F488096

General Info

Members Datasets Scaffolds Average Seq Length
1009 419 966 285

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_002778|Ga0495627_002778_2308_3243
Length 311
Sequence MMLRLRPRKRIAEMARITAGVASSHVPLLGVASDFNKDRDDYFGPIFAGYDWTREWEKAEKPDVVILVYNDHASAFDMKIIPTFAIGCGERYKSADEGWGPRAVPDVEGHPDLAWHIAQSLVLDEFDMTIINEMDVDHGLTVPLSMMFGKPDAWPCKVVPLAVNVVTYPPPSGNRCWALGEAVRKAVESYPEDLNVQIWGTGGMSHQLQGPRAGLINKEWDNRFLDGLIGDSDHLRRIPHIEYLRETGSEGIEMVMWLVMRGALGKNTRALHRHYHVPCSNTAIGHMVLRPDNGEGLDMTGSDTVTRIAAE

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
4 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
5 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
6 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
7 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
8 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
9 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
10 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
11 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
12 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
13 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
14 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
15 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
16 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
17 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
18 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
19 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
20 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
21 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
22 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
23 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
24 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
25 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
26 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
27 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
28 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
29 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
30 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
31 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
32 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
33 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
34 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
35 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
36 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
37 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
38 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
39 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
40 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
41 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
42 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
43 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
44 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
45 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
46 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
47 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
50 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
51 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
52 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
53 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
54 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
55 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
56 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
57 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
66 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
67 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
70 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
71 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
72 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
73 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
74 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
75 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
76 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
77 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
78 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
79 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
85 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
101 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
108 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
129 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
130 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
135 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
136 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
137 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
138 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
139 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
159 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
160 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
162 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
225 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
227 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
231 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
232 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
233 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
236 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
237 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
238 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
258 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
259 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
260 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
261 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
262 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
263 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
273 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
274 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
275 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
276 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
282 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
283 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
284 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
285 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
286 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
287 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
288 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
289 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
292 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
293 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
294 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
299 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
302 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
303 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
304 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
305 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
306 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
309 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
328 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
329 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
330 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
331 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
332 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
333 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
334 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
335 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
336 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
337 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
338 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
339 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
340 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
341 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
351 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
352 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
353 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
354 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
355 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
356 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
357 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
358 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
359 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
360 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
361 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
362 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
363 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
364 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
365 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
366 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
367 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
368 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
371 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
372 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
373 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
376 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
377 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
378 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
379 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
380 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
381 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
382 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
383 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
384 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
387 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
388 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
389 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
390 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
391 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
392 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
393 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
394 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
395 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
396 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
397 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
398 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
399 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
400 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
401 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
402 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
403 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
404 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
405 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
408 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
409 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
410 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
411 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
412 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
413 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
414 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
415 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
416 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
418 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
419 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0.1
Isolates 3.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11
Nodule 0.1
Rhizoplane 3.67
Rhizosphere 74.83
Stem 0
Stem Tuber 0
Unclassified 10.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_728105 2162886006 Bacteria 2634
2 SwRhRL2b_contig_1724569 2162886007 Bacteria 3176
3 SwRhRL2b_contig_2992305 2162886007 Bacteria 3968
4 SwRhRL2b_contig_3826517 2162886007 Bacteria 1445
5 SwRhRL2b_contig_58648 2162886007 Bacteria 3931
6 ARcpr5yngRDRAFT_c001119 3300000043 Bacteria 3027
7 JGI24736J21556_1000628 3300001904 Bacteria 6467
8 JGI24741J21665_1000412 3300001915 Bacteria 12949
9 JGI24741J21665_1001567 3300001915 Bacteria 6451
10 JGI24741J21665_1007882 3300001915 Bacteria 2041
11 JGI24752J21851_1000508 3300001976 Bacteria 5224
12 JGI24740J21852_10001161 3300001979 Bacteria 11888
13 JGI24740J21852_10002608 3300001979 Bacteria 8132
14 JGI24740J21852_10002728 3300001979 Bacteria 7892
15 JGI24740J21852_10044008 3300001979 Bacteria 1328
16 JGI24739J22299_10000474 3300001989 Bacteria 14136
17 JGI24739J22299_10000894 3300001989 Bacteria 11018
18 JGI24739J22299_10002269 3300001989 Bacteria 7393
19 JGI24739J22299_10043286 3300001989 Bacteria 1489
20 JGI24737J22298_10000777 3300001990 Bacteria 11301
21 JGI24737J22298_10004720 3300001990 Bacteria 4733
22 JGI24737J22298_10022827 3300001990 Bacteria 1987
23 JGI24735J21928_10001703 3300002067 Bacteria 7770
24 JGI24735J21928_10007611 3300002067 Bacteria 3529
25 JGI24735J21928_10012271 3300002067 Bacteria 2710
26 JGI24750J21931_1000309 3300002070 Bacteria 8402
27 JGI24750J21931_1000672 3300002070 Bacteria 5030
28 JGI24748J21848_1000084 3300002074 Bacteria 28101
29 JGI24748J21848_1000110 3300002074 Bacteria 17278
30 JGI24748J21848_1001561 3300002074 Bacteria 2545
31 JGI24738J21930_10000342 3300002075 Bacteria 12775
32 JGI24738J21930_10001583 3300002075 Bacteria 6266
33 JGI24738J21930_10002238 3300002075 Bacteria 5135
34 JGI24738J21930_10002496 3300002075 Bacteria 4792
35 JGI24749J21850_1000368 3300002076 Bacteria 6725
36 JGI24749J21850_1000467 3300002076 Bacteria 5986
37 JGI24749J21850_1001980 3300002076 Bacteria 2891
38 JGI24744J21845_10002073 3300002077 Bacteria 4062
39 JGI24034J26672_10000018 3300002239 Bacteria 130180
40 JGI24742J22300_10002759 3300002244 Bacteria 2828
41 JGI24742J22300_10009297 3300002244 Bacteria 1622
42 JGI24751J29686_10000254 3300002459 Bacteria 20892
43 JGI24751J29686_10000437 3300002459 Bacteria 12906
44 JGI25165J46597_1000021 3300003214 Bacteria 359288
45 JGI25153J46596_10000006 3300003215 Bacteria 447760
46 JGI25153J46596_10002634 3300003215 Bacteria 10258
47 Ga0055526_1000009 3300003771 Bacteria 257259
48 Ga0055537_1000650 3300003773 Bacteria 18342
49 Ga0055524_1000115 3300003775 Bacteria 94326
50 Ga0055534_1003258 3300003784 Bacteria 5181
51 Ga0055530_10004411 3300003791 Bacteria 7247
52 Ga0055531_10000961 3300003794 Bacteria 23107
53 Ga0065165_1002167 3300005262 Bacteria 17747
54 Ga0065165_1003474 3300005262 Bacteria 11005
55 Ga0065165_1005126 3300005262 Bacteria 7588
56 Ga0065704_10000815 3300005289 Bacteria 12109
57 Ga0065704_10001087 3300005289 Bacteria 9633
58 Ga0065704_10070333 3300005289 Bacteria 31916
59 Ga0065704_10070525 3300005289 Bacteria 21766
60 Ga0065704_10082208 3300005289 Bacteria 3637
61 Ga0065704_10105062 3300005289 Bacteria 2122
62 Ga0065704_10105224 3300005289 Bacteria 2117
63 Ga0065704_10122357 3300005289 Bacteria 1750
64 Ga0065707_10000429 3300005295 Bacteria 96496
65 Ga0065707_10001250 3300005295 Bacteria 11180
66 Ga0065707_10081774 3300005295 Bacteria 43222
67 Ga0065707_10082048 3300005295 Bacteria 23588
68 Ga0065707_10082823 3300005295 Bacteria 11874
69 Ga0065707_10087646 3300005295 Bacteria 4939
70 Ga0065707_10090188 3300005295 Bacteria 4192
71 Ga0065707_10091077 3300005295 Bacteria 4008
72 Ga0065707_10101741 3300005295 Bacteria 2847
73 Ga0065707_10115320 3300005295 Bacteria 2270
74 Ga0070658_10000167 3300005327 Bacteria 57334
75 Ga0070658_10001013 3300005327 Bacteria 24091
76 Ga0070658_10005110 3300005327 Bacteria 10681
77 Ga0070658_10011645 3300005327 Bacteria 7054
78 Ga0070658_10012920 3300005327 Bacteria 6703
79 Ga0070658_10064528 3300005327 Bacteria 2987
80 Ga0070658_10157304 3300005327 Bacteria 1905
81 Ga0070658_10325650 3300005327 Bacteria 1313
82 Ga0070676_10000192 3300005328 Bacteria 25516
83 Ga0070676_10057017 3300005328 Bacteria 2310
84 Ga0070683_100418141 3300005329 Bacteria 1279
85 Ga0070690_100000008 3300005330 Bacteria 118441
86 Ga0070690_100000212 3300005330 Bacteria 30301
87 Ga0070670_100000339 3300005331 Bacteria 39253
88 Ga0070670_100098177 3300005331 Bacteria 2520
89 Ga0070670_100330408 3300005331 Bacteria 1337
90 Ga0068869_100000163 3300005334 Bacteria 33165
91 Ga0070666_10000032 3300005335 Bacteria 129142
92 Ga0070666_10326247 3300005335 Bacteria 1095
93 Ga0068868_100001386 3300005338 Bacteria 16724
94 Ga0068868_100138869 3300005338 Bacteria 1993
95 Ga0070660_100000222 3300005339 Bacteria 37567
96 Ga0070660_100038822 3300005339 Bacteria 3616
97 Ga0070660_100045768 3300005339 Bacteria 3351
98 Ga0070660_100070757 3300005339 Bacteria 2722
99 Ga0070660_100121179 3300005339 Bacteria 2087
100 Ga0070689_100001547 3300005340 Bacteria 14657
101 Ga0070661_100000327 3300005344 Bacteria 38235
102 Ga0070661_100274660 3300005344 Bacteria 1306
103 Ga0070661_100380887 3300005344 Bacteria 1112
104 Ga0070668_100005438 3300005347 Bacteria 9456
105 Ga0070668_100023619 3300005347 Bacteria 4652
106 Ga0070668_100073194 3300005347 Bacteria 2671
107 Ga0070668_100080184 3300005347 Bacteria 2557
108 Ga0070668_100219096 3300005347 Bacteria 1569
109 Ga0070669_100000143 3300005353 Bacteria 64072
110 Ga0070669_100000345 3300005353 Bacteria 36221
111 Ga0070669_100001464 3300005353 Bacteria 17088
112 Ga0070669_100002597 3300005353 Bacteria 13056
113 Ga0070669_100013431 3300005353 Bacteria 5822
114 Ga0070669_100273297 3300005353 Bacteria 1352
115 Ga0070675_100011917 3300005354 Bacteria 6814
116 Ga0070675_100453006 3300005354 Bacteria 1151
117 Ga0070671_100000093 3300005355 Bacteria 57157
118 Ga0070671_100001928 3300005355 Bacteria 15902
119 Ga0070671_100011033 3300005355 Bacteria 7251
120 Ga0070671_100019820 3300005355 Bacteria 5479
121 Ga0070671_100040801 3300005355 Bacteria 3856
122 Ga0070671_100073254 3300005355 Bacteria 2861
123 Ga0070674_100001288 3300005356 Bacteria 13200
124 Ga0070674_100005654 3300005356 Bacteria 7247
125 Ga0070673_100000011 3300005364 Bacteria 145332
126 Ga0070688_100002657 3300005365 Bacteria 9073
127 Ga0070688_100010545 3300005365 Bacteria 5101
128 Ga0070659_100047972 3300005366 Bacteria 3353
129 Ga0070659_100455523 3300005366 Bacteria 1086
130 Ga0070667_100000210 3300005367 Bacteria 68040
131 Ga0070667_100000985 3300005367 Bacteria 26177
132 Ga0070667_100041142 3300005367 Bacteria 3877
133 Ga0070667_100227156 3300005367 Bacteria 1663
134 Ga0070667_100297097 3300005367 Bacteria 1454
135 Ga0070711_100324583 3300005439 Bacteria 1231
136 Ga0070705_100058364 3300005440 Bacteria 2281
137 Ga0070663_100000422 3300005455 Bacteria 22325
138 Ga0070663_100001266 3300005455 Bacteria 13895
139 Ga0070678_100011088 3300005456 Bacteria 5542
140 Ga0070662_100029752 3300005457 Bacteria 3814
141 Ga0070662_100044323 3300005457 Bacteria 3186
142 Ga0070662_100049006 3300005457 Bacteria 3045
143 Ga0070681_10008671 3300005458 Bacteria 9971
144 Ga0068867_100000049 3300005459 Bacteria 72604
145 Ga0070685_10000774 3300005466 Bacteria 17387
146 Ga0070685_10003150 3300005466 Bacteria 8381
147 Ga0070698_100032618 3300005471 Bacteria 5394
148 Ga0070679_100361108 3300005530 Bacteria 1400
149 Ga0070684_100174406 3300005535 Bacteria 1954
150 Ga0070684_100237583 3300005535 Bacteria 1664
151 Ga0068853_100027452 3300005539 Bacteria 4783
152 Ga0068853_100126808 3300005539 Bacteria 2281
153 Ga0068853_100178407 3300005539 Bacteria 1925
154 Ga0068853_100376794 3300005539 Bacteria 1324
155 Ga0070672_100017723 3300005543 Bacteria 5132
156 Ga0070686_100000030 3300005544 Bacteria 118308
157 Ga0070686_100000331 3300005544 Bacteria 30636
158 Ga0070665_100000011 3300005548 Bacteria 525539
159 Ga0070665_100000056 3300005548 Bacteria 242622
160 Ga0070665_100000169 3300005548 Bacteria 118043
161 Ga0070665_100000226 3300005548 Bacteria 94176
162 Ga0070665_100000532 3300005548 Bacteria 53844
163 Ga0070665_100089019 3300005548 Bacteria 3093
164 Ga0070665_100239550 3300005548 Bacteria 1815
165 Ga0070665_100296005 3300005548 Bacteria 1621
166 Ga0068855_100000265 3300005563 Bacteria 65271
167 Ga0068855_100002478 3300005563 Bacteria 22773
168 Ga0068855_100032538 3300005563 Bacteria 6226
169 Ga0068855_100309074 3300005563 Bacteria 1749
170 Ga0068855_100429644 3300005563 Bacteria 1444
171 Ga0068855_100437920 3300005563 Bacteria 1428
172 Ga0068855_100508820 3300005563 Bacteria 1308
173 Ga0070664_100105392 3300005564 Bacteria 2456
174 Ga0070664_100253589 3300005564 Bacteria 1582
175 Ga0070664_100404610 3300005564 Bacteria 1248
176 Ga0068857_100039516 3300005577 Bacteria 4179
177 Ga0068857_100041607 3300005577 Bacteria 4075
178 Ga0068857_100113403 3300005577 Bacteria 2437
179 Ga0068857_100132375 3300005577 Bacteria 2250
180 Ga0068857_100135121 3300005577 Bacteria 2226
181 Ga0068854_100000405 3300005578 Bacteria 27114
182 Ga0068854_100004023 3300005578 Bacteria 9227
183 Ga0068854_100079912 3300005578 Bacteria 2412
184 Ga0068854_100264040 3300005578 Bacteria 1379
185 Ga0068856_100004268 3300005614 Bacteria 14272
186 Ga0068856_100005115 3300005614 Bacteria 12961
187 Ga0070702_100443588 3300005615 Bacteria 940
188 Ga0068852_100000544 3300005616 Bacteria 24681
189 Ga0068852_100030135 3300005616 Bacteria 4463
190 Ga0068852_100272273 3300005616 Bacteria 1630
191 Ga0068852_100305815 3300005616 Bacteria 1540
192 Ga0068859_100019606 3300005617 Bacteria 6794
193 Ga0068859_100195204 3300005617 Bacteria 2108
194 Ga0068859_100517827 3300005617 Bacteria 1288
195 Ga0068864_100000088 3300005618 Bacteria 98366
196 Ga0068864_100000379 3300005618 Bacteria 38803
197 Ga0068864_100001540 3300005618 Bacteria 18983
198 Ga0068864_100235371 3300005618 Bacteria 1695
199 Ga0068861_100040635 3300005719 Bacteria 3480
200 Ga0068863_100000065 3300005841 Bacteria 117925
201 Ga0068863_100000158 3300005841 Bacteria 71918
202 Ga0068863_100000645 3300005841 Bacteria 35348
203 Ga0068863_100000925 3300005841 Bacteria 29446
204 Ga0068863_100008798 3300005841 Bacteria 9858
205 Ga0068858_100000094 3300005842 Bacteria 93130
206 Ga0068858_100000149 3300005842 Bacteria 73242
207 Ga0068858_100002113 3300005842 Bacteria 20168
208 Ga0068858_100009628 3300005842 Bacteria 9210
209 Ga0068858_100018905 3300005842 Bacteria 6447
210 Ga0068858_100457179 3300005842 Bacteria 1231
211 Ga0068860_100000132 3300005843 Bacteria 120657
212 Ga0068860_100001798 3300005843 Bacteria 22829
213 Ga0068860_100006559 3300005843 Bacteria 11684
214 Ga0068860_100028234 3300005843 Bacteria 5401
215 Ga0068860_100186099 3300005843 Bacteria 2008
216 Ga0068862_100000095 3300005844 Bacteria 105957
217 Ga0068862_100001939 3300005844 Bacteria 18783
218 Ga0068862_100003339 3300005844 Bacteria 13854
219 Ga0068862_100012900 3300005844 Bacteria 6911
220 Ga0068862_100014185 3300005844 Bacteria 6607
221 Ga0068862_100191054 3300005844 Bacteria 1843
222 Ga0081455_10000072 3300005937 Bacteria 108040
223 Ga0081455_10014422 3300005937 Bacteria 7749
224 Ga0081539_10019600 3300005985 Bacteria 4620
225 Ga0075368_10000367 3300006042 Bacteria 13288
226 Ga0075432_10001680 3300006058 Bacteria 7288
227 Ga0075367_10001292 3300006178 Bacteria 10596
228 Ga0075369_10070024 3300006186 Bacteria 1543
229 Ga0075366_10000082 3300006195 Bacteria 37102
230 Ga0075366_10042459 3300006195 Bacteria 2692
231 Ga0075366_10147536 3300006195 Bacteria 1424
232 Ga0075366_10152320 3300006195 Bacteria 1400
233 Ga0097621_100003864 3300006237 Bacteria 10378
234 Ga0097621_100116871 3300006237 Bacteria 2259
235 Ga0075370_10007132 3300006353 Bacteria 5673
236 Ga0075370_10024315 3300006353 Bacteria 3346
237 Ga0068871_100016763 3300006358 Bacteria 5529
238 Ga0068871_100025482 3300006358 Bacteria 4602
239 Ga0075434_100092271 3300006871 Bacteria 3030
240 Ga0068865_100000012 3300006881 Bacteria 145314
241 Ga0068865_100114330 3300006881 Bacteria 1996
242 Ga0075436_100051150 3300006914 Bacteria 2851
243 Ga0097620_100019605 3300006931 Bacteria 6794
244 Ga0097620_100195213 3300006931 Bacteria 2108
245 Ga0097620_100271514 3300006931 Bacteria 1788
246 Ga0097620_100517802 3300006931 Bacteria 1288
247 Ga0079104_1010088 3300006946 Bacteria 3141
248 Ga0105251_10004488 3300009011 Bacteria 9471
249 Ga0105251_10091874 3300009011 Bacteria 1394
250 Ga0105250_10000014 3300009092 Bacteria 268458
251 Ga0105250_10008693 3300009092 Bacteria 4302
252 Ga0105250_10016341 3300009092 Bacteria 3026
253 Ga0105240_10016880 3300009093 Bacteria 9866
254 Ga0105240_10078124 3300009093 Bacteria 4076
255 Ga0105240_10325764 3300009093 Bacteria 1750
256 Ga0105245_10000097 3300009098 Bacteria 84528
257 Ga0105245_10000529 3300009098 Bacteria 35001
258 Ga0105245_10070673 3300009098 Bacteria 3168
259 Ga0105245_10584711 3300009098 Bacteria 1141
260 Ga0105247_10030374 3300009101 Bacteria 3275
261 Ga0105247_10081818 3300009101 Bacteria 2037
262 Ga0114129_10431909 3300009147 Bacteria 1730
263 Ga0105243_10000164 3300009148 Bacteria 75666
264 Ga0105243_10000297 3300009148 Bacteria 55019
265 Ga0105243_10087297 3300009148 Bacteria 2560
266 Ga0105241_10005018 3300009174 Bacteria 9772
267 Ga0105241_10025210 3300009174 Bacteria 4420
268 Ga0105242_10000645 3300009176 Bacteria 27285
269 Ga0105242_10248497 3300009176 Bacteria 1602
270 Ga0105248_10004976 3300009177 Bacteria 14689
271 Ga0105248_10021768 3300009177 Bacteria 7103
272 Ga0105248_10025690 3300009177 Bacteria 6550
273 Ga0105248_10091229 3300009177 Bacteria 3432
274 Ga0105248_10111946 3300009177 Bacteria 3079
275 Ga0105248_10283139 3300009177 Bacteria 1866
276 Ga0105248_10284510 3300009177 Bacteria 1861
277 Ga0105237_10075160 3300009545 Bacteria 3370
278 Ga0105237_10086697 3300009545 Bacteria 3121
279 Ga0105238_10017041 3300009551 Bacteria 7376
280 Ga0105238_10129713 3300009551 Bacteria 2499
281 Ga0105238_10394997 3300009551 Bacteria 1375
282 Ga0105249_10000079 3300009553 Bacteria 139904
283 Ga0105249_10000443 3300009553 Bacteria 38901
284 Ga0105249_10021563 3300009553 Bacteria 5768
285 Ga0105148_100197 3300009978 Bacteria 8818
286 Ga0105239_10063344 3300010375 Bacteria 4060
287 Ga0105239_10200749 3300010375 Bacteria 2234
288 Ga0105246_10006686 3300011119 Bacteria 7048
289 Ga0105246_10036288 3300011119 Bacteria 3301
290 Ga0157317_1000219 3300012475 Bacteria 2086
291 Ga0157326_1001312 3300012513 Bacteria 2752
292 Ga0157373_10014308 3300013100 Bacteria 5816
293 Ga0157373_10073403 3300013100 Bacteria 2414
294 Ga0157371_10000024 3300013102 Bacteria 281202
295 Ga0157371_10047887 3300013102 Bacteria 3039
296 Ga0157371_10302742 3300013102 Bacteria 1158
297 Ga0157370_10025702 3300013104 Bacteria 5826
298 Ga0157370_10036824 3300013104 Bacteria 4746
299 Ga0157369_10057118 3300013105 Bacteria 4211
300 Ga0157369_10096183 3300013105 Bacteria 3160
301 Ga0157374_10000936 3300013296 Bacteria 25437
302 Ga0157374_10010980 3300013296 Bacteria 7821
303 Ga0157378_10001079 3300013297 Bacteria 24942
304 Ga0157378_10091580 3300013297 Bacteria 2765
305 Ga0163162_10000458 3300013306 Bacteria 37802
306 Ga0163162_10007763 3300013306 Bacteria 10454
307 Ga0163162_10062932 3300013306 Bacteria 3751
308 Ga0163162_10166472 3300013306 Bacteria 2328
309 Ga0163162_10185255 3300013306 Bacteria 2209
310 Ga0163162_10442795 3300013306 Bacteria 1431
311 Ga0163162_10601930 3300013306 Bacteria 1225
312 Ga0163162_10914008 3300013306 Bacteria 990
313 Ga0157372_10059106 3300013307 Bacteria 4287
314 Ga0157372_10177386 3300013307 Bacteria 2466
315 Ga0157375_10000294 3300013308 Bacteria 45311
316 Ga0157375_10381607 3300013308 Bacteria 1576
317 Ga0163163_10123345 3300014325 Bacteria 2626
318 Ga0163163_10220316 3300014325 Bacteria 1946
319 Ga0163163_10486933 3300014325 Bacteria 1295
320 Ga0157380_10000788 3300014326 Bacteria 19907
321 Ga0157380_10003365 3300014326 Bacteria 10970
322 Ga0157380_10013680 3300014326 Bacteria 5924
323 Ga0157380_10017753 3300014326 Bacteria 5271
324 Ga0157380_10032883 3300014326 Bacteria 3991
325 Ga0157380_10058373 3300014326 Bacteria 3076
326 Ga0157379_10000278 3300014968 Bacteria 40420
327 Ga0157379_10010360 3300014968 Bacteria 8122
328 Ga0157379_10041193 3300014968 Bacteria 4123
329 Ga0157379_10113552 3300014968 Bacteria 2434
330 Ga0157376_10000251 3300014969 Bacteria 37177
331 Ga0163161_10000084 3300017792 Bacteria 93742
332 Ga0163161_10001082 3300017792 Bacteria 20625
333 Ga0163161_10140722 3300017792 Bacteria 1827
334 Ga0163161_10155666 3300017792 Bacteria 1740
335 Ga0213876_10006914 3300021384 Bacteria 6182
336 Ga0207672_1000210 3300025223 Bacteria 8234
337 Ga0209674_106031 3300025226 Bacteria 1702
338 Ga0209147_100302 3300025229 Bacteria 40451
339 Ga0209147_100780 3300025229 Bacteria 15503
340 Ga0209437_102017 3300025233 Bacteria 4155
341 Ga0207425_1004019 3300025245 Bacteria 4520
342 Ga0209677_106712 3300025253 Bacteria 2646
343 Ga0209233_1000065 3300025261 Bacteria 387195
344 Ga0209565_1000008 3300025263 Bacteria 774179
345 Ga0209455_1014561 3300025272 Bacteria 1773
346 Ga0209673_1001306 3300025273 Bacteria 25290
347 Ga0209675_1000248 3300025291 Bacteria 53556
348 Ga0209675_1036876 3300025291 Bacteria 1103
349 Ga0209564_1000069 3300025295 Bacteria 303332
350 Ga0209758_1000001 3300025297 Bacteria 1981790
351 Ga0209758_1008432 3300025297 Bacteria 6677
352 Ga0209050_1000299 3300025298 Bacteria 104017
353 Ga0209050_1006717 3300025298 Bacteria 6723
354 Ga0209256_1000009 3300025299 Bacteria 922071
355 Ga0209256_1000010 3300025299 Bacteria 912110
356 Ga0209257_1000524 3300025304 Bacteria 66567
357 Ga0207697_10007182 3300025315 Bacteria 4978
358 Ga0207697_10073900 3300025315 Bacteria 1431
359 Ga0207656_10046123 3300025321 Bacteria 1868
360 Ga0207696_1000087 3300025711 Bacteria 194367
361 Ga0207696_1006001 3300025711 Bacteria 4959
362 Ga0207713_1002844 3300025735 Bacteria 12178
363 Ga0207710_10017082 3300025900 Bacteria 3075
364 Ga0207688_10040012 3300025901 Bacteria 2604
365 Ga0207680_10000009 3300025903 Bacteria 464571
366 Ga0207680_10015096 3300025903 Bacteria 4021
367 Ga0207680_10241635 3300025903 Bacteria 1244
368 Ga0207647_10000997 3300025904 Bacteria 21946
369 Ga0207647_10004006 3300025904 Bacteria 10988
370 Ga0207647_10012963 3300025904 Bacteria 5792
371 Ga0207647_10018514 3300025904 Bacteria 4707
372 Ga0207647_10027052 3300025904 Bacteria 3743
373 Ga0207647_10114361 3300025904 Bacteria 1594
374 Ga0207645_10001889 3300025907 Bacteria 16906
375 Ga0207645_10113318 3300025907 Bacteria 1757
376 Ga0207645_10214863 3300025907 Bacteria 1267
377 Ga0207645_10222713 3300025907 Bacteria 1244
378 Ga0207645_10318266 3300025907 Bacteria 1037
379 Ga0207705_10000004 3300025909 Bacteria 705756
380 Ga0207705_10000018 3300025909 Bacteria 319792
381 Ga0207705_10000366 3300025909 Bacteria 41006
382 Ga0207705_10000816 3300025909 Bacteria 25494
383 Ga0207705_10042421 3300025909 Bacteria 3266
384 Ga0207705_10106866 3300025909 Bacteria 2064
385 Ga0207705_10149239 3300025909 Bacteria 1751
386 Ga0207705_10223750 3300025909 Bacteria 1430
387 Ga0207684_10201298 3300025910 Bacteria 1718
388 Ga0207654_10000319 3300025911 Bacteria 28813
389 Ga0207654_10001192 3300025911 Bacteria 13947
390 Ga0207654_10028014 3300025911 Bacteria 3068
391 Ga0207695_10004104 3300025913 Bacteria 20021
392 Ga0207695_10008455 3300025913 Bacteria 12888
393 Ga0207695_10010364 3300025913 Bacteria 11407
394 Ga0207695_10016957 3300025913 Bacteria 8499
395 Ga0207695_10231605 3300025913 Bacteria 1751
396 Ga0207671_10000800 3300025914 Bacteria 39901
397 Ga0207671_10011333 3300025914 Bacteria 7262
398 Ga0207671_10070919 3300025914 Bacteria 2598
399 Ga0207657_10000606 3300025919 Bacteria 38130
400 Ga0207657_10002728 3300025919 Bacteria 19014
401 Ga0207657_10003773 3300025919 Bacteria 16105
402 Ga0207657_10013446 3300025919 Bacteria 8029
403 Ga0207657_10014710 3300025919 Bacteria 7620
404 Ga0207649_10055431 3300025920 Bacteria 2471
405 Ga0207652_10417777 3300025921 Bacteria 1210
406 Ga0207681_10000086 3300025923 Bacteria 81919
407 Ga0207681_10000512 3300025923 Bacteria 26921
408 Ga0207681_10000789 3300025923 Bacteria 20864
409 Ga0207681_10001567 3300025923 Bacteria 14708
410 Ga0207681_10002247 3300025923 Bacteria 12274
411 Ga0207681_10034479 3300025923 Bacteria 3328
412 Ga0207694_10006783 3300025924 Bacteria 8694
413 Ga0207694_10011155 3300025924 Bacteria 6785
414 Ga0207694_10044196 3300025924 Bacteria 3440
415 Ga0207694_10135189 3300025924 Bacteria 1979
416 Ga0207694_10156565 3300025924 Bacteria 1838
417 Ga0207694_10157367 3300025924 Bacteria 1834
418 Ga0207694_10220676 3300025924 Bacteria 1546
419 Ga0207650_10000008 3300025925 Bacteria 498534
420 Ga0207650_10093885 3300025925 Bacteria 2297
421 Ga0207650_10285822 3300025925 Bacteria 1344
422 Ga0207659_10027564 3300025926 Bacteria 3849
423 Ga0207659_10180091 3300025926 Bacteria 1674
424 Ga0207687_10000580 3300025927 Bacteria 24742
425 Ga0207687_10002448 3300025927 Bacteria 12604
426 Ga0207700_10196489 3300025928 Bacteria 1698
427 Ga0207644_10000122 3300025931 Bacteria 57193
428 Ga0207644_10000409 3300025931 Bacteria 28023
429 Ga0207644_10002084 3300025931 Bacteria 12946
430 Ga0207644_10020510 3300025931 Bacteria 4494
431 Ga0207644_10216448 3300025931 Bacteria 1516
432 Ga0207690_10000213 3300025932 Bacteria 44040
433 Ga0207690_10005085 3300025932 Bacteria 7768
434 Ga0207690_10085971 3300025932 Bacteria 2209
435 Ga0207706_10006648 3300025933 Bacteria 10692
436 Ga0207706_10047748 3300025933 Bacteria 3787
437 Ga0207706_10140539 3300025933 Bacteria 2124
438 Ga0207706_10147934 3300025933 Bacteria 2066
439 Ga0207686_10097603 3300025934 Bacteria 1955
440 Ga0207686_10365410 3300025934 Bacteria 1090
441 Ga0207709_10000123 3300025935 Bacteria 115697
442 Ga0207709_10000299 3300025935 Bacteria 54506
443 Ga0207709_10300296 3300025935 Bacteria 1194
444 Ga0207709_10428996 3300025935 Bacteria 1017
445 Ga0207670_10001908 3300025936 Bacteria 10896
446 Ga0207669_10000230 3300025937 Bacteria 25566
447 Ga0207669_10368727 3300025937 Bacteria 1115
448 Ga0207704_10000021 3300025938 Bacteria 148508
449 Ga0207711_10005756 3300025941 Bacteria 10464
450 Ga0207711_10008787 3300025941 Bacteria 8448
451 Ga0207711_10008938 3300025941 Bacteria 8373
452 Ga0207711_10014519 3300025941 Bacteria 6547
453 Ga0207711_10026559 3300025941 Bacteria 4858
454 Ga0207711_10135230 3300025941 Bacteria 2214
455 Ga0207711_10411374 3300025941 Bacteria 1257
456 Ga0207689_10000132 3300025942 Bacteria 63321
457 Ga0207661_10511129 3300025944 Bacteria 1098
458 Ga0207679_10523028 3300025945 Bacteria 1061
459 Ga0207667_10000010 3300025949 Bacteria 477432
460 Ga0207667_10000029 3300025949 Bacteria 329192
461 Ga0207667_10004694 3300025949 Bacteria 16723
462 Ga0207667_10122183 3300025949 Bacteria 2683
463 Ga0207667_10149916 3300025949 Bacteria 2401
464 Ga0207667_10503941 3300025949 Bacteria 1228
465 Ga0207651_10000012 3300025960 Bacteria 189928
466 Ga0207651_10200065 3300025960 Bacteria 1600
467 Ga0207712_10000030 3300025961 Bacteria 216514
468 Ga0207712_10000046 3300025961 Bacteria 162468
469 Ga0207712_10059600 3300025961 Bacteria 2702
470 Ga0207668_10015096 3300025972 Bacteria 4794
471 Ga0207668_10017042 3300025972 Bacteria 4546
472 Ga0207668_10017068 3300025972 Bacteria 4541
473 Ga0207668_10123084 3300025972 Bacteria 1967
474 Ga0207668_10183025 3300025972 Bacteria 1654
475 Ga0207668_10398703 3300025972 Bacteria 1163
476 Ga0207640_10000021 3300025981 Bacteria 168138
477 Ga0207640_10001341 3300025981 Bacteria 13336
478 Ga0207640_10007006 3300025981 Bacteria 6204
479 Ga0207640_10103477 3300025981 Bacteria 2002
480 Ga0207640_10281135 3300025981 Bacteria 1307
481 Ga0207640_10551790 3300025981 Bacteria 968
482 Ga0207658_10000333 3300025986 Bacteria 47363
483 Ga0207658_10001804 3300025986 Bacteria 16035
484 Ga0207658_10005994 3300025986 Bacteria 8308
485 Ga0207658_10007736 3300025986 Bacteria 7323
486 Ga0207658_10012892 3300025986 Bacteria 5708
487 Ga0207677_10000170 3300026023 Bacteria 51603
488 Ga0207677_10282750 3300026023 Bacteria 1363
489 Ga0207703_10000050 3300026035 Bacteria 145849
490 Ga0207703_10000665 3300026035 Bacteria 34309
491 Ga0207703_10000948 3300026035 Bacteria 28101
492 Ga0207703_10001637 3300026035 Bacteria 20186
493 Ga0207703_10089780 3300026035 Bacteria 2581
494 Ga0207703_10179687 3300026035 Bacteria 1867
495 Ga0207703_10214866 3300026035 Bacteria 1716
496 Ga0207639_10011454 3300026041 Bacteria 6161
497 Ga0207639_10014903 3300026041 Bacteria 5476
498 Ga0207639_10034145 3300026041 Bacteria 3757
499 Ga0207639_10052337 3300026041 Bacteria 3111
500 Ga0207639_10240416 3300026041 Bacteria 1574
501 Ga0207639_10275067 3300026041 Bacteria 1479
502 Ga0207678_10000400 3300026067 Bacteria 39732
503 Ga0207678_10002548 3300026067 Bacteria 16597
504 Ga0207678_10003044 3300026067 Bacteria 15167
505 Ga0207678_10003534 3300026067 Bacteria 14062
506 Ga0207678_10064027 3300026067 Bacteria 3159
507 Ga0207702_10001123 3300026078 Bacteria 27335
508 Ga0207702_10001257 3300026078 Bacteria 25552
509 Ga0207702_10004107 3300026078 Bacteria 13062
510 Ga0207702_10004976 3300026078 Bacteria 11672
511 Ga0207702_10067961 3300026078 Bacteria 3060
512 Ga0207702_10271500 3300026078 Bacteria 1600
513 Ga0207641_10000063 3300026088 Bacteria 159283
514 Ga0207641_10000118 3300026088 Bacteria 117721
515 Ga0207641_10000632 3300026088 Bacteria 38419
516 Ga0207641_10068073 3300026088 Bacteria 3051
517 Ga0207648_10000051 3300026089 Bacteria 108363
518 Ga0207676_10000264 3300026095 Bacteria 45636
519 Ga0207676_10000312 3300026095 Bacteria 41651
520 Ga0207676_10000362 3300026095 Bacteria 38788
521 Ga0207676_10001060 3300026095 Bacteria 20944
522 Ga0207676_10001111 3300026095 Bacteria 20352
523 Ga0207674_10008204 3300026116 Bacteria 12102
524 Ga0207674_10022081 3300026116 Bacteria 6841
525 Ga0207674_10038184 3300026116 Bacteria 4989
526 Ga0207674_10094103 3300026116 Bacteria 2983
527 Ga0207674_10123014 3300026116 Bacteria 2560
528 Ga0207675_100005849 3300026118 Bacteria 11749
529 Ga0207675_100006391 3300026118 Bacteria 11164
530 Ga0207683_10000449 3300026121 Bacteria 38134
531 Ga0207698_10000019 3300026142 Bacteria 145910
532 Ga0207698_10000595 3300026142 Bacteria 21136
533 Ga0207698_10004840 3300026142 Bacteria 8246
534 Ga0207698_10032269 3300026142 Bacteria 3792
535 Ga0207698_10194280 3300026142 Bacteria 1811
536 Ga0207698_10358874 3300026142 Bacteria 1379
537 Ga0209813_10000040 3300027866 Bacteria 53861
538 Ga0209974_10065527 3300027876 Bacteria 1233
539 Ga0207428_10010319 3300027907 Bacteria 8349
540 Ga0268266_10000002 3300028379 Bacteria 3059047
541 Ga0268266_10000063 3300028379 Bacteria 253339
542 Ga0268266_10000066 3300028379 Bacteria 242637
543 Ga0268266_10000641 3300028379 Bacteria 47529
544 Ga0268266_10001173 3300028379 Bacteria 32393
545 Ga0268266_10070145 3300028379 Bacteria 3037
546 Ga0268266_10101557 3300028379 Bacteria 2536
547 Ga0268266_10168697 3300028379 Bacteria 1985
548 Ga0268265_10001076 3300028380 Bacteria 24356
549 Ga0268265_10001366 3300028380 Bacteria 20776
550 Ga0268265_10001713 3300028380 Bacteria 17784
551 Ga0268265_10003845 3300028380 Bacteria 10623
552 Ga0268265_10063532 3300028380 Bacteria 2840
553 Ga0268264_10000130 3300028381 Bacteria 181732
554 Ga0268264_10001891 3300028381 Bacteria 19009
555 Ga0268264_10003658 3300028381 Bacteria 13220
556 Ga0268264_10015461 3300028381 Bacteria 6257
557 Ga0268264_10063589 3300028381 Bacteria 3102
558 Ga0307517_10028837 3300028786 Bacteria 6590
559 Ga0307517_10033389 3300028786 Bacteria 5912
560 Ga0307517_10129486 3300028786 Bacteria 1824
561 Ga0265338_10010111 3300028800 Bacteria 11142
562 Ga0265327_10001037 3300031251 Bacteria 39182
563 Ga0265327_10052803 3300031251 Bacteria 2114
564 Ga0307513_10030702 3300031456 Bacteria 6100
565 Ga0307408_100430033 3300031548 Bacteria 1140
566 Ga0307508_10002212 3300031616 Bacteria 20747
567 Ga0265314_10000565 3300031711 Bacteria 47145
568 Ga0265342_10001962 3300031712 Bacteria 18392
569 Ga0307516_10000427 3300031730 Bacteria 55250
570 Ga0307405_10003283 3300031731 Bacteria 7393
571 Ga0307405_10010561 3300031731 Bacteria 4795
572 Ga0307413_10147452 3300031824 Bacteria 1635
573 Ga0307413_10171546 3300031824 Bacteria 1536
574 Ga0307406_10024351 3300031901 Bacteria 3615
575 Ga0307412_10000470 3300031911 Bacteria 24167
576 Ga0307412_10009099 3300031911 Bacteria 5692
577 Ga0307412_10014154 3300031911 Bacteria 4697
578 Ga0307412_10016021 3300031911 Bacteria 4454
579 Ga0307412_10205603 3300031911 Bacteria 1498
580 Ga0307414_10000390 3300032004 Bacteria 23921
581 Ga0307414_10000984 3300032004 Bacteria 14530
582 Ga0307414_10024875 3300032004 Bacteria 3825
583 Ga0307414_10481750 3300032004 Bacteria 1094
584 Ga0307510_10101383 3300033180 Bacteria 2667
585 Ga0316574_0082162 3300035398 Bacteria 2047
586 Ga0373931_0055613 3300035691 Bacteria 2118
587 Ga0373933_0190270 3300035724 Bacteria 1311
588 Ga0373933_0231521 3300035724 Bacteria 1187
589 Ga0373947_0224754 3300035725 Bacteria 1235
590 Ga0373937_0285570 3300036401 Bacteria 1559
591 Ga0373925_0000010 3300037068 Bacteria 229059
592 Ga0373925_0017278 3300037068 Bacteria 5226
593 Ga0395899_0100903 3300037312 Bacteria 2083
594 Ga0395899_0105521 3300037312 Bacteria 2029
595 Ga0395899_0120549 3300037312 Bacteria 1879
596 Ga0395899_0146250 3300037312 Bacteria 1678
597 Ga0395900_0001466 3300037418 Bacteria 28150
598 Ga0395900_0017250 3300037418 Bacteria 7369
599 Ga0395900_0323100 3300037418 Bacteria 1523
600 Ga0395900_0386517 3300037418 Bacteria 1366
601 Ga0395898_0010266 3300037466 Bacteria 9801
602 Ga0395898_0055931 3300037466 Bacteria 3848
603 Ga0395898_0069062 3300037466 Bacteria 3419
604 Ga0395898_0072742 3300037466 Bacteria 3321
605 Ga0395898_0322527 3300037466 Bacteria 1473
606 Ga0395905_0000335 3300037471 Bacteria 67466
607 Ga0395905_0003607 3300037471 Bacteria 16456
608 Ga0395905_0035512 3300037471 Bacteria 4681
609 Ga0395905_0073570 3300037471 Bacteria 3203
610 Ga0395905_0102393 3300037471 Bacteria 2688
611 Ga0395905_0455196 3300037471 Bacteria 1178
612 Ga0395901_0031477 3300038443 Bacteria 5471
613 Ga0395901_0052148 3300038443 Bacteria 4252
614 Ga0395901_0161719 3300038443 Bacteria 2351
615 Ga0395901_0308758 3300038443 Bacteria 1639
616 Ga0436365_0712898 3300039437 Bacteria 6216
617 Ga0436362_0783629 3300039453 Bacteria 1236
618 Ga0451806_192368 3300041462 Bacteria 2312
619 Ga0451841_0006845 3300041498 Bacteria 1876
620 Ga0439448_0017020 3300042005 Bacteria 2217
621 Ga0439448_0020590 3300042005 Bacteria 2042
622 Ga0439449_0005387 3300042007 Bacteria 4903
623 Ga0439455_0034219 3300042012 Bacteria 1277
624 Ga0439458_0000017 3300042157 Bacteria 26142
625 Ga0439458_0001648 3300042157 Bacteria 5579
626 Ga0439458_0003585 3300042157 Bacteria 3617
627 Ga0466972_0002717 3300044658 Bacteria 8753
628 Ga0466966_0125352 3300044684 Bacteria 1575
629 Ga0466961_0042863 3300044693 Bacteria 2900
630 Ga0466961_0207696 3300044693 Bacteria 1209
631 Ga0466963_0017972 3300044694 Bacteria 4412
632 Ga0466964_0007648 3300044706 Bacteria 4044
633 Ga0466971_0000962 3300044719 Bacteria 11823
634 Ga0466957_0103183 3300044842 Bacteria 1800
635 Ga0466958_0069852 3300045836 Bacteria 2148
636 Ga0495617_004384 3300046452 Bacteria 5143
637 Ga0495627_000127 3300046453 Bacteria 92757
638 Ga0495627_000162 3300046453 Bacteria 76049
639 Ga0495627_002778 3300046453 Bacteria 8130
640 Ga0495638_0000021 3300046460 Bacteria 365602
641 Ga0495638_0000209 3300046460 Bacteria 82799
642 Ga0495638_0000893 3300046460 Bacteria 30574
643 Ga0495641_0026727 3300046461 Bacteria 2814
644 Ga0495650_0000116 3300046471 Bacteria 189814
645 Ga0495650_0001253 3300046471 Bacteria 26207
646 Ga0495584_0025735 3300046491 Bacteria 2983
647 Ga0495585_0001465 3300046492 Bacteria 18468
648 Ga0495596_0000042 3300046500 Bacteria 90746
649 Ga0495596_0001157 3300046500 Bacteria 15510
650 Ga0495607_0010179 3300046501 Bacteria 6327
651 Ga0495583_0000184 3300046506 Bacteria 105978
652 Ga0495583_0000657 3300046506 Bacteria 45442
653 Ga0495583_0000840 3300046506 Bacteria 37393
654 Ga0495583_0011117 3300046506 Bacteria 5187
655 Ga0495583_0023034 3300046506 Bacteria 3160
656 Ga0495583_0024408 3300046506 Bacteria 3038
657 Ga0495583_0130475 3300046506 Bacteria 1052
658 Ga0495606_0000977 3300046507 Bacteria 41762
659 Ga0495606_0003584 3300046507 Bacteria 16361
660 Ga0495606_0088792 3300046507 Bacteria 1905
661 Ga0495610_0000041 3300046512 Bacteria 160898
662 Ga0495610_0000059 3300046512 Bacteria 134692
663 Ga0495610_0002305 3300046512 Bacteria 16131
664 Ga0495610_0164618 3300046512 Bacteria 935
665 Ga0495616_0087226 3300046513 Bacteria 1483
666 Ga0495631_0089509 3300046518 Bacteria 1325
667 Ga0495632_0000038 3300046519 Bacteria 155743
668 Ga0495632_0000410 3300046519 Bacteria 40576
669 Ga0495632_0001694 3300046519 Bacteria 18032
670 Ga0495637_0003726 3300046520 Bacteria 8048
671 Ga0495637_0011549 3300046520 Bacteria 4242
672 Ga0495637_0016583 3300046520 Bacteria 3442
673 Ga0495643_0000004 3300046522 Bacteria 519944
674 Ga0495643_0000088 3300046522 Bacteria 155458
675 Ga0495643_0003968 3300046522 Bacteria 10578
676 Ga0495643_0014694 3300046522 Bacteria 4651
677 Ga0495643_0152261 3300046522 Bacteria 1144
678 Ga0495643_0152295 3300046522 Bacteria 1144
679 Ga0495648_0000026 3300046524 Bacteria 232162
680 Ga0495648_0000108 3300046524 Bacteria 102335
681 Ga0495648_0007834 3300046524 Bacteria 8498
682 Ga0495648_0032071 3300046524 Bacteria 3453
683 Ga0495648_0224910 3300046524 Bacteria 923
684 Ga0495663_0000013 3300046525 Bacteria 155493
685 Ga0495663_0005255 3300046525 Bacteria 3603
686 Ga0495642_0086585 3300046528 Bacteria 1323
687 Ga0495654_0044744 3300046530 Bacteria 2188
688 Ga0495609_0005517 3300046538 Bacteria 6616
689 Ga0495597_0033805 3300046542 Bacteria 2312
690 Ga0495633_0000212 3300046558 Bacteria 73041
691 Ga0495633_0000670 3300046558 Bacteria 31596
692 Ga0495633_0013362 3300046558 Bacteria 4330
693 Ga0495633_0014845 3300046558 Bacteria 4055
694 Ga0495668_0000085 3300046616 Bacteria 153045
695 Ga0495668_0067012 3300046616 Bacteria 1975
696 Ga0495625_0000014 3300046660 Bacteria 323486
697 Ga0495625_0000072 3300046660 Bacteria 166439
698 Ga0495625_0005016 3300046660 Bacteria 12280
699 Ga0495625_0013733 3300046660 Bacteria 6493
700 Ga0495625_0014355 3300046660 Bacteria 6328
701 Ga0495625_0027330 3300046660 Bacteria 4298
702 Ga0495625_0063251 3300046660 Bacteria 2613
703 Ga0495669_0000192 3300046684 Bacteria 37810
704 Ga0495669_0022153 3300046684 Bacteria 2760
705 Ga0495613_0000380 3300046689 Bacteria 38251
706 Ga0495670_0022796 3300046691 Bacteria 3092
707 Ga0495670_0037214 3300046691 Bacteria 2426
708 Ga0495670_0269424 3300046691 Bacteria 910
709 Ga0495671_0000048 3300046692 Bacteria 155712
710 Ga0495671_0000050 3300046692 Bacteria 141936
711 Ga0495671_0009905 3300046692 Bacteria 5304
712 Ga0495683_0001323 3300047323 Bacteria 16619
713 Ga0495687_000217 3300047443 Bacteria 81602
714 Ga0495687_000270 3300047443 Bacteria 69481
715 Ga0495677_0003186 3300047445 Bacteria 6398
716 Ga0495677_0003823 3300047445 Bacteria 5824
717 Ga0495673_0000125 3300047469 Bacteria 141937
718 Ga0495681_0000022 3300047470 Bacteria 165281
719 Ga0495681_0000045 3300047470 Bacteria 111769
720 Ga0495686_0000606 3300047472 Bacteria 49623
721 Ga0495686_0000736 3300047472 Bacteria 43676
722 Ga0495686_0006128 3300047472 Bacteria 9310
723 Ga0495686_0015268 3300047472 Bacteria 5252
724 Ga0495686_0019225 3300047472 Bacteria 4568
725 Ga0495686_0039861 3300047472 Bacteria 2998
726 Ga0495686_0050645 3300047472 Bacteria 2609
727 Ga0495686_0070463 3300047472 Bacteria 2154
728 Ga0495615_0000018 3300048090 Bacteria 54585
729 Ga0495626_0003066 3300048091 Bacteria 10963
730 Ga0496100_0007205 3300048903 Bacteria 6116
731 Ga0496101_0027708 3300048904 Bacteria 3949
732 Ga0496101_0227536 3300048904 Bacteria 1449
733 Ga0496102_0000230 3300048905 Bacteria 73225
734 Ga0496102_0000648 3300048905 Bacteria 35117
735 Ga0496102_0004071 3300048905 Bacteria 12398
736 Ga0496102_0023975 3300048905 Bacteria 5423
737 Ga0496102_0099079 3300048905 Bacteria 2705
738 Ga0496102_0289784 3300048905 Bacteria 1543
739 Ga0496103_0000110 3300048906 Bacteria 90202
740 Ga0496103_0000200 3300048906 Bacteria 59876
741 Ga0496103_0000590 3300048906 Bacteria 28622
742 Ga0496103_0002993 3300048906 Bacteria 10446
743 Ga0496103_0012080 3300048906 Bacteria 5130
744 Ga0496103_0051853 3300048906 Bacteria 2540
745 Ga0496103_0117595 3300048906 Bacteria 1692
746 Ga0496104_0000047 3300048907 Bacteria 148896
747 Ga0496104_0023430 3300048907 Bacteria 5675
748 Ga0496104_0078556 3300048907 Bacteria 3145
749 Ga0496104_0093584 3300048907 Bacteria 2875
750 Ga0496105_0000081 3300048908 Bacteria 70237
751 Ga0496105_0008602 3300048908 Bacteria 7933
752 Ga0496106_0382945 3300048909 Bacteria 1130
753 Ga0496107_0025653 3300048910 Bacteria 4174
754 Ga0496107_0198261 3300048910 Bacteria 1492
755 Ga0496108_0003387 3300048911 Bacteria 12801
756 Ga0496110_0213150 3300048913 Bacteria 1756
757 Ga0496110_0267995 3300048913 Bacteria 1555
758 Ga0496110_0308948 3300048913 Bacteria 1440
759 Ga0496112_0073551 3300048915 Bacteria 3379
760 Ga0496112_0524528 3300048915 Bacteria 1119
761 Ga0496113_0000020 3300048916 Bacteria 70677
762 Ga0496113_0320951 3300048916 Bacteria 1241
763 Ga0496115_0000173 3300048918 Bacteria 59935
764 Ga0496115_0097188 3300048918 Bacteria 2412
765 Ga0496116_0000060 3300048919 Bacteria 272219
766 Ga0496116_0035405 3300048919 Bacteria 3507
767 Ga0496116_0047529 3300048919 Bacteria 2888
768 Ga0496116_0100041 3300048919 Bacteria 1735
769 Ga0496117_0000670 3300048920 Bacteria 54795
770 Ga0496117_0006958 3300048920 Bacteria 11215
771 Ga0496117_0007224 3300048920 Bacteria 10935
772 Ga0496117_0010423 3300048920 Bacteria 8477
773 Ga0496117_0014334 3300048920 Bacteria 6837
774 Ga0496117_0022967 3300048920 Bacteria 4989
775 Ga0496117_0052366 3300048920 Bacteria 2875
776 Ga0496117_0079561 3300048920 Bacteria 2159
777 Ga0496117_0087606 3300048920 Bacteria 2017
778 Ga0496118_0000592 3300048921 Bacteria 59967
779 Ga0496118_0003977 3300048921 Bacteria 18028
780 Ga0496118_0006353 3300048921 Bacteria 13036
781 Ga0496118_0027984 3300048921 Bacteria 4759
782 Ga0496118_0082566 3300048921 Bacteria 2251
783 Ga0496118_0084510 3300048921 Bacteria 2214
784 Ga0496119_0000699 3300048922 Bacteria 44963
785 Ga0496119_0008055 3300048922 Bacteria 9357
786 Ga0496119_0016331 3300048922 Bacteria 5655
787 Ga0496119_0124694 3300048922 Bacteria 1411
788 Ga0496120_0001199 3300048923 Bacteria 32884
789 Ga0496120_0005962 3300048923 Bacteria 9494
790 Ga0496120_0008143 3300048923 Bacteria 7687
791 Ga0496121_0000009 3300048924 Bacteria 836971
792 Ga0496121_0000176 3300048924 Bacteria 142585
793 Ga0496121_0000295 3300048924 Bacteria 103239
794 Ga0496121_0000670 3300048924 Bacteria 63957
795 Ga0496121_0001672 3300048924 Bacteria 36560
796 Ga0496121_0005579 3300048924 Bacteria 16069
797 Ga0496121_0009918 3300048924 Bacteria 10841
798 Ga0496121_0042811 3300048924 Bacteria 3932
799 Ga0496121_0081751 3300048924 Bacteria 2556
800 Ga0496122_0000735 3300048925 Bacteria 64114
801 Ga0496122_0003067 3300048925 Bacteria 22531
802 Ga0496122_0003693 3300048925 Bacteria 19828
803 Ga0496122_0006224 3300048925 Bacteria 13821
804 Ga0496122_0012217 3300048925 Bacteria 8586
805 Ga0496122_0194130 3300048925 Bacteria 1195
806 Ga0496123_0000362 3300048926 Bacteria 85587
807 Ga0496123_0000457 3300048926 Bacteria 71921
808 Ga0496123_0000503 3300048926 Bacteria 67921
809 Ga0496123_0007175 3300048926 Bacteria 10573
810 Ga0496123_0008453 3300048926 Bacteria 9451
811 Ga0496123_0021763 3300048926 Bacteria 4971
812 Ga0496123_0121090 3300048926 Bacteria 1472
813 Ga0496123_0178549 3300048926 Bacteria 1112
814 Ga0496124_0000116 3300048927 Bacteria 164788
815 Ga0496124_0000177 3300048927 Bacteria 128355
816 Ga0496124_0001084 3300048927 Bacteria 42949
817 Ga0496124_0002381 3300048927 Bacteria 24765
818 Ga0496124_0003896 3300048927 Bacteria 17845
819 Ga0496124_0006822 3300048927 Bacteria 12323
820 Ga0496124_0006882 3300048927 Bacteria 12224
821 Ga0496124_0008630 3300048927 Bacteria 10620
822 Ga0496124_0171459 3300048927 Bacteria 1680
823 Ga0496124_0293529 3300048927 Bacteria 1178
824 Ga0496125_0000336 3300048928 Bacteria 89942
825 Ga0496125_0000555 3300048928 Bacteria 64263
826 Ga0496125_0002945 3300048928 Bacteria 21421
827 Ga0496125_0004371 3300048928 Bacteria 16366
828 Ga0496125_0013788 3300048928 Bacteria 7919
829 Ga0496125_0018419 3300048928 Bacteria 6631
830 Ga0496125_0032022 3300048928 Bacteria 4677
831 Ga0496125_0060032 3300048928 Bacteria 3060
832 Ga0496125_0092833 3300048928 Bacteria 2255
833 Ga0496125_0173880 3300048928 Bacteria 1444
834 Ga0496125_0213285 3300048928 Bacteria 1252
835 Ga0496125_0318063 3300048928 Bacteria 945
836 Ga0496126_0000028 3300048929 Bacteria 394082
837 Ga0496126_0000725 3300048929 Bacteria 59835
838 Ga0496126_0002255 3300048929 Bacteria 26590
839 Ga0496126_0083927 3300048929 Bacteria 2811
840 Ga0496126_0177984 3300048929 Bacteria 1808
841 Ga0495682_0021473 3300049460 Bacteria 2419
842 Ga0501290_000118 3300049513 Bacteria 11992
843 Ga0501290_001907 3300049513 Bacteria 2754
844 Ga0501292_000010 3300049515 Bacteria 72340
845 Ga0501293_000480 3300049516 Bacteria 3016
846 Ga0501298_001906 3300049521 Bacteria 3106
847 Ga0501299_014103 3300049522 Bacteria 1386
848 Ga0501300_000865 3300049523 Bacteria 4630
849 Ga0501300_000897 3300049523 Bacteria 4545
850 Ga0501033_0236429 3300049570 Bacteria 1297
851 Ga0501034_0006776 3300049571 Bacteria 12251
852 Ga0501038_0058246 3300049574 Bacteria 3313
853 Ga0501039_0242575 3300049575 Bacteria 1417
854 Ga0501042_0143009 3300049578 Bacteria 1725
855 Ga0501047_0002891 3300049581 Bacteria 16289
856 Ga0501047_0318416 3300049581 Bacteria 1396
857 Ga0501048_0222911 3300049582 Bacteria 1338
858 Ga0501071_0044196 3300049587 Bacteria 3195
859 Ga0501071_0323612 3300049587 Bacteria 1171
860 Ga0501071_0505370 3300049587 Bacteria 927
861 Ga0501076_0153344 3300049592 Bacteria 1875
862 Ga0501206_000946 3300049653 Bacteria 3591
863 Ga0501211_001628 3300049658 Bacteria 2405
864 Ga0501222_000177 3300049662 Bacteria 11651
865 Ga0501223_000017 3300049663 Bacteria 68157
866 Ga0501223_000107 3300049663 Bacteria 23945
867 Ga0501223_001340 3300049663 Bacteria 5699
868 Ga0501224_000031 3300049664 Bacteria 43294
869 Ga0501224_001407 3300049664 Bacteria 3187
870 Ga0501233_000040 3300049668 Bacteria 17026
871 Ga0501233_001211 3300049668 Bacteria 4395
872 Ga0501233_036130 3300049668 Bacteria 1141
873 Ga0501235_005127 3300049669 Bacteria 2847
874 Ga0501235_022608 3300049669 Bacteria 1398
875 Ga0501246_001831 3300049676 Bacteria 1651
876 Ga0501257_000001 3300049686 Bacteria 74809
877 Ga0501259_000145 3300049688 Bacteria 10613
878 Ga0501261_000003 3300049690 Bacteria 106942
879 Ga0501225_0000004 3300049705 Bacteria 140738
880 Ga0501225_0000070 3300049705 Bacteria 33694
881 Ga0501234_000164 3300049707 Bacteria 9016
882 Ga0501081_0318302 3300049743 Bacteria 1143
883 Ga0501241_002348 3300049758 Bacteria 3662
884 Ga0501241_023346 3300049758 Bacteria 1145
885 Ga0501279_000007 3300049775 Bacteria 141756
886 Ga0501280_000007 3300049776 Bacteria 75585
887 Ga0501280_000464 3300049776 Bacteria 9665
888 Ga0501281_00034 3300049777 Bacteria 15559
889 Ga0501282_000352 3300049778 Bacteria 5517
890 Ga0501282_001648 3300049778 Bacteria 2459
891 Ga0501044_0148718 3300049823 Bacteria 2326
892 Ga0501226_000051 3300049853 Bacteria 49149
893 nmdc:mga03683_25400_c1 3300050489 Bacteria 2327
894 nmdc:mga03n38_1084_c1 3300050490 Bacteria 7508
895 nmdc:mga0k408_5_c1 3300050493 Bacteria 73264
896 nmdc:mga0k408_63905_c1 3300050493 Bacteria 2141
897 nmdc:mga06z11_132_c1 3300050494 Bacteria 29648
898 nmdc:mga04h51_262_c1 3300050495 Bacteria 13675
899 nmdc:mga07m45_18825_c1 3300050496 Bacteria 3734
900 nmdc:mga0n895_40845_c1 3300050512 Bacteria 4507
901 nmdc:mga0sz30_12658_c1 3300050516 Bacteria 3285
902 Ga0500610_0000057 3300053079 Bacteria 34550
903 Ga0500643_000199 3300053087 Bacteria 57141
904 Ga0500643_000221 3300053087 Bacteria 53085
905 Ga0500643_000295 3300053087 Bacteria 42617
906 Ga0500646_0034180 3300053090 Bacteria 1409
907 Ga0500646_0056539 3300053090 Bacteria 1144
908 Ga0500647_0018734 3300053091 Bacteria 3209
909 Ga0500583_0078196 3300053092 Bacteria 1594
910 Ga0500651_0000843 3300053093 Bacteria 15035
911 Ga0500641_0003958 3300053096 Bacteria 5236
912 Ga0500641_0009125 3300053096 Bacteria 3557
913 Ga0500641_0013275 3300053096 Bacteria 3024
914 Ga0500641_0033688 3300053096 Bacteria 2035
915 Ga0500555_000886 3300053103 Bacteria 10651
916 Ga0500556_0039178 3300053104 Bacteria 1659
917 Ga0500562_028756 3300053108 Bacteria 1461
918 Ga0500594_0001273 3300053118 Bacteria 5469
919 Ga0500594_0041625 3300053118 Bacteria 1259
920 Ga0500595_000150 3300053119 Bacteria 45894
921 Ga0500595_003849 3300053119 Bacteria 6893
922 Ga0500595_048610 3300053119 Bacteria 1325
923 Ga0500597_007599 3300053120 Bacteria 3685
924 Ga0500607_000006 3300053121 Bacteria 136863
925 Ga0500608_000298 3300053122 Bacteria 19216
926 Ga0500614_025073 3300053123 Bacteria 1414
927 Ga0500618_000817 3300053125 Bacteria 17137
928 Ga0500618_018611 3300053125 Bacteria 1717
929 Ga0500642_0001829 3300053130 Bacteria 6141
930 Ga0500642_0026441 3300053130 Bacteria 2369
931 Ga0500655_000020 3300053133 Bacteria 44643
932 Ga0500658_0000284 3300053134 Bacteria 23056
933 Ga0500559_0000698 3300053136 Bacteria 22073
934 Ga0500559_0004182 3300053136 Bacteria 6923
935 Ga0500559_0027412 3300053136 Bacteria 2431
936 Ga0500564_004573 3300053138 Bacteria 5559
937 Ga0500568_0000916 3300053139 Bacteria 20348
938 Ga0500573_0000235 3300053140 Bacteria 23015
939 Ga0500577_0004769 3300053142 Bacteria 3609
940 Ga0500577_0145193 3300053142 Bacteria 1003
941 Ga0500590_001132 3300053148 Bacteria 10511
942 Ga0500590_010918 3300053148 Bacteria 4594
943 Ga0500604_0000011 3300053151 Bacteria 104892
944 Ga0500616_0000030 3300053153 Bacteria 415224
945 Ga0500616_0000123 3300053153 Bacteria 140214
946 Ga0500616_0012922 3300053153 Bacteria 4865
947 Ga0500616_0047289 3300053153 Bacteria 2284
948 Ga0500619_000038 3300053154 Bacteria 40615
949 Ga0500622_0001376 3300053156 Bacteria 19604
950 Ga0500622_0006319 3300053156 Bacteria 6915
951 Ga0500624_000007 3300053157 Bacteria 184487
952 Ga0500624_000032 3300053157 Bacteria 104403
953 Ga0500636_0001312 3300053177 Bacteria 13508
954 Ga0500637_0000109 3300053178 Bacteria 29639
955 Ga0500637_0002011 3300053178 Bacteria 8870
956 Ga0500570_000051 3300053724 Bacteria 28955
957 Ga0500625_000001 3300053729 Bacteria 395993
958 Ga0500645_000037 3300053730 Bacteria 112944
959 Ga0500645_000215 3300053730 Bacteria 43997
960 Ga0500645_001429 3300053730 Bacteria 12140
961 Ga0500645_006747 3300053730 Bacteria 4067
962 Ga0500645_012901 3300053730 Bacteria 2693
963 Ga0501084_0306092 3300054114 Bacteria 1342
964 Ga0587090_004497 3300059510 Bacteria 1695
965 Ga0501082_0131512 3300060353 Bacteria 2172
966 Ga0466962_0000343 3300061719 Bacteria 19924

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014326 Ga0157380_10003365 Ga0157380_100033652 234
2 3300035724 Ga0373933_0190270 Ga0373933_0190270_549_1301 250
3 3300046500 Ga0495596_0000042 Ga0495596_0000042_51150_52055 259
4 3300046500 Ga0495596_0001157 Ga0495596_0001157_6933_7838 259
5 3300048091 Ga0495626_0003066 Ga0495626_0003066_4695_5600 259
6 3300005289 Ga0065704_10082208 Ga0065704_100822081 260
7 3300005295 Ga0065707_10001250 Ga0065707_100012503 260
8 3300005440 Ga0070705_100058364 Ga0070705_1000583642 260
9 3300028381 Ga0268264_10063589 Ga0268264_100635895 260
10 3300048920 Ga0496117_0087606 Ga0496117_0087606_36_818 260
11 3300046691 Ga0495670_0269424 Ga0495670_0269424_32_817 261
12 3300009092 Ga0105250_10016341 Ga0105250_100163414 263
13 3300046506 Ga0495583_0130475 Ga0495583_0130475_241_1032 263
14 3300002076 JGI24749J21850_1000467 JGI24749J21850_10004672 264
15 3300002459 JGI24751J29686_10000437 JGI24751J29686_1000043714 264
16 3300005295 Ga0065707_10082823 Ga0065707_1008282314 264
17 3300005331 Ga0070670_100000339 Ga0070670_10000033930 264
18 3300005353 Ga0070669_100000345 Ga0070669_10000034515 264
19 3300005617 Ga0068859_100195204 Ga0068859_1001952042 264
20 3300005618 Ga0068864_100000379 Ga0068864_10000037914 264
21 3300005719 Ga0068861_100040635 Ga0068861_1000406354 264
22 3300005844 Ga0068862_100014185 Ga0068862_1000141852 264
23 3300006931 Ga0097620_100195213 Ga0097620_1001952132 264
24 3300009177 Ga0105248_10025690 Ga0105248_100256902 264
25 3300014325 Ga0163163_10123345 Ga0163163_101233453 264
26 3300025923 Ga0207681_10000086 Ga0207681_1000008668 264
27 3300025925 Ga0207650_10000008 Ga0207650_10000008430 264
28 3300025941 Ga0207711_10008787 Ga0207711_100087873 264
29 3300025986 Ga0207658_10001804 Ga0207658_100018047 264
30 3300026095 Ga0207676_10000264 Ga0207676_1000026434 264
31 3300026118 Ga0207675_100005849 Ga0207675_10000584914 264
32 3300028380 Ga0268265_10001713 Ga0268265_100017137 264
33 3300048907 Ga0496104_0078556 Ga0496104_0078556_333_1130 265
34 3300049581 Ga0501047_0318416 Ga0501047_0318416_578_1378 266
35 3300025907 Ga0207645_10318266 Ga0207645_103182661 268
36 3300053092 Ga0500583_0078196 Ga0500583_0078196_486_1301 268
37 3300053153 Ga0500616_0000030 Ga0500616_0000030_276584_277399 268
38 3300005289 Ga0065704_10105224 Ga0065704_101052242 272
39 3300005295 Ga0065707_10081774 Ga0065707_1008177434 272
40 3300005548 Ga0070665_100000226 Ga0070665_10000022611 272
41 3300005548 Ga0070665_100000532 Ga0070665_1000005329 272
42 3300014326 Ga0157380_10000788 Ga0157380_1000078814 272
43 3300028379 Ga0268266_10000002 Ga0268266_100000022804 272
44 3300028379 Ga0268266_10000641 Ga0268266_1000064149 272
45 3300048928 Ga0496125_0173880 Ga0496125_0173880_524_1375 273
46 3300049743 Ga0501081_0318302 Ga0501081_0318302_25_846 273
47 3300060353 Ga0501082_0131512 Ga0501082_0131512_450_1364 273
48 3300005563 Ga0068855_100309074 Ga0068855_1003090743 274
49 3300013104 Ga0157370_10036824 Ga0157370_100368244 274
50 3300013105 Ga0157369_10096183 Ga0157369_100961834 274
51 iso_pu_bacteria 2643221605 2644036637 274
52 3300001976 JGI24752J21851_1000508 JGI24752J21851_10005083 275
53 3300002070 JGI24750J21931_1000309 JGI24750J21931_10003092 275
54 3300002074 JGI24748J21848_1000110 JGI24748J21848_100011013 275
55 3300002076 JGI24749J21850_1001980 JGI24749J21850_10019802 275
56 3300002239 JGI24034J26672_10000018 JGI24034J26672_10000018115 275
57 3300002244 JGI24742J22300_10009297 JGI24742J22300_100092971 275
58 3300005330 Ga0070690_100000008 Ga0070690_100000008114 275
59 3300005335 Ga0070666_10000032 Ga0070666_100000329 275
60 3300005355 Ga0070671_100040801 Ga0070671_1000408013 275
61 3300005365 Ga0070688_100010545 Ga0070688_1000105453 275
62 3300005367 Ga0070667_100227156 Ga0070667_1002271562 275
63 3300005466 Ga0070685_10000774 Ga0070685_1000077411 275
64 3300005544 Ga0070686_100000030 Ga0070686_10000003011 275
65 3300005548 Ga0070665_100000056 Ga0070665_10000005671 275
66 3300005617 Ga0068859_100019606 Ga0068859_1000196067 275
67 3300005841 Ga0068863_100000065 Ga0068863_100000065118 275
68 3300005842 Ga0068858_100018905 Ga0068858_1000189057 275
69 3300005843 Ga0068860_100000132 Ga0068860_100000132120 275
70 3300006931 Ga0097620_100019605 Ga0097620_1000196053 275
71 3300009101 Ga0105247_10081818 Ga0105247_100818183 275
72 3300014326 Ga0157380_10017753 Ga0157380_100177533 275
73 3300014968 Ga0157379_10010360 Ga0157379_100103605 275
74 3300017792 Ga0163161_10000084 Ga0163161_100000843 275
75 3300025900 Ga0207710_10017082 Ga0207710_100170821 275
76 3300025903 Ga0207680_10000009 Ga0207680_10000009437 275
77 3300025923 Ga0207681_10001567 Ga0207681_100015677 275
78 3300025931 Ga0207644_10002084 Ga0207644_100020842 275
79 3300025936 Ga0207670_10001908 Ga0207670_100019082 275
80 3300025941 Ga0207711_10014519 Ga0207711_100145198 275
81 3300025961 Ga0207712_10000046 Ga0207712_10000046125 275
82 3300025986 Ga0207658_10005994 Ga0207658_100059949 275
83 3300026035 Ga0207703_10000948 Ga0207703_1000094818 275
84 3300026088 Ga0207641_10000063 Ga0207641_1000006349 275
85 3300026095 Ga0207676_10001111 Ga0207676_100011116 275
86 3300026118 Ga0207675_100006391 Ga0207675_1000063919 275
87 3300028379 Ga0268266_10000066 Ga0268266_10000066182 275
88 3300028380 Ga0268265_10001076 Ga0268265_1000107614 275
89 3300028381 Ga0268264_10000130 Ga0268264_10000130144 275
90 3300048905 Ga0496102_0004071 Ga0496102_0004071_5177_6028 275
91 3300048906 Ga0496103_0000590 Ga0496103_0000590_5796_6647 275
92 3300048910 Ga0496107_0198261 Ga0496107_0198261_474_1325 275
93 3300048919 Ga0496116_0100041 Ga0496116_0100041_327_1178 275
94 3300048920 Ga0496117_0007224 Ga0496117_0007224_816_1667 275
95 iso_pu_bacteria 2510917021 2511130982 275
96 iso_pu_bacteria 2524023250 2524612631 275
97 iso_pu_bacteria 2643221541 2643729490 275
98 iso_pu_bacteria 2643221605 2644041072 275
99 iso_pu_bacteria 2643221606 2644043847 275
100 iso_pu_bacteria 2643221671 2644392318 275
101 iso_pu_bacteria 2751185897 2753767229 275
102 iso_pu_bacteria 2818991438 2819552009 275
103 iso_pu_bacteria 2512564014 2512643210 276
104 iso_pu_bacteria 2582581305 2585262750 276
105 iso_pu_bacteria 2599185359 2600227209 276
106 iso_pu_bacteria 2643221605 2644041100 276
107 iso_pu_bacteria 2643221606 2644042462 276
108 iso_pu_bacteria 2738541275 2738711416 276
109 iso_pu_bacteria 2738541301 2738849841 276
110 iso_pu_bacteria 2738541304 2738865570 276
111 iso_pu_bacteria 2738543022 2739298088 276
112 iso_pu_bacteria 2738543033 2739359766 276
113 iso_pu_bacteria 2739367664 2739648787 276
114 iso_pu_bacteria 2739367865 2740027260 276
115 iso_pu_bacteria 2808606401 2809064119 276
116 iso_pu_bacteria 2808606404 2809080087 276
117 iso_pu_bacteria 2808606405 2809084560 276
118 iso_pu_bacteria 2879163058 2879163233 276
119 iso_pu_bacteria 2880518877 2880523049 276
120 iso_pu_bacteria 2919138771 2919141223 276
121 iso_pu_bacteria 2919709256 2919713058 276
122 iso_pu_bacteria 2928100450 2928103191 276
123 iso_pu_bacteria 2928959182 2928962668 276
124 iso_pu_bacteria 3000865235 3000867504 276
125 iso_pu_bacteria 8057101203 8057104426 276
126 2162886007 SwRhRL2b_contig_3826517 SwRhRL2b_0415.00003500 279
127 2162886007 SwRhRL2b_contig_58648 SwRhRL2b_0969.00006940 279
128 3300005289 Ga0065704_10000815 Ga0065704_100008155 279
129 3300005289 Ga0065704_10070525 Ga0065704_1007052520 279
130 3300005289 Ga0065704_10105062 Ga0065704_101050622 279
131 3300005295 Ga0065707_10000429 Ga0065707_100004293 279
132 3300005295 Ga0065707_10115320 Ga0065707_101153201 279
133 3300005331 Ga0070670_100098177 Ga0070670_1000981772 279
134 3300005347 Ga0070668_100005438 Ga0070668_10000543811 279
135 3300005347 Ga0070668_100080184 Ga0070668_1000801844 279
136 3300005353 Ga0070669_100002597 Ga0070669_1000025978 279
137 3300005353 Ga0070669_100013431 Ga0070669_1000134315 279
138 3300005353 Ga0070669_100273297 Ga0070669_1002732972 279
139 3300005355 Ga0070671_100000093 Ga0070671_10000009346 279
140 3300005355 Ga0070671_100001928 Ga0070671_1000019285 279
141 3300005367 Ga0070667_100000985 Ga0070667_10000098519 279
142 3300005548 Ga0070665_100000169 Ga0070665_10000016974 279
143 3300005548 Ga0070665_100296005 Ga0070665_1002960052 279
144 3300005563 Ga0068855_100437920 Ga0068855_1004379202 279
145 3300005617 Ga0068859_100517827 Ga0068859_1005178272 279
146 3300005618 Ga0068864_100235371 Ga0068864_1002353712 279
147 3300005841 Ga0068863_100000645 Ga0068863_10000064527 279
148 3300005841 Ga0068863_100008798 Ga0068863_1000087988 279
149 3300005842 Ga0068858_100457179 Ga0068858_1004571792 279
150 3300005843 Ga0068860_100006559 Ga0068860_1000065595 279
151 3300005843 Ga0068860_100028234 Ga0068860_1000282347 279
152 3300005843 Ga0068860_100186099 Ga0068860_1001860992 279
153 3300005844 Ga0068862_100000095 Ga0068862_1000000951 279
154 3300005844 Ga0068862_100001939 Ga0068862_1000019394 279
155 3300006931 Ga0097620_100517802 Ga0097620_1005178021 279
156 3300009011 Ga0105251_10004488 Ga0105251_100044887 279
157 3300009177 Ga0105248_10091229 Ga0105248_100912292 279
158 3300009177 Ga0105248_10283139 Ga0105248_102831392 279
159 3300009551 Ga0105238_10129713 Ga0105238_101297134 279
160 3300009978 Ga0105148_100197 Ga0105148_1001979 279
161 3300013102 Ga0157371_10302742 Ga0157371_103027422 279
162 3300013306 Ga0163162_10000458 Ga0163162_1000045815 279
163 3300013306 Ga0163162_10914008 Ga0163162_109140081 279
164 3300017792 Ga0163161_10001082 Ga0163161_100010829 279
165 3300021384 Ga0213876_10006914 Ga0213876_100069146 279
166 3300025298 Ga0209050_1000299 Ga0209050_100029985 279
167 3300025315 Ga0207697_10073900 Ga0207697_100739002 279
168 3300025735 Ga0207713_1002844 Ga0207713_10028446 279
169 3300025903 Ga0207680_10015096 Ga0207680_100150964 279
170 3300025923 Ga0207681_10002247 Ga0207681_100022479 279
171 3300025923 Ga0207681_10034479 Ga0207681_100344792 279
172 3300025925 Ga0207650_10093885 Ga0207650_100938852 279
173 3300025931 Ga0207644_10000122 Ga0207644_1000012246 279
174 3300025931 Ga0207644_10000409 Ga0207644_1000040918 279
175 3300025937 Ga0207669_10368727 Ga0207669_103687272 279
176 3300025941 Ga0207711_10135230 Ga0207711_101352303 279
177 3300025949 Ga0207667_10503941 Ga0207667_105039412 279
178 3300025972 Ga0207668_10015096 Ga0207668_100150964 279
179 3300025972 Ga0207668_10017068 Ga0207668_100170683 279
180 3300025986 Ga0207658_10012892 Ga0207658_100128923 279
181 3300026035 Ga0207703_10089780 Ga0207703_100897802 279
182 3300026035 Ga0207703_10179687 Ga0207703_101796872 279
183 3300026035 Ga0207703_10214866 Ga0207703_102148663 279
184 3300026088 Ga0207641_10000632 Ga0207641_1000063227 279
185 3300026088 Ga0207641_10068073 Ga0207641_100680734 279
186 3300028379 Ga0268266_10001173 Ga0268266_1000117325 279
187 3300028379 Ga0268266_10101557 Ga0268266_101015572 279
188 3300028380 Ga0268265_10003845 Ga0268265_100038451 279
189 3300028381 Ga0268264_10001891 Ga0268264_1000189110 279
190 3300028381 Ga0268264_10003658 Ga0268264_100036585 279
191 3300028381 Ga0268264_10015461 Ga0268264_100154614 279
192 3300031548 Ga0307408_100430033 Ga0307408_1004300331 279
193 3300031731 Ga0307405_10010561 Ga0307405_100105614 279
194 3300031824 Ga0307413_10147452 Ga0307413_101474522 279
195 3300031901 Ga0307406_10024351 Ga0307406_100243515 279
196 3300037068 Ga0373925_0000010 Ga0373925_0000010_208850_209689 279
197 3300037312 Ga0395899_0146250 Ga0395899_0146250_512_1351 279
198 3300037418 Ga0395900_0323100 Ga0395900_0323100_528_1367 279
199 3300037466 Ga0395898_0010266 Ga0395898_0010266_2306_3145 279
200 3300037466 Ga0395898_0072742 Ga0395898_0072742_1673_2512 279
201 3300039437 Ga0436365_0712898 Ga0436365_0712898_494_1333 279
202 3300039453 Ga0436362_0783629 Ga0436362_0783629_340_1179 279
203 3300044684 Ga0466966_0125352 Ga0466966_0125352_340_1179 279
204 3300046453 Ga0495627_000162 Ga0495627_000162_47857_48765 279
205 3300046460 Ga0495638_0000021 Ga0495638_0000021_15892_16734 279
206 3300046460 Ga0495638_0000209 Ga0495638_0000209_58981_59820 279
207 3300046461 Ga0495641_0026727 Ga0495641_0026727_1776_2627 279
208 3300046501 Ga0495607_0010179 Ga0495607_0010179_4088_4993 279
209 3300046506 Ga0495583_0000184 Ga0495583_0000184_54613_55455 279
210 3300046506 Ga0495583_0000840 Ga0495583_0000840_6775_7614 279
211 3300046507 Ga0495606_0088792 Ga0495606_0088792_838_1677 279
212 3300046512 Ga0495610_0000059 Ga0495610_0000059_27117_28025 279
213 3300046519 Ga0495632_0000410 Ga0495632_0000410_902_1810 279
214 3300046519 Ga0495632_0001694 Ga0495632_0001694_15898_16740 279
215 3300046522 Ga0495643_0003968 Ga0495643_0003968_4857_5762 279
216 3300046524 Ga0495648_0000026 Ga0495648_0000026_15864_16706 279
217 3300046528 Ga0495642_0086585 Ga0495642_0086585_191_1030 279
218 3300046530 Ga0495654_0044744 Ga0495654_0044744_265_1104 279
219 3300046538 Ga0495609_0005517 Ga0495609_0005517_146_1051 279
220 3300046660 Ga0495625_0014355 Ga0495625_0014355_1226_2131 279
221 3300046691 Ga0495670_0022796 Ga0495670_0022796_22_861 279
222 3300046691 Ga0495670_0037214 Ga0495670_0037214_368_1207 279
223 3300046692 Ga0495671_0000050 Ga0495671_0000050_125266_126108 279
224 3300047469 Ga0495673_0000125 Ga0495673_0000125_15830_16672 279
225 3300047470 Ga0495681_0000045 Ga0495681_0000045_47847_48755 279
226 3300047472 Ga0495686_0000606 Ga0495686_0000606_29944_30783 279
227 3300047472 Ga0495686_0039861 Ga0495686_0039861_1387_2226 279
228 3300048904 Ga0496101_0227536 Ga0496101_0227536_27_932 279
229 3300048905 Ga0496102_0289784 Ga0496102_0289784_633_1472 279
230 3300048906 Ga0496103_0012080 Ga0496103_0012080_2638_3477 279
231 3300048906 Ga0496103_0117595 Ga0496103_0117595_148_999 279
232 3300048913 Ga0496110_0267995 Ga0496110_0267995_44_886 279
233 3300048915 Ga0496112_0524528 Ga0496112_0524528_241_1080 279
234 3300048916 Ga0496113_0320951 Ga0496113_0320951_362_1204 279
235 3300048919 Ga0496116_0000060 Ga0496116_0000060_108349_109254 279
236 3300048920 Ga0496117_0022967 Ga0496117_0022967_1431_2282 279
237 3300048920 Ga0496117_0052366 Ga0496117_0052366_354_1193 279
238 3300048920 Ga0496117_0079561 Ga0496117_0079561_1026_1931 279
239 3300048921 Ga0496118_0003977 Ga0496118_0003977_162_1001 279
240 3300048921 Ga0496118_0027984 Ga0496118_0027984_1869_2720 279
241 3300048924 Ga0496121_0001672 Ga0496121_0001672_7438_8337 279
242 3300048924 Ga0496121_0009918 Ga0496121_0009918_8721_9560 279
243 3300048925 Ga0496122_0003693 Ga0496122_0003693_16623_17528 279
244 3300048925 Ga0496122_0194130 Ga0496122_0194130_44_886 279
245 3300048926 Ga0496123_0000457 Ga0496123_0000457_133_1038 279
246 3300048927 Ga0496124_0006822 Ga0496124_0006822_8200_9039 279
247 3300048927 Ga0496124_0006882 Ga0496124_0006882_11121_12020 279
248 3300048927 Ga0496124_0171459 Ga0496124_0171459_283_1125 279
249 3300048927 Ga0496124_0293529 Ga0496124_0293529_310_1149 279
250 3300048928 Ga0496125_0004371 Ga0496125_0004371_9526_10377 279
251 3300048928 Ga0496125_0013788 Ga0496125_0013788_3122_4021 279
252 3300048928 Ga0496125_0092833 Ga0496125_0092833_1286_2128 279
253 3300048928 Ga0496125_0318063 Ga0496125_0318063_11_862 279
254 3300048929 Ga0496126_0002255 Ga0496126_0002255_5973_6878 279
255 3300049460 Ga0495682_0021473 Ga0495682_0021473_14_853 279
256 3300049570 Ga0501033_0236429 Ga0501033_0236429_285_1124 279
257 3300049575 Ga0501039_0242575 Ga0501039_0242575_502_1341 279
258 3300049578 Ga0501042_0143009 Ga0501042_0143009_355_1194 279
259 3300049582 Ga0501048_0222911 Ga0501048_0222911_313_1152 279
260 3300049587 Ga0501071_0323612 Ga0501071_0323612_30_869 279
261 3300049587 Ga0501071_0505370 Ga0501071_0505370_59_898 279
262 3300049592 Ga0501076_0153344 Ga0501076_0153344_171_1010 279
263 3300049758 Ga0501241_023346 Ga0501241_023346_189_1028 279
264 3300053096 Ga0500641_0013275 Ga0500641_0013275_892_1731 279
265 3300053103 Ga0500555_000886 Ga0500555_000886_7781_8620 279
266 3300053104 Ga0500556_0039178 Ga0500556_0039178_796_1635 279
267 3300053118 Ga0500594_0001273 Ga0500594_0001273_49_888 279
268 3300053118 Ga0500594_0041625 Ga0500594_0041625_324_1163 279
269 3300053122 Ga0500608_000298 Ga0500608_000298_12015_12854 279
270 3300053125 Ga0500618_018611 Ga0500618_018611_37_876 279
271 3300053134 Ga0500658_0000284 Ga0500658_0000284_19030_19869 279
272 3300053138 Ga0500564_004573 Ga0500564_004573_1270_2109 279
273 3300053142 Ga0500577_0145193 Ga0500577_0145193_126_965 279
274 3300053153 Ga0500616_0012922 Ga0500616_0012922_1899_2738 279
275 3300053154 Ga0500619_000038 Ga0500619_000038_26497_27336 279
276 3300053729 Ga0500625_000001 Ga0500625_000001_102569_103408 279
277 3300054114 Ga0501084_0306092 Ga0501084_0306092_114_953 279
278 2162886006 SwRhRL3b_contig_728105 SwRhRL3b_0067.00001710 280
279 2162886007 SwRhRL2b_contig_1724569 SwRhRL2b_0374.00002730 280
280 2162886007 SwRhRL2b_contig_2992305 SwRhRL2b_0795.00001290 280
281 3300000043 ARcpr5yngRDRAFT_c001119 ARcpr5yngRDRAFT_0011192 280
282 3300001904 JGI24736J21556_1000628 JGI24736J21556_10006284 280
283 3300001915 JGI24741J21665_1000412 JGI24741J21665_10004129 280
284 3300001915 JGI24741J21665_1001567 JGI24741J21665_10015675 280
285 3300001915 JGI24741J21665_1007882 JGI24741J21665_10078823 280
286 3300001979 JGI24740J21852_10001161 JGI24740J21852_100011613 280
287 3300001979 JGI24740J21852_10002608 JGI24740J21852_100026084 280
288 3300001979 JGI24740J21852_10002728 JGI24740J21852_1000272810 280
289 3300001979 JGI24740J21852_10044008 JGI24740J21852_100440082 280
290 3300001989 JGI24739J22299_10000474 JGI24739J22299_100004744 280
291 3300001989 JGI24739J22299_10000894 JGI24739J22299_100008949 280
292 3300001989 JGI24739J22299_10002269 JGI24739J22299_100022695 280
293 3300001989 JGI24739J22299_10043286 JGI24739J22299_100432863 280
294 3300001990 JGI24737J22298_10000777 JGI24737J22298_100007774 280
295 3300001990 JGI24737J22298_10004720 JGI24737J22298_100047202 280
296 3300001990 JGI24737J22298_10022827 JGI24737J22298_100228273 280
297 3300002067 JGI24735J21928_10001703 JGI24735J21928_100017035 280
298 3300002067 JGI24735J21928_10007611 JGI24735J21928_100076114 280
299 3300002067 JGI24735J21928_10012271 JGI24735J21928_100122711 280
300 3300002070 JGI24750J21931_1000672 JGI24750J21931_10006726 280
301 3300002074 JGI24748J21848_1000084 JGI24748J21848_100008429 280
302 3300002074 JGI24748J21848_1001561 JGI24748J21848_10015612 280
303 3300002075 JGI24738J21930_10000342 JGI24738J21930_100003428 280
304 3300002075 JGI24738J21930_10001583 JGI24738J21930_100015834 280
305 3300002075 JGI24738J21930_10002238 JGI24738J21930_100022385 280
306 3300002075 JGI24738J21930_10002496 JGI24738J21930_100024962 280
307 3300002076 JGI24749J21850_1000368 JGI24749J21850_10003682 280
308 3300002077 JGI24744J21845_10002073 JGI24744J21845_100020733 280
309 3300002239 JGI24034J26672_10000018 JGI24034J26672_10000018127 280
310 3300002244 JGI24742J22300_10002759 JGI24742J22300_100027594 280
311 3300002459 JGI24751J29686_10000254 JGI24751J29686_1000025410 280
312 3300003214 JGI25165J46597_1000021 JGI25165J46597_1000021184 280
313 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006119 280
314 3300003215 JGI25153J46596_10002634 JGI25153J46596_100026348 280
315 3300003771 Ga0055526_1000009 Ga0055526_1000009181 280
316 3300003773 Ga0055537_1000650 Ga0055537_100065010 280
317 3300003775 Ga0055524_1000115 Ga0055524_100011515 280
318 3300003784 Ga0055534_1003258 Ga0055534_10032584 280
319 3300003791 Ga0055530_10004411 Ga0055530_100044118 280
320 3300003794 Ga0055531_10000961 Ga0055531_100009617 280
321 3300005262 Ga0065165_1002167 Ga0065165_100216716 280
322 3300005262 Ga0065165_1003474 Ga0065165_10034748 280
323 3300005262 Ga0065165_1005126 Ga0065165_10051262 280
324 3300005289 Ga0065704_10001087 Ga0065704_100010875 280
325 3300005289 Ga0065704_10070333 Ga0065704_1007033318 280
326 3300005289 Ga0065704_10122357 Ga0065704_101223572 280
327 3300005295 Ga0065707_10082048 Ga0065707_100820489 280
328 3300005295 Ga0065707_10087646 Ga0065707_100876464 280
329 3300005295 Ga0065707_10090188 Ga0065707_100901883 280
330 3300005295 Ga0065707_10091077 Ga0065707_100910773 280
331 3300005295 Ga0065707_10101741 Ga0065707_101017411 280
332 3300005327 Ga0070658_10000167 Ga0070658_1000016750 280
333 3300005327 Ga0070658_10001013 Ga0070658_100010133 280
334 3300005327 Ga0070658_10005110 Ga0070658_100051102 280
335 3300005327 Ga0070658_10011645 Ga0070658_100116452 280
336 3300005327 Ga0070658_10012920 Ga0070658_100129202 280
337 3300005327 Ga0070658_10064528 Ga0070658_100645284 280
338 3300005327 Ga0070658_10157304 Ga0070658_101573042 280
339 3300005327 Ga0070658_10325650 Ga0070658_103256502 280
340 3300005328 Ga0070676_10000192 Ga0070676_1000019214 280
341 3300005328 Ga0070676_10057017 Ga0070676_100570171 280
342 3300005329 Ga0070683_100418141 Ga0070683_1004181411 280
343 3300005330 Ga0070690_100000212 Ga0070690_10000021240 280
344 3300005331 Ga0070670_100330408 Ga0070670_1003304082 280
345 3300005334 Ga0068869_100000163 Ga0068869_1000001635 280
346 3300005335 Ga0070666_10326247 Ga0070666_103262471 280
347 3300005338 Ga0068868_100001386 Ga0068868_1000013861 280
348 3300005338 Ga0068868_100138869 Ga0068868_1001388692 280
349 3300005339 Ga0070660_100000222 Ga0070660_10000022219 280
350 3300005339 Ga0070660_100038822 Ga0070660_1000388223 280
351 3300005339 Ga0070660_100045768 Ga0070660_1000457682 280
352 3300005339 Ga0070660_100070757 Ga0070660_1000707573 280
353 3300005339 Ga0070660_100121179 Ga0070660_1001211793 280
354 3300005340 Ga0070689_100001547 Ga0070689_10000154714 280
355 3300005344 Ga0070661_100000327 Ga0070661_10000032716 280
356 3300005344 Ga0070661_100274660 Ga0070661_1002746602 280
357 3300005344 Ga0070661_100380887 Ga0070661_1003808871 280
358 3300005347 Ga0070668_100023619 Ga0070668_1000236193 280
359 3300005347 Ga0070668_100073194 Ga0070668_1000731943 280
360 3300005347 Ga0070668_100219096 Ga0070668_1002190963 280
361 3300005353 Ga0070669_100000143 Ga0070669_10000014317 280
362 3300005353 Ga0070669_100001464 Ga0070669_1000014645 280
363 3300005354 Ga0070675_100011917 Ga0070675_1000119173 280
364 3300005354 Ga0070675_100453006 Ga0070675_1004530061 280
365 3300005355 Ga0070671_100011033 Ga0070671_1000110338 280
366 3300005355 Ga0070671_100019820 Ga0070671_1000198202 280
367 3300005355 Ga0070671_100073254 Ga0070671_1000732543 280
368 3300005356 Ga0070674_100001288 Ga0070674_1000012881 280
369 3300005356 Ga0070674_100005654 Ga0070674_1000056544 280
370 3300005364 Ga0070673_100000011 Ga0070673_10000001131 280
371 3300005365 Ga0070688_100002657 Ga0070688_1000026579 280
372 3300005366 Ga0070659_100047972 Ga0070659_1000479723 280
373 3300005366 Ga0070659_100455523 Ga0070659_1004555231 280
374 3300005367 Ga0070667_100000210 Ga0070667_10000021031 280
375 3300005367 Ga0070667_100041142 Ga0070667_1000411423 280
376 3300005367 Ga0070667_100297097 Ga0070667_1002970972 280
377 3300005439 Ga0070711_100324583 Ga0070711_1003245832 280
378 3300005455 Ga0070663_100000422 Ga0070663_10000042221 280
379 3300005455 Ga0070663_100001266 Ga0070663_1000012668 280
380 3300005456 Ga0070678_100011088 Ga0070678_1000110882 280
381 3300005457 Ga0070662_100029752 Ga0070662_1000297524 280
382 3300005457 Ga0070662_100044323 Ga0070662_1000443233 280
383 3300005457 Ga0070662_100049006 Ga0070662_1000490063 280
384 3300005458 Ga0070681_10008671 Ga0070681_100086713 280
385 3300005459 Ga0068867_100000049 Ga0068867_10000004939 280
386 3300005466 Ga0070685_10003150 Ga0070685_100031502 280
387 3300005471 Ga0070698_100032618 Ga0070698_1000326183 280
388 3300005530 Ga0070679_100361108 Ga0070679_1003611082 280
389 3300005535 Ga0070684_100174406 Ga0070684_1001744062 280
390 3300005535 Ga0070684_100237583 Ga0070684_1002375832 280
391 3300005539 Ga0068853_100027452 Ga0068853_1000274522 280
392 3300005539 Ga0068853_100126808 Ga0068853_1001268082 280
393 3300005539 Ga0068853_100178407 Ga0068853_1001784073 280
394 3300005539 Ga0068853_100376794 Ga0068853_1003767942 280
395 3300005543 Ga0070672_100017723 Ga0070672_1000177235 280
396 3300005544 Ga0070686_100000331 Ga0070686_1000003312 280
397 3300005548 Ga0070665_100000011 Ga0070665_10000001196 280
398 3300005548 Ga0070665_100000056 Ga0070665_10000005659 280
399 3300005548 Ga0070665_100089019 Ga0070665_1000890193 280
400 3300005548 Ga0070665_100239550 Ga0070665_1002395502 280
401 3300005563 Ga0068855_100000265 Ga0068855_10000026525 280
402 3300005563 Ga0068855_100002478 Ga0068855_10000247812 280
403 3300005563 Ga0068855_100032538 Ga0068855_1000325386 280
404 3300005563 Ga0068855_100429644 Ga0068855_1004296442 280
405 3300005563 Ga0068855_100508820 Ga0068855_1005088202 280
406 3300005564 Ga0070664_100105392 Ga0070664_1001053922 280
407 3300005564 Ga0070664_100253589 Ga0070664_1002535892 280
408 3300005564 Ga0070664_100404610 Ga0070664_1004046102 280
409 3300005577 Ga0068857_100039516 Ga0068857_1000395166 280
410 3300005577 Ga0068857_100041607 Ga0068857_1000416075 280
411 3300005577 Ga0068857_100113403 Ga0068857_1001134032 280
412 3300005577 Ga0068857_100132375 Ga0068857_1001323753 280
413 3300005577 Ga0068857_100135121 Ga0068857_1001351213 280
414 3300005578 Ga0068854_100000405 Ga0068854_1000004056 280
415 3300005578 Ga0068854_100004023 Ga0068854_1000040238 280
416 3300005578 Ga0068854_100079912 Ga0068854_1000799123 280
417 3300005578 Ga0068854_100264040 Ga0068854_1002640402 280
418 3300005614 Ga0068856_100004268 Ga0068856_1000042686 280
419 3300005614 Ga0068856_100005115 Ga0068856_1000051155 280
420 3300005615 Ga0070702_100443588 Ga0070702_1004435881 280
421 3300005616 Ga0068852_100000544 Ga0068852_1000005447 280
422 3300005616 Ga0068852_100030135 Ga0068852_1000301355 280
423 3300005616 Ga0068852_100272273 Ga0068852_1002722732 280
424 3300005616 Ga0068852_100305815 Ga0068852_1003058152 280
425 3300005618 Ga0068864_100000088 Ga0068864_10000008818 280
426 3300005618 Ga0068864_100001540 Ga0068864_10000154010 280
427 3300005841 Ga0068863_100000158 Ga0068863_10000015832 280
428 3300005841 Ga0068863_100000925 Ga0068863_10000092538 280
429 3300005842 Ga0068858_100000094 Ga0068858_10000009438 280
430 3300005842 Ga0068858_100000149 Ga0068858_10000014968 280
431 3300005842 Ga0068858_100002113 Ga0068858_1000021133 280
432 3300005842 Ga0068858_100009628 Ga0068858_1000096282 280
433 3300005843 Ga0068860_100001798 Ga0068860_10000179831 280
434 3300005844 Ga0068862_100003339 Ga0068862_10000333910 280
435 3300005844 Ga0068862_100012900 Ga0068862_1000129007 280
436 3300005844 Ga0068862_100191054 Ga0068862_1001910543 280
437 3300005937 Ga0081455_10000072 Ga0081455_1000007237 280
438 3300005937 Ga0081455_10014422 Ga0081455_100144228 280
439 3300005985 Ga0081539_10019600 Ga0081539_100196003 280
440 3300006042 Ga0075368_10000367 Ga0075368_100003672 280
441 3300006058 Ga0075432_10001680 Ga0075432_100016805 280
442 3300006178 Ga0075367_10001292 Ga0075367_100012925 280
443 3300006186 Ga0075369_10070024 Ga0075369_100700242 280
444 3300006195 Ga0075366_10000082 Ga0075366_1000008212 280
445 3300006195 Ga0075366_10042459 Ga0075366_100424592 280
446 3300006195 Ga0075366_10147536 Ga0075366_101475362 280
447 3300006195 Ga0075366_10152320 Ga0075366_101523202 280
448 3300006237 Ga0097621_100003864 Ga0097621_1000038641 280
449 3300006237 Ga0097621_100116871 Ga0097621_1001168711 280
450 3300006353 Ga0075370_10007132 Ga0075370_100071325 280
451 3300006353 Ga0075370_10024315 Ga0075370_100243153 280
452 3300006358 Ga0068871_100016763 Ga0068871_1000167633 280
453 3300006358 Ga0068871_100025482 Ga0068871_1000254825 280
454 3300006871 Ga0075434_100092271 Ga0075434_1000922713 280
455 3300006881 Ga0068865_100000012 Ga0068865_10000001293 280
456 3300006881 Ga0068865_100114330 Ga0068865_1001143302 280
457 3300006914 Ga0075436_100051150 Ga0075436_1000511502 280
458 3300006931 Ga0097620_100271514 Ga0097620_1002715142 280
459 3300006946 Ga0079104_1010088 Ga0079104_10100884 280
460 3300009011 Ga0105251_10091874 Ga0105251_100918742 280
461 3300009092 Ga0105250_10000014 Ga0105250_1000001411 280
462 3300009092 Ga0105250_10008693 Ga0105250_100086933 280
463 3300009093 Ga0105240_10016880 Ga0105240_100168808 280
464 3300009093 Ga0105240_10078124 Ga0105240_100781245 280
465 3300009093 Ga0105240_10325764 Ga0105240_103257643 280
466 3300009098 Ga0105245_10000097 Ga0105245_100000979 280
467 3300009098 Ga0105245_10000529 Ga0105245_1000052912 280
468 3300009098 Ga0105245_10070673 Ga0105245_100706733 280
469 3300009098 Ga0105245_10584711 Ga0105245_105847112 280
470 3300009101 Ga0105247_10030374 Ga0105247_100303744 280
471 3300009147 Ga0114129_10431909 Ga0114129_104319092 280
472 3300009148 Ga0105243_10000164 Ga0105243_100001646 280
473 3300009148 Ga0105243_10000297 Ga0105243_1000029731 280
474 3300009148 Ga0105243_10087297 Ga0105243_100872974 280
475 3300009174 Ga0105241_10005018 Ga0105241_1000501810 280
476 3300009174 Ga0105241_10025210 Ga0105241_100252104 280
477 3300009176 Ga0105242_10000645 Ga0105242_100006452 280
478 3300009176 Ga0105242_10248497 Ga0105242_102484973 280
479 3300009177 Ga0105248_10004976 Ga0105248_100049769 280
480 3300009177 Ga0105248_10021768 Ga0105248_100217685 280
481 3300009177 Ga0105248_10111946 Ga0105248_101119463 280
482 3300009177 Ga0105248_10284510 Ga0105248_102845101 280
483 3300009545 Ga0105237_10075160 Ga0105237_100751604 280
484 3300009545 Ga0105237_10086697 Ga0105237_100866972 280
485 3300009551 Ga0105238_10017041 Ga0105238_100170416 280
486 3300009551 Ga0105238_10394997 Ga0105238_103949971 280
487 3300009553 Ga0105249_10000079 Ga0105249_1000007943 280
488 3300009553 Ga0105249_10000443 Ga0105249_1000044313 280
489 3300009553 Ga0105249_10021563 Ga0105249_100215637 280
490 3300010375 Ga0105239_10063344 Ga0105239_100633444 280
491 3300010375 Ga0105239_10200749 Ga0105239_102007493 280
492 3300011119 Ga0105246_10006686 Ga0105246_100066862 280
493 3300011119 Ga0105246_10036288 Ga0105246_100362883 280
494 3300012475 Ga0157317_1000219 Ga0157317_10002192 280
495 3300012513 Ga0157326_1001312 Ga0157326_10013122 280
496 3300013100 Ga0157373_10014308 Ga0157373_100143087 280
497 3300013100 Ga0157373_10073403 Ga0157373_100734032 280
498 3300013102 Ga0157371_10000024 Ga0157371_10000024153 280
499 3300013102 Ga0157371_10047887 Ga0157371_100478873 280
500 3300013104 Ga0157370_10025702 Ga0157370_100257026 280
501 3300013105 Ga0157369_10057118 Ga0157369_100571185 280
502 3300013296 Ga0157374_10000936 Ga0157374_1000093610 280
503 3300013296 Ga0157374_10010980 Ga0157374_100109806 280
504 3300013297 Ga0157378_10001079 Ga0157378_1000107910 280
505 3300013297 Ga0157378_10091580 Ga0157378_100915804 280
506 3300013306 Ga0163162_10007763 Ga0163162_100077634 280
507 3300013306 Ga0163162_10062932 Ga0163162_100629324 280
508 3300013306 Ga0163162_10166472 Ga0163162_101664723 280
509 3300013306 Ga0163162_10185255 Ga0163162_101852552 280
510 3300013306 Ga0163162_10442795 Ga0163162_104427952 280
511 3300013306 Ga0163162_10601930 Ga0163162_106019302 280
512 3300013307 Ga0157372_10059106 Ga0157372_100591063 280
513 3300013307 Ga0157372_10177386 Ga0157372_101773862 280
514 3300013308 Ga0157375_10000294 Ga0157375_100002949 280
515 3300013308 Ga0157375_10381607 Ga0157375_103816071 280
516 3300014325 Ga0163163_10220316 Ga0163163_102203163 280
517 3300014325 Ga0163163_10486933 Ga0163163_104869332 280
518 3300014326 Ga0157380_10013680 Ga0157380_100136803 280
519 3300014326 Ga0157380_10032883 Ga0157380_100328835 280
520 3300014326 Ga0157380_10058373 Ga0157380_100583734 280
521 3300014968 Ga0157379_10000278 Ga0157379_1000027812 280
522 3300014968 Ga0157379_10041193 Ga0157379_100411934 280
523 3300014968 Ga0157379_10113552 Ga0157379_101135522 280
524 3300014969 Ga0157376_10000251 Ga0157376_100002517 280
525 3300017792 Ga0163161_10140722 Ga0163161_101407223 280
526 3300017792 Ga0163161_10155666 Ga0163161_101556663 280
527 3300025223 Ga0207672_1000210 Ga0207672_10002104 280
528 3300025226 Ga0209674_106031 Ga0209674_1060312 280
529 3300025229 Ga0209147_100302 Ga0209147_10030227 280
530 3300025229 Ga0209147_100780 Ga0209147_10078014 280
531 3300025233 Ga0209437_102017 Ga0209437_1020172 280
532 3300025245 Ga0207425_1004019 Ga0207425_10040194 280
533 3300025253 Ga0209677_106712 Ga0209677_1067123 280
534 3300025261 Ga0209233_1000065 Ga0209233_1000065185 280
535 3300025263 Ga0209565_1000008 Ga0209565_100000864 280
536 3300025272 Ga0209455_1014561 Ga0209455_10145612 280
537 3300025273 Ga0209673_1001306 Ga0209673_10013062 280
538 3300025291 Ga0209675_1000248 Ga0209675_100024816 280
539 3300025291 Ga0209675_1036876 Ga0209675_10368762 280
540 3300025295 Ga0209564_1000069 Ga0209564_100006934 280
541 3300025297 Ga0209758_1000001 Ga0209758_10000011706 280
542 3300025297 Ga0209758_1008432 Ga0209758_10084322 280
543 3300025298 Ga0209050_1006717 Ga0209050_10067174 280
544 3300025299 Ga0209256_1000009 Ga0209256_1000009807 280
545 3300025299 Ga0209256_1000010 Ga0209256_1000010731 280
546 3300025304 Ga0209257_1000524 Ga0209257_10005248 280
547 3300025315 Ga0207697_10007182 Ga0207697_100071826 280
548 3300025321 Ga0207656_10046123 Ga0207656_100461232 280
549 3300025711 Ga0207696_1000087 Ga0207696_100008711 280
550 3300025711 Ga0207696_1006001 Ga0207696_10060013 280
551 3300025901 Ga0207688_10040012 Ga0207688_100400122 280
552 3300025903 Ga0207680_10000009 Ga0207680_10000009449 280
553 3300025903 Ga0207680_10241635 Ga0207680_102416352 280
554 3300025904 Ga0207647_10000997 Ga0207647_1000099724 280
555 3300025904 Ga0207647_10004006 Ga0207647_100040062 280
556 3300025904 Ga0207647_10012963 Ga0207647_100129635 280
557 3300025904 Ga0207647_10018514 Ga0207647_100185145 280
558 3300025904 Ga0207647_10027052 Ga0207647_100270523 280
559 3300025904 Ga0207647_10114361 Ga0207647_101143612 280
560 3300025907 Ga0207645_10001889 Ga0207645_1000188913 280
561 3300025907 Ga0207645_10113318 Ga0207645_101133183 280
562 3300025907 Ga0207645_10214863 Ga0207645_102148632 280
563 3300025907 Ga0207645_10222713 Ga0207645_102227131 280
564 3300025909 Ga0207705_10000004 Ga0207705_10000004203 280
565 3300025909 Ga0207705_10000018 Ga0207705_1000001824 280
566 3300025909 Ga0207705_10000366 Ga0207705_1000036620 280
567 3300025909 Ga0207705_10000816 Ga0207705_1000081610 280
568 3300025909 Ga0207705_10042421 Ga0207705_100424212 280
569 3300025909 Ga0207705_10106866 Ga0207705_101068662 280
570 3300025909 Ga0207705_10149239 Ga0207705_101492392 280
571 3300025909 Ga0207705_10223750 Ga0207705_102237501 280
572 3300025910 Ga0207684_10201298 Ga0207684_102012982 280
573 3300025911 Ga0207654_10000319 Ga0207654_100003196 280
574 3300025911 Ga0207654_10001192 Ga0207654_1000119210 280
575 3300025911 Ga0207654_10028014 Ga0207654_100280144 280
576 3300025913 Ga0207695_10004104 Ga0207695_1000410422 280
577 3300025913 Ga0207695_10008455 Ga0207695_1000845512 280
578 3300025913 Ga0207695_10010364 Ga0207695_100103648 280
579 3300025913 Ga0207695_10016957 Ga0207695_100169577 280
580 3300025913 Ga0207695_10231605 Ga0207695_102316053 280
581 3300025914 Ga0207671_10000800 Ga0207671_100008003 280
582 3300025914 Ga0207671_10011333 Ga0207671_100113334 280
583 3300025914 Ga0207671_10070919 Ga0207671_100709192 280
584 3300025919 Ga0207657_10000606 Ga0207657_1000060620 280
585 3300025919 Ga0207657_10002728 Ga0207657_100027288 280
586 3300025919 Ga0207657_10003773 Ga0207657_1000377311 280
587 3300025919 Ga0207657_10013446 Ga0207657_100134464 280
588 3300025919 Ga0207657_10014710 Ga0207657_100147104 280
589 3300025920 Ga0207649_10055431 Ga0207649_100554313 280
590 3300025921 Ga0207652_10417777 Ga0207652_104177771 280
591 3300025923 Ga0207681_10000512 Ga0207681_1000051219 280
592 3300025923 Ga0207681_10000789 Ga0207681_100007899 280
593 3300025924 Ga0207694_10006783 Ga0207694_100067838 280
594 3300025924 Ga0207694_10011155 Ga0207694_100111556 280
595 3300025924 Ga0207694_10044196 Ga0207694_100441964 280
596 3300025924 Ga0207694_10135189 Ga0207694_101351892 280
597 3300025924 Ga0207694_10156565 Ga0207694_101565652 280
598 3300025924 Ga0207694_10157367 Ga0207694_101573672 280
599 3300025924 Ga0207694_10220676 Ga0207694_102206762 280
600 3300025925 Ga0207650_10000008 Ga0207650_10000008404 280
601 3300025925 Ga0207650_10285822 Ga0207650_102858222 280
602 3300025926 Ga0207659_10027564 Ga0207659_100275645 280
603 3300025926 Ga0207659_10180091 Ga0207659_101800913 280
604 3300025927 Ga0207687_10000580 Ga0207687_1000058012 280
605 3300025927 Ga0207687_10002448 Ga0207687_100024488 280
606 3300025928 Ga0207700_10196489 Ga0207700_101964891 280
607 3300025931 Ga0207644_10002084 Ga0207644_1000208414 280
608 3300025931 Ga0207644_10020510 Ga0207644_100205103 280
609 3300025931 Ga0207644_10216448 Ga0207644_102164482 280
610 3300025932 Ga0207690_10000213 Ga0207690_1000021335 280
611 3300025932 Ga0207690_10005085 Ga0207690_100050857 280
612 3300025932 Ga0207690_10085971 Ga0207690_100859714 280
613 3300025933 Ga0207706_10006648 Ga0207706_100066485 280
614 3300025933 Ga0207706_10047748 Ga0207706_100477485 280
615 3300025933 Ga0207706_10140539 Ga0207706_101405393 280
616 3300025933 Ga0207706_10147934 Ga0207706_101479341 280
617 3300025934 Ga0207686_10097603 Ga0207686_100976033 280
618 3300025934 Ga0207686_10365410 Ga0207686_103654102 280
619 3300025935 Ga0207709_10000123 Ga0207709_1000012396 280
620 3300025935 Ga0207709_10000299 Ga0207709_100002999 280
621 3300025935 Ga0207709_10300296 Ga0207709_103002962 280
622 3300025935 Ga0207709_10428996 Ga0207709_104289962 280
623 3300025937 Ga0207669_10000230 Ga0207669_1000023019 280
624 3300025938 Ga0207704_10000021 Ga0207704_1000002131 280
625 3300025941 Ga0207711_10005756 Ga0207711_100057569 280
626 3300025941 Ga0207711_10008938 Ga0207711_100089383 280
627 3300025941 Ga0207711_10026559 Ga0207711_100265592 280
628 3300025941 Ga0207711_10411374 Ga0207711_104113742 280
629 3300025942 Ga0207689_10000132 Ga0207689_1000013230 280
630 3300025944 Ga0207661_10511129 Ga0207661_105111292 280
631 3300025945 Ga0207679_10523028 Ga0207679_105230282 280
632 3300025949 Ga0207667_10000010 Ga0207667_10000010115 280
633 3300025949 Ga0207667_10000029 Ga0207667_1000002938 280
634 3300025949 Ga0207667_10004694 Ga0207667_1000469412 280
635 3300025949 Ga0207667_10122183 Ga0207667_101221833 280
636 3300025949 Ga0207667_10149916 Ga0207667_101499163 280
637 3300025960 Ga0207651_10000012 Ga0207651_1000001291 280
638 3300025960 Ga0207651_10200065 Ga0207651_102000651 280
639 3300025961 Ga0207712_10000030 Ga0207712_10000030112 280
640 3300025961 Ga0207712_10000046 Ga0207712_10000046137 280
641 3300025961 Ga0207712_10059600 Ga0207712_100596002 280
642 3300025972 Ga0207668_10017042 Ga0207668_100170424 280
643 3300025972 Ga0207668_10123084 Ga0207668_101230842 280
644 3300025972 Ga0207668_10183025 Ga0207668_101830251 280
645 3300025972 Ga0207668_10398703 Ga0207668_103987032 280
646 3300025981 Ga0207640_10000021 Ga0207640_1000002141 280
647 3300025981 Ga0207640_10001341 Ga0207640_1000134112 280
648 3300025981 Ga0207640_10007006 Ga0207640_100070063 280
649 3300025981 Ga0207640_10103477 Ga0207640_101034772 280
650 3300025981 Ga0207640_10281135 Ga0207640_102811352 280
651 3300025981 Ga0207640_10551790 Ga0207640_105517901 280
652 3300025986 Ga0207658_10000333 Ga0207658_1000033329 280
653 3300025986 Ga0207658_10007736 Ga0207658_100077362 280
654 3300026023 Ga0207677_10000170 Ga0207677_1000017019 280
655 3300026023 Ga0207677_10282750 Ga0207677_102827502 280
656 3300026035 Ga0207703_10000050 Ga0207703_100000508 280
657 3300026035 Ga0207703_10000665 Ga0207703_1000066530 280
658 3300026035 Ga0207703_10000948 Ga0207703_100009486 280
659 3300026035 Ga0207703_10001637 Ga0207703_1000163717 280
660 3300026041 Ga0207639_10011454 Ga0207639_100114542 280
661 3300026041 Ga0207639_10014903 Ga0207639_100149034 280
662 3300026041 Ga0207639_10034145 Ga0207639_100341453 280
663 3300026041 Ga0207639_10052337 Ga0207639_100523373 280
664 3300026041 Ga0207639_10240416 Ga0207639_102404162 280
665 3300026041 Ga0207639_10275067 Ga0207639_102750672 280
666 3300026067 Ga0207678_10000400 Ga0207678_1000040038 280
667 3300026067 Ga0207678_10002548 Ga0207678_1000254810 280
668 3300026067 Ga0207678_10003044 Ga0207678_100030448 280
669 3300026067 Ga0207678_10003534 Ga0207678_100035346 280
670 3300026067 Ga0207678_10064027 Ga0207678_100640272 280
671 3300026078 Ga0207702_10001123 Ga0207702_1000112326 280
672 3300026078 Ga0207702_10001257 Ga0207702_100012579 280
673 3300026078 Ga0207702_10004107 Ga0207702_1000410710 280
674 3300026078 Ga0207702_10004976 Ga0207702_100049765 280
675 3300026078 Ga0207702_10067961 Ga0207702_100679614 280
676 3300026078 Ga0207702_10271500 Ga0207702_102715001 280
677 3300026088 Ga0207641_10000063 Ga0207641_1000006337 280
678 3300026088 Ga0207641_10000118 Ga0207641_10000118111 280
679 3300026089 Ga0207648_10000051 Ga0207648_1000005162 280
680 3300026095 Ga0207676_10000312 Ga0207676_1000031231 280
681 3300026095 Ga0207676_10000362 Ga0207676_100003626 280
682 3300026095 Ga0207676_10001060 Ga0207676_100010609 280
683 3300026095 Ga0207676_10001111 Ga0207676_1000111118 280
684 3300026116 Ga0207674_10008204 Ga0207674_1000820412 280
685 3300026116 Ga0207674_10022081 Ga0207674_100220813 280
686 3300026116 Ga0207674_10038184 Ga0207674_100381845 280
687 3300026116 Ga0207674_10094103 Ga0207674_100941032 280
688 3300026116 Ga0207674_10123014 Ga0207674_101230143 280
689 3300026121 Ga0207683_10000449 Ga0207683_1000044929 280
690 3300026142 Ga0207698_10000019 Ga0207698_1000001910 280
691 3300026142 Ga0207698_10000595 Ga0207698_1000059517 280
692 3300026142 Ga0207698_10004840 Ga0207698_100048406 280
693 3300026142 Ga0207698_10032269 Ga0207698_100322692 280
694 3300026142 Ga0207698_10194280 Ga0207698_101942803 280
695 3300026142 Ga0207698_10358874 Ga0207698_103588742 280
696 3300027866 Ga0209813_10000040 Ga0209813_1000004047 280
697 3300027876 Ga0209974_10065527 Ga0209974_100655271 280
698 3300027907 Ga0207428_10010319 Ga0207428_100103196 280
699 3300028379 Ga0268266_10000063 Ga0268266_1000006393 280
700 3300028379 Ga0268266_10000066 Ga0268266_10000066194 280
701 3300028379 Ga0268266_10070145 Ga0268266_100701453 280
702 3300028379 Ga0268266_10168697 Ga0268266_101686972 280
703 3300028380 Ga0268265_10001366 Ga0268265_100013669 280
704 3300028380 Ga0268265_10063532 Ga0268265_100635324 280
705 3300028381 Ga0268264_10000130 Ga0268264_10000130156 280
706 3300028786 Ga0307517_10028837 Ga0307517_100288373 280
707 3300028786 Ga0307517_10033389 Ga0307517_100333894 280
708 3300028786 Ga0307517_10129486 Ga0307517_101294862 280
709 3300028800 Ga0265338_10010111 Ga0265338_100101117 280
710 3300031251 Ga0265327_10001037 Ga0265327_1000103718 280
711 3300031251 Ga0265327_10052803 Ga0265327_100528032 280
712 3300031456 Ga0307513_10030702 Ga0307513_100307025 280
713 3300031616 Ga0307508_10002212 Ga0307508_100022126 280
714 3300031711 Ga0265314_10000565 Ga0265314_1000056511 280
715 3300031712 Ga0265342_10001962 Ga0265342_1000196211 280
716 3300031730 Ga0307516_10000427 Ga0307516_1000042712 280
717 3300031731 Ga0307405_10003283 Ga0307405_100032832 280
718 3300031824 Ga0307413_10171546 Ga0307413_101715461 280
719 3300031911 Ga0307412_10000470 Ga0307412_1000047017 280
720 3300031911 Ga0307412_10009099 Ga0307412_100090992 280
721 3300031911 Ga0307412_10014154 Ga0307412_100141543 280
722 3300031911 Ga0307412_10016021 Ga0307412_100160215 280
723 3300031911 Ga0307412_10205603 Ga0307412_102056032 280
724 3300032004 Ga0307414_10000390 Ga0307414_1000039013 280
725 3300032004 Ga0307414_10000984 Ga0307414_100009844 280
726 3300032004 Ga0307414_10024875 Ga0307414_100248753 280
727 3300032004 Ga0307414_10481750 Ga0307414_104817502 280
728 3300033180 Ga0307510_10101383 Ga0307510_101013833 280
729 3300035398 Ga0316574_0082162 Ga0316574_0082162_1090_1935 280
730 3300035691 Ga0373931_0055613 Ga0373931_0055613_878_1723 280
731 3300035724 Ga0373933_0231521 Ga0373933_0231521_232_1083 280
732 3300035725 Ga0373947_0224754 Ga0373947_0224754_186_1028 280
733 3300036401 Ga0373937_0285570 Ga0373937_0285570_354_1226 280
734 3300037068 Ga0373925_0017278 Ga0373925_0017278_640_1482 280
735 3300037312 Ga0395899_0100903 Ga0395899_0100903_105_950 280
736 3300037312 Ga0395899_0105521 Ga0395899_0105521_1090_1986 280
737 3300037312 Ga0395899_0120549 Ga0395899_0120549_346_1188 280
738 3300037418 Ga0395900_0001466 Ga0395900_0001466_124_1020 280
739 3300037418 Ga0395900_0017250 Ga0395900_0017250_4666_5508 280
740 3300037418 Ga0395900_0386517 Ga0395900_0386517_438_1283 280
741 3300037466 Ga0395898_0055931 Ga0395898_0055931_744_1586 280
742 3300037466 Ga0395898_0069062 Ga0395898_0069062_1902_2798 280
743 3300037466 Ga0395898_0322527 Ga0395898_0322527_551_1396 280
744 3300037471 Ga0395905_0000335 Ga0395905_0000335_28997_29893 280
745 3300037471 Ga0395905_0003607 Ga0395905_0003607_7758_8654 280
746 3300037471 Ga0395905_0035512 Ga0395905_0035512_3023_3919 280
747 3300037471 Ga0395905_0073570 Ga0395905_0073570_1796_2692 280
748 3300037471 Ga0395905_0102393 Ga0395905_0102393_836_1732 280
749 3300037471 Ga0395905_0455196 Ga0395905_0455196_140_1039 280
750 3300038443 Ga0395901_0031477 Ga0395901_0031477_806_1648 280
751 3300038443 Ga0395901_0052148 Ga0395901_0052148_2870_3766 280
752 3300038443 Ga0395901_0161719 Ga0395901_0161719_1178_2023 280
753 3300038443 Ga0395901_0308758 Ga0395901_0308758_394_1236 280
754 3300041462 Ga0451806_192368 Ga0451806_192368_177_1034 280
755 3300041498 Ga0451841_0006845 Ga0451841_0006845_212_1054 280
756 3300042005 Ga0439448_0017020 Ga0439448_0017020_1111_1953 280
757 3300042005 Ga0439448_0020590 Ga0439448_0020590_1017_1859 280
758 3300042007 Ga0439449_0005387 Ga0439449_0005387_666_1508 280
759 3300042012 Ga0439455_0034219 Ga0439455_0034219_71_913 280
760 3300042157 Ga0439458_0000017 Ga0439458_0000017_24848_25744 280
761 3300042157 Ga0439458_0001648 Ga0439458_0001648_1535_2389 280
762 3300042157 Ga0439458_0003585 Ga0439458_0003585_1225_2067 280
763 3300044658 Ga0466972_0002717 Ga0466972_0002717_1315_2157 280
764 3300044693 Ga0466961_0042863 Ga0466961_0042863_1565_2407 280
765 3300044693 Ga0466961_0207696 Ga0466961_0207696_68_910 280
766 3300044694 Ga0466963_0017972 Ga0466963_0017972_799_1641 280
767 3300044706 Ga0466964_0007648 Ga0466964_0007648_967_1809 280
768 3300044719 Ga0466971_0000962 Ga0466971_0000962_4817_5659 280
769 3300044842 Ga0466957_0103183 Ga0466957_0103183_190_1032 280
770 3300045836 Ga0466958_0069852 Ga0466958_0069852_582_1424 280
771 3300046452 Ga0495617_004384 Ga0495617_004384_3978_4874 280
772 3300046453 Ga0495627_000127 Ga0495627_000127_12537_13433 280
773 3300046453 Ga0495627_002778 Ga0495627_002778_2308_3243 280
774 3300046460 Ga0495638_0000893 Ga0495638_0000893_22013_22879 280
775 3300046471 Ga0495650_0000116 Ga0495650_0000116_111453_112349 280
776 3300046471 Ga0495650_0001253 Ga0495650_0001253_11088_11933 280
777 3300046491 Ga0495584_0025735 Ga0495584_0025735_568_1461 280
778 3300046492 Ga0495585_0001465 Ga0495585_0001465_4195_5091 280
779 3300046506 Ga0495583_0000657 Ga0495583_0000657_14075_14971 280
780 3300046506 Ga0495583_0011117 Ga0495583_0011117_1888_2784 280
781 3300046506 Ga0495583_0023034 Ga0495583_0023034_1324_2220 280
782 3300046506 Ga0495583_0024408 Ga0495583_0024408_881_1777 280
783 3300046507 Ga0495606_0000977 Ga0495606_0000977_821_1714 280
784 3300046507 Ga0495606_0003584 Ga0495606_0003584_2385_3230 280
785 3300046512 Ga0495610_0000041 Ga0495610_0000041_33733_34641 280
786 3300046512 Ga0495610_0002305 Ga0495610_0002305_10699_11595 280
787 3300046512 Ga0495610_0164618 Ga0495610_0164618_79_921 280
788 3300046513 Ga0495616_0087226 Ga0495616_0087226_533_1429 280
789 3300046518 Ga0495631_0089509 Ga0495631_0089509_164_1060 280
790 3300046519 Ga0495632_0000038 Ga0495632_0000038_141355_142287 280
791 3300046520 Ga0495637_0003726 Ga0495637_0003726_561_1454 280
792 3300046520 Ga0495637_0011549 Ga0495637_0011549_2847_3689 280
793 3300046520 Ga0495637_0016583 Ga0495637_0016583_567_1502 280
794 3300046522 Ga0495643_0000004 Ga0495643_0000004_265462_266370 280
795 3300046522 Ga0495643_0000088 Ga0495643_0000088_13353_14246 280
796 3300046522 Ga0495643_0014694 Ga0495643_0014694_983_1876 280
797 3300046522 Ga0495643_0152261 Ga0495643_0152261_175_1068 280
798 3300046522 Ga0495643_0152295 Ga0495643_0152295_28_870 280
799 3300046524 Ga0495648_0000108 Ga0495648_0000108_90214_91107 280
800 3300046524 Ga0495648_0007834 Ga0495648_0007834_7368_8303 280
801 3300046524 Ga0495648_0032071 Ga0495648_0032071_1867_2760 280
802 3300046524 Ga0495648_0224910 Ga0495648_0224910_21_863 280
803 3300046525 Ga0495663_0000013 Ga0495663_0000013_13350_14243 280
804 3300046525 Ga0495663_0005255 Ga0495663_0005255_337_1233 280
805 3300046542 Ga0495597_0033805 Ga0495597_0033805_649_1491 280
806 3300046558 Ga0495633_0000212 Ga0495633_0000212_13477_14370 280
807 3300046558 Ga0495633_0000670 Ga0495633_0000670_17173_18066 280
808 3300046558 Ga0495633_0013362 Ga0495633_0013362_324_1169 280
809 3300046558 Ga0495633_0014845 Ga0495633_0014845_2780_3676 280
810 3300046616 Ga0495668_0000085 Ga0495668_0000085_28954_29847 280
811 3300046616 Ga0495668_0067012 Ga0495668_0067012_693_1535 280
812 3300046660 Ga0495625_0000014 Ga0495625_0000014_254039_254881 280
813 3300046660 Ga0495625_0000072 Ga0495625_0000072_110444_111340 280
814 3300046660 Ga0495625_0005016 Ga0495625_0005016_1245_2141 280
815 3300046660 Ga0495625_0013733 Ga0495625_0013733_1015_1881 280
816 3300046660 Ga0495625_0027330 Ga0495625_0027330_1121_1963 280
817 3300046660 Ga0495625_0063251 Ga0495625_0063251_252_1148 280
818 3300046684 Ga0495669_0000192 Ga0495669_0000192_22349_23245 280
819 3300046684 Ga0495669_0022153 Ga0495669_0022153_633_1475 280
820 3300046689 Ga0495613_0000380 Ga0495613_0000380_36148_37020 280
821 3300046692 Ga0495671_0000048 Ga0495671_0000048_13480_14373 280
822 3300046692 Ga0495671_0009905 Ga0495671_0009905_2590_3471 280
823 3300047323 Ga0495683_0001323 Ga0495683_0001323_2021_2917 280
824 3300047443 Ga0495687_000217 Ga0495687_000217_30317_31213 280
825 3300047443 Ga0495687_000270 Ga0495687_000270_28368_29261 280
826 3300047445 Ga0495677_0003186 Ga0495677_0003186_1915_2808 280
827 3300047445 Ga0495677_0003823 Ga0495677_0003823_2142_3038 280
828 3300047470 Ga0495681_0000022 Ga0495681_0000022_21038_21934 280
829 3300047472 Ga0495686_0000736 Ga0495686_0000736_37531_38436 280
830 3300047472 Ga0495686_0006128 Ga0495686_0006128_1218_2114 280
831 3300047472 Ga0495686_0015268 Ga0495686_0015268_1350_2282 280
832 3300047472 Ga0495686_0019225 Ga0495686_0019225_507_1352 280
833 3300047472 Ga0495686_0050645 Ga0495686_0050645_1264_2196 280
834 3300047472 Ga0495686_0070463 Ga0495686_0070463_26_931 280
835 3300048090 Ga0495615_0000018 Ga0495615_0000018_44895_45806 280
836 3300048903 Ga0496100_0007205 Ga0496100_0007205_2642_3502 280
837 3300048904 Ga0496101_0027708 Ga0496101_0027708_2703_3563 280
838 3300048905 Ga0496102_0000230 Ga0496102_0000230_33905_34801 280
839 3300048905 Ga0496102_0000648 Ga0496102_0000648_24090_24950 280
840 3300048905 Ga0496102_0023975 Ga0496102_0023975_2296_3138 280
841 3300048905 Ga0496102_0099079 Ga0496102_0099079_695_1552 280
842 3300048906 Ga0496103_0000110 Ga0496103_0000110_10176_11036 280
843 3300048906 Ga0496103_0000200 Ga0496103_0000200_38171_39067 280
844 3300048906 Ga0496103_0002993 Ga0496103_0002993_2414_3256 280
845 3300048906 Ga0496103_0051853 Ga0496103_0051853_109_966 280
846 3300048907 Ga0496104_0000047 Ga0496104_0000047_79078_79938 280
847 3300048907 Ga0496104_0023430 Ga0496104_0023430_4738_5634 280
848 3300048907 Ga0496104_0093584 Ga0496104_0093584_1106_1948 280
849 3300048908 Ga0496105_0000081 Ga0496105_0000081_59217_60077 280
850 3300048908 Ga0496105_0008602 Ga0496105_0008602_6848_7744 280
851 3300048909 Ga0496106_0382945 Ga0496106_0382945_227_1069 280
852 3300048910 Ga0496107_0025653 Ga0496107_0025653_1029_1871 280
853 3300048911 Ga0496108_0003387 Ga0496108_0003387_5511_6356 280
854 3300048913 Ga0496110_0213150 Ga0496110_0213150_693_1535 280
855 3300048913 Ga0496110_0308948 Ga0496110_0308948_429_1325 280
856 3300048915 Ga0496112_0073551 Ga0496112_0073551_1572_2432 280
857 3300048916 Ga0496113_0000020 Ga0496113_0000020_12286_13146 280
858 3300048918 Ga0496115_0000173 Ga0496115_0000173_38201_39097 280
859 3300048918 Ga0496115_0097188 Ga0496115_0097188_814_1686 280
860 3300048919 Ga0496116_0035405 Ga0496116_0035405_50_895 280
861 3300048919 Ga0496116_0047529 Ga0496116_0047529_911_1753 280
862 3300048920 Ga0496117_0000670 Ga0496117_0000670_15841_16737 280
863 3300048920 Ga0496117_0006958 Ga0496117_0006958_446_1297 280
864 3300048920 Ga0496117_0010423 Ga0496117_0010423_6951_7793 280
865 3300048920 Ga0496117_0014334 Ga0496117_0014334_642_1502 280
866 3300048921 Ga0496118_0000592 Ga0496118_0000592_38202_39098 280
867 3300048921 Ga0496118_0006353 Ga0496118_0006353_7728_8579 280
868 3300048921 Ga0496118_0082566 Ga0496118_0082566_956_1822 280
869 3300048921 Ga0496118_0084510 Ga0496118_0084510_398_1240 280
870 3300048922 Ga0496119_0000699 Ga0496119_0000699_31033_31893 280
871 3300048922 Ga0496119_0008055 Ga0496119_0008055_2060_2956 280
872 3300048922 Ga0496119_0016331 Ga0496119_0016331_4654_5505 280
873 3300048922 Ga0496119_0124694 Ga0496119_0124694_75_920 280
874 3300048923 Ga0496120_0001199 Ga0496120_0001199_21855_22715 280
875 3300048923 Ga0496120_0005962 Ga0496120_0005962_2150_2995 280
876 3300048923 Ga0496120_0008143 Ga0496120_0008143_345_1241 280
877 3300048924 Ga0496121_0000009 Ga0496121_0000009_398254_399105 280
878 3300048924 Ga0496121_0000176 Ga0496121_0000176_80947_81831 280
879 3300048924 Ga0496121_0000295 Ga0496121_0000295_38071_38967 280
880 3300048924 Ga0496121_0000670 Ga0496121_0000670_8064_8909 280
881 3300048924 Ga0496121_0005579 Ga0496121_0005579_11437_12297 280
882 3300048924 Ga0496121_0042811 Ga0496121_0042811_490_1332 280
883 3300048924 Ga0496121_0081751 Ga0496121_0081751_396_1238 280
884 3300048925 Ga0496122_0000735 Ga0496122_0000735_53567_54427 280
885 3300048925 Ga0496122_0003067 Ga0496122_0003067_9030_9941 280
886 3300048925 Ga0496122_0006224 Ga0496122_0006224_3232_4125 280
887 3300048925 Ga0496122_0012217 Ga0496122_0012217_3624_4469 280
888 3300048926 Ga0496123_0000362 Ga0496123_0000362_32773_33633 280
889 3300048926 Ga0496123_0000503 Ga0496123_0000503_9001_9912 280
890 3300048926 Ga0496123_0007175 Ga0496123_0007175_6942_7787 280
891 3300048926 Ga0496123_0008453 Ga0496123_0008453_2502_3347 280
892 3300048926 Ga0496123_0021763 Ga0496123_0021763_2652_3545 280
893 3300048926 Ga0496123_0121090 Ga0496123_0121090_29_871 280
894 3300048926 Ga0496123_0178549 Ga0496123_0178549_214_1056 280
895 3300048927 Ga0496124_0000116 Ga0496124_0000116_28180_29025 280
896 3300048927 Ga0496124_0000177 Ga0496124_0000177_106627_107523 280
897 3300048927 Ga0496124_0001084 Ga0496124_0001084_2502_3362 280
898 3300048927 Ga0496124_0002381 Ga0496124_0002381_13268_14113 280
899 3300048927 Ga0496124_0003896 Ga0496124_0003896_8606_9451 280
900 3300048927 Ga0496124_0008630 Ga0496124_0008630_8884_9729 280
901 3300048928 Ga0496125_0000336 Ga0496125_0000336_31888_32781 280
902 3300048928 Ga0496125_0000555 Ga0496125_0000555_22971_23831 280
903 3300048928 Ga0496125_0002945 Ga0496125_0002945_10376_11221 280
904 3300048928 Ga0496125_0018419 Ga0496125_0018419_4620_5465 280
905 3300048928 Ga0496125_0032022 Ga0496125_0032022_3011_3907 280
906 3300048928 Ga0496125_0060032 Ga0496125_0060032_1746_2657 280
907 3300048928 Ga0496125_0213285 Ga0496125_0213285_371_1219 280
908 3300048929 Ga0496126_0000028 Ga0496126_0000028_4556_5416 280
909 3300048929 Ga0496126_0000725 Ga0496126_0000725_38107_39003 280
910 3300048929 Ga0496126_0083927 Ga0496126_0083927_503_1348 280
911 3300048929 Ga0496126_0177984 Ga0496126_0177984_659_1504 280
912 3300049513 Ga0501290_000118 Ga0501290_000118_4778_5641 280
913 3300049513 Ga0501290_001907 Ga0501290_001907_1434_2276 280
914 3300049515 Ga0501292_000010 Ga0501292_000010_4109_4972 280
915 3300049516 Ga0501293_000480 Ga0501293_000480_898_1740 280
916 3300049521 Ga0501298_001906 Ga0501298_001906_1948_2790 280
917 3300049522 Ga0501299_014103 Ga0501299_014103_146_988 280
918 3300049523 Ga0501300_000865 Ga0501300_000865_2370_3233 280
919 3300049523 Ga0501300_000897 Ga0501300_000897_1236_2078 280
920 3300049571 Ga0501034_0006776 Ga0501034_0006776_7820_8665 280
921 3300049574 Ga0501038_0058246 Ga0501038_0058246_345_1235 280
922 3300049581 Ga0501047_0002891 Ga0501047_0002891_12385_13227 280
923 3300049587 Ga0501071_0044196 Ga0501071_0044196_1806_2696 280
924 3300049653 Ga0501206_000946 Ga0501206_000946_559_1422 280
925 3300049658 Ga0501211_001628 Ga0501211_001628_95_940 280
926 3300049662 Ga0501222_000177 Ga0501222_000177_994_1857 280
927 3300049663 Ga0501223_000017 Ga0501223_000017_31975_32817 280
928 3300049663 Ga0501223_000107 Ga0501223_000107_8572_9417 280
929 3300049663 Ga0501223_001340 Ga0501223_001340_2188_3051 280
930 3300049664 Ga0501224_000031 Ga0501224_000031_14502_15347 280
931 3300049664 Ga0501224_001407 Ga0501224_001407_888_1751 280
932 3300049668 Ga0501233_000040 Ga0501233_000040_4711_5556 280
933 3300049668 Ga0501233_001211 Ga0501233_001211_2449_3312 280
934 3300049668 Ga0501233_036130 Ga0501233_036130_170_1015 280
935 3300049669 Ga0501235_005127 Ga0501235_005127_1032_1877 280
936 3300049669 Ga0501235_022608 Ga0501235_022608_202_1047 280
937 3300049676 Ga0501246_001831 Ga0501246_001831_515_1357 280
938 3300049686 Ga0501257_000001 Ga0501257_000001_30302_31144 280
939 3300049688 Ga0501259_000145 Ga0501259_000145_4049_4912 280
940 3300049690 Ga0501261_000003 Ga0501261_000003_38015_38878 280
941 3300049705 Ga0501225_0000004 Ga0501225_0000004_16073_16915 280
942 3300049705 Ga0501225_0000070 Ga0501225_0000070_27987_28832 280
943 3300049707 Ga0501234_000164 Ga0501234_000164_3550_4395 280
944 3300049758 Ga0501241_002348 Ga0501241_002348_803_1660 280
945 3300049775 Ga0501279_000007 Ga0501279_000007_64352_65215 280
946 3300049776 Ga0501280_000007 Ga0501280_000007_8897_9760 280
947 3300049776 Ga0501280_000464 Ga0501280_000464_1022_1864 280
948 3300049777 Ga0501281_00034 Ga0501281_00034_2150_3013 280
949 3300049778 Ga0501282_000352 Ga0501282_000352_656_1519 280
950 3300049778 Ga0501282_001648 Ga0501282_001648_681_1535 280
951 3300049823 Ga0501044_0148718 Ga0501044_0148718_79_954 280
952 3300049853 Ga0501226_000051 Ga0501226_000051_20482_21327 280
953 3300050489 nmdc:mga03683_25400_c1 nmdc:mga03683_25400_c1_687_1538 280
954 3300050490 nmdc:mga03n38_1084_c1 nmdc:mga03n38_1084_c1_5065_5913 280
955 3300050493 nmdc:mga0k408_5_c1 nmdc:mga0k408_5_c1_44752_45594 280
956 3300050493 nmdc:mga0k408_63905_c1 nmdc:mga0k408_63905_c1_237_1079 280
957 3300050494 nmdc:mga06z11_132_c1 nmdc:mga06z11_132_c1_4134_4982 280
958 3300050495 nmdc:mga04h51_262_c1 nmdc:mga04h51_262_c1_4134_4982 280
959 3300050496 nmdc:mga07m45_18825_c1 nmdc:mga07m45_18825_c1_2682_3524 280
960 3300050512 nmdc:mga0n895_40845_c1 nmdc:mga0n895_40845_c1_1619_2461 280
961 3300050516 nmdc:mga0sz30_12658_c1 nmdc:mga0sz30_12658_c1_1232_2074 280
962 3300053079 Ga0500610_0000057 Ga0500610_0000057_25463_26356 280
963 3300053087 Ga0500643_000199 Ga0500643_000199_50003_50845 280
964 3300053087 Ga0500643_000221 Ga0500643_000221_23162_24058 280
965 3300053087 Ga0500643_000295 Ga0500643_000295_30244_31086 280
966 3300053090 Ga0500646_0034180 Ga0500646_0034180_71_967 280
967 3300053090 Ga0500646_0056539 Ga0500646_0056539_167_1009 280
968 3300053091 Ga0500647_0018734 Ga0500647_0018734_594_1436 280
969 3300053093 Ga0500651_0000843 Ga0500651_0000843_9122_9964 280
970 3300053096 Ga0500641_0003958 Ga0500641_0003958_4356_5198 280
971 3300053096 Ga0500641_0009125 Ga0500641_0009125_1822_2664 280
972 3300053096 Ga0500641_0033688 Ga0500641_0033688_124_978 280
973 3300053108 Ga0500562_028756 Ga0500562_028756_566_1408 280
974 3300053119 Ga0500595_000150 Ga0500595_000150_11340_12236 280
975 3300053119 Ga0500595_003849 Ga0500595_003849_3175_4020 280
976 3300053119 Ga0500595_048610 Ga0500595_048610_362_1228 280
977 3300053120 Ga0500597_007599 Ga0500597_007599_2361_3203 280
978 3300053121 Ga0500607_000006 Ga0500607_000006_117942_118784 280
979 3300053123 Ga0500614_025073 Ga0500614_025073_267_1109 280
980 3300053125 Ga0500618_000817 Ga0500618_000817_4392_5234 280
981 3300053130 Ga0500642_0001829 Ga0500642_0001829_206_1048 280
982 3300053130 Ga0500642_0026441 Ga0500642_0026441_37_933 280
983 3300053133 Ga0500655_000020 Ga0500655_000020_18376_19218 280
984 3300053136 Ga0500559_0000698 Ga0500559_0000698_2437_3279 280
985 3300053136 Ga0500559_0004182 Ga0500559_0004182_1513_2355 280
986 3300053136 Ga0500559_0027412 Ga0500559_0027412_49_945 280
987 3300053139 Ga0500568_0000916 Ga0500568_0000916_2039_2881 280
988 3300053140 Ga0500573_0000235 Ga0500573_0000235_19015_19926 280
989 3300053142 Ga0500577_0004769 Ga0500577_0004769_1669_2511 280
990 3300053148 Ga0500590_001132 Ga0500590_001132_8490_9332 280
991 3300053148 Ga0500590_010918 Ga0500590_010918_3737_4582 280
992 3300053151 Ga0500604_0000011 Ga0500604_0000011_99379_100221 280
993 3300053153 Ga0500616_0000123 Ga0500616_0000123_120465_121307 280
994 3300053153 Ga0500616_0047289 Ga0500616_0047289_1400_2242 280
995 3300053156 Ga0500622_0001376 Ga0500622_0001376_442_1284 280
996 3300053156 Ga0500622_0006319 Ga0500622_0006319_1910_2752 280
997 3300053157 Ga0500624_000007 Ga0500624_000007_113947_114792 280
998 3300053157 Ga0500624_000032 Ga0500624_000032_36790_37632 280
999 3300053177 Ga0500636_0001312 Ga0500636_0001312_12110_13006 280
1000 3300053178 Ga0500637_0000109 Ga0500637_0000109_1753_2595 280
1001 3300053178 Ga0500637_0002011 Ga0500637_0002011_4731_5573 280
1002 3300053724 Ga0500570_000051 Ga0500570_000051_13078_13920 280
1003 3300053730 Ga0500645_000037 Ga0500645_000037_69810_70706 280
1004 3300053730 Ga0500645_000215 Ga0500645_000215_30244_31086 280
1005 3300053730 Ga0500645_001429 Ga0500645_001429_419_1273 280
1006 3300053730 Ga0500645_006747 Ga0500645_006747_1042_1884 280
1007 3300053730 Ga0500645_012901 Ga0500645_012901_783_1625 280
1008 3300059510 Ga0587090_004497 Ga0587090_004497_25_876 280
1009 3300061719 Ga0466962_0000343 Ga0466962_0000343_13035_13877 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

19

285

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bou-assembly1.cif.gz_D three-dimensional structure of ligab 0.983 3 278
3wku-assembly1.cif.gz_B crystal structure of the anaerobic desb-gallate complex 0.968 3 280
1bou-assembly1.cif.gz_D three-dimensional structure of ligab 0.9657 3 278
3wrb-assembly1.cif.gz_A crystal structure of the anaerobic h124f desb-gallate complex 0.9609 3 280
3wrc-assembly1.cif.gz_A crystal structure of the anaerobic desb-protocatechuate (pca) complex 0.9588 3 280
ID Description Score Start End Superfamily
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9829 3 278 3.40.830.10
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9656 3 278 3.40.830.10
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9526 1 280 3.40.830.10
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8969 1 280 3.40.830.10
af_P0ABR9_4_309_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8178 7 274 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A258WZS1-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9893 1 184 GO:0008198
GO:0051213
AF-A0A3D0WE34-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9884 1 195 GO:0008198
GO:0051213
AF-A0A537VV32-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9858 1 278 GO:0008198
GO:0051213
AF-A0A3N5PII1-F1-model_v4 Glycosyltransferase 0.985 10 151 GO:0006487
GO:0008198
GO:0016491
GO:0016740
AF-A0A1Q4BMP0-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9849 1 279 GO:0008198
GO:0051213

Feature Viewer

pLDDT pTM Quality
91.99 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map