369_10141542 3300013105 Bacteria 2545
368 Ga0157369_10151363 3300013105 Bacteria 2452
369 Ga0171462_1022 3300013250 Bacteria 141292
370 Ga0157374_10009440 3300013296 Bacteria 8375
371 Ga0157374_10010971 3300013296 Bacteria 7824
372 Ga0157374_10019766 3300013296 Bacteria 5968
373 Ga0157378_10012848 3300013297 Bacteria 7329
374 Ga0157378_10019283 3300013297 Bacteria 5995
375 Ga0157378_10113931 3300013297 Bacteria 2483
376 Ga0157378_10135519 3300013297 Bacteria 2283
377 Ga0163162_10008251 3300013306 Bacteria 10167
378 Ga0163162_10013347 3300013306 Bacteria 8023
379 Ga0163162_10042903 3300013306 Bacteria 4528
380 Ga0163162_10078701 3300013306 Bacteria 3362
381 Ga0163162_10147385 3300013306 Bacteria 2470
382 Ga0157372_10000256 3300013307 Bacteria 58784
383 Ga0157372_10006493 3300013307 Bacteria 12447
384 Ga0157372_10033163 3300013307 Bacteria 5669
385 Ga0157372_10034530 3300013307 Bacteria 5560
386 Ga0157372_10038963 3300013307 Bacteria 5246
387 Ga0157375_10000281 3300013308 Bacteria 46431
388 Ga0157375_10027879 3300013308 Bacteria 5284
389 Ga0157375_10343157 3300013308 Bacteria 1659
390 Ga0163163_10027026 3300014325 Bacteria 5492
391 Ga0163163_10059648 3300014325 Bacteria 3775
392 Ga0163163_10073100 3300014325 Bacteria 3419
393 Ga0163163_10145920 3300014325 Bacteria 2410
394 Ga0163163_10197511 3300014325 Bacteria 2060
395 Ga0163163_10211767 3300014325 Bacteria 1987
396 Ga0163163_10234890 3300014325 Bacteria 1883
397 Ga0157380_10008367 3300014326 Bacteria 7379
398 Ga0157380_10341651 3300014326 Bacteria 1397
399 Ga0157380_10369601 3300014326 Bacteria 1349
400 Ga0182008_10001193 3300014497 Bacteria 17905
401 Ga0157377_10005375 3300014745 Bacteria 6015
402 Ga0157377_10015758 3300014745 Bacteria 3874
403 Ga0157379_10004419 3300014968 Bacteria 12050
404 Ga0157379_10054844 3300014968 Bacteria 3561
405 Ga0157376_10001792 3300014969 Bacteria 14297
406 Ga0157376_10105507 3300014969 Bacteria 2471
407 Ga0157376_10113090 3300014969 Bacteria 2393
408 Ga0157376_10229368 3300014969 Bacteria 1724
409 Ga0182006_1000046 3300015261 Bacteria 189544
410 Ga0182007_10000044 3300015262 Bacteria 106301
411 Ga0182005_1000032 3300015265 Bacteria 188517
412 Ga0163161_10008887 3300017792 Bacteria 6945
413 Ga0213876_10002213 3300021384 Bacteria 11476
414 Ga0209565_1000005 3300025263 Bacteria 947317
415 Ga0209673_1000027 3300025273 Bacteria 360561
416 Ga0209130_1000065 3300025284 Bacteria 195251
417 Ga0209675_1000004 3300025291 Bacteria 947166
418 Ga0209025_1000005 3300025294 Bacteria 1272149
419 Ga0209564_1000006 3300025295 Bacteria 1100927
420 Ga0209564_1000050 3300025295 Bacteria 360560
421 Ga0209758_1012915 3300025297 Bacteria 4615
422 Ga0209256_1000031 3300025299 Bacteria 410189
423 Ga0207697_10000704 3300025315 Bacteria 19037
424 Ga0207697_10002895 3300025315 Bacteria 8688
425 Ga0207697_10012325 3300025315 Bacteria 3587
426 Ga0207655_1012763 3300025728 Bacteria 4874
427 Ga0207682_10001891 3300025893 Bacteria 9509
428 Ga0207682_10004527 3300025893 Bacteria 5793
429 Ga0207682_10018742 3300025893 Bacteria 2707
430 Ga0207710_10020350 3300025900 Bacteria 2836
431 Ga0207710_10063479 3300025900 Bacteria 1680
432 Ga0207688_10011291 3300025901 Bacteria 4862
433 Ga0207688_10018320 3300025901 Bacteria 3810
434 Ga0207688_10092483 3300025901 Bacteria 1738
435 Ga0207680_10000003 3300025903 Bacteria 925264
436 Ga0207680_10027253 3300025903 Bacteria 3179
437 Ga0207647_10028405 3300025904 Bacteria 3633
438 Ga0207645_10009178 3300025907 Bacteria 6856
439 Ga0207643_10001379 3300025908 Bacteria 13984
440 Ga0207643_10001906 3300025908 Bacteria 11504
441 Ga0207643_10025175 3300025908 Bacteria 3288
442 Ga0207643_10083523 3300025908 Bacteria 1853
443 Ga0207705_10000940 3300025909 Bacteria 23778
444 Ga0207705_10001812 3300025909 Bacteria 16842
445 Ga0207654_10008464 3300025911 Bacteria 5202
446 Ga0207654_10015707 3300025911 Bacteria 3934
447 Ga0207654_10058801 3300025911 Bacteria 2239
448 Ga0207707_10015222 3300025912 Bacteria 6697
449 Ga0207707_10016367 3300025912 Bacteria 6469
450 Ga0207707_10052960 3300025912 Bacteria 3532
451 Ga0207707_10137703 3300025912 Bacteria 2134
452 Ga0207707_10176332 3300025912 Bacteria 1867
453 Ga0207695_10000341 3300025913 Bacteria 109857
454 Ga0207695_10017849 3300025913 Bacteria 8226
455 Ga0207695_10042629 3300025913 Bacteria 4843
456 Ga0207695_10091887 3300025913 Bacteria 3047
457 Ga0207695_10277606 3300025913 Bacteria 1570
458 Ga0207671_10009199 3300025914 Bacteria 8287
459 Ga0207671_10058454 3300025914 Bacteria 2859
460 Ga0207663_10175791 3300025916 Bacteria 1525
461 Ga0207660_10044102 3300025917 Bacteria 3137
462 Ga0207662_10005937 3300025918 Bacteria 6556
463 Ga0207657_10014858 3300025919 Bacteria 7577
464 Ga0207657_10014903 3300025919 Bacteria 7560
465 Ga0207657_10040729 3300025919 Bacteria 4114
466 Ga0207649_10013967 3300025920 Bacteria 4493
467 Ga0207652_10003642 3300025921 Bacteria 12686
468 Ga0207652_10004161 3300025921 Bacteria 11798
469 Ga0207652_10007231 3300025921 Bacteria 8946
470 Ga0207652_10026709 3300025921 Bacteria 4811
471 Ga0207652_10038703 3300025921 Bacteria 4044
472 Ga0207652_10084277 3300025921 Bacteria 2784
473 Ga0207646_10176121 3300025922 Bacteria 1932
474 Ga0207681_10003028 3300025923 Bacteria 10561
475 Ga0207681_10048151 3300025923 Bacteria 2876
476 Ga0207681_10051656 3300025923 Bacteria 2786
477 Ga0207694_10002851 3300025924 Bacteria 13944
478 Ga0207694_10005041 3300025924 Bacteria 10217
479 Ga0207694_10023397 3300025924 Bacteria 4689
480 Ga0207694_10026394 3300025924 Bacteria 4418
481 Ga0207650_10002755 3300025925 Bacteria 12131
482 Ga0207650_10026340 3300025925 Bacteria 4147
483 Ga0207650_10036464 3300025925 Bacteria 3578
484 Ga0207659_10000914 3300025926 Bacteria 17608
485 Ga0207659_10009263 3300025926 Bacteria 6148
486 Ga0207659_10155235 3300025926 Bacteria 1791
487 Ga0207687_10045444 3300025927 Bacteria 3035
488 Ga0207700_10053602 3300025928 Bacteria 3023
489 Ga0207664_10040493 3300025929 Bacteria 3624
490 Ga0207644_10015593 3300025931 Bacteria 5103
491 Ga0207644_10059537 3300025931 Bacteria 2762
492 Ga0207644_10092895 3300025931 Bacteria 2252
493 Ga0207690_10076822 3300025932 Bacteria 2320
494 Ga0207706_10006185 3300025933 Bacteria 11117
495 Ga0207706_10027627 3300025933 Bacteria 5073
496 Ga0207706_10067402 3300025933 Bacteria 3149
497 Ga0207706_10078680 3300025933 Bacteria 2900
498 Ga0207709_10028589 3300025935 Bacteria 3224
499 Ga0207670_10003410 3300025936 Bacteria 8437
500 Ga0207670_10005670 3300025936 Bacteria 6873
501 Ga0207670_10010780 3300025936 Bacteria 5274
502 Ga0207669_10000757 3300025937 Bacteria 13957
503 Ga0207704_10009050 3300025938 Bacteria 4787
504 Ga0207704_10010163 3300025938 Bacteria 4576
505 Ga0207704_10091555 3300025938 Bacteria 1999
506 Ga0207691_10001298 3300025940 Bacteria 24940
507 Ga0207691_10055866 3300025940 Bacteria 3598
508 Ga0207691_10142974 3300025940 Bacteria 2107
509 Ga0207711_10000141 3300025941 Bacteria 77173
510 Ga0207711_10004086 3300025941 Bacteria 12520
511 Ga0207711_10024424 3300025941 Bacteria 5064
512 Ga0207711_10026520 3300025941 Bacteria 4863
513 Ga0207689_10008557 3300025942 Bacteria 8920
514 Ga0207689_10030848 3300025942 Bacteria 4466
515 Ga0207689_10054212 3300025942 Bacteria 3303
516 Ga0207689_10057665 3300025942 Bacteria 3194
517 Ga0207661_10035742 3300025944 Bacteria 3874
518 Ga0207679_10096666 3300025945 Bacteria 2299
519 Ga0207679_10121520 3300025945 Bacteria 2080
520 Ga0207667_10001147 3300025949 Bacteria 33314
521 Ga0207667_10042887 3300025949 Bacteria 4805
522 Ga0207667_10048642 3300025949 Bacteria 4483
523 Ga0207667_10202329 3300025949 Bacteria 2037
524 Ga0207667_10316681 3300025949 Bacteria 1593
525 Ga0207651_10003661 3300025960 Bacteria 7586
526 Ga0207651_10044820 3300025960 Bacteria 2963
527 Ga0207712_10007244 3300025961 Bacteria 6993
528 Ga0207712_10021086 3300025961 Bacteria 4274
529 Ga0207668_10013128 3300025972 Bacteria 5091
530 Ga0207668_10013653 3300025972 Bacteria 5010
531 Ga0207640_10036133 3300025981 Bacteria 3098
532 Ga0207658_10110616 3300025986 Bacteria 2171
533 Ga0207658_10183084 3300025986 Bacteria 1735
534 Ga0207677_10035339 3300026023 Bacteria 3245
535 Ga0207703_10001119 3300026035 Bacteria 25314
536 Ga0207703_10078926 3300026035 Bacteria 2737
537 Ga0207703_10113299 3300026035 Bacteria 2318
538 Ga0207639_10030350 3300026041 Bacteria 3964
539 Ga0207639_10089916 3300026041 Bacteria 2454
540 Ga0207678_10002203 3300026067 Bacteria 17590
541 Ga0207678_10005401 3300026067 Bacteria 11449
542 Ga0207708_10024453 3300026075 Bacteria 4569
543 Ga0207708_10028186 3300026075 Bacteria 4252
544 Ga0207702_10063865 3300026078 Bacteria 3150
545 Ga0207702_10208807 3300026078 Bacteria 1814
546 Ga0207641_10131174 3300026088 Bacteria 2251
547 Ga0207641_10220503 3300026088 Bacteria 1758
548 Ga0207648_10046185 3300026089 Bacteria 3819
549 Ga0207648_10047391 3300026089 Bacteria 3767
550 Ga0207648_10070802 3300026089 Bacteria 3040
551 Ga0207676_10003276 3300026095 Bacteria 11510
552 Ga0207676_10017141 3300026095 Bacteria 5248
553 Ga0207676_10022409 3300026095 Bacteria 4645
554 Ga0207676_10034141 3300026095 Bacteria 3850
555 Ga0207676_10173953 3300026095 Bacteria 1879
556 Ga0207674_10015243 3300026116 Bacteria 8455
557 Ga0207674_10016607 3300026116 Bacteria 8049
558 Ga0207674_10050268 3300026116 Bacteria 4260
559 Ga0207674_10065037 3300026116 Bacteria 3677
560 Ga0207674_10071684 3300026116 Bacteria 3481
561 Ga0207674_10145060 3300026116 Bacteria 2332
562 Ga0207675_100018999 3300026118 Bacteria 6416
563 Ga0207675_100190825 3300026118 Bacteria 1965
564 Ga0207683_10024624 3300026121 Bacteria 5185
565 Ga0207683_10072725 3300026121 Bacteria 3041
566 Ga0207683_10112797 3300026121 Bacteria 2435
567 Ga0207683_10213047 3300026121 Bacteria 1758
568 Ga0207698_10020516 3300026142 Bacteria 4550
569 Ga0207698_10192455 3300026142 Bacteria 1818
570 Ga0207428_10004273 3300027907 Bacteria 13671
571 Ga0207428_10005162 3300027907 Bacteria 12226
572 Ga0207428_10005911 3300027907 Bacteria 11332
573 Ga0207428_10019022 3300027907 Bacteria 5858
574 Ga0207428_10032313 3300027907 Bacteria 4305
575 Ga0268266_10000011 3300028379 Bacteria 757403
576 Ga0268266_10010860 3300028379 Bacteria 7932
577 Ga0268266_10022114 3300028379 Bacteria 5421
578 Ga0268266_10029627 3300028379 Bacteria 4652
579 Ga0268266_10057272 3300028379 Bacteria 3353
580 Ga0268266_10229814 3300028379 Bacteria 1708
581 Ga0268265_10002863 3300028380 Bacteria 12684
582 Ga0268265_10184625 3300028380 Bacteria 1795
583 Ga0268264_10110148 3300028381 Bacteria 2411
584 Ga0268264_10143089 3300028381 Bacteria 2135
585 Ga0265319_1009083 3300028563 Bacteria 4278
586 Ga0265318_10000122 3300028577 Bacteria 71971
587 Ga0265318_10007779 3300028577 Bacteria 4817
588 Ga0265318_10032918 3300028577 Bacteria 2003
589 Ga0307515_10096088 3300028794 Bacteria 3638
590 Ga0265338_10016375 3300028800 Bacteria 8074
591 Ga0265338_10126506 3300028800 Bacteria 2026
592 Ga0265338_10129346 3300028800 Bacteria 1997
593 Ga0265338_10135103 3300028800 Bacteria 1940
594 Ga0265330_10001106 3300031235 Bacteria 16236
595 Ga0265320_10000019 3300031240 Bacteria 183346
596 Ga0265325_10011088 3300031241 Bacteria 5187
597 Ga0265325_10014355 3300031241 Bacteria 4479
598 Ga0265325_10020153 3300031241 Bacteria 3679
599 Ga0265329_10006852 3300031242 Bacteria 4472
600 Ga0265329_10020185 3300031242 Bacteria 2253
601 Ga0265340_10001198 3300031247 Bacteria 14820
602 Ga0265339_10026388 3300031249 Bacteria 3327
603 Ga0265339_10033368 3300031249 Bacteria 2899
604 Ga0265331_10000028 3300031250 Bacteria 216539
605 Ga0265316_10000092 3300031344 Bacteria 96395
606 Ga0307509_10002182 3300031507 Bacteria 32144
607 Ga0307509_10023635 3300031507 Bacteria 6895
608 Ga0307408_100049797 3300031548 Bacteria 3010
609 Ga0265313_10000704 3300031595 Bacteria 34513
610 Ga0265313_10001475 3300031595 Bacteria 21906
611 Ga0265314_10000131 3300031711 Bacteria 113375
612 Ga0265314_10001078 3300031711 Bacteria 31616
613 Ga0265314_10104921 3300031711 Bacteria 1808
614 Ga0265342_10000161 3300031712 Bacteria 75750
615 Ga0265342_10002743 3300031712 Bacteria 14973
616 Ga0307405_10013435 3300031731 Bacteria 4367
617 Ga0307405_10015035 3300031731 Bacteria 4178
618 Ga0307410_10024457 3300031852 Bacteria 3773
619 Ga0307412_10083861 3300031911 Bacteria 2211
620 Ga0307409_100013111 3300031995 Bacteria 5317
621 Ga0307416_100000731 3300032002 Bacteria 17101
622 Ga0307416_100006131 3300032002 Bacteria 7490
623 Ga0307416_100008501 3300032002 Bacteria 6631
624 Ga0307416_100080980 3300032002 Bacteria 2743
625 Ga0307414_10000449 3300032004 Bacteria 21733
626 Ga0307414_10064074 3300032004 Bacteria 2615
627 Ga0307411_10015527 3300032005 Bacteria 4281
628 Ga0307411_10113715 3300032005 Bacteria 1943
629 Ga0307415_100163569 3300032126 Bacteria 1728
630 Ga0373948_0002220 3300034817 Bacteria 2836
631 Ga0373958_0000338 3300034819 Bacteria 5644
632 Ga0373938_0002432 3300034957 Bacteria 3002
633 Ga0373944_0004683 3300035089 Bacteria 3572
634 Ga0373949_0001593 3300035090 Bacteria 6390
635 Ga0373951_0000334 3300035091 Bacteria 14616
636 Ga0373923_0034942 3300035111 Bacteria 2043
637 Ga0373932_0001320 3300035112 Bacteria 6977
638 Ga0373954_0001824 3300035118 Bacteria 8791
639 Ga0373954_0066556 3300035118 Bacteria 1706
640 Ga0373956_0025803 3300035119 Bacteria 2541
641 Ga0373943_0100510 3300035170 Bacteria 1512
642 Ga0373955_0033868 3300035172 Bacteria 2692
643 Ga0373942_0000300 3300035207 Bacteria 13537
644 Ga0373924_0014375 3300035410 Bacteria 2991
645 Ga0373935_0001821 3300035692 Bacteria 11963
646 Ga0373927_0002543 3300035695 Bacteria 13305
647 Ga0373927_0025807 3300035695 Bacteria 3841
648 Ga0373933_0000034 3300035724 Bacteria 83243
649 Ga0373933_0092613 3300035724 Bacteria 1867
650 Ga0373947_0048591 3300035725 Bacteria 2546
651 Ga0373937_0000001 3300036401 Bacteria 478903
652 Ga0373937_0116319 3300036401 Bacteria 2490
653 Ga0373925_0218972 3300037068 Bacteria 1519
654 Ga0373925_0222934 3300037068 Bacteria 1505
655 Ga0395900_0021101 3300037418 Bacteria 6657
656 Ga0395900_0187362 3300037418 Bacteria 2100
657 Ga0395898_0092856 3300037466 Bacteria 2902
658 Ga0395901_0012641 3300038443 Bacteria 8566
659 Ga0395901_0018220 3300038443 Bacteria 7169
660 Ga0436365_1759017 3300039437 Bacteria 5156
661 Ga0436365_1796416 3300039437 Bacteria 5000
662 Ga0439447_001727 3300041407 Bacteria 8009
663 Ga0451797_0723557 3300041453 Bacteria 2342
664 Ga0451807_1802640 3300041486 Bacteria 3285
665 Ga0451807_2035948 3300041486 Bacteria 4835
666 Ga0451843_0291122 3300041509 Bacteria 1821
667 Ga0439431_0026094 3300041997 Bacteria 1430
668 Ga0439446_0018374 3300042156 Bacteria 1959
669 Ga0451577_0054247 3300042876 Bacteria 3579
670 Ga0451577_0097912 3300042876 Bacteria 2620
671 Ga0466969_0033773 3300044656 Bacteria 2596
672 Ga0466961_0022799 3300044693 Bacteria 4027
673 Ga0466961_0039350 3300044693 Bacteria 3031
674 Ga0466959_0007010 3300045049 Bacteria 7877
675 Ga0451576_0090138 3300045051 Bacteria 3189
676 Ga0451576_0101277 3300045051 Bacteria 2996
677 Ga0451576_0255244 3300045051 Bacteria 1832
678 Ga0495617_000007 3300046452 Bacteria 369986
679 Ga0495592_0032891 3300046454 Bacteria 3912
680 Ga0495629_0002811 3300046459 Bacteria 13280
681 Ga0495638_0017261 3300046460 Bacteria 4818
682 Ga0495651_0001343 3300046462 Bacteria 19044
683 Ga0495651_0004152 3300046462 Bacteria 11094
684 Ga0495651_0011894 3300046462 Bacteria 6694
685 Ga0495651_0020556 3300046462 Bacteria 5126
686 Ga0495653_0000297 3300046463 Bacteria 40421
687 Ga0495653_0008111 3300046463 Bacteria 8601
688 Ga0495653_0053088 3300046463 Bacteria 3102
689 Ga0495650_0000357 3300046471 Bacteria 80726
690 Ga0495650_0000852 3300046471 Bacteria 36650
691 Ga0495650_0007439 3300046471 Bacteria 6583
692 Ga0495580_0017641 3300046472 Bacteria 5332
693 Ga0495580_0049246 3300046472 Bacteria 2981
694 Ga0495580_0077173 3300046472 Bacteria 2323
695 Ga0495580_0106816 3300046472 Bacteria 1944
696 Ga0495582_0136186 3300046473 Bacteria 1390
697 Ga0495639_0009371 3300046475 Bacteria 4199
698 Ga0495584_0000343 3300046491 Bacteria 32238
699 Ga0495584_0027742 3300046491 Bacteria 2869
700 Ga0495584_0050909 3300046491 Bacteria 2086
701 Ga0495585_0000257 3300046492 Bacteria 54605
702 Ga0495585_0000364 3300046492 Bacteria 43911
703 Ga0495585_0003059 3300046492 Bacteria 11508
704 Ga0495585_0046711 3300046492 Bacteria 2414
705 Ga0495594_0004342 3300046499 Bacteria 7295
706 Ga0495594_0067014 3300046499 Bacteria 1992
707 Ga0495596_0000578 3300046500 Bacteria 22865
708 Ga0495607_0005633 3300046501 Bacteria 8928
709 Ga0495583_0000318 3300046506 Bacteria 76178
710 Ga0495583_0009533 3300046506 Bacteria 5789
711 Ga0495583_0025898 3300046506 Bacteria 2920
712 Ga0495583_0030315 3300046506 Bacteria 2636
713 Ga0495606_0000037 3300046507 Bacteria 231282
714 Ga0495606_0000331 3300046507 Bacteria 81871
715 Ga0495608_0005483 3300046511 Bacteria 9067
716 Ga0495608_0007458 3300046511 Bacteria 7726
717 Ga0495610_0000004 3300046512 Bacteria 1006135
718 Ga0495610_0028593 3300046512 Bacteria 2945
719 Ga0495610_0053354 3300046512 Bacteria 1958
720 Ga0495616_0018539 3300046513 Bacteria 3818
721 Ga0495628_0006870 3300046516 Bacteria 9893
722 Ga0495630_0002003 3300046517 Bacteria 14169
723 Ga0495637_0001635 3300046520 Bacteria 12982
724 Ga0495643_0000233 3300046522 Bacteria 84175
725 Ga0495643_0003131 3300046522 Bacteria 12342
726 Ga0495643_0006650 3300046522 Bacteria 7580
727 Ga0495644_0007794 3300046523 Bacteria 4129
728 Ga0495644_0008523 3300046523 Bacteria 3949
729 Ga0495648_0001623 3300046524 Bacteria 21830
730 Ga0495648_0019046 3300046524 Bacteria 4840
731 Ga0495648_0081788 3300046524 Bacteria 1836
732 Ga0495642_0026689 3300046528 Bacteria 2295
733 Ga0495652_0009228 3300046529 Bacteria 8965
734 Ga0495652_0042210 3300046529 Bacteria 3934
735 Ga0495654_0000004 3300046530 Bacteria 515304
736 Ga0495665_0000965 3300046531 Bacteria 15222
737 Ga0495665_0002916 3300046531 Bacteria 9240
738 Ga0495665_0096855 3300046531 Bacteria 1549
739 Ga0495587_0000392 3300046536 Bacteria 31174
740 Ga0495587_0004124 3300046536 Bacteria 9610
741 Ga0495609_0003914 3300046538 Bacteria 8350
742 Ga0495609_0011277 3300046538 Bacteria 4262
743 Ga0495609_0020365 3300046538 Bacteria 3065
744 Ga0495609_0026513 3300046538 Bacteria 2653
745 Ga0495621_0010391 3300046539 Bacteria 2846
746 Ga0495621_0015889 3300046539 Bacteria 2407
747 Ga0495621_0019944 3300046539 Bacteria 2195
748 Ga0495621_0025945 3300046539 Bacteria 1973
749 Ga0495645_0048144 3300046543 Bacteria 3105
750 Ga0495622_0005665 3300046557 Bacteria 5790
751 Ga0495622_0051424 3300046557 Bacteria 1911
752 Ga0495633_0000756 3300046558 Bacteria 29179
753 Ga0495667_0010677 3300046559 Bacteria 6210
754 Ga0495667_0024704 3300046559 Bacteria 4047
755 Ga0495656_0005498 3300046615 Bacteria 4376
756 Ga0495668_0002904 3300046616 Bacteria 13528
757 Ga0495668_0005002 3300046616 Bacteria 9157
758 Ga0495668_0008628 3300046616 Bacteria 6337
759 Ga0495668_0011101 3300046616 Bacteria 5413
760 Ga0495611_0030837 3300046648 Bacteria 2358
761 Ga0495625_0042020 3300046660 Bacteria 3324
762 Ga0495635_0189194 3300046663 Bacteria 1398
763 Ga0495659_0001388 3300046664 Bacteria 8263
764 Ga0495659_0011649 3300046664 Bacteria 2834
765 Ga0495661_0004759 3300046665 Bacteria 9739
766 Ga0495661_0010720 3300046665 Bacteria 6243
767 Ga0495661_0015184 3300046665 Bacteria 5142
768 Ga0495661_0034244 3300046665 Bacteria 3196
769 Ga0495588_0005258 3300046674 Bacteria 5754
770 Ga0495588_0017791 3300046674 Bacteria 3457
771 Ga0495657_0020903 3300046675 Bacteria 4704
772 Ga0495657_0098896 3300046675 Bacteria 1861
773 Ga0495599_0079821 3300046678 Bacteria 2043
774 Ga0495623_0014004 3300046679 Bacteria 5197
775 Ga0495646_0003866 3300046680 Bacteria 9362
776 Ga0495658_0001597 3300046683 Bacteria 11805
777 Ga0495669_0008486 3300046684 Bacteria 4322
778 Ga0495613_0018906 3300046689 Bacteria 5133
779 Ga0495624_0023543 3300046690 Bacteria 4061
780 Ga0495670_0002448 3300046691 Bacteria 9172
781 Ga0495671_0000177 3300046692 Bacteria 56452
782 Ga0495649_0008013 3300046694 Bacteria 6384
783 Ga0495600_0018515 3300046809 Bacteria 4437
784 Ga0495660_0001429 3300046810 Bacteria 16363
785 Ga0495581_0002799 3300047315 Bacteria 9953
786 Ga0495581_0060451 3300047315 Bacteria 2190
787 Ga0495604_0006990 3300047317 Bacteria 8942
788 Ga0495604_0009216 3300047317 Bacteria 7814
789 Ga0495636_0004916 3300047318 Bacteria 5238
790 Ga0495674_0011791 3300047319 Bacteria 8242
791 Ga0495674_0027948 3300047319 Bacteria 5150
792 Ga0495674_0071474 3300047319 Bacteria 2995
793 Ga0495672_0000206 3300047320 Bacteria 84222
794 Ga0495672_0000242 3300047320 Bacteria 76766
795 Ga0495672_0096319 3300047320 Bacteria 1613
796 Ga0495676_0030478 3300047321 Bacteria 4577
797 Ga0495676_0055978 3300047321 Bacteria 3122
798 Ga0495676_0125552 3300047321 Bacteria 1860
799 Ga0495680_0000068 3300047322 Bacteria 89135
800 Ga0495680_0005490 3300047322 Bacteria 11920
801 Ga0495680_0034636 3300047322 Bacteria 4074
802 Ga0495683_0000007 3300047323 Bacteria 268546
803 Ga0495675_0000027 3300047444 Bacteria 106917
804 Ga0495675_0001586 3300047444 Bacteria 13704
805 Ga0495675_0047659 3300047444 Bacteria 2726
806 Ga0495673_0000017 3300047469 Bacteria 574970
807 Ga0495673_0000027 3300047469 Bacteria 475440
808 Ga0495681_0004212 3300047470 Bacteria 9864
809 Ga0495684_0001011 3300047471 Bacteria 22911
810 Ga0495686_0000006 3300047472 Bacteria 770778
811 Ga0495686_0002116 3300047472 Bacteria 19445
812 Ga0495686_0002175 3300047472 Bacteria 19088
813 Ga0495686_0009047 3300047472 Bacteria 7227
814 Ga0495593_0007764 3300047673 Bacteria 6252
815 Ga0495593_0028545 3300047673 Bacteria 3064
816 Ga0495602_0013119 3300048088 Bacteria 8477
817 Ga0495614_0038149 3300048089 Bacteria 2062
818 Ga0495626_0004800 3300048091 Bacteria 8156
819 Ga0496100_0030977 3300048903 Bacteria 3322
820 Ga0496102_0041537 3300048905 Bacteria 4164
821 Ga0496102_0233331 3300048905 Bacteria 1734
822 Ga0496104_0000291 3300048907 Bacteria 44138
823 Ga0496104_0119307 3300048907 Bacteria 2532
824 Ga0496105_0000075 3300048908 Bacteria 75152
825 Ga0496105_0255414 3300048908 Bacteria 1419
826 Ga0496106_0129421 3300048909 Bacteria 1979
827 Ga0496108_0103156 3300048911 Bacteria 2433
828 Ga0496110_0172088 3300048913 Bacteria 1965
829 Ga0496112_0078500 3300048915 Bacteria 3265
830 Ga0496112_0119969 3300048915 Bacteria 2600
831 Ga0496112_0164589 3300048915 Bacteria 2184
832 Ga0496112_0237821 3300048915 Bacteria 1775
833 Ga0496114_0020789 3300048917 Bacteria 5328
834 Ga0496114_0163257 3300048917 Bacteria 1938
835 Ga0496115_0077369 3300048918 Bacteria 2705
836 Ga0496115_0128393 3300048918 Bacteria 2089
837 Ga0496116_0045702 3300048919 Bacteria 2961
838 Ga0496117_0000010 3300048920 Bacteria 611954
839 Ga0496117_0130766 3300048920 Bacteria 1522
840 Ga0496118_0000009 3300048921 Bacteria 611954
841 Ga0496118_0000182 3300048921 Bacteria 110967
842 Ga0496121_0006227 3300048924 Bacteria 14949
843 Ga0496121_0012863 3300048924 Bacteria 9053
844 Ga0496121_0023762 3300048924 Bacteria 5889
845 Ga0496121_0076340 3300048924 Bacteria 2672
846 Ga0496122_0002845 3300048925 Bacteria 23688
847 Ga0496122_0012865 3300048925 Bacteria 8272
848 Ga0496122_0020494 3300048925 Bacteria 5970
849 Ga0496123_0007735 3300048926 Bacteria 10031
850 Ga0496123_0024801 3300048926 Bacteria 4543
851 Ga0496124_0024133 3300048927 Bacteria 5535
852 Ga0496126_0000139 3300048929 Bacteria 167097
853 Ga0496126_0002052 3300048929 Bacteria 28303
854 Ga0496126_0020972 3300048929 Bacteria 6395
855 Ga0496126_0115897 3300048929 Bacteria 2329
856 Ga0496126_0234229 3300048929 Bacteria 1537
857 Ga0495678_002205 3300049459 Bacteria 13652
858 Ga0501299_004431 3300049522 Bacteria 2098
859 Ga0501299_005221 3300049522 Bacteria 1985
860 Ga0501033_0014916 3300049570 Bacteria 5899
861 Ga0501033_0031227 3300049570 Bacteria 4004
862 Ga0501034_0004072 3300049571 Bacteria 16405
863 Ga0501034_0012936 3300049571 Bacteria 8602
864 Ga0501034_0023006 3300049571 Bacteria 6350
865 Ga0501034_0067442 3300049571 Bacteria 3591
866 Ga0501034_0068468 3300049571 Bacteria 3559
867 Ga0501034_0210748 3300049571 Bacteria 1898
868 Ga0501036_0008184 3300049572 Bacteria 8571
869 Ga0501036_0008804 3300049572 Bacteria 8284
870 Ga0501037_0001648 3300049573 Bacteria 16237
871 Ga0501037_0009111 3300049573 Bacteria 7272
872 Ga0501037_0034714 3300049573 Bacteria 3721
873 Ga0501038_0007833 3300049574 Bacteria 9846
874 Ga0501038_0013770 3300049574 Bacteria 7370
875 Ga0501042_0192497 3300049578 Bacteria 1471
876 Ga0501043_0031371 3300049579 Bacteria 4177
877 Ga0501043_0072158 3300049579 Bacteria 2712
878 Ga0501046_0000887 3300049580 Bacteria 29123
879 Ga0501046_0020892 3300049580 Bacteria 5406
880 Ga0501047_0014503 3300049581 Bacteria 7494
881 Ga0501047_0018167 3300049581 Bacteria 6739
882 Ga0501047_0058552 3300049581 Bacteria 3722
883 Ga0501047_0070013 3300049581 Bacteria 3377
884 Ga0501047_0309106 3300049581 Bacteria 1421
885 Ga0501048_0036930 3300049582 Bacteria 3509
886 Ga0501048_0060301 3300049582 Bacteria 2688
887 Ga0501067_0009767 3300049583 Bacteria 5311
888 Ga0501067_0029285 3300049583 Bacteria 3052
889 Ga0501067_0075269 3300049583 Bacteria 1870
890 Ga0501068_0020186 3300049584 Bacteria 3879
891 Ga0501069_0001461 3300049585 Bacteria 11617
892 Ga0501070_0017220 3300049586 Bacteria 6067
893 Ga0501071_0120738 3300049587 Bacteria 1943
894 Ga0501071_0225164 3300049587 Bacteria 1412
895 Ga0501072_0016599 3300049588 Bacteria 5656
896 Ga0501073_0016712 3300049589 Bacteria 5317
897 Ga0501073_0035063 3300049589 Bacteria 3567
898 Ga0501074_0016520 3300049590 Bacteria 5357
899 Ga0501074_0095027 3300049590 Bacteria 2134
900 Ga0501074_0096007 3300049590 Bacteria 2123
901 Ga0501075_0032354 3300049591 Bacteria 3884
902 Ga0501076_0081211 3300049592 Bacteria 2602
903 Ga0501077_0063713 3300049593 Bacteria 2339
904 Ga0501079_0008610 3300049741 Bacteria 7743
905 Ga0501079_0024837 3300049741 Bacteria 4597
906 Ga0501080_0080245 3300049742 Bacteria 3032
907 Ga0501081_0019726 3300049743 Bacteria 4493
908 Ga0501081_0066077 3300049743 Bacteria 2515
909 Ga0501081_0088367 3300049743 Bacteria 2177
910 Ga0501083_0006954 3300049744 Bacteria 8025
911 Ga0501083_0014583 3300049744 Bacteria 5494
912 Ga0501269_000024 3300049766 Bacteria 52180
913 Ga0501035_0013386 3300049822 Bacteria 7574
914 Ga0501035_0021497 3300049822 Bacteria 5931
915 Ga0501035_0287566 3300049822 Bacteria 1388
916 Ga0501044_0018895 3300049823 Bacteria 7379
917 Ga0501044_0026431 3300049823 Bacteria 6142
918 Ga0501045_0005367 3300049824 Bacteria 8881
919 Ga0501045_0037400 3300049824 Bacteria 3528
920 nmdc:mga0yw44_42582_c1 3300050492 Bacteria 2708
921 nmdc:mga05p37_14271_c1 3300050507 Bacteria 9539
922 nmdc:mga05p37_263442_c1 3300050507 Bacteria 2062
923 nmdc:mga05p37_288908_c1 3300050507 Bacteria 1952
924 nmdc:mga05p37_3248_c1 3300050507 Bacteria 18933
925 nmdc:mga05p37_33175_c1 3300050507 Bacteria 6322
926 nmdc:mga05p37_339636_c1 3300050507 Bacteria 1771
927 nmdc:mga05p37_5160_c1 3300050507 Bacteria 15308
928 nmdc:mga05p37_63879_c1 3300050507 Bacteria 4531
929 nmdc:mga05p37_73775_c1 3300050507 Bacteria 4199
930 nmdc:mga09592_10440_c1 3300050508 Bacteria 7556
931 nmdc:mga09592_110236_c1 3300050508 Bacteria 2361
932 nmdc:mga09592_32935_c1 3300050508 Bacteria 4322
933 nmdc:mga09592_38094_c1 3300050508 Bacteria 4035
934 nmdc:mga09592_4121_c1 3300050508 Bacteria 11742
935 nmdc:mga09592_91659_c1 3300050508 Bacteria 2597
936 nmdc:mga0qj67_14341_c1 3300050509 Bacteria 5990
937 nmdc:mga0qj67_156522_c1 3300050509 Bacteria 1850
938 nmdc:mga0qj67_2530_c1 3300050509 Bacteria 13054
939 nmdc:mga0qj67_31339_c1 3300050509 Bacteria 4141
940 nmdc:mga0qj67_63098_c1 3300050509 Bacteria 2946
941 nmdc:mga0qj67_66497_c1 3300050509 Bacteria 2871
942 nmdc:mga06r32_112685_c1 3300050510 Bacteria 2677
943 nmdc:mga06r32_167689_c1 3300050510 Bacteria 2179
944 nmdc:mga06r32_24242_c1 3300050510 Bacteria 5628
945 nmdc:mga06r32_24456_c1 3300050510 Bacteria 5607
946 nmdc:mga06r32_69537_c1 3300050510 Bacteria 3403
947 nmdc:mga08y16_1346_c1 3300050511 Bacteria 24536
948 nmdc:mga08y16_141997_c1 3300050511 Bacteria 2496
949 nmdc:mga08y16_30179_c1 3300050511 Bacteria 5707
950 nmdc:mga08y16_371649_c1 3300050511 Bacteria 1466
951 nmdc:mga08y16_49007_c1 3300050511 Bacteria 4420
952 nmdc:mga08y16_5495_c1 3300050511 Bacteria 13251
953 nmdc:mga08y16_73656_c1 3300050511 Bacteria 3558
954 nmdc:mga08y16_81746_c1 3300050511 Bacteria 3368
955 nmdc:mga0n895_11322_c1 3300050512 Bacteria 7949
956 nmdc:mga0n895_142622_c1 3300050512 Bacteria 2425
957 nmdc:mga0n895_220045_c1 3300050512 Bacteria 1928
958 nmdc:mga0n895_3505_c1 3300050512 Bacteria 12669
959 nmdc:mga0n895_358545_c1 3300050512 Bacteria 1477
960 nmdc:mga0n895_4988_c1 3300050512 Bacteria 11013
961 nmdc:mga0rr50_10664_c1 3300050513 Bacteria 5846
962 nmdc:mga0rr50_170372_c1 3300050513 Bacteria 1774
963 nmdc:mga0rr50_72231_c1 3300050513 Bacteria 2635
964 nmdc:mga0a205_12595_c2 3300050515 Bacteria 6346
965 nmdc:mga0a205_186685_c1 3300050515 Bacteria 1966
966 nmdc:mga0a205_20548_c1 3300050515 Bacteria 6232
967 nmdc:mga0a205_302685_c1 3300050515 Bacteria 1472
968 nmdc:mga0a205_30644_c1 3300050515 Bacteria 5152
969 nmdc:mga0a205_8668_c1 3300050515 Bacteria 8615
970 Ga0495612_0006784 3300053078 Bacteria 4690
971 Ga0495619_0145238 3300053085 Bacteria 1635
972 Ga0500644_0010739 3300053088 Bacteria 2485
973 Ga0500651_0000222 3300053093 Bacteria 35734
974 Ga0500555_002778 3300053103 Bacteria 5024
975 Ga0500555_008549 3300053103 Bacteria 2921
976 Ga0500618_001426 3300053125 Bacteria 10666
977 Ga0500616_0000086 3300053153 Bacteria 192348
978 Ga0500645_000044 3300053730 Bacteria 109705
979 Ga0500599_003594 3300053736 Bacteria 1896
980 Ga0501084_0032006 3300054114 Bacteria 4399
981 Ga0501084_0044940 3300054114 Bacteria 3698
982 Ga0501084_0146042 3300054114 Bacteria 1992
983 Ga0590071_001592 3300059421 Bacteria 5948
984 Ga0590075_000138 3300059424 Bacteria 19114
985 Ga0590077_000077 3300059426 Bacteria 24876
986 Ga0590077_001774 3300059426 Bacteria 4854
987 Ga0501082_0012400 3300060353 Bacteria 7325
988 Ga0501082_0013767 3300060353 Bacteria 6954
989 Ga0501082_0028608 3300060353 Bacteria 4800
990 Ga0530510_0006774 3300061734 Bacteria 7983
991 Ga0530510_0136903 3300061734 Bacteria 1803
992 2601670618 2600255292 Bacteria 6300551
993 2643976130 2643221593 Bacteria 6296053
994 2738825483 2738541297 Bacteria 6549566
995 2739149280 2738541357 Bacteria 6549408
996 2739191199 2738543003 Bacteria 6549560
997 2739317676 2738543026 Bacteria 6549408
998 2739335917 2738543029 Bacteria 6549249
999 2857548037 2857547612 Bacteria 6179999
1000 2857561170 2857558681 Bacteria 6617694
1001 2885082956 2885080285 Bacteria 6355622
1002 2904429110 2904424332 Bacteria 7633521
1003 2917705053 2917699015 Bacteria 7043791
1004 2919514911 2919513703 Bacteria 3844312
1005 2919679030 2919675420 Bacteria 3969095
1006 2932412627 2932410948 Bacteria 6312192
1007 2932420142 2932416698 Bacteria 6315112
1008 2941492832 2941489479 Bacteria 6313767
1009 nmdc:mga05p37_32609_c1
1010 JGI24746J21847_1001222
1011 JGI25151J46595_10001398
1012 JGI25406J46586_10000121
1013 rootH2_10009426
1014 Ga0055526_1000129
1015 Ga0055543_1002002
1016 Ga0065165_1000050
1017 Ga0065712_10010331
1018 Ga0065712_10017262
1019 Ga0065712_10079412
1020 Ga0065712_10081025
1021 Ga0065715_10003555
1022 Ga0065715_10003862
1023 Ga0065715_10103465
1024 Ga0065715_10117896
1025 Ga0065715_10191947
1026 Ga0065707_10004066
1027 Ga0065707_10107365
1028 Ga0070658_10001036
1029 Ga0070658_10029586
1030 Ga0070658_10092672
1031 Ga0070658_10130569
1032 Ga0070658_10147021
1033 Ga0070676_10024926
1034 Ga0070676_10028465
1035 Ga0070676_10057556
1036 Ga0070683_100020144
1037 Ga0070683_100048338
1038 Ga0070683_100111233
1039 Ga0070683_100189029
1040 Ga0070690_100003577
1041 Ga0070690_100025518
1042 Ga0070690_100029732
1043 Ga0070690_100059519
1044 Ga0070670_100001059
1045 Ga0070670_100014434
1046 Ga0070670_100028275
1047 Ga0070670_100053077
1048 Ga0070670_100109514
1049 Ga0070677_10000820
1050 Ga0068869_100012848
1051 Ga0068869_100172785
1052 Ga0070666_10000001
1053 Ga0070666_10021458
1054 Ga0070680_100030360
1055 Ga0070680_100060072
1056 Ga0070680_100087677
1057 Ga0070682_100069908
1058 Ga0068868_100010518
1059 Ga0068868_100010978
1060 Ga0070660_100003334
1061 Ga0070660_100070552
1062 Ga0070660_100082316
1063 Ga0070689_100010769
1064 Ga0070689_100021262
1065 Ga0070689_100077606
1066 Ga0070687_100010132
1067 Ga0070687_100044317
1068 Ga0070687_100078109
1069 Ga0070661_100008933
1070 Ga0070692_10046861
1071 Ga0070668_100001298
1072 Ga0070668_100021672
1073 Ga0070668_100028229
1074 Ga0070669_100003163
1075 Ga0070669_100006451
1076 Ga0070669_100037619
1077 Ga0070669_100088013
1078 Ga0070669_100100234
1079 Ga0070669_100144810
1080 Ga0070675_100020276
1081 Ga0070675_100032864
1082 Ga0070675_100123824
1083 Ga0070675_100157319
1084 Ga0070675_100160155
1085 Ga0070671_100013621
1086 Ga0070671_100047619
1087 Ga0070671_100056437
1088 Ga0070671_100098006
1089 Ga0070671_100103816
1090 Ga0070674_100000143
1091 Ga0070674_100079753
1092 Ga0070673_100008923
1093 Ga0070673_100018740
1094 Ga0070688_100006661
1095 Ga0070688_100009731
1096 Ga0070688_100064968
1097 Ga0070688_100065073
1098 Ga0070688_100174115
1099 Ga0070659_100018847
1100 Ga0070659_100111308
1101 Ga0070667_100014750
1102 Ga0070667_100043256
1103 Ga0070667_100155064
1104 Ga0070709_10130612
1105 Ga0070714_100020018
1106 Ga0070713_100004822
1107 Ga0070713_100020467
1108 Ga0070713_100084811
1109 Ga0070713_100294125
1110 Ga0070701_10010680
1111 Ga0070701_10089578
1112 Ga0070711_100078109
1113 Ga0070711_100163771
1114 Ga0070705_100000704
1115 Ga0070700_100032916
1116 Ga0070700_100073305
1117 Ga0070694_100001822
1118 Ga0070694_100069089
1119 Ga0070694_100202982
1120 Ga0070663_100010132
1121 Ga0070663_100061648
1122 Ga0070678_100036289
1123 Ga0070678_100196453
1124 Ga0070662_100106995
1125 Ga0070681_10007479
1126 Ga0070681_10015033
1127 Ga0070681_10015833
1128 Ga0070681_10060643
1129 Ga0070681_10127067
1130 Ga0068867_100001114
1131 Ga0068867_100047855
1132 Ga0068867_100050118
1133 Ga0068867_100252119
1134 Ga0070706_100124640
1135 Ga0070707_100062214
1136 Ga0070707_100096914
1137 Ga0070707_100225237
1138 Ga0070698_100003696
1139 Ga0070698_100005828
1140 Ga0070699_100000457
1141 Ga0070699_100004350
1142 Ga0070699_100031962
1143 Ga0070699_100052047
1144 Ga0070699_100080647
1145 Ga0070699_100086996
1146 Ga0070679_100001692
1147 Ga0070679_100018177
1148 Ga0070679_100025310
1149 Ga0070679_100056750
1150 Ga0070679_100074035
1151 Ga0070684_100040400
1152 Ga0068853_100112795
1153 Ga0068853_100123923
1154 Ga0068853_100167980
1155 Ga0070672_100009546
1156 Ga0070672_100027138
1157 Ga0070686_100000861
1158 Ga0070686_100004648
1159 Ga0070686_100029381
1160 Ga0070695_100000064
1161 Ga0070696_100001482
1162 Ga0070696_100001985
1163 Ga0070696_100029109
1164 Ga0070665_100007298
1165 Ga0070665_100010641
1166 Ga0070665_100017890
1167 Ga0070665_100018594
1168 Ga0070665_100028274
1169 Ga0070665_100083335
1170 Ga0070704_100007103
1171 Ga0070704_100009708
1172 Ga0070704_100045496
1173 Ga0070704_100079102
1174 Ga0070704_100192356
1175 Ga0068855_100002900
1176 Ga0068855_100019059
1177 Ga0068855_100040460
1178 Ga0068855_100043264
1179 Ga0068855_100051520
1180 Ga0068855_100091291
1181 Ga0068855_100280079
1182 Ga0070664_100041917
1183 Ga0070664_100188441
1184 Ga0070664_100192393
1185 Ga0068857_100002823
1186 Ga0068857_100012106
1187 Ga0068857_100059226
1188 Ga0068857_100099783
1189 Ga0068857_100197332
1190 Ga0068854_100007890
1191 Ga0068854_100068824
1192 Ga0068854_100118231
1193 Ga0068856_100001937
1194 Ga0068856_100062334
1195 Ga0068856_100063710
1196 Ga0070702_100005745
1197 Ga0068852_100000040
1198 Ga0068852_100014922
1199 Ga0068852_100062682
1200 Ga0068852_100183564
1201 Ga0068859_100000180
1202 Ga0068859_100007306
1203 Ga0068859_100018472
1204 Ga0068859_100018712
1205 Ga0068859_100025109
1206 Ga0068859_100035592
1207 Ga0068859_100085901
1208 Ga0068859_100403060
1209 Ga0068864_100004327
1210 Ga0068864_100023737
1211 Ga0068864_100030559
1212 Ga0068864_100036523
1213 Ga0068864_100048708
1214 Ga0068864_100063908
1215 Ga0068864_100102508
1216 Ga0068861_100001421
1217 Ga0068861_100012591
1218 Ga0068870_10000779
1219 Ga0068870_10011176
1220 Ga0068863_100005988
1221 Ga0068863_100207061
1222 Ga0068858_100001977
1223 Ga0068858_100003784
1224 Ga0068858_100012713
1225 Ga0068858_100180883
1226 Ga0068858_100206453
1227 Ga0068860_100004193
1228 Ga0068860_100010622
1229 Ga0068860_100019864
1230 Ga0068860_100286226
1231 Ga0068862_100001270
1232 Ga0068862_100025123
1233 Ga0068862_100129011
1234 Ga0081539_10001107
1235 Ga0081539_10006892
1236 Ga0070717_10037836
1237 Ga0075365_10006974
1238 Ga0070716_100050096
1239 Ga0097621_100002357
1240 Ga0097621_100013642
1241 Ga0097621_100024363
1242 Ga0068871_100010807
1243 Ga0068871_100094222
1244 Ga0068871_100169672
1245 Ga0075428_100002102
1246 Ga0075428_100019109
1247 Ga0075428_100021511
1248 Ga0075428_100040680
1249 Ga0075428_100045963
1250 Ga0075428_100105542
1251 Ga0075428_100304413
1252 Ga0075430_100003042
1253 Ga0075430_100007983
1254 Ga0075430_100013989
1255 Ga0075430_100016386
1256 Ga0075430_100064038
1257 Ga0075430_100082061
1258 Ga0075431_100014150
1259 Ga0075431_100014321
1260 Ga0075431_100034366
1261 Ga0075431_100192238
1262 Ga0075431_100235399
1263 Ga0075433_10001136
1264 Ga0075433_10021456
1265 Ga0075433_10031464
1266 Ga0075433_10042560
1267 Ga0075434_100010027
1268 Ga0075434_100011440
1269 Ga0075434_100031731
1270 Ga0075434_100046360
1271 Ga0075434_100056464
1272 Ga0075434_100154827
1273 Ga0075434_100226310
1274 Ga0075429_100002201
1275 Ga0075429_100011476
1276 Ga0075429_100015558
1277 Ga0075429_100064196
1278 Ga0075429_100072751
1279 Ga0075429_100091410
1280 Ga0075429_100103714
1281 Ga0068865_100014820
1282 Ga0068865_100154819
1283 Ga0068865_100197892
1284 Ga0075436_100088389
1285 Ga0097620_100000180
1286 Ga0097620_100007306
1287 Ga0097620_100018472
1288 Ga0097620_100018711
1289 Ga0097620_100025112
1290 Ga0097620_100035592
1291 Ga0097620_100085903
1292 Ga0097620_100403022
1293 Ga0075435_100001202
1294 Ga0075435_100002251
1295 Ga0075435_100006158
1296 Ga0075435_100006182
1297 Ga0075435_100155273
1298 Ga0105244_10000678
1299 Ga0105240_10000312
1300 Ga0105240_10002273
1301 Ga0105240_10007947
1302 Ga0105240_10011435
1303 Ga0105240_10012892
1304 Ga0105240_10055314
1305 Ga0105240_10057743
1306 Ga0105240_10081877
1307 Ga0105240_10160641
1308 Ga0105240_10165845
1309 Ga0111539_10000159
1310 Ga0111539_10003690
1311 Ga0111539_10006988
1312 Ga0111539_10033767
1313 Ga0111539_10052188
1314 Ga0111539_10060760
1315 Ga0111539_10063215
1316 Ga0111539_10122390
1317 Ga0111539_10159861
1318 Ga0111539_10179701
1319 Ga0111539_10381031
1320 Ga0105245_10020420
1321 Ga0105245_10047116
1322 Ga0105245_10123276
1323 Ga0105247_10034018
1324 Ga0105247_10068043
1325 Ga0105247_10098441
1326 Ga0114129_10001780
1327 Ga0114129_10005772
1328 Ga0114129_10008257
1329 Ga0114129_10008325
1330 Ga0114129_10014579
1331 Ga0114129_10023777
1332 Ga0114129_10030346
1333 Ga0114129_10050086
1334 Ga0114129_10050645
1335 Ga0114129_10198603
1336 Ga0114129_10266906
1337 Ga0114129_10506431
1338 Ga0105243_10019766
1339 Ga0105243_10058213
1340 Ga0105241_10011936
1341 Ga0105241_10016182
1342 Ga0105241_10050221
1343 Ga0105242_10008024
1344 Ga0105248_10000166
1345 Ga0105248_10002222
1346 Ga0105248_10029280
1347 Ga0105248_10050029
1348 Ga0105248_10065374
1349 Ga0105248_10075185
1350 Ga0105237_10051840
1351 Ga0105238_10000680
1352 Ga0105238_10004104
1353 Ga0105238_10018121
1354 Ga0105238_10024567
1355 Ga0105238_10088927
1356 Ga0105249_10000858
1357 Ga0105249_10008306
1358 Ga0105249_10182376
1359 Ga0105239_10007060
1360 Ga0105246_10027790
1361 Ga0157371_10057680
1362 Ga0157371_10099718
1363 Ga0157370_10000164
1364 Ga0157370_10015684
1365 Ga0157370_10019444
1366 Ga0157370_10028865
1367 Ga0157370_10050928
1368 Ga0157370_10076906
1369 Ga0157369_10000021
1370 Ga0157369_10000209
1371 Ga0157369_10003493
1372 Ga0157369_10028132
1373 Ga0157369_10035469
1374 Ga0157369_10049410
1375 Ga0157369_10141542
1376 Ga0157369_10151363
1377 Ga0171462_1022
1378 Ga0157374_10009440
1379 Ga0157374_10010971
1380 Ga0157374_10019766
1381 Ga0157378_10012848
1382 Ga0157378_10019283
1383 Ga0157378_10113931
1384 Ga0157378_10135519
1385 Ga0163162_10008251
1386 Ga0163162_10013347
1387 Ga0163162_10042903
1388 Ga0163162_10078701
1389 Ga0163162_10147385
1390 Ga0157372_10000256
1391 Ga0157372_10006493
1392 Ga0157372_10033163
1393 Ga0157372_10034530
1394 Ga0157372_10038963
1395 Ga0157375_10000281
1396 Ga0157375_10027879
1397 Ga0157375_10343157
1398 Ga0163163_10027026
1399 Ga0163163_10059648
1400 Ga0163163_10073100
1401 Ga0163163_10145920
1402 Ga0163163_10197511
1403 Ga0163163_10211767
1404 Ga0163163_10234890
1405 Ga0157380_10008367
1406 Ga0157380_10341651
1407 Ga0157380_10369601
1408 Ga0182008_10001193
1409 Ga0157377_10005375
1410 Ga0157377_10015758
1411 Ga0157379_10004419
1412 Ga0157379_10054844
1413 Ga0157376_10001792
1414 Ga0157376_10105507
1415 Ga0157376_10113090
1416 Ga0157376_10229368
1417 Ga0182006_1000046
1418 Ga0182007_10000044
1419 Ga0182005_1000032
1420 Ga0163161_10008887
1421 Ga0213876_10002213
1422 Ga0209565_1000005
1423 Ga0209673_1000027
1424 Ga0209130_1000065
1425 Ga0209675_1000004
1426 Ga0209025_1000005
1427 Ga0209564_1000006
1428 Ga0209564_1000050
1429 Ga0209758_1012915
1430 Ga0209256_1000031
1431 Ga0207697_10000704
1432 Ga0207697_10002895
1433 Ga0207697_10012325
1434 Ga0207655_1012763
1435 Ga0207682_10001891
1436 Ga0207682_10004527
1437 Ga0207682_10018742
1438 Ga0207710_10020350
1439 Ga0207710_10063479
1440 Ga0207688_10011291
1441 Ga0207688_10018320
1442 Ga0207688_10092483
1443 Ga0207680_10000003
1444 Ga0207680_10027253
1445 Ga0207647_10028405
1446 Ga0207645_10009178
1447 Ga0207643_10001379
1448 Ga0207643_10001906
1449 Ga0207643_10025175
1450 Ga0207643_10083523
1451 Ga0207705_10000940
1452 Ga0207705_10001812
1453 Ga0207654_10008464
1454 Ga0207654_10015707
1455 Ga0207654_10058801
1456 Ga0207707_10015222
1457 Ga0207707_10016367
1458 Ga0207707_10052960
1459 Ga0207707_10137703
1460 Ga0207707_10176332
1461 Ga0207695_10000341
1462 Ga0207695_10017849
1463 Ga0207695_10042629
1464 Ga0207695_10091887
1465 Ga0207695_10277606
1466 Ga0207671_10009199
1467 Ga0207671_10058454
1468 Ga0207663_10175791
1469 Ga0207660_10044102
1470 Ga0207662_10005937
1471 Ga0207657_10014858
1472 Ga0207657_10014903
1473 Ga0207657_10040729
1474 Ga0207649_10013967
1475 Ga0207652_10003642
1476 Ga0207652_10004161
1477 Ga0207652_10007231
1478 Ga0207652_10026709
1479 Ga0207652_10038703
1480 Ga0207652_10084277
1481 Ga0207646_10176121
1482 Ga0207681_10003028
1483 Ga0207681_10048151
1484 Ga0207681_10051656
1485 Ga0207694_10002851
1486 Ga0207694_10005041
1487 Ga0207694_10023397
1488 Ga0207694_10026394
1489 Ga0207650_10002755
1490 Ga0207650_10026340
1491 Ga0207650_10036464
1492 Ga0207659_10000914
1493 Ga0207659_10009263
1494 Ga0207659_10155235
1495 Ga0207687_10045444
1496 Ga0207700_10053602
1497 Ga0207664_10040493
1498 Ga0207644_10015593
1499 Ga0207644_10059537
1500 Ga0207644_10092895
1501 Ga0207690_10076822
1502 Ga0207706_10006185
1503 Ga0207706_10027627
1504 Ga0207706_10067402
1505 Ga0207706_10078680
1506 Ga0207709_10028589
1507 Ga0207670_10003410
1508 Ga0207670_10005670
1509 Ga0207670_10010780
1510 Ga0207669_10000757
1511 Ga0207704_10009050
1512 Ga0207704_10010163
1513 Ga0207704_10091555
1514 Ga0207691_10001298
1515 Ga0207691_10055866
1516 Ga0207691_10142974
1517 Ga0207711_10000141
1518 Ga0207711_10004086
1519 Ga0207711_10024424
1520 Ga0207711_10026520
1521 Ga0207689_10008557
1522 Ga0207689_10030848
1523 Ga0207689_10054212
1524 Ga0207689_10057665
1525 Ga0207661_10035742
1526 Ga0207679_10096666
1527 Ga0207679_10121520
1528 Ga0207667_10001147
1529 Ga0207667_10042887
1530 Ga0207667_10048642
1531 Ga0207667_10202329
1532 Ga0207667_10316681
1533 Ga0207651_10003661
1534 Ga0207651_10044820
1535 Ga0207712_10007244
1536 Ga0207712_10021086
1537 Ga0207668_10013128
1538 Ga0207668_10013653
1539 Ga0207640_10036133
1540 Ga0207658_10110616
1541 Ga0207658_10183084
1542 Ga0207677_10035339
1543 Ga0207703_10001119
1544 Ga0207703_10078926
1545 Ga0207703_10113299
1546 Ga0207639_10030350
1547 Ga0207639_10089916
1548 Ga0207678_10002203
1549 Ga0207678_10005401
1550 Ga0207708_10024453
1551 Ga0207708_10028186
1552 Ga0207702_10063865
1553 Ga0207702_10208807
1554 Ga0207641_10131174
1555 Ga0207641_10220503
1556 Ga0207648_10046185
1557 Ga0207648_10047391
1558 Ga0207648_10070802
1559 Ga0207676_10003276
1560 Ga0207676_10017141
1561 Ga0207676_10022409
1562 Ga0207676_10034141
1563 Ga0207676_10173953
1564 Ga0207674_10015243
1565 Ga0207674_10016607
1566 Ga0207674_10050268
1567 Ga0207674_10065037
1568 Ga0207674_10071684
1569 Ga0207674_10145060
1570 Ga0207675_100018999
1571 Ga0207675_100190825
1572 Ga0207683_10024624
1573 Ga0207683_10072725
1574 Ga0207683_10112797
1575 Ga0207683_10213047
1576 Ga0207698_10020516
1577 Ga0207698_10192455
1578 Ga0207428_10004273
1579 Ga0207428_10005162
1580 Ga0207428_10005911
1581 Ga0207428_10019022
1582 Ga0207428_10032313
1583 Ga0268266_10000011
1584 Ga0268266_10010860
1585 Ga0268266_10022114
1586 Ga0268266_10029627
1587 Ga0268266_10057272
1588 Ga0268266_10229814
1589 Ga0268265_10002863
1590 Ga0268265_10184625
1591 Ga0268264_10110148
1592 Ga0268264_10143089
1593 Ga0265319_1009083
1594 Ga0265318_10000122
1595 Ga0265318_10007779
1596 Ga0265318_10032918
1597 Ga0307515_10096088
1598 Ga0265338_10016375
1599 Ga0265338_10126506
1600 Ga0265338_10129346
1601 Ga0265338_10135103
1602 Ga0265330_10001106
1603 Ga0265320_10000019
1604 Ga0265325_10011088
1605 Ga0265325_10014355
1606 Ga0265325_10020153
1607 Ga0265329_10006852
1608 Ga0265329_10020185
1609 Ga0265340_10001198
1610 Ga0265339_10026388
1611 Ga0265339_10033368
1612 Ga0265331_10000028
1613 Ga0265316_10000092
1614 Ga0307509_10002182
1615 Ga0307509_10023635
1616 Ga0307408_100049797
1617 Ga0265313_10000704
1618 Ga0265313_10001475
1619 Ga0265314_10000131
1620 Ga0265314_10001078
1621 Ga0265314_10104921
1622 Ga0265342_10000161
1623 Ga0265342_10002743
1624 Ga0307405_10013435
1625 Ga0307405_10015035
1626 Ga0307410_10024457
1627 Ga0307412_10083861
1628 Ga0307409_100013111
1629 Ga0307416_100000731
1630 Ga0307416_100006131
1631 Ga0307416_100008501
1632 Ga0307416_100080980
1633 Ga0307414_10000449
1634 Ga0307414_10064074
1635 Ga0307411_10015527
1636 Ga0307411_10113715
1637 Ga0307415_100163569
1638 Ga0373948_0002220
1639 Ga0373958_0000338
1640 Ga0373938_0002432
1641 Ga0373944_0004683
1642 Ga0373949_0001593
1643 Ga0373951_0000334
1644 Ga0373923_0034942
1645 Ga0373932_0001320
1646 Ga0373954_0001824
1647 Ga0373954_0066556
1648 Ga0373956_0025803
1649 Ga0373943_0100510
1650 Ga0373955_0033868
1651 Ga0373942_0000300
1652 Ga0373924_0014375
1653 Ga0373935_0001821
1654 Ga0373927_0002543
1655 Ga0373927_0025807
1656 Ga0373933_0000034
1657 Ga0373933_0092613
1658 Ga0373947_0048591
1659 Ga0373937_0000001
1660 Ga0373937_0116319
1661 Ga0373925_0218972
1662 Ga0373925_0222934
1663 Ga0395900_0021101
1664 Ga0395900_0187362
1665 Ga0395898_0092856
1666 Ga0395901_0012641
1667 Ga0395901_0018220
1668 Ga0436365_1759017
1669 Ga0436365_1796416
1670 Ga0439447_001727
1671 Ga0451797_0723557
1672 Ga0451807_1802640
1673 Ga0451807_2035948
1674 Ga0451843_0291122
1675 Ga0439431_0026094
1676 Ga0439446_0018374
1677 Ga0451577_0054247
1678 Ga0451577_0097912
1679 Ga0466969_0033773
1680 Ga0466961_0022799
1681 Ga0466961_0039350
1682 Ga0466959_0007010
1683 Ga0451576_0090138
1684 Ga0451576_0101277
1685 Ga0451576_0255244
1686 Ga0495617_000007
1687 Ga0495592_0032891
1688 Ga0495629_0002811
1689 Ga0495638_0017261
1690 Ga0495651_0001343
1691 Ga0495651_0004152
1692 Ga0495651_0011894
1693 Ga0495651_0020556
1694 Ga0495653_0000297
1695 Ga0495653_0008111
1696 Ga0495653_0053088
1697 Ga0495650_0000357
1698 Ga0495650_0000852
1699 Ga0495650_0007439
1700 Ga0495580_0017641
1701 Ga0495580_0049246
1702 Ga0495580_0077173
1703 Ga0495580_0106816
1704 Ga0495582_0136186
1705 Ga0495639_0009371
1706 Ga0495584_0000343
1707 Ga0495584_0027742
1708 Ga0495584_0050909
1709 Ga0495585_0000257
1710 Ga0495585_0000364
1711 Ga0495585_0003059
1712 Ga0495585_0046711
1713 Ga0495594_0004342
1714 Ga0495594_0067014
1715 Ga0495596_0000578
1716 Ga0495607_0005633
1717 Ga0495583_0000318
1718 Ga0495583_0009533
1719 Ga0495583_0025898
1720 Ga0495583_0030315
1721 Ga0495606_0000037
1722 Ga0495606_0000331
1723 Ga0495608_0005483
1724 Ga0495608_0007458
1725 Ga0495610_0000004
1726 Ga0495610_0028593
1727 Ga0495610_0053354
1728 Ga0495616_0018539
1729 Ga0495628_0006870
1730 Ga0495630_0002003
1731 Ga0495637_0001635
1732 Ga0495643_0000233
1733 Ga0495643_0003131
1734 Ga0495643_0006650
1735 Ga0495644_0007794
1736 Ga0495644_0008523
1737 Ga0495648_0001623
1738 Ga0495648_0019046
1739 Ga0495648_0081788
1740 Ga0495642_0026689
1741 Ga0495652_0009228
1742 Ga0495652_0042210
1743 Ga0495654_0000004
1744 Ga0495665_0000965
1745 Ga0495665_0002916
1746 Ga0495665_0096855
1747 Ga0495587_0000392
1748 Ga0495587_0004124
1749 Ga0495609_0003914
1750 Ga0495609_0011277
1751 Ga0495609_0020365
1752 Ga0495609_0026513
1753 Ga0495621_0010391
1754 Ga0495621_0015889
1755 Ga0495621_0019944
1756 Ga0495621_0025945
1757 Ga0495645_0048144
1758 Ga0495622_0005665
1759 Ga0495622_0051424
1760 Ga0495633_0000756
1761 Ga0495667_0010677
1762 Ga0495667_0024704
1763 Ga0495656_0005498
1764 Ga0495668_0002904
1765 Ga0495668_0005002
1766 Ga0495668_0008628
1767 Ga0495668_0011101
1768 Ga0495611_0030837
1769 Ga0495625_0042020
1770 Ga0495635_0189194
1771 Ga0495659_0001388
1772 Ga0495659_0011649
1773 Ga0495661_0004759
1774 Ga0495661_0010720
1775 Ga0495661_0015184
1776 Ga0495661_0034244
1777 Ga0495588_0005258
1778 Ga0495588_0017791
1779 Ga0495657_0020903
1780 Ga0495657_0098896
1781 Ga0495599_0079821
1782 Ga0495623_0014004
1783 Ga0495646_0003866
1784 Ga0495658_0001597
1785 Ga0495669_0008486
1786 Ga0495613_0018906
1787 Ga0495624_0023543
1788 Ga0495670_0002448
1789 Ga0495671_0000177
1790 Ga0495649_0008013
1791 Ga0495600_0018515
1792 Ga0495660_0001429
1793 Ga0495581_0002799
1794 Ga0495581_0060451
1795 Ga0495604_0006990
1796 Ga0495604_0009216
1797 Ga0495636_0004916
1798 Ga0495674_0011791
1799 Ga0495674_0027948
1800 Ga0495674_0071474
1801 Ga0495672_0000206
1802 Ga0495672_0000242
1803 Ga0495672_0096319
1804 Ga0495676_0030478
1805 Ga0495676_0055978
1806 Ga0495676_0125552
1807 Ga0495680_0000068
1808 Ga0495680_0005490
1809 Ga0495680_0034636
1810 Ga0495683_0000007
1811 Ga0495675_0000027
1812 Ga0495675_0001586
1813 Ga0495675_0047659
1814 Ga0495673_0000017
1815 Ga0495673_0000027
1816 Ga0495681_0004212
1817 Ga0495684_0001011
1818 Ga0495686_0000006
1819 Ga0495686_0002116
1820 Ga0495686_0002175
1821 Ga0495686_0009047
1822 Ga0495593_0007764
1823 Ga0495593_0028545
1824 Ga0495602_0013119
1825 Ga0495614_0038149
1826 Ga0495626_0004800
1827 Ga0496100_0030977
1828 Ga0496102_0041537
1829 Ga0496102_0233331
1830 Ga0496104_0000291
1831 Ga0496104_0119307
1832 Ga0496105_0000075
1833 Ga0496105_0255414
1834 Ga0496106_0129421
1835 Ga0496108_0103156
1836 Ga0496110_0172088
1837 Ga0496112_0078500
1838 Ga0496112_0119969
1839 Ga0496112_0164589
1840 Ga0496112_0237821
1841 Ga0496114_0020789
1842 Ga0496114_0163257
1843 Ga0496115_0077369
1844 Ga0496115_0128393
1845 Ga0496116_0045702
1846 Ga0496117_0000010
1847 Ga0496117_0130766
1848 Ga0496118_0000009
1849 Ga0496118_0000182
1850 Ga0496121_0006227
1851 Ga0496121_0012863
1852 Ga0496121_0023762
1853 Ga0496121_0076340
1854 Ga0496122_0002845
1855 Ga0496122_0012865
1856 Ga0496122_0020494
1857 Ga0496123_0007735
1858 Ga0496123_0024801
1859 Ga0496124_0024133
1860 Ga0496126_0000139
1861 Ga0496126_0002052
1862 Ga0496126_0020972
1863 Ga0496126_0115897
1864 Ga0496126_0234229
1865 Ga0495678_002205
1866 Ga0501299_004431
1867 Ga0501299_005221
1868 Ga0501033_0014916
1869 Ga0501033_0031227
1870 Ga0501034_0004072
1871 Ga0501034_0012936
1872 Ga0501034_0023006
1873 Ga0501034_0067442
1874 Ga0501034_0068468
1875 Ga0501034_0210748
1876 Ga0501036_0008184
1877 Ga0501036_0008804
1878 Ga0501037_0001648
1879 Ga0501037_0009111
1880 Ga0501037_0034714
1881 Ga0501038_0007833
1882 Ga0501038_0013770
1883 Ga0501042_0192497
1884 Ga0501043_0031371
1885 Ga0501043_0072158
1886 Ga0501046_0000887
1887 Ga0501046_0020892
1888 Ga0501047_0014503
1889 Ga0501047_0018167
1890 Ga0501047_0058552
1891 Ga0501047_0070013
1892 Ga0501047_0309106
1893 Ga0501048_0036930
1894 Ga0501048_0060301
1895 Ga0501067_0009767
1896 Ga0501067_0029285
1897 Ga0501067_0075269
1898 Ga0501068_0020186
1899 Ga0501069_0001461
1900 Ga0501070_0017220
1901 Ga0501071_0120738
1902 Ga0501071_0225164
1903 Ga0501072_0016599
1904 Ga0501073_0016712
1905 Ga0501073_0035063
1906 Ga0501074_0016520
1907 Ga0501074_0095027
1908 Ga0501074_0096007
1909 Ga0501075_0032354
1910 Ga0501076_0081211
1911 Ga0501077_0063713
1912 Ga0501079_0008610
1913 Ga0501079_0024837
1914 Ga0501080_0080245
1915 Ga0501081_0019726
1916 Ga0501081_0066077
1917 Ga0501081_0088367
1918 Ga0501083_0006954
1919 Ga0501083_0014583
1920 Ga0501269_000024
1921 Ga0501035_0013386
1922 Ga0501035_0021497
1923 Ga0501035_0287566
1924 Ga0501044_0018895
1925 Ga0501044_0026431
1926 Ga0501045_0005367
1927 Ga0501045_0037400
1928 nmdc:mga0yw44_42582_c1
1929 nmdc:mga05p37_14271_c1
1930 nmdc:mga05p37_263442_c1
1931 nmdc:mga05p37_288908_c1
1932 nmdc:mga05p37_3248_c1
1933 nmdc:mga05p37_33175_c1
1934 nmdc:mga05p37_339636_c1
1935 nmdc:mga05p37_5160_c1
1936 nmdc:mga05p37_63879_c1
1937 nmdc:mga05p37_73775_c1
1938 nmdc:mga09592_10440_c1
1939 nmdc:mga09592_110236_c1
1940 nmdc:mga09592_32935_c1
1941 nmdc:mga09592_38094_c1
1942 nmdc:mga09592_4121_c1
1943 nmdc:mga09592_91659_c1
1944 nmdc:mga0qj67_14341_c1
1945 nmdc:mga0qj67_156522_c1
1946 nmdc:mga0qj67_2530_c1
1947 nmdc:mga0qj67_31339_c1
1948 nmdc:mga0qj67_63098_c1
1949 nmdc:mga0qj67_66497_c1
1950 nmdc:mga06r32_112685_c1
1951 nmdc:mga06r32_167689_c1
1952 nmdc:mga06r32_24242_c1
1953 nmdc:mga06r32_24456_c1
1954 nmdc:mga06r32_69537_c1
1955 nmdc:mga08y16_1346_c1
1956 nmdc:mga08y16_141997_c1
1957 nmdc:mga08y16_30179_c1
1958 nmdc:mga08y16_371649_c1
1959 nmdc:mga08y16_49007_c1
1960 nmdc:mga08y16_5495_c1
1961 nmdc:mga08y16_73656_c1
1962 nmdc:mga08y16_81746_c1
1963 nmdc:mga0n895_11322_c1
1964 nmdc:mga0n895_142622_c1
1965 nmdc:mga0n895_220045_c1
1966 nmdc:mga0n895_3505_c1
1967 nmdc:mga0n895_358545_c1
1968 nmdc:mga0n895_4988_c1
1969 nmdc:mga0rr50_10664_c1
1970 nmdc:mga0rr50_170372_c1
1971 nmdc:mga0rr50_72231_c1
1972 nmdc:mga0a205_12595_c2
1973 nmdc:mga0a205_186685_c1
1974 nmdc:mga0a205_20548_c1
1975 nmdc:mga0a205_302685_c1
1976 nmdc:mga0a205_30644_c1
1977 nmdc:mga0a205_8668_c1
1978 Ga0495612_0006784
1979 Ga0495619_0145238
1980 Ga0500644_0010739
1981 Ga0500651_0000222
1982 Ga0500555_002778
1983 Ga0500555_008549
1984 Ga0500618_001426
1985 Ga0500616_0000086
1986 Ga0500645_000044
1987 Ga0500599_003594
1988 Ga0501084_0032006
1989 Ga0501084_0044940
1990 Ga0501084_0146042
1991 Ga0590071_001592
1992 Ga0590075_000138
1993 Ga0590077_000077
1994 Ga0590077_001774
1995 Ga0501082_0012400
1996 Ga0501082_0013767
1997 Ga0501082_0028608
1998 Ga0530510_0006774
1999 Ga0530510_0136903
2000 2601670618
2001 2643976130
2002 2738825483
2003 2739149280
2004 2739191199
2005 2739317676
2006 2739335917
2007 2857548037
2008 2857561170
2009 2885082956
2010 2904429110
2011 2917705053
2012 2919514911
2013 2919679030
2014 2932412627
2015 2932420142
2016 2941492832

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

1

213

0.88

PF00083

Sugar_tr

Sugar (and other) transporter

214

410

0.75

PF07690

MFS_1

Major Facilitator Superfamily

5

369

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lo8-assembly1.cif.gz_Z nora in complex with fab36 0.8168 19 421
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8127 21 424
6rw3-assembly3.cif.gz_C the molecular basis for sugar import in malaria parasites. 0.8097 18 427
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8027 21 424
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.802 17 420
ID Description Score Start End Superfamily
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9958 21 235 1.20.1250.20
af_P37643_245_439_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9928 243 430 1.20.1250.20
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9867 21 235 1.20.1250.20
af_O05301_232_420_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9665 246 429 1.20.1250.20
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9638 20 229 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6D1I932-F1-model_v4 deleted 0.9729 18 431
AF-A0A1C2B6B9-F1-model_v4 deleted 0.9704 24 431
AF-A0A3D0VG45-F1-model_v4 MFS transporter 0.9613 19 382 GO:0005886
GO:0022857
AF-A0A3D0Q216-F1-model_v4 MFS transporter 0.9562 12 246 GO:0005886
GO:0022857
AF-A0A809WQV5-F1-model_v4 deleted 0.9561 20 220

Map