F488096
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1009 | 419 | 966 | 285 |
Family's Representative Sequence
| Representative Sequence | 3300046453|Ga0495627_002778|Ga0495627_002778_2308_3243 |
| Length | 311 |
| Sequence | MMLRLRPRKRIAEMARITAGVASSHVPLLGVASDFNKDRDDYFGPIFAGYDWTREWEKAEKPDVVILVYNDHASAFDMKIIPTFAIGCGERYKSADEGWGPRAVPDVEGHPDLAWHIAQSLVLDEFDMTIINEMDVDHGLTVPLSMMFGKPDAWPCKVVPLAVNVVTYPPPSGNRCWALGEAVRKAVESYPEDLNVQIWGTGGMSHQLQGPRAGLINKEWDNRFLDGLIGDSDHLRRIPHIEYLRETGSEGIEMVMWLVMRGALGKNTRALHRHYHVPCSNTAIGHMVLRPDNGEGLDMTGSDTVTRIAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 4 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 5 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 6 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 7 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 8 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 9 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 10 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 11 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 12 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 13 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 14 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 15 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 16 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 17 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 18 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 19 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 20 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 21 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 22 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 23 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 24 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 25 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 26 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 27 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 28 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 29 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 30 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 31 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 32 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 33 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 34 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 35 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 36 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 37 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 38 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 39 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 40 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 41 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 42 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 43 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 44 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 45 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 46 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 47 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 48 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 49 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 56 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 57 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 64 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 66 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 76 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 85 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 100 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 101 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 108 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 109 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 110 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 111 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 112 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 122 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 136 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 139 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 155 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 227 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 231 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 234 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 235 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 236 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 237 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 238 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 239 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 258 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 260 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 261 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 262 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 263 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 266 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 267 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 268 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 269 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 272 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 324 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 325 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 326 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 327 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 328 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 329 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 330 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 331 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 332 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 333 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 334 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 336 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 337 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 338 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 339 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 340 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 341 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 351 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 352 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 353 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 354 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 355 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 356 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 357 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 358 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 359 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 360 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 361 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 363 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 365 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 366 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 367 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 368 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 371 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 374 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 376 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 379 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 381 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 382 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 383 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 384 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 385 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 386 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 387 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 389 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 391 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 392 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 393 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 394 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 395 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 397 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 398 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 400 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 402 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 403 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 404 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 405 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 406 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 408 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 409 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 410 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 412 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 413 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 414 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 415 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 416 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 419 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.73 |
| Metatranscriptomes | 0.1 |
| Isolates | 3.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11 |
| Nodule | 0.1 |
| Rhizoplane | 3.67 |
| Rhizosphere | 74.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_728105 | 2162886006 | Bacteria | 2634 |
| 2 | SwRhRL2b_contig_1724569 | 2162886007 | Bacteria | 3176 |
| 3 | SwRhRL2b_contig_2992305 | 2162886007 | Bacteria | 3968 |
| 4 | SwRhRL2b_contig_3826517 | 2162886007 | Bacteria | 1445 |
| 5 | SwRhRL2b_contig_58648 | 2162886007 | Bacteria | 3931 |
| 6 | ARcpr5yngRDRAFT_c001119 | 3300000043 | Bacteria | 3027 |
| 7 | JGI24736J21556_1000628 | 3300001904 | Bacteria | 6467 |
| 8 | JGI24741J21665_1000412 | 3300001915 | Bacteria | 12949 |
| 9 | JGI24741J21665_1001567 | 3300001915 | Bacteria | 6451 |
| 10 | JGI24741J21665_1007882 | 3300001915 | Bacteria | 2041 |
| 11 | JGI24752J21851_1000508 | 3300001976 | Bacteria | 5224 |
| 12 | JGI24740J21852_10001161 | 3300001979 | Bacteria | 11888 |
| 13 | JGI24740J21852_10002608 | 3300001979 | Bacteria | 8132 |
| 14 | JGI24740J21852_10002728 | 3300001979 | Bacteria | 7892 |
| 15 | JGI24740J21852_10044008 | 3300001979 | Bacteria | 1328 |
| 16 | JGI24739J22299_10000474 | 3300001989 | Bacteria | 14136 |
| 17 | JGI24739J22299_10000894 | 3300001989 | Bacteria | 11018 |
| 18 | JGI24739J22299_10002269 | 3300001989 | Bacteria | 7393 |
| 19 | JGI24739J22299_10043286 | 3300001989 | Bacteria | 1489 |
| 20 | JGI24737J22298_10000777 | 3300001990 | Bacteria | 11301 |
| 21 | JGI24737J22298_10004720 | 3300001990 | Bacteria | 4733 |
| 22 | JGI24737J22298_10022827 | 3300001990 | Bacteria | 1987 |
| 23 | JGI24735J21928_10001703 | 3300002067 | Bacteria | 7770 |
| 24 | JGI24735J21928_10007611 | 3300002067 | Bacteria | 3529 |
| 25 | JGI24735J21928_10012271 | 3300002067 | Bacteria | 2710 |
| 26 | JGI24750J21931_1000309 | 3300002070 | Bacteria | 8402 |
| 27 | JGI24750J21931_1000672 | 3300002070 | Bacteria | 5030 |
| 28 | JGI24748J21848_1000084 | 3300002074 | Bacteria | 28101 |
| 29 | JGI24748J21848_1000110 | 3300002074 | Bacteria | 17278 |
| 30 | JGI24748J21848_1001561 | 3300002074 | Bacteria | 2545 |
| 31 | JGI24738J21930_10000342 | 3300002075 | Bacteria | 12775 |
| 32 | JGI24738J21930_10001583 | 3300002075 | Bacteria | 6266 |
| 33 | JGI24738J21930_10002238 | 3300002075 | Bacteria | 5135 |
| 34 | JGI24738J21930_10002496 | 3300002075 | Bacteria | 4792 |
| 35 | JGI24749J21850_1000368 | 3300002076 | Bacteria | 6725 |
| 36 | JGI24749J21850_1000467 | 3300002076 | Bacteria | 5986 |
| 37 | JGI24749J21850_1001980 | 3300002076 | Bacteria | 2891 |
| 38 | JGI24744J21845_10002073 | 3300002077 | Bacteria | 4062 |
| 39 | JGI24034J26672_10000018 | 3300002239 | Bacteria | 130180 |
| 40 | JGI24742J22300_10002759 | 3300002244 | Bacteria | 2828 |
| 41 | JGI24742J22300_10009297 | 3300002244 | Bacteria | 1622 |
| 42 | JGI24751J29686_10000254 | 3300002459 | Bacteria | 20892 |
| 43 | JGI24751J29686_10000437 | 3300002459 | Bacteria | 12906 |
| 44 | JGI25165J46597_1000021 | 3300003214 | Bacteria | 359288 |
| 45 | JGI25153J46596_10000006 | 3300003215 | Bacteria | 447760 |
| 46 | JGI25153J46596_10002634 | 3300003215 | Bacteria | 10258 |
| 47 | Ga0055526_1000009 | 3300003771 | Bacteria | 257259 |
| 48 | Ga0055537_1000650 | 3300003773 | Bacteria | 18342 |
| 49 | Ga0055524_1000115 | 3300003775 | Bacteria | 94326 |
| 50 | Ga0055534_1003258 | 3300003784 | Bacteria | 5181 |
| 51 | Ga0055530_10004411 | 3300003791 | Bacteria | 7247 |
| 52 | Ga0055531_10000961 | 3300003794 | Bacteria | 23107 |
| 53 | Ga0065165_1002167 | 3300005262 | Bacteria | 17747 |
| 54 | Ga0065165_1003474 | 3300005262 | Bacteria | 11005 |
| 55 | Ga0065165_1005126 | 3300005262 | Bacteria | 7588 |
| 56 | Ga0065704_10000815 | 3300005289 | Bacteria | 12109 |
| 57 | Ga0065704_10001087 | 3300005289 | Bacteria | 9633 |
| 58 | Ga0065704_10070333 | 3300005289 | Bacteria | 31916 |
| 59 | Ga0065704_10070525 | 3300005289 | Bacteria | 21766 |
| 60 | Ga0065704_10082208 | 3300005289 | Bacteria | 3637 |
| 61 | Ga0065704_10105062 | 3300005289 | Bacteria | 2122 |
| 62 | Ga0065704_10105224 | 3300005289 | Bacteria | 2117 |
| 63 | Ga0065704_10122357 | 3300005289 | Bacteria | 1750 |
| 64 | Ga0065707_10000429 | 3300005295 | Bacteria | 96496 |
| 65 | Ga0065707_10001250 | 3300005295 | Bacteria | 11180 |
| 66 | Ga0065707_10081774 | 3300005295 | Bacteria | 43222 |
| 67 | Ga0065707_10082048 | 3300005295 | Bacteria | 23588 |
| 68 | Ga0065707_10082823 | 3300005295 | Bacteria | 11874 |
| 69 | Ga0065707_10087646 | 3300005295 | Bacteria | 4939 |
| 70 | Ga0065707_10090188 | 3300005295 | Bacteria | 4192 |
| 71 | Ga0065707_10091077 | 3300005295 | Bacteria | 4008 |
| 72 | Ga0065707_10101741 | 3300005295 | Bacteria | 2847 |
| 73 | Ga0065707_10115320 | 3300005295 | Bacteria | 2270 |
| 74 | Ga0070658_10000167 | 3300005327 | Bacteria | 57334 |
| 75 | Ga0070658_10001013 | 3300005327 | Bacteria | 24091 |
| 76 | Ga0070658_10005110 | 3300005327 | Bacteria | 10681 |
| 77 | Ga0070658_10011645 | 3300005327 | Bacteria | 7054 |
| 78 | Ga0070658_10012920 | 3300005327 | Bacteria | 6703 |
| 79 | Ga0070658_10064528 | 3300005327 | Bacteria | 2987 |
| 80 | Ga0070658_10157304 | 3300005327 | Bacteria | 1905 |
| 81 | Ga0070658_10325650 | 3300005327 | Bacteria | 1313 |
| 82 | Ga0070676_10000192 | 3300005328 | Bacteria | 25516 |
| 83 | Ga0070676_10057017 | 3300005328 | Bacteria | 2310 |
| 84 | Ga0070683_100418141 | 3300005329 | Bacteria | 1279 |
| 85 | Ga0070690_100000008 | 3300005330 | Bacteria | 118441 |
| 86 | Ga0070690_100000212 | 3300005330 | Bacteria | 30301 |
| 87 | Ga0070670_100000339 | 3300005331 | Bacteria | 39253 |
| 88 | Ga0070670_100098177 | 3300005331 | Bacteria | 2520 |
| 89 | Ga0070670_100330408 | 3300005331 | Bacteria | 1337 |
| 90 | Ga0068869_100000163 | 3300005334 | Bacteria | 33165 |
| 91 | Ga0070666_10000032 | 3300005335 | Bacteria | 129142 |
| 92 | Ga0070666_10326247 | 3300005335 | Bacteria | 1095 |
| 93 | Ga0068868_100001386 | 3300005338 | Bacteria | 16724 |
| 94 | Ga0068868_100138869 | 3300005338 | Bacteria | 1993 |
| 95 | Ga0070660_100000222 | 3300005339 | Bacteria | 37567 |
| 96 | Ga0070660_100038822 | 3300005339 | Bacteria | 3616 |
| 97 | Ga0070660_100045768 | 3300005339 | Bacteria | 3351 |
| 98 | Ga0070660_100070757 | 3300005339 | Bacteria | 2722 |
| 99 | Ga0070660_100121179 | 3300005339 | Bacteria | 2087 |
| 100 | Ga0070689_100001547 | 3300005340 | Bacteria | 14657 |
| 101 | Ga0070661_100000327 | 3300005344 | Bacteria | 38235 |
| 102 | Ga0070661_100274660 | 3300005344 | Bacteria | 1306 |
| 103 | Ga0070661_100380887 | 3300005344 | Bacteria | 1112 |
| 104 | Ga0070668_100005438 | 3300005347 | Bacteria | 9456 |
| 105 | Ga0070668_100023619 | 3300005347 | Bacteria | 4652 |
| 106 | Ga0070668_100073194 | 3300005347 | Bacteria | 2671 |
| 107 | Ga0070668_100080184 | 3300005347 | Bacteria | 2557 |
| 108 | Ga0070668_100219096 | 3300005347 | Bacteria | 1569 |
| 109 | Ga0070669_100000143 | 3300005353 | Bacteria | 64072 |
| 110 | Ga0070669_100000345 | 3300005353 | Bacteria | 36221 |
| 111 | Ga0070669_100001464 | 3300005353 | Bacteria | 17088 |
| 112 | Ga0070669_100002597 | 3300005353 | Bacteria | 13056 |
| 113 | Ga0070669_100013431 | 3300005353 | Bacteria | 5822 |
| 114 | Ga0070669_100273297 | 3300005353 | Bacteria | 1352 |
| 115 | Ga0070675_100011917 | 3300005354 | Bacteria | 6814 |
| 116 | Ga0070675_100453006 | 3300005354 | Bacteria | 1151 |
| 117 | Ga0070671_100000093 | 3300005355 | Bacteria | 57157 |
| 118 | Ga0070671_100001928 | 3300005355 | Bacteria | 15902 |
| 119 | Ga0070671_100011033 | 3300005355 | Bacteria | 7251 |
| 120 | Ga0070671_100019820 | 3300005355 | Bacteria | 5479 |
| 121 | Ga0070671_100040801 | 3300005355 | Bacteria | 3856 |
| 122 | Ga0070671_100073254 | 3300005355 | Bacteria | 2861 |
| 123 | Ga0070674_100001288 | 3300005356 | Bacteria | 13200 |
| 124 | Ga0070674_100005654 | 3300005356 | Bacteria | 7247 |
| 125 | Ga0070673_100000011 | 3300005364 | Bacteria | 145332 |
| 126 | Ga0070688_100002657 | 3300005365 | Bacteria | 9073 |
| 127 | Ga0070688_100010545 | 3300005365 | Bacteria | 5101 |
| 128 | Ga0070659_100047972 | 3300005366 | Bacteria | 3353 |
| 129 | Ga0070659_100455523 | 3300005366 | Bacteria | 1086 |
| 130 | Ga0070667_100000210 | 3300005367 | Bacteria | 68040 |
| 131 | Ga0070667_100000985 | 3300005367 | Bacteria | 26177 |
| 132 | Ga0070667_100041142 | 3300005367 | Bacteria | 3877 |
| 133 | Ga0070667_100227156 | 3300005367 | Bacteria | 1663 |
| 134 | Ga0070667_100297097 | 3300005367 | Bacteria | 1454 |
| 135 | Ga0070711_100324583 | 3300005439 | Bacteria | 1231 |
| 136 | Ga0070705_100058364 | 3300005440 | Bacteria | 2281 |
| 137 | Ga0070663_100000422 | 3300005455 | Bacteria | 22325 |
| 138 | Ga0070663_100001266 | 3300005455 | Bacteria | 13895 |
| 139 | Ga0070678_100011088 | 3300005456 | Bacteria | 5542 |
| 140 | Ga0070662_100029752 | 3300005457 | Bacteria | 3814 |
| 141 | Ga0070662_100044323 | 3300005457 | Bacteria | 3186 |
| 142 | Ga0070662_100049006 | 3300005457 | Bacteria | 3045 |
| 143 | Ga0070681_10008671 | 3300005458 | Bacteria | 9971 |
| 144 | Ga0068867_100000049 | 3300005459 | Bacteria | 72604 |
| 145 | Ga0070685_10000774 | 3300005466 | Bacteria | 17387 |
| 146 | Ga0070685_10003150 | 3300005466 | Bacteria | 8381 |
| 147 | Ga0070698_100032618 | 3300005471 | Bacteria | 5394 |
| 148 | Ga0070679_100361108 | 3300005530 | Bacteria | 1400 |
| 149 | Ga0070684_100174406 | 3300005535 | Bacteria | 1954 |
| 150 | Ga0070684_100237583 | 3300005535 | Bacteria | 1664 |
| 151 | Ga0068853_100027452 | 3300005539 | Bacteria | 4783 |
| 152 | Ga0068853_100126808 | 3300005539 | Bacteria | 2281 |
| 153 | Ga0068853_100178407 | 3300005539 | Bacteria | 1925 |
| 154 | Ga0068853_100376794 | 3300005539 | Bacteria | 1324 |
| 155 | Ga0070672_100017723 | 3300005543 | Bacteria | 5132 |
| 156 | Ga0070686_100000030 | 3300005544 | Bacteria | 118308 |
| 157 | Ga0070686_100000331 | 3300005544 | Bacteria | 30636 |
| 158 | Ga0070665_100000011 | 3300005548 | Bacteria | 525539 |
| 159 | Ga0070665_100000056 | 3300005548 | Bacteria | 242622 |
| 160 | Ga0070665_100000169 | 3300005548 | Bacteria | 118043 |
| 161 | Ga0070665_100000226 | 3300005548 | Bacteria | 94176 |
| 162 | Ga0070665_100000532 | 3300005548 | Bacteria | 53844 |
| 163 | Ga0070665_100089019 | 3300005548 | Bacteria | 3093 |
| 164 | Ga0070665_100239550 | 3300005548 | Bacteria | 1815 |
| 165 | Ga0070665_100296005 | 3300005548 | Bacteria | 1621 |
| 166 | Ga0068855_100000265 | 3300005563 | Bacteria | 65271 |
| 167 | Ga0068855_100002478 | 3300005563 | Bacteria | 22773 |
| 168 | Ga0068855_100032538 | 3300005563 | Bacteria | 6226 |
| 169 | Ga0068855_100309074 | 3300005563 | Bacteria | 1749 |
| 170 | Ga0068855_100429644 | 3300005563 | Bacteria | 1444 |
| 171 | Ga0068855_100437920 | 3300005563 | Bacteria | 1428 |
| 172 | Ga0068855_100508820 | 3300005563 | Bacteria | 1308 |
| 173 | Ga0070664_100105392 | 3300005564 | Bacteria | 2456 |
| 174 | Ga0070664_100253589 | 3300005564 | Bacteria | 1582 |
| 175 | Ga0070664_100404610 | 3300005564 | Bacteria | 1248 |
| 176 | Ga0068857_100039516 | 3300005577 | Bacteria | 4179 |
| 177 | Ga0068857_100041607 | 3300005577 | Bacteria | 4075 |
| 178 | Ga0068857_100113403 | 3300005577 | Bacteria | 2437 |
| 179 | Ga0068857_100132375 | 3300005577 | Bacteria | 2250 |
| 180 | Ga0068857_100135121 | 3300005577 | Bacteria | 2226 |
| 181 | Ga0068854_100000405 | 3300005578 | Bacteria | 27114 |
| 182 | Ga0068854_100004023 | 3300005578 | Bacteria | 9227 |
| 183 | Ga0068854_100079912 | 3300005578 | Bacteria | 2412 |
| 184 | Ga0068854_100264040 | 3300005578 | Bacteria | 1379 |
| 185 | Ga0068856_100004268 | 3300005614 | Bacteria | 14272 |
| 186 | Ga0068856_100005115 | 3300005614 | Bacteria | 12961 |
| 187 | Ga0070702_100443588 | 3300005615 | Bacteria | 940 |
| 188 | Ga0068852_100000544 | 3300005616 | Bacteria | 24681 |
| 189 | Ga0068852_100030135 | 3300005616 | Bacteria | 4463 |
| 190 | Ga0068852_100272273 | 3300005616 | Bacteria | 1630 |
| 191 | Ga0068852_100305815 | 3300005616 | Bacteria | 1540 |
| 192 | Ga0068859_100019606 | 3300005617 | Bacteria | 6794 |
| 193 | Ga0068859_100195204 | 3300005617 | Bacteria | 2108 |
| 194 | Ga0068859_100517827 | 3300005617 | Bacteria | 1288 |
| 195 | Ga0068864_100000088 | 3300005618 | Bacteria | 98366 |
| 196 | Ga0068864_100000379 | 3300005618 | Bacteria | 38803 |
| 197 | Ga0068864_100001540 | 3300005618 | Bacteria | 18983 |
| 198 | Ga0068864_100235371 | 3300005618 | Bacteria | 1695 |
| 199 | Ga0068861_100040635 | 3300005719 | Bacteria | 3480 |
| 200 | Ga0068863_100000065 | 3300005841 | Bacteria | 117925 |
| 201 | Ga0068863_100000158 | 3300005841 | Bacteria | 71918 |
| 202 | Ga0068863_100000645 | 3300005841 | Bacteria | 35348 |
| 203 | Ga0068863_100000925 | 3300005841 | Bacteria | 29446 |
| 204 | Ga0068863_100008798 | 3300005841 | Bacteria | 9858 |
| 205 | Ga0068858_100000094 | 3300005842 | Bacteria | 93130 |
| 206 | Ga0068858_100000149 | 3300005842 | Bacteria | 73242 |
| 207 | Ga0068858_100002113 | 3300005842 | Bacteria | 20168 |
| 208 | Ga0068858_100009628 | 3300005842 | Bacteria | 9210 |
| 209 | Ga0068858_100018905 | 3300005842 | Bacteria | 6447 |
| 210 | Ga0068858_100457179 | 3300005842 | Bacteria | 1231 |
| 211 | Ga0068860_100000132 | 3300005843 | Bacteria | 120657 |
| 212 | Ga0068860_100001798 | 3300005843 | Bacteria | 22829 |
| 213 | Ga0068860_100006559 | 3300005843 | Bacteria | 11684 |
| 214 | Ga0068860_100028234 | 3300005843 | Bacteria | 5401 |
| 215 | Ga0068860_100186099 | 3300005843 | Bacteria | 2008 |
| 216 | Ga0068862_100000095 | 3300005844 | Bacteria | 105957 |
| 217 | Ga0068862_100001939 | 3300005844 | Bacteria | 18783 |
| 218 | Ga0068862_100003339 | 3300005844 | Bacteria | 13854 |
| 219 | Ga0068862_100012900 | 3300005844 | Bacteria | 6911 |
| 220 | Ga0068862_100014185 | 3300005844 | Bacteria | 6607 |
| 221 | Ga0068862_100191054 | 3300005844 | Bacteria | 1843 |
| 222 | Ga0081455_10000072 | 3300005937 | Bacteria | 108040 |
| 223 | Ga0081455_10014422 | 3300005937 | Bacteria | 7749 |
| 224 | Ga0081539_10019600 | 3300005985 | Bacteria | 4620 |
| 225 | Ga0075368_10000367 | 3300006042 | Bacteria | 13288 |
| 226 | Ga0075432_10001680 | 3300006058 | Bacteria | 7288 |
| 227 | Ga0075367_10001292 | 3300006178 | Bacteria | 10596 |
| 228 | Ga0075369_10070024 | 3300006186 | Bacteria | 1543 |
| 229 | Ga0075366_10000082 | 3300006195 | Bacteria | 37102 |
| 230 | Ga0075366_10042459 | 3300006195 | Bacteria | 2692 |
| 231 | Ga0075366_10147536 | 3300006195 | Bacteria | 1424 |
| 232 | Ga0075366_10152320 | 3300006195 | Bacteria | 1400 |
| 233 | Ga0097621_100003864 | 3300006237 | Bacteria | 10378 |
| 234 | Ga0097621_100116871 | 3300006237 | Bacteria | 2259 |
| 235 | Ga0075370_10007132 | 3300006353 | Bacteria | 5673 |
| 236 | Ga0075370_10024315 | 3300006353 | Bacteria | 3346 |
| 237 | Ga0068871_100016763 | 3300006358 | Bacteria | 5529 |
| 238 | Ga0068871_100025482 | 3300006358 | Bacteria | 4602 |
| 239 | Ga0075434_100092271 | 3300006871 | Bacteria | 3030 |
| 240 | Ga0068865_100000012 | 3300006881 | Bacteria | 145314 |
| 241 | Ga0068865_100114330 | 3300006881 | Bacteria | 1996 |
| 242 | Ga0075436_100051150 | 3300006914 | Bacteria | 2851 |
| 243 | Ga0097620_100019605 | 3300006931 | Bacteria | 6794 |
| 244 | Ga0097620_100195213 | 3300006931 | Bacteria | 2108 |
| 245 | Ga0097620_100271514 | 3300006931 | Bacteria | 1788 |
| 246 | Ga0097620_100517802 | 3300006931 | Bacteria | 1288 |
| 247 | Ga0079104_1010088 | 3300006946 | Bacteria | 3141 |
| 248 | Ga0105251_10004488 | 3300009011 | Bacteria | 9471 |
| 249 | Ga0105251_10091874 | 3300009011 | Bacteria | 1394 |
| 250 | Ga0105250_10000014 | 3300009092 | Bacteria | 268458 |
| 251 | Ga0105250_10008693 | 3300009092 | Bacteria | 4302 |
| 252 | Ga0105250_10016341 | 3300009092 | Bacteria | 3026 |
| 253 | Ga0105240_10016880 | 3300009093 | Bacteria | 9866 |
| 254 | Ga0105240_10078124 | 3300009093 | Bacteria | 4076 |
| 255 | Ga0105240_10325764 | 3300009093 | Bacteria | 1750 |
| 256 | Ga0105245_10000097 | 3300009098 | Bacteria | 84528 |
| 257 | Ga0105245_10000529 | 3300009098 | Bacteria | 35001 |
| 258 | Ga0105245_10070673 | 3300009098 | Bacteria | 3168 |
| 259 | Ga0105245_10584711 | 3300009098 | Bacteria | 1141 |
| 260 | Ga0105247_10030374 | 3300009101 | Bacteria | 3275 |
| 261 | Ga0105247_10081818 | 3300009101 | Bacteria | 2037 |
| 262 | Ga0114129_10431909 | 3300009147 | Bacteria | 1730 |
| 263 | Ga0105243_10000164 | 3300009148 | Bacteria | 75666 |
| 264 | Ga0105243_10000297 | 3300009148 | Bacteria | 55019 |
| 265 | Ga0105243_10087297 | 3300009148 | Bacteria | 2560 |
| 266 | Ga0105241_10005018 | 3300009174 | Bacteria | 9772 |
| 267 | Ga0105241_10025210 | 3300009174 | Bacteria | 4420 |
| 268 | Ga0105242_10000645 | 3300009176 | Bacteria | 27285 |
| 269 | Ga0105242_10248497 | 3300009176 | Bacteria | 1602 |
| 270 | Ga0105248_10004976 | 3300009177 | Bacteria | 14689 |
| 271 | Ga0105248_10021768 | 3300009177 | Bacteria | 7103 |
| 272 | Ga0105248_10025690 | 3300009177 | Bacteria | 6550 |
| 273 | Ga0105248_10091229 | 3300009177 | Bacteria | 3432 |
| 274 | Ga0105248_10111946 | 3300009177 | Bacteria | 3079 |
| 275 | Ga0105248_10283139 | 3300009177 | Bacteria | 1866 |
| 276 | Ga0105248_10284510 | 3300009177 | Bacteria | 1861 |
| 277 | Ga0105237_10075160 | 3300009545 | Bacteria | 3370 |
| 278 | Ga0105237_10086697 | 3300009545 | Bacteria | 3121 |
| 279 | Ga0105238_10017041 | 3300009551 | Bacteria | 7376 |
| 280 | Ga0105238_10129713 | 3300009551 | Bacteria | 2499 |
| 281 | Ga0105238_10394997 | 3300009551 | Bacteria | 1375 |
| 282 | Ga0105249_10000079 | 3300009553 | Bacteria | 139904 |
| 283 | Ga0105249_10000443 | 3300009553 | Bacteria | 38901 |
| 284 | Ga0105249_10021563 | 3300009553 | Bacteria | 5768 |
| 285 | Ga0105148_100197 | 3300009978 | Bacteria | 8818 |
| 286 | Ga0105239_10063344 | 3300010375 | Bacteria | 4060 |
| 287 | Ga0105239_10200749 | 3300010375 | Bacteria | 2234 |
| 288 | Ga0105246_10006686 | 3300011119 | Bacteria | 7048 |
| 289 | Ga0105246_10036288 | 3300011119 | Bacteria | 3301 |
| 290 | Ga0157317_1000219 | 3300012475 | Bacteria | 2086 |
| 291 | Ga0157326_1001312 | 3300012513 | Bacteria | 2752 |
| 292 | Ga0157373_10014308 | 3300013100 | Bacteria | 5816 |
| 293 | Ga0157373_10073403 | 3300013100 | Bacteria | 2414 |
| 294 | Ga0157371_10000024 | 3300013102 | Bacteria | 281202 |
| 295 | Ga0157371_10047887 | 3300013102 | Bacteria | 3039 |
| 296 | Ga0157371_10302742 | 3300013102 | Bacteria | 1158 |
| 297 | Ga0157370_10025702 | 3300013104 | Bacteria | 5826 |
| 298 | Ga0157370_10036824 | 3300013104 | Bacteria | 4746 |
| 299 | Ga0157369_10057118 | 3300013105 | Bacteria | 4211 |
| 300 | Ga0157369_10096183 | 3300013105 | Bacteria | 3160 |
| 301 | Ga0157374_10000936 | 3300013296 | Bacteria | 25437 |
| 302 | Ga0157374_10010980 | 3300013296 | Bacteria | 7821 |
| 303 | Ga0157378_10001079 | 3300013297 | Bacteria | 24942 |
| 304 | Ga0157378_10091580 | 3300013297 | Bacteria | 2765 |
| 305 | Ga0163162_10000458 | 3300013306 | Bacteria | 37802 |
| 306 | Ga0163162_10007763 | 3300013306 | Bacteria | 10454 |
| 307 | Ga0163162_10062932 | 3300013306 | Bacteria | 3751 |
| 308 | Ga0163162_10166472 | 3300013306 | Bacteria | 2328 |
| 309 | Ga0163162_10185255 | 3300013306 | Bacteria | 2209 |
| 310 | Ga0163162_10442795 | 3300013306 | Bacteria | 1431 |
| 311 | Ga0163162_10601930 | 3300013306 | Bacteria | 1225 |
| 312 | Ga0163162_10914008 | 3300013306 | Bacteria | 990 |
| 313 | Ga0157372_10059106 | 3300013307 | Bacteria | 4287 |
| 314 | Ga0157372_10177386 | 3300013307 | Bacteria | 2466 |
| 315 | Ga0157375_10000294 | 3300013308 | Bacteria | 45311 |
| 316 | Ga0157375_10381607 | 3300013308 | Bacteria | 1576 |
| 317 | Ga0163163_10123345 | 3300014325 | Bacteria | 2626 |
| 318 | Ga0163163_10220316 | 3300014325 | Bacteria | 1946 |
| 319 | Ga0163163_10486933 | 3300014325 | Bacteria | 1295 |
| 320 | Ga0157380_10000788 | 3300014326 | Bacteria | 19907 |
| 321 | Ga0157380_10003365 | 3300014326 | Bacteria | 10970 |
| 322 | Ga0157380_10013680 | 3300014326 | Bacteria | 5924 |
| 323 | Ga0157380_10017753 | 3300014326 | Bacteria | 5271 |
| 324 | Ga0157380_10032883 | 3300014326 | Bacteria | 3991 |
| 325 | Ga0157380_10058373 | 3300014326 | Bacteria | 3076 |
| 326 | Ga0157379_10000278 | 3300014968 | Bacteria | 40420 |
| 327 | Ga0157379_10010360 | 3300014968 | Bacteria | 8122 |
| 328 | Ga0157379_10041193 | 3300014968 | Bacteria | 4123 |
| 329 | Ga0157379_10113552 | 3300014968 | Bacteria | 2434 |
| 330 | Ga0157376_10000251 | 3300014969 | Bacteria | 37177 |
| 331 | Ga0163161_10000084 | 3300017792 | Bacteria | 93742 |
| 332 | Ga0163161_10001082 | 3300017792 | Bacteria | 20625 |
| 333 | Ga0163161_10140722 | 3300017792 | Bacteria | 1827 |
| 334 | Ga0163161_10155666 | 3300017792 | Bacteria | 1740 |
| 335 | Ga0213876_10006914 | 3300021384 | Bacteria | 6182 |
| 336 | Ga0207672_1000210 | 3300025223 | Bacteria | 8234 |
| 337 | Ga0209674_106031 | 3300025226 | Bacteria | 1702 |
| 338 | Ga0209147_100302 | 3300025229 | Bacteria | 40451 |
| 339 | Ga0209147_100780 | 3300025229 | Bacteria | 15503 |
| 340 | Ga0209437_102017 | 3300025233 | Bacteria | 4155 |
| 341 | Ga0207425_1004019 | 3300025245 | Bacteria | 4520 |
| 342 | Ga0209677_106712 | 3300025253 | Bacteria | 2646 |
| 343 | Ga0209233_1000065 | 3300025261 | Bacteria | 387195 |
| 344 | Ga0209565_1000008 | 3300025263 | Bacteria | 774179 |
| 345 | Ga0209455_1014561 | 3300025272 | Bacteria | 1773 |
| 346 | Ga0209673_1001306 | 3300025273 | Bacteria | 25290 |
| 347 | Ga0209675_1000248 | 3300025291 | Bacteria | 53556 |
| 348 | Ga0209675_1036876 | 3300025291 | Bacteria | 1103 |
| 349 | Ga0209564_1000069 | 3300025295 | Bacteria | 303332 |
| 350 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 351 | Ga0209758_1008432 | 3300025297 | Bacteria | 6677 |
| 352 | Ga0209050_1000299 | 3300025298 | Bacteria | 104017 |
| 353 | Ga0209050_1006717 | 3300025298 | Bacteria | 6723 |
| 354 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 355 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 356 | Ga0209257_1000524 | 3300025304 | Bacteria | 66567 |
| 357 | Ga0207697_10007182 | 3300025315 | Bacteria | 4978 |
| 358 | Ga0207697_10073900 | 3300025315 | Bacteria | 1431 |
| 359 | Ga0207656_10046123 | 3300025321 | Bacteria | 1868 |
| 360 | Ga0207696_1000087 | 3300025711 | Bacteria | 194367 |
| 361 | Ga0207696_1006001 | 3300025711 | Bacteria | 4959 |
| 362 | Ga0207713_1002844 | 3300025735 | Bacteria | 12178 |
| 363 | Ga0207710_10017082 | 3300025900 | Bacteria | 3075 |
| 364 | Ga0207688_10040012 | 3300025901 | Bacteria | 2604 |
| 365 | Ga0207680_10000009 | 3300025903 | Bacteria | 464571 |
| 366 | Ga0207680_10015096 | 3300025903 | Bacteria | 4021 |
| 367 | Ga0207680_10241635 | 3300025903 | Bacteria | 1244 |
| 368 | Ga0207647_10000997 | 3300025904 | Bacteria | 21946 |
| 369 | Ga0207647_10004006 | 3300025904 | Bacteria | 10988 |
| 370 | Ga0207647_10012963 | 3300025904 | Bacteria | 5792 |
| 371 | Ga0207647_10018514 | 3300025904 | Bacteria | 4707 |
| 372 | Ga0207647_10027052 | 3300025904 | Bacteria | 3743 |
| 373 | Ga0207647_10114361 | 3300025904 | Bacteria | 1594 |
| 374 | Ga0207645_10001889 | 3300025907 | Bacteria | 16906 |
| 375 | Ga0207645_10113318 | 3300025907 | Bacteria | 1757 |
| 376 | Ga0207645_10214863 | 3300025907 | Bacteria | 1267 |
| 377 | Ga0207645_10222713 | 3300025907 | Bacteria | 1244 |
| 378 | Ga0207645_10318266 | 3300025907 | Bacteria | 1037 |
| 379 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 380 | Ga0207705_10000018 | 3300025909 | Bacteria | 319792 |
| 381 | Ga0207705_10000366 | 3300025909 | Bacteria | 41006 |
| 382 | Ga0207705_10000816 | 3300025909 | Bacteria | 25494 |
| 383 | Ga0207705_10042421 | 3300025909 | Bacteria | 3266 |
| 384 | Ga0207705_10106866 | 3300025909 | Bacteria | 2064 |
| 385 | Ga0207705_10149239 | 3300025909 | Bacteria | 1751 |
| 386 | Ga0207705_10223750 | 3300025909 | Bacteria | 1430 |
| 387 | Ga0207684_10201298 | 3300025910 | Bacteria | 1718 |
| 388 | Ga0207654_10000319 | 3300025911 | Bacteria | 28813 |
| 389 | Ga0207654_10001192 | 3300025911 | Bacteria | 13947 |
| 390 | Ga0207654_10028014 | 3300025911 | Bacteria | 3068 |
| 391 | Ga0207695_10004104 | 3300025913 | Bacteria | 20021 |
| 392 | Ga0207695_10008455 | 3300025913 | Bacteria | 12888 |
| 393 | Ga0207695_10010364 | 3300025913 | Bacteria | 11407 |
| 394 | Ga0207695_10016957 | 3300025913 | Bacteria | 8499 |
| 395 | Ga0207695_10231605 | 3300025913 | Bacteria | 1751 |
| 396 | Ga0207671_10000800 | 3300025914 | Bacteria | 39901 |
| 397 | Ga0207671_10011333 | 3300025914 | Bacteria | 7262 |
| 398 | Ga0207671_10070919 | 3300025914 | Bacteria | 2598 |
| 399 | Ga0207657_10000606 | 3300025919 | Bacteria | 38130 |
| 400 | Ga0207657_10002728 | 3300025919 | Bacteria | 19014 |
| 401 | Ga0207657_10003773 | 3300025919 | Bacteria | 16105 |
| 402 | Ga0207657_10013446 | 3300025919 | Bacteria | 8029 |
| 403 | Ga0207657_10014710 | 3300025919 | Bacteria | 7620 |
| 404 | Ga0207649_10055431 | 3300025920 | Bacteria | 2471 |
| 405 | Ga0207652_10417777 | 3300025921 | Bacteria | 1210 |
| 406 | Ga0207681_10000086 | 3300025923 | Bacteria | 81919 |
| 407 | Ga0207681_10000512 | 3300025923 | Bacteria | 26921 |
| 408 | Ga0207681_10000789 | 3300025923 | Bacteria | 20864 |
| 409 | Ga0207681_10001567 | 3300025923 | Bacteria | 14708 |
| 410 | Ga0207681_10002247 | 3300025923 | Bacteria | 12274 |
| 411 | Ga0207681_10034479 | 3300025923 | Bacteria | 3328 |
| 412 | Ga0207694_10006783 | 3300025924 | Bacteria | 8694 |
| 413 | Ga0207694_10011155 | 3300025924 | Bacteria | 6785 |
| 414 | Ga0207694_10044196 | 3300025924 | Bacteria | 3440 |
| 415 | Ga0207694_10135189 | 3300025924 | Bacteria | 1979 |
| 416 | Ga0207694_10156565 | 3300025924 | Bacteria | 1838 |
| 417 | Ga0207694_10157367 | 3300025924 | Bacteria | 1834 |
| 418 | Ga0207694_10220676 | 3300025924 | Bacteria | 1546 |
| 419 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 420 | Ga0207650_10093885 | 3300025925 | Bacteria | 2297 |
| 421 | Ga0207650_10285822 | 3300025925 | Bacteria | 1344 |
| 422 | Ga0207659_10027564 | 3300025926 | Bacteria | 3849 |
| 423 | Ga0207659_10180091 | 3300025926 | Bacteria | 1674 |
| 424 | Ga0207687_10000580 | 3300025927 | Bacteria | 24742 |
| 425 | Ga0207687_10002448 | 3300025927 | Bacteria | 12604 |
| 426 | Ga0207700_10196489 | 3300025928 | Bacteria | 1698 |
| 427 | Ga0207644_10000122 | 3300025931 | Bacteria | 57193 |
| 428 | Ga0207644_10000409 | 3300025931 | Bacteria | 28023 |
| 429 | Ga0207644_10002084 | 3300025931 | Bacteria | 12946 |
| 430 | Ga0207644_10020510 | 3300025931 | Bacteria | 4494 |
| 431 | Ga0207644_10216448 | 3300025931 | Bacteria | 1516 |
| 432 | Ga0207690_10000213 | 3300025932 | Bacteria | 44040 |
| 433 | Ga0207690_10005085 | 3300025932 | Bacteria | 7768 |
| 434 | Ga0207690_10085971 | 3300025932 | Bacteria | 2209 |
| 435 | Ga0207706_10006648 | 3300025933 | Bacteria | 10692 |
| 436 | Ga0207706_10047748 | 3300025933 | Bacteria | 3787 |
| 437 | Ga0207706_10140539 | 3300025933 | Bacteria | 2124 |
| 438 | Ga0207706_10147934 | 3300025933 | Bacteria | 2066 |
| 439 | Ga0207686_10097603 | 3300025934 | Bacteria | 1955 |
| 440 | Ga0207686_10365410 | 3300025934 | Bacteria | 1090 |
| 441 | Ga0207709_10000123 | 3300025935 | Bacteria | 115697 |
| 442 | Ga0207709_10000299 | 3300025935 | Bacteria | 54506 |
| 443 | Ga0207709_10300296 | 3300025935 | Bacteria | 1194 |
| 444 | Ga0207709_10428996 | 3300025935 | Bacteria | 1017 |
| 445 | Ga0207670_10001908 | 3300025936 | Bacteria | 10896 |
| 446 | Ga0207669_10000230 | 3300025937 | Bacteria | 25566 |
| 447 | Ga0207669_10368727 | 3300025937 | Bacteria | 1115 |
| 448 | Ga0207704_10000021 | 3300025938 | Bacteria | 148508 |
| 449 | Ga0207711_10005756 | 3300025941 | Bacteria | 10464 |
| 450 | Ga0207711_10008787 | 3300025941 | Bacteria | 8448 |
| 451 | Ga0207711_10008938 | 3300025941 | Bacteria | 8373 |
| 452 | Ga0207711_10014519 | 3300025941 | Bacteria | 6547 |
| 453 | Ga0207711_10026559 | 3300025941 | Bacteria | 4858 |
| 454 | Ga0207711_10135230 | 3300025941 | Bacteria | 2214 |
| 455 | Ga0207711_10411374 | 3300025941 | Bacteria | 1257 |
| 456 | Ga0207689_10000132 | 3300025942 | Bacteria | 63321 |
| 457 | Ga0207661_10511129 | 3300025944 | Bacteria | 1098 |
| 458 | Ga0207679_10523028 | 3300025945 | Bacteria | 1061 |
| 459 | Ga0207667_10000010 | 3300025949 | Bacteria | 477432 |
| 460 | Ga0207667_10000029 | 3300025949 | Bacteria | 329192 |
| 461 | Ga0207667_10004694 | 3300025949 | Bacteria | 16723 |
| 462 | Ga0207667_10122183 | 3300025949 | Bacteria | 2683 |
| 463 | Ga0207667_10149916 | 3300025949 | Bacteria | 2401 |
| 464 | Ga0207667_10503941 | 3300025949 | Bacteria | 1228 |
| 465 | Ga0207651_10000012 | 3300025960 | Bacteria | 189928 |
| 466 | Ga0207651_10200065 | 3300025960 | Bacteria | 1600 |
| 467 | Ga0207712_10000030 | 3300025961 | Bacteria | 216514 |
| 468 | Ga0207712_10000046 | 3300025961 | Bacteria | 162468 |
| 469 | Ga0207712_10059600 | 3300025961 | Bacteria | 2702 |
| 470 | Ga0207668_10015096 | 3300025972 | Bacteria | 4794 |
| 471 | Ga0207668_10017042 | 3300025972 | Bacteria | 4546 |
| 472 | Ga0207668_10017068 | 3300025972 | Bacteria | 4541 |
| 473 | Ga0207668_10123084 | 3300025972 | Bacteria | 1967 |
| 474 | Ga0207668_10183025 | 3300025972 | Bacteria | 1654 |
| 475 | Ga0207668_10398703 | 3300025972 | Bacteria | 1163 |
| 476 | Ga0207640_10000021 | 3300025981 | Bacteria | 168138 |
| 477 | Ga0207640_10001341 | 3300025981 | Bacteria | 13336 |
| 478 | Ga0207640_10007006 | 3300025981 | Bacteria | 6204 |
| 479 | Ga0207640_10103477 | 3300025981 | Bacteria | 2002 |
| 480 | Ga0207640_10281135 | 3300025981 | Bacteria | 1307 |
| 481 | Ga0207640_10551790 | 3300025981 | Bacteria | 968 |
| 482 | Ga0207658_10000333 | 3300025986 | Bacteria | 47363 |
| 483 | Ga0207658_10001804 | 3300025986 | Bacteria | 16035 |
| 484 | Ga0207658_10005994 | 3300025986 | Bacteria | 8308 |
| 485 | Ga0207658_10007736 | 3300025986 | Bacteria | 7323 |
| 486 | Ga0207658_10012892 | 3300025986 | Bacteria | 5708 |
| 487 | Ga0207677_10000170 | 3300026023 | Bacteria | 51603 |
| 488 | Ga0207677_10282750 | 3300026023 | Bacteria | 1363 |
| 489 | Ga0207703_10000050 | 3300026035 | Bacteria | 145849 |
| 490 | Ga0207703_10000665 | 3300026035 | Bacteria | 34309 |
| 491 | Ga0207703_10000948 | 3300026035 | Bacteria | 28101 |
| 492 | Ga0207703_10001637 | 3300026035 | Bacteria | 20186 |
| 493 | Ga0207703_10089780 | 3300026035 | Bacteria | 2581 |
| 494 | Ga0207703_10179687 | 3300026035 | Bacteria | 1867 |
| 495 | Ga0207703_10214866 | 3300026035 | Bacteria | 1716 |
| 496 | Ga0207639_10011454 | 3300026041 | Bacteria | 6161 |
| 497 | Ga0207639_10014903 | 3300026041 | Bacteria | 5476 |
| 498 | Ga0207639_10034145 | 3300026041 | Bacteria | 3757 |
| 499 | Ga0207639_10052337 | 3300026041 | Bacteria | 3111 |
| 500 | Ga0207639_10240416 | 3300026041 | Bacteria | 1574 |
| 501 | Ga0207639_10275067 | 3300026041 | Bacteria | 1479 |
| 502 | Ga0207678_10000400 | 3300026067 | Bacteria | 39732 |
| 503 | Ga0207678_10002548 | 3300026067 | Bacteria | 16597 |
| 504 | Ga0207678_10003044 | 3300026067 | Bacteria | 15167 |
| 505 | Ga0207678_10003534 | 3300026067 | Bacteria | 14062 |
| 506 | Ga0207678_10064027 | 3300026067 | Bacteria | 3159 |
| 507 | Ga0207702_10001123 | 3300026078 | Bacteria | 27335 |
| 508 | Ga0207702_10001257 | 3300026078 | Bacteria | 25552 |
| 509 | Ga0207702_10004107 | 3300026078 | Bacteria | 13062 |
| 510 | Ga0207702_10004976 | 3300026078 | Bacteria | 11672 |
| 511 | Ga0207702_10067961 | 3300026078 | Bacteria | 3060 |
| 512 | Ga0207702_10271500 | 3300026078 | Bacteria | 1600 |
| 513 | Ga0207641_10000063 | 3300026088 | Bacteria | 159283 |
| 514 | Ga0207641_10000118 | 3300026088 | Bacteria | 117721 |
| 515 | Ga0207641_10000632 | 3300026088 | Bacteria | 38419 |
| 516 | Ga0207641_10068073 | 3300026088 | Bacteria | 3051 |
| 517 | Ga0207648_10000051 | 3300026089 | Bacteria | 108363 |
| 518 | Ga0207676_10000264 | 3300026095 | Bacteria | 45636 |
| 519 | Ga0207676_10000312 | 3300026095 | Bacteria | 41651 |
| 520 | Ga0207676_10000362 | 3300026095 | Bacteria | 38788 |
| 521 | Ga0207676_10001060 | 3300026095 | Bacteria | 20944 |
| 522 | Ga0207676_10001111 | 3300026095 | Bacteria | 20352 |
| 523 | Ga0207674_10008204 | 3300026116 | Bacteria | 12102 |
| 524 | Ga0207674_10022081 | 3300026116 | Bacteria | 6841 |
| 525 | Ga0207674_10038184 | 3300026116 | Bacteria | 4989 |
| 526 | Ga0207674_10094103 | 3300026116 | Bacteria | 2983 |
| 527 | Ga0207674_10123014 | 3300026116 | Bacteria | 2560 |
| 528 | Ga0207675_100005849 | 3300026118 | Bacteria | 11749 |
| 529 | Ga0207675_100006391 | 3300026118 | Bacteria | 11164 |
| 530 | Ga0207683_10000449 | 3300026121 | Bacteria | 38134 |
| 531 | Ga0207698_10000019 | 3300026142 | Bacteria | 145910 |
| 532 | Ga0207698_10000595 | 3300026142 | Bacteria | 21136 |
| 533 | Ga0207698_10004840 | 3300026142 | Bacteria | 8246 |
| 534 | Ga0207698_10032269 | 3300026142 | Bacteria | 3792 |
| 535 | Ga0207698_10194280 | 3300026142 | Bacteria | 1811 |
| 536 | Ga0207698_10358874 | 3300026142 | Bacteria | 1379 |
| 537 | Ga0209813_10000040 | 3300027866 | Bacteria | 53861 |
| 538 | Ga0209974_10065527 | 3300027876 | Bacteria | 1233 |
| 539 | Ga0207428_10010319 | 3300027907 | Bacteria | 8349 |
| 540 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 541 | Ga0268266_10000063 | 3300028379 | Bacteria | 253339 |
| 542 | Ga0268266_10000066 | 3300028379 | Bacteria | 242637 |
| 543 | Ga0268266_10000641 | 3300028379 | Bacteria | 47529 |
| 544 | Ga0268266_10001173 | 3300028379 | Bacteria | 32393 |
| 545 | Ga0268266_10070145 | 3300028379 | Bacteria | 3037 |
| 546 | Ga0268266_10101557 | 3300028379 | Bacteria | 2536 |
| 547 | Ga0268266_10168697 | 3300028379 | Bacteria | 1985 |
| 548 | Ga0268265_10001076 | 3300028380 | Bacteria | 24356 |
| 549 | Ga0268265_10001366 | 3300028380 | Bacteria | 20776 |
| 550 | Ga0268265_10001713 | 3300028380 | Bacteria | 17784 |
| 551 | Ga0268265_10003845 | 3300028380 | Bacteria | 10623 |
| 552 | Ga0268265_10063532 | 3300028380 | Bacteria | 2840 |
| 553 | Ga0268264_10000130 | 3300028381 | Bacteria | 181732 |
| 554 | Ga0268264_10001891 | 3300028381 | Bacteria | 19009 |
| 555 | Ga0268264_10003658 | 3300028381 | Bacteria | 13220 |
| 556 | Ga0268264_10015461 | 3300028381 | Bacteria | 6257 |
| 557 | Ga0268264_10063589 | 3300028381 | Bacteria | 3102 |
| 558 | Ga0307517_10028837 | 3300028786 | Bacteria | 6590 |
| 559 | Ga0307517_10033389 | 3300028786 | Bacteria | 5912 |
| 560 | Ga0307517_10129486 | 3300028786 | Bacteria | 1824 |
| 561 | Ga0265338_10010111 | 3300028800 | Bacteria | 11142 |
| 562 | Ga0265327_10001037 | 3300031251 | Bacteria | 39182 |
| 563 | Ga0265327_10052803 | 3300031251 | Bacteria | 2114 |
| 564 | Ga0307513_10030702 | 3300031456 | Bacteria | 6100 |
| 565 | Ga0307408_100430033 | 3300031548 | Bacteria | 1140 |
| 566 | Ga0307508_10002212 | 3300031616 | Bacteria | 20747 |
| 567 | Ga0265314_10000565 | 3300031711 | Bacteria | 47145 |
| 568 | Ga0265342_10001962 | 3300031712 | Bacteria | 18392 |
| 569 | Ga0307516_10000427 | 3300031730 | Bacteria | 55250 |
| 570 | Ga0307405_10003283 | 3300031731 | Bacteria | 7393 |
| 571 | Ga0307405_10010561 | 3300031731 | Bacteria | 4795 |
| 572 | Ga0307413_10147452 | 3300031824 | Bacteria | 1635 |
| 573 | Ga0307413_10171546 | 3300031824 | Bacteria | 1536 |
| 574 | Ga0307406_10024351 | 3300031901 | Bacteria | 3615 |
| 575 | Ga0307412_10000470 | 3300031911 | Bacteria | 24167 |
| 576 | Ga0307412_10009099 | 3300031911 | Bacteria | 5692 |
| 577 | Ga0307412_10014154 | 3300031911 | Bacteria | 4697 |
| 578 | Ga0307412_10016021 | 3300031911 | Bacteria | 4454 |
| 579 | Ga0307412_10205603 | 3300031911 | Bacteria | 1498 |
| 580 | Ga0307414_10000390 | 3300032004 | Bacteria | 23921 |
| 581 | Ga0307414_10000984 | 3300032004 | Bacteria | 14530 |
| 582 | Ga0307414_10024875 | 3300032004 | Bacteria | 3825 |
| 583 | Ga0307414_10481750 | 3300032004 | Bacteria | 1094 |
| 584 | Ga0307510_10101383 | 3300033180 | Bacteria | 2667 |
| 585 | Ga0316574_0082162 | 3300035398 | Bacteria | 2047 |
| 586 | Ga0373931_0055613 | 3300035691 | Bacteria | 2118 |
| 587 | Ga0373933_0190270 | 3300035724 | Bacteria | 1311 |
| 588 | Ga0373933_0231521 | 3300035724 | Bacteria | 1187 |
| 589 | Ga0373947_0224754 | 3300035725 | Bacteria | 1235 |
| 590 | Ga0373937_0285570 | 3300036401 | Bacteria | 1559 |
| 591 | Ga0373925_0000010 | 3300037068 | Bacteria | 229059 |
| 592 | Ga0373925_0017278 | 3300037068 | Bacteria | 5226 |
| 593 | Ga0395899_0100903 | 3300037312 | Bacteria | 2083 |
| 594 | Ga0395899_0105521 | 3300037312 | Bacteria | 2029 |
| 595 | Ga0395899_0120549 | 3300037312 | Bacteria | 1879 |
| 596 | Ga0395899_0146250 | 3300037312 | Bacteria | 1678 |
| 597 | Ga0395900_0001466 | 3300037418 | Bacteria | 28150 |
| 598 | Ga0395900_0017250 | 3300037418 | Bacteria | 7369 |
| 599 | Ga0395900_0323100 | 3300037418 | Bacteria | 1523 |
| 600 | Ga0395900_0386517 | 3300037418 | Bacteria | 1366 |
| 601 | Ga0395898_0010266 | 3300037466 | Bacteria | 9801 |
| 602 | Ga0395898_0055931 | 3300037466 | Bacteria | 3848 |
| 603 | Ga0395898_0069062 | 3300037466 | Bacteria | 3419 |
| 604 | Ga0395898_0072742 | 3300037466 | Bacteria | 3321 |
| 605 | Ga0395898_0322527 | 3300037466 | Bacteria | 1473 |
| 606 | Ga0395905_0000335 | 3300037471 | Bacteria | 67466 |
| 607 | Ga0395905_0003607 | 3300037471 | Bacteria | 16456 |
| 608 | Ga0395905_0035512 | 3300037471 | Bacteria | 4681 |
| 609 | Ga0395905_0073570 | 3300037471 | Bacteria | 3203 |
| 610 | Ga0395905_0102393 | 3300037471 | Bacteria | 2688 |
| 611 | Ga0395905_0455196 | 3300037471 | Bacteria | 1178 |
| 612 | Ga0395901_0031477 | 3300038443 | Bacteria | 5471 |
| 613 | Ga0395901_0052148 | 3300038443 | Bacteria | 4252 |
| 614 | Ga0395901_0161719 | 3300038443 | Bacteria | 2351 |
| 615 | Ga0395901_0308758 | 3300038443 | Bacteria | 1639 |
| 616 | Ga0436365_0712898 | 3300039437 | Bacteria | 6216 |
| 617 | Ga0436362_0783629 | 3300039453 | Bacteria | 1236 |
| 618 | Ga0451806_192368 | 3300041462 | Bacteria | 2312 |
| 619 | Ga0451841_0006845 | 3300041498 | Bacteria | 1876 |
| 620 | Ga0439448_0017020 | 3300042005 | Bacteria | 2217 |
| 621 | Ga0439448_0020590 | 3300042005 | Bacteria | 2042 |
| 622 | Ga0439449_0005387 | 3300042007 | Bacteria | 4903 |
| 623 | Ga0439455_0034219 | 3300042012 | Bacteria | 1277 |
| 624 | Ga0439458_0000017 | 3300042157 | Bacteria | 26142 |
| 625 | Ga0439458_0001648 | 3300042157 | Bacteria | 5579 |
| 626 | Ga0439458_0003585 | 3300042157 | Bacteria | 3617 |
| 627 | Ga0466972_0002717 | 3300044658 | Bacteria | 8753 |
| 628 | Ga0466966_0125352 | 3300044684 | Bacteria | 1575 |
| 629 | Ga0466961_0042863 | 3300044693 | Bacteria | 2900 |
| 630 | Ga0466961_0207696 | 3300044693 | Bacteria | 1209 |
| 631 | Ga0466963_0017972 | 3300044694 | Bacteria | 4412 |
| 632 | Ga0466964_0007648 | 3300044706 | Bacteria | 4044 |
| 633 | Ga0466971_0000962 | 3300044719 | Bacteria | 11823 |
| 634 | Ga0466957_0103183 | 3300044842 | Bacteria | 1800 |
| 635 | Ga0466958_0069852 | 3300045836 | Bacteria | 2148 |
| 636 | Ga0495617_004384 | 3300046452 | Bacteria | 5143 |
| 637 | Ga0495627_000127 | 3300046453 | Bacteria | 92757 |
| 638 | Ga0495627_000162 | 3300046453 | Bacteria | 76049 |
| 639 | Ga0495627_002778 | 3300046453 | Bacteria | 8130 |
| 640 | Ga0495638_0000021 | 3300046460 | Bacteria | 365602 |
| 641 | Ga0495638_0000209 | 3300046460 | Bacteria | 82799 |
| 642 | Ga0495638_0000893 | 3300046460 | Bacteria | 30574 |
| 643 | Ga0495641_0026727 | 3300046461 | Bacteria | 2814 |
| 644 | Ga0495650_0000116 | 3300046471 | Bacteria | 189814 |
| 645 | Ga0495650_0001253 | 3300046471 | Bacteria | 26207 |
| 646 | Ga0495584_0025735 | 3300046491 | Bacteria | 2983 |
| 647 | Ga0495585_0001465 | 3300046492 | Bacteria | 18468 |
| 648 | Ga0495596_0000042 | 3300046500 | Bacteria | 90746 |
| 649 | Ga0495596_0001157 | 3300046500 | Bacteria | 15510 |
| 650 | Ga0495607_0010179 | 3300046501 | Bacteria | 6327 |
| 651 | Ga0495583_0000184 | 3300046506 | Bacteria | 105978 |
| 652 | Ga0495583_0000657 | 3300046506 | Bacteria | 45442 |
| 653 | Ga0495583_0000840 | 3300046506 | Bacteria | 37393 |
| 654 | Ga0495583_0011117 | 3300046506 | Bacteria | 5187 |
| 655 | Ga0495583_0023034 | 3300046506 | Bacteria | 3160 |
| 656 | Ga0495583_0024408 | 3300046506 | Bacteria | 3038 |
| 657 | Ga0495583_0130475 | 3300046506 | Bacteria | 1052 |
| 658 | Ga0495606_0000977 | 3300046507 | Bacteria | 41762 |
| 659 | Ga0495606_0003584 | 3300046507 | Bacteria | 16361 |
| 660 | Ga0495606_0088792 | 3300046507 | Bacteria | 1905 |
| 661 | Ga0495610_0000041 | 3300046512 | Bacteria | 160898 |
| 662 | Ga0495610_0000059 | 3300046512 | Bacteria | 134692 |
| 663 | Ga0495610_0002305 | 3300046512 | Bacteria | 16131 |
| 664 | Ga0495610_0164618 | 3300046512 | Bacteria | 935 |
| 665 | Ga0495616_0087226 | 3300046513 | Bacteria | 1483 |
| 666 | Ga0495631_0089509 | 3300046518 | Bacteria | 1325 |
| 667 | Ga0495632_0000038 | 3300046519 | Bacteria | 155743 |
| 668 | Ga0495632_0000410 | 3300046519 | Bacteria | 40576 |
| 669 | Ga0495632_0001694 | 3300046519 | Bacteria | 18032 |
| 670 | Ga0495637_0003726 | 3300046520 | Bacteria | 8048 |
| 671 | Ga0495637_0011549 | 3300046520 | Bacteria | 4242 |
| 672 | Ga0495637_0016583 | 3300046520 | Bacteria | 3442 |
| 673 | Ga0495643_0000004 | 3300046522 | Bacteria | 519944 |
| 674 | Ga0495643_0000088 | 3300046522 | Bacteria | 155458 |
| 675 | Ga0495643_0003968 | 3300046522 | Bacteria | 10578 |
| 676 | Ga0495643_0014694 | 3300046522 | Bacteria | 4651 |
| 677 | Ga0495643_0152261 | 3300046522 | Bacteria | 1144 |
| 678 | Ga0495643_0152295 | 3300046522 | Bacteria | 1144 |
| 679 | Ga0495648_0000026 | 3300046524 | Bacteria | 232162 |
| 680 | Ga0495648_0000108 | 3300046524 | Bacteria | 102335 |
| 681 | Ga0495648_0007834 | 3300046524 | Bacteria | 8498 |
| 682 | Ga0495648_0032071 | 3300046524 | Bacteria | 3453 |
| 683 | Ga0495648_0224910 | 3300046524 | Bacteria | 923 |
| 684 | Ga0495663_0000013 | 3300046525 | Bacteria | 155493 |
| 685 | Ga0495663_0005255 | 3300046525 | Bacteria | 3603 |
| 686 | Ga0495642_0086585 | 3300046528 | Bacteria | 1323 |
| 687 | Ga0495654_0044744 | 3300046530 | Bacteria | 2188 |
| 688 | Ga0495609_0005517 | 3300046538 | Bacteria | 6616 |
| 689 | Ga0495597_0033805 | 3300046542 | Bacteria | 2312 |
| 690 | Ga0495633_0000212 | 3300046558 | Bacteria | 73041 |
| 691 | Ga0495633_0000670 | 3300046558 | Bacteria | 31596 |
| 692 | Ga0495633_0013362 | 3300046558 | Bacteria | 4330 |
| 693 | Ga0495633_0014845 | 3300046558 | Bacteria | 4055 |
| 694 | Ga0495668_0000085 | 3300046616 | Bacteria | 153045 |
| 695 | Ga0495668_0067012 | 3300046616 | Bacteria | 1975 |
| 696 | Ga0495625_0000014 | 3300046660 | Bacteria | 323486 |
| 697 | Ga0495625_0000072 | 3300046660 | Bacteria | 166439 |
| 698 | Ga0495625_0005016 | 3300046660 | Bacteria | 12280 |
| 699 | Ga0495625_0013733 | 3300046660 | Bacteria | 6493 |
| 700 | Ga0495625_0014355 | 3300046660 | Bacteria | 6328 |
| 701 | Ga0495625_0027330 | 3300046660 | Bacteria | 4298 |
| 702 | Ga0495625_0063251 | 3300046660 | Bacteria | 2613 |
| 703 | Ga0495669_0000192 | 3300046684 | Bacteria | 37810 |
| 704 | Ga0495669_0022153 | 3300046684 | Bacteria | 2760 |
| 705 | Ga0495613_0000380 | 3300046689 | Bacteria | 38251 |
| 706 | Ga0495670_0022796 | 3300046691 | Bacteria | 3092 |
| 707 | Ga0495670_0037214 | 3300046691 | Bacteria | 2426 |
| 708 | Ga0495670_0269424 | 3300046691 | Bacteria | 910 |
| 709 | Ga0495671_0000048 | 3300046692 | Bacteria | 155712 |
| 710 | Ga0495671_0000050 | 3300046692 | Bacteria | 141936 |
| 711 | Ga0495671_0009905 | 3300046692 | Bacteria | 5304 |
| 712 | Ga0495683_0001323 | 3300047323 | Bacteria | 16619 |
| 713 | Ga0495687_000217 | 3300047443 | Bacteria | 81602 |
| 714 | Ga0495687_000270 | 3300047443 | Bacteria | 69481 |
| 715 | Ga0495677_0003186 | 3300047445 | Bacteria | 6398 |
| 716 | Ga0495677_0003823 | 3300047445 | Bacteria | 5824 |
| 717 | Ga0495673_0000125 | 3300047469 | Bacteria | 141937 |
| 718 | Ga0495681_0000022 | 3300047470 | Bacteria | 165281 |
| 719 | Ga0495681_0000045 | 3300047470 | Bacteria | 111769 |
| 720 | Ga0495686_0000606 | 3300047472 | Bacteria | 49623 |
| 721 | Ga0495686_0000736 | 3300047472 | Bacteria | 43676 |
| 722 | Ga0495686_0006128 | 3300047472 | Bacteria | 9310 |
| 723 | Ga0495686_0015268 | 3300047472 | Bacteria | 5252 |
| 724 | Ga0495686_0019225 | 3300047472 | Bacteria | 4568 |
| 725 | Ga0495686_0039861 | 3300047472 | Bacteria | 2998 |
| 726 | Ga0495686_0050645 | 3300047472 | Bacteria | 2609 |
| 727 | Ga0495686_0070463 | 3300047472 | Bacteria | 2154 |
| 728 | Ga0495615_0000018 | 3300048090 | Bacteria | 54585 |
| 729 | Ga0495626_0003066 | 3300048091 | Bacteria | 10963 |
| 730 | Ga0496100_0007205 | 3300048903 | Bacteria | 6116 |
| 731 | Ga0496101_0027708 | 3300048904 | Bacteria | 3949 |
| 732 | Ga0496101_0227536 | 3300048904 | Bacteria | 1449 |
| 733 | Ga0496102_0000230 | 3300048905 | Bacteria | 73225 |
| 734 | Ga0496102_0000648 | 3300048905 | Bacteria | 35117 |
| 735 | Ga0496102_0004071 | 3300048905 | Bacteria | 12398 |
| 736 | Ga0496102_0023975 | 3300048905 | Bacteria | 5423 |
| 737 | Ga0496102_0099079 | 3300048905 | Bacteria | 2705 |
| 738 | Ga0496102_0289784 | 3300048905 | Bacteria | 1543 |
| 739 | Ga0496103_0000110 | 3300048906 | Bacteria | 90202 |
| 740 | Ga0496103_0000200 | 3300048906 | Bacteria | 59876 |
| 741 | Ga0496103_0000590 | 3300048906 | Bacteria | 28622 |
| 742 | Ga0496103_0002993 | 3300048906 | Bacteria | 10446 |
| 743 | Ga0496103_0012080 | 3300048906 | Bacteria | 5130 |
| 744 | Ga0496103_0051853 | 3300048906 | Bacteria | 2540 |
| 745 | Ga0496103_0117595 | 3300048906 | Bacteria | 1692 |
| 746 | Ga0496104_0000047 | 3300048907 | Bacteria | 148896 |
| 747 | Ga0496104_0023430 | 3300048907 | Bacteria | 5675 |
| 748 | Ga0496104_0078556 | 3300048907 | Bacteria | 3145 |
| 749 | Ga0496104_0093584 | 3300048907 | Bacteria | 2875 |
| 750 | Ga0496105_0000081 | 3300048908 | Bacteria | 70237 |
| 751 | Ga0496105_0008602 | 3300048908 | Bacteria | 7933 |
| 752 | Ga0496106_0382945 | 3300048909 | Bacteria | 1130 |
| 753 | Ga0496107_0025653 | 3300048910 | Bacteria | 4174 |
| 754 | Ga0496107_0198261 | 3300048910 | Bacteria | 1492 |
| 755 | Ga0496108_0003387 | 3300048911 | Bacteria | 12801 |
| 756 | Ga0496110_0213150 | 3300048913 | Bacteria | 1756 |
| 757 | Ga0496110_0267995 | 3300048913 | Bacteria | 1555 |
| 758 | Ga0496110_0308948 | 3300048913 | Bacteria | 1440 |
| 759 | Ga0496112_0073551 | 3300048915 | Bacteria | 3379 |
| 760 | Ga0496112_0524528 | 3300048915 | Bacteria | 1119 |
| 761 | Ga0496113_0000020 | 3300048916 | Bacteria | 70677 |
| 762 | Ga0496113_0320951 | 3300048916 | Bacteria | 1241 |
| 763 | Ga0496115_0000173 | 3300048918 | Bacteria | 59935 |
| 764 | Ga0496115_0097188 | 3300048918 | Bacteria | 2412 |
| 765 | Ga0496116_0000060 | 3300048919 | Bacteria | 272219 |
| 766 | Ga0496116_0035405 | 3300048919 | Bacteria | 3507 |
| 767 | Ga0496116_0047529 | 3300048919 | Bacteria | 2888 |
| 768 | Ga0496116_0100041 | 3300048919 | Bacteria | 1735 |
| 769 | Ga0496117_0000670 | 3300048920 | Bacteria | 54795 |
| 770 | Ga0496117_0006958 | 3300048920 | Bacteria | 11215 |
| 771 | Ga0496117_0007224 | 3300048920 | Bacteria | 10935 |
| 772 | Ga0496117_0010423 | 3300048920 | Bacteria | 8477 |
| 773 | Ga0496117_0014334 | 3300048920 | Bacteria | 6837 |
| 774 | Ga0496117_0022967 | 3300048920 | Bacteria | 4989 |
| 775 | Ga0496117_0052366 | 3300048920 | Bacteria | 2875 |
| 776 | Ga0496117_0079561 | 3300048920 | Bacteria | 2159 |
| 777 | Ga0496117_0087606 | 3300048920 | Bacteria | 2017 |
| 778 | Ga0496118_0000592 | 3300048921 | Bacteria | 59967 |
| 779 | Ga0496118_0003977 | 3300048921 | Bacteria | 18028 |
| 780 | Ga0496118_0006353 | 3300048921 | Bacteria | 13036 |
| 781 | Ga0496118_0027984 | 3300048921 | Bacteria | 4759 |
| 782 | Ga0496118_0082566 | 3300048921 | Bacteria | 2251 |
| 783 | Ga0496118_0084510 | 3300048921 | Bacteria | 2214 |
| 784 | Ga0496119_0000699 | 3300048922 | Bacteria | 44963 |
| 785 | Ga0496119_0008055 | 3300048922 | Bacteria | 9357 |
| 786 | Ga0496119_0016331 | 3300048922 | Bacteria | 5655 |
| 787 | Ga0496119_0124694 | 3300048922 | Bacteria | 1411 |
| 788 | Ga0496120_0001199 | 3300048923 | Bacteria | 32884 |
| 789 | Ga0496120_0005962 | 3300048923 | Bacteria | 9494 |
| 790 | Ga0496120_0008143 | 3300048923 | Bacteria | 7687 |
| 791 | Ga0496121_0000009 | 3300048924 | Bacteria | 836971 |
| 792 | Ga0496121_0000176 | 3300048924 | Bacteria | 142585 |
| 793 | Ga0496121_0000295 | 3300048924 | Bacteria | 103239 |
| 794 | Ga0496121_0000670 | 3300048924 | Bacteria | 63957 |
| 795 | Ga0496121_0001672 | 3300048924 | Bacteria | 36560 |
| 796 | Ga0496121_0005579 | 3300048924 | Bacteria | 16069 |
| 797 | Ga0496121_0009918 | 3300048924 | Bacteria | 10841 |
| 798 | Ga0496121_0042811 | 3300048924 | Bacteria | 3932 |
| 799 | Ga0496121_0081751 | 3300048924 | Bacteria | 2556 |
| 800 | Ga0496122_0000735 | 3300048925 | Bacteria | 64114 |
| 801 | Ga0496122_0003067 | 3300048925 | Bacteria | 22531 |
| 802 | Ga0496122_0003693 | 3300048925 | Bacteria | 19828 |
| 803 | Ga0496122_0006224 | 3300048925 | Bacteria | 13821 |
| 804 | Ga0496122_0012217 | 3300048925 | Bacteria | 8586 |
| 805 | Ga0496122_0194130 | 3300048925 | Bacteria | 1195 |
| 806 | Ga0496123_0000362 | 3300048926 | Bacteria | 85587 |
| 807 | Ga0496123_0000457 | 3300048926 | Bacteria | 71921 |
| 808 | Ga0496123_0000503 | 3300048926 | Bacteria | 67921 |
| 809 | Ga0496123_0007175 | 3300048926 | Bacteria | 10573 |
| 810 | Ga0496123_0008453 | 3300048926 | Bacteria | 9451 |
| 811 | Ga0496123_0021763 | 3300048926 | Bacteria | 4971 |
| 812 | Ga0496123_0121090 | 3300048926 | Bacteria | 1472 |
| 813 | Ga0496123_0178549 | 3300048926 | Bacteria | 1112 |
| 814 | Ga0496124_0000116 | 3300048927 | Bacteria | 164788 |
| 815 | Ga0496124_0000177 | 3300048927 | Bacteria | 128355 |
| 816 | Ga0496124_0001084 | 3300048927 | Bacteria | 42949 |
| 817 | Ga0496124_0002381 | 3300048927 | Bacteria | 24765 |
| 818 | Ga0496124_0003896 | 3300048927 | Bacteria | 17845 |
| 819 | Ga0496124_0006822 | 3300048927 | Bacteria | 12323 |
| 820 | Ga0496124_0006882 | 3300048927 | Bacteria | 12224 |
| 821 | Ga0496124_0008630 | 3300048927 | Bacteria | 10620 |
| 822 | Ga0496124_0171459 | 3300048927 | Bacteria | 1680 |
| 823 | Ga0496124_0293529 | 3300048927 | Bacteria | 1178 |
| 824 | Ga0496125_0000336 | 3300048928 | Bacteria | 89942 |
| 825 | Ga0496125_0000555 | 3300048928 | Bacteria | 64263 |
| 826 | Ga0496125_0002945 | 3300048928 | Bacteria | 21421 |
| 827 | Ga0496125_0004371 | 3300048928 | Bacteria | 16366 |
| 828 | Ga0496125_0013788 | 3300048928 | Bacteria | 7919 |
| 829 | Ga0496125_0018419 | 3300048928 | Bacteria | 6631 |
| 830 | Ga0496125_0032022 | 3300048928 | Bacteria | 4677 |
| 831 | Ga0496125_0060032 | 3300048928 | Bacteria | 3060 |
| 832 | Ga0496125_0092833 | 3300048928 | Bacteria | 2255 |
| 833 | Ga0496125_0173880 | 3300048928 | Bacteria | 1444 |
| 834 | Ga0496125_0213285 | 3300048928 | Bacteria | 1252 |
| 835 | Ga0496125_0318063 | 3300048928 | Bacteria | 945 |
| 836 | Ga0496126_0000028 | 3300048929 | Bacteria | 394082 |
| 837 | Ga0496126_0000725 | 3300048929 | Bacteria | 59835 |
| 838 | Ga0496126_0002255 | 3300048929 | Bacteria | 26590 |
| 839 | Ga0496126_0083927 | 3300048929 | Bacteria | 2811 |
| 840 | Ga0496126_0177984 | 3300048929 | Bacteria | 1808 |
| 841 | Ga0495682_0021473 | 3300049460 | Bacteria | 2419 |
| 842 | Ga0501290_000118 | 3300049513 | Bacteria | 11992 |
| 843 | Ga0501290_001907 | 3300049513 | Bacteria | 2754 |
| 844 | Ga0501292_000010 | 3300049515 | Bacteria | 72340 |
| 845 | Ga0501293_000480 | 3300049516 | Bacteria | 3016 |
| 846 | Ga0501298_001906 | 3300049521 | Bacteria | 3106 |
| 847 | Ga0501299_014103 | 3300049522 | Bacteria | 1386 |
| 848 | Ga0501300_000865 | 3300049523 | Bacteria | 4630 |
| 849 | Ga0501300_000897 | 3300049523 | Bacteria | 4545 |
| 850 | Ga0501033_0236429 | 3300049570 | Bacteria | 1297 |
| 851 | Ga0501034_0006776 | 3300049571 | Bacteria | 12251 |
| 852 | Ga0501038_0058246 | 3300049574 | Bacteria | 3313 |
| 853 | Ga0501039_0242575 | 3300049575 | Bacteria | 1417 |
| 854 | Ga0501042_0143009 | 3300049578 | Bacteria | 1725 |
| 855 | Ga0501047_0002891 | 3300049581 | Bacteria | 16289 |
| 856 | Ga0501047_0318416 | 3300049581 | Bacteria | 1396 |
| 857 | Ga0501048_0222911 | 3300049582 | Bacteria | 1338 |
| 858 | Ga0501071_0044196 | 3300049587 | Bacteria | 3195 |
| 859 | Ga0501071_0323612 | 3300049587 | Bacteria | 1171 |
| 860 | Ga0501071_0505370 | 3300049587 | Bacteria | 927 |
| 861 | Ga0501076_0153344 | 3300049592 | Bacteria | 1875 |
| 862 | Ga0501206_000946 | 3300049653 | Bacteria | 3591 |
| 863 | Ga0501211_001628 | 3300049658 | Bacteria | 2405 |
| 864 | Ga0501222_000177 | 3300049662 | Bacteria | 11651 |
| 865 | Ga0501223_000017 | 3300049663 | Bacteria | 68157 |
| 866 | Ga0501223_000107 | 3300049663 | Bacteria | 23945 |
| 867 | Ga0501223_001340 | 3300049663 | Bacteria | 5699 |
| 868 | Ga0501224_000031 | 3300049664 | Bacteria | 43294 |
| 869 | Ga0501224_001407 | 3300049664 | Bacteria | 3187 |
| 870 | Ga0501233_000040 | 3300049668 | Bacteria | 17026 |
| 871 | Ga0501233_001211 | 3300049668 | Bacteria | 4395 |
| 872 | Ga0501233_036130 | 3300049668 | Bacteria | 1141 |
| 873 | Ga0501235_005127 | 3300049669 | Bacteria | 2847 |
| 874 | Ga0501235_022608 | 3300049669 | Bacteria | 1398 |
| 875 | Ga0501246_001831 | 3300049676 | Bacteria | 1651 |
| 876 | Ga0501257_000001 | 3300049686 | Bacteria | 74809 |
| 877 | Ga0501259_000145 | 3300049688 | Bacteria | 10613 |
| 878 | Ga0501261_000003 | 3300049690 | Bacteria | 106942 |
| 879 | Ga0501225_0000004 | 3300049705 | Bacteria | 140738 |
| 880 | Ga0501225_0000070 | 3300049705 | Bacteria | 33694 |
| 881 | Ga0501234_000164 | 3300049707 | Bacteria | 9016 |
| 882 | Ga0501081_0318302 | 3300049743 | Bacteria | 1143 |
| 883 | Ga0501241_002348 | 3300049758 | Bacteria | 3662 |
| 884 | Ga0501241_023346 | 3300049758 | Bacteria | 1145 |
| 885 | Ga0501279_000007 | 3300049775 | Bacteria | 141756 |
| 886 | Ga0501280_000007 | 3300049776 | Bacteria | 75585 |
| 887 | Ga0501280_000464 | 3300049776 | Bacteria | 9665 |
| 888 | Ga0501281_00034 | 3300049777 | Bacteria | 15559 |
| 889 | Ga0501282_000352 | 3300049778 | Bacteria | 5517 |
| 890 | Ga0501282_001648 | 3300049778 | Bacteria | 2459 |
| 891 | Ga0501044_0148718 | 3300049823 | Bacteria | 2326 |
| 892 | Ga0501226_000051 | 3300049853 | Bacteria | 49149 |
| 893 | nmdc:mga03683_25400_c1 | 3300050489 | Bacteria | 2327 |
| 894 | nmdc:mga03n38_1084_c1 | 3300050490 | Bacteria | 7508 |
| 895 | nmdc:mga0k408_5_c1 | 3300050493 | Bacteria | 73264 |
| 896 | nmdc:mga0k408_63905_c1 | 3300050493 | Bacteria | 2141 |
| 897 | nmdc:mga06z11_132_c1 | 3300050494 | Bacteria | 29648 |
| 898 | nmdc:mga04h51_262_c1 | 3300050495 | Bacteria | 13675 |
| 899 | nmdc:mga07m45_18825_c1 | 3300050496 | Bacteria | 3734 |
| 900 | nmdc:mga0n895_40845_c1 | 3300050512 | Bacteria | 4507 |
| 901 | nmdc:mga0sz30_12658_c1 | 3300050516 | Bacteria | 3285 |
| 902 | Ga0500610_0000057 | 3300053079 | Bacteria | 34550 |
| 903 | Ga0500643_000199 | 3300053087 | Bacteria | 57141 |
| 904 | Ga0500643_000221 | 3300053087 | Bacteria | 53085 |
| 905 | Ga0500643_000295 | 3300053087 | Bacteria | 42617 |
| 906 | Ga0500646_0034180 | 3300053090 | Bacteria | 1409 |
| 907 | Ga0500646_0056539 | 3300053090 | Bacteria | 1144 |
| 908 | Ga0500647_0018734 | 3300053091 | Bacteria | 3209 |
| 909 | Ga0500583_0078196 | 3300053092 | Bacteria | 1594 |
| 910 | Ga0500651_0000843 | 3300053093 | Bacteria | 15035 |
| 911 | Ga0500641_0003958 | 3300053096 | Bacteria | 5236 |
| 912 | Ga0500641_0009125 | 3300053096 | Bacteria | 3557 |
| 913 | Ga0500641_0013275 | 3300053096 | Bacteria | 3024 |
| 914 | Ga0500641_0033688 | 3300053096 | Bacteria | 2035 |
| 915 | Ga0500555_000886 | 3300053103 | Bacteria | 10651 |
| 916 | Ga0500556_0039178 | 3300053104 | Bacteria | 1659 |
| 917 | Ga0500562_028756 | 3300053108 | Bacteria | 1461 |
| 918 | Ga0500594_0001273 | 3300053118 | Bacteria | 5469 |
| 919 | Ga0500594_0041625 | 3300053118 | Bacteria | 1259 |
| 920 | Ga0500595_000150 | 3300053119 | Bacteria | 45894 |
| 921 | Ga0500595_003849 | 3300053119 | Bacteria | 6893 |
| 922 | Ga0500595_048610 | 3300053119 | Bacteria | 1325 |
| 923 | Ga0500597_007599 | 3300053120 | Bacteria | 3685 |
| 924 | Ga0500607_000006 | 3300053121 | Bacteria | 136863 |
| 925 | Ga0500608_000298 | 3300053122 | Bacteria | 19216 |
| 926 | Ga0500614_025073 | 3300053123 | Bacteria | 1414 |
| 927 | Ga0500618_000817 | 3300053125 | Bacteria | 17137 |
| 928 | Ga0500618_018611 | 3300053125 | Bacteria | 1717 |
| 929 | Ga0500642_0001829 | 3300053130 | Bacteria | 6141 |
| 930 | Ga0500642_0026441 | 3300053130 | Bacteria | 2369 |
| 931 | Ga0500655_000020 | 3300053133 | Bacteria | 44643 |
| 932 | Ga0500658_0000284 | 3300053134 | Bacteria | 23056 |
| 933 | Ga0500559_0000698 | 3300053136 | Bacteria | 22073 |
| 934 | Ga0500559_0004182 | 3300053136 | Bacteria | 6923 |
| 935 | Ga0500559_0027412 | 3300053136 | Bacteria | 2431 |
| 936 | Ga0500564_004573 | 3300053138 | Bacteria | 5559 |
| 937 | Ga0500568_0000916 | 3300053139 | Bacteria | 20348 |
| 938 | Ga0500573_0000235 | 3300053140 | Bacteria | 23015 |
| 939 | Ga0500577_0004769 | 3300053142 | Bacteria | 3609 |
| 940 | Ga0500577_0145193 | 3300053142 | Bacteria | 1003 |
| 941 | Ga0500590_001132 | 3300053148 | Bacteria | 10511 |
| 942 | Ga0500590_010918 | 3300053148 | Bacteria | 4594 |
| 943 | Ga0500604_0000011 | 3300053151 | Bacteria | 104892 |
| 944 | Ga0500616_0000030 | 3300053153 | Bacteria | 415224 |
| 945 | Ga0500616_0000123 | 3300053153 | Bacteria | 140214 |
| 946 | Ga0500616_0012922 | 3300053153 | Bacteria | 4865 |
| 947 | Ga0500616_0047289 | 3300053153 | Bacteria | 2284 |
| 948 | Ga0500619_000038 | 3300053154 | Bacteria | 40615 |
| 949 | Ga0500622_0001376 | 3300053156 | Bacteria | 19604 |
| 950 | Ga0500622_0006319 | 3300053156 | Bacteria | 6915 |
| 951 | Ga0500624_000007 | 3300053157 | Bacteria | 184487 |
| 952 | Ga0500624_000032 | 3300053157 | Bacteria | 104403 |
| 953 | Ga0500636_0001312 | 3300053177 | Bacteria | 13508 |
| 954 | Ga0500637_0000109 | 3300053178 | Bacteria | 29639 |
| 955 | Ga0500637_0002011 | 3300053178 | Bacteria | 8870 |
| 956 | Ga0500570_000051 | 3300053724 | Bacteria | 28955 |
| 957 | Ga0500625_000001 | 3300053729 | Bacteria | 395993 |
| 958 | Ga0500645_000037 | 3300053730 | Bacteria | 112944 |
| 959 | Ga0500645_000215 | 3300053730 | Bacteria | 43997 |
| 960 | Ga0500645_001429 | 3300053730 | Bacteria | 12140 |
| 961 | Ga0500645_006747 | 3300053730 | Bacteria | 4067 |
| 962 | Ga0500645_012901 | 3300053730 | Bacteria | 2693 |
| 963 | Ga0501084_0306092 | 3300054114 | Bacteria | 1342 |
| 964 | Ga0587090_004497 | 3300059510 | Bacteria | 1695 |
| 965 | Ga0501082_0131512 | 3300060353 | Bacteria | 2172 |
| 966 | Ga0466962_0000343 | 3300061719 | Bacteria | 19924 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014326 | Ga0157380_10003365 | Ga0157380_100033652 | 234 |
| 2 | 3300035724 | Ga0373933_0190270 | Ga0373933_0190270_549_1301 | 250 |
| 3 | 3300046500 | Ga0495596_0000042 | Ga0495596_0000042_51150_52055 | 259 |
| 4 | 3300046500 | Ga0495596_0001157 | Ga0495596_0001157_6933_7838 | 259 |
| 5 | 3300048091 | Ga0495626_0003066 | Ga0495626_0003066_4695_5600 | 259 |
| 6 | 3300005289 | Ga0065704_10082208 | Ga0065704_100822081 | 260 |
| 7 | 3300005295 | Ga0065707_10001250 | Ga0065707_100012503 | 260 |
| 8 | 3300005440 | Ga0070705_100058364 | Ga0070705_1000583642 | 260 |
| 9 | 3300028381 | Ga0268264_10063589 | Ga0268264_100635895 | 260 |
| 10 | 3300048920 | Ga0496117_0087606 | Ga0496117_0087606_36_818 | 260 |
| 11 | 3300046691 | Ga0495670_0269424 | Ga0495670_0269424_32_817 | 261 |
| 12 | 3300009092 | Ga0105250_10016341 | Ga0105250_100163414 | 263 |
| 13 | 3300046506 | Ga0495583_0130475 | Ga0495583_0130475_241_1032 | 263 |
| 14 | 3300002076 | JGI24749J21850_1000467 | JGI24749J21850_10004672 | 264 |
| 15 | 3300002459 | JGI24751J29686_10000437 | JGI24751J29686_1000043714 | 264 |
| 16 | 3300005295 | Ga0065707_10082823 | Ga0065707_1008282314 | 264 |
| 17 | 3300005331 | Ga0070670_100000339 | Ga0070670_10000033930 | 264 |
| 18 | 3300005353 | Ga0070669_100000345 | Ga0070669_10000034515 | 264 |
| 19 | 3300005617 | Ga0068859_100195204 | Ga0068859_1001952042 | 264 |
| 20 | 3300005618 | Ga0068864_100000379 | Ga0068864_10000037914 | 264 |
| 21 | 3300005719 | Ga0068861_100040635 | Ga0068861_1000406354 | 264 |
| 22 | 3300005844 | Ga0068862_100014185 | Ga0068862_1000141852 | 264 |
| 23 | 3300006931 | Ga0097620_100195213 | Ga0097620_1001952132 | 264 |
| 24 | 3300009177 | Ga0105248_10025690 | Ga0105248_100256902 | 264 |
| 25 | 3300014325 | Ga0163163_10123345 | Ga0163163_101233453 | 264 |
| 26 | 3300025923 | Ga0207681_10000086 | Ga0207681_1000008668 | 264 |
| 27 | 3300025925 | Ga0207650_10000008 | Ga0207650_10000008430 | 264 |
| 28 | 3300025941 | Ga0207711_10008787 | Ga0207711_100087873 | 264 |
| 29 | 3300025986 | Ga0207658_10001804 | Ga0207658_100018047 | 264 |
| 30 | 3300026095 | Ga0207676_10000264 | Ga0207676_1000026434 | 264 |
| 31 | 3300026118 | Ga0207675_100005849 | Ga0207675_10000584914 | 264 |
| 32 | 3300028380 | Ga0268265_10001713 | Ga0268265_100017137 | 264 |
| 33 | 3300048907 | Ga0496104_0078556 | Ga0496104_0078556_333_1130 | 265 |
| 34 | 3300049581 | Ga0501047_0318416 | Ga0501047_0318416_578_1378 | 266 |
| 35 | 3300025907 | Ga0207645_10318266 | Ga0207645_103182661 | 268 |
| 36 | 3300053092 | Ga0500583_0078196 | Ga0500583_0078196_486_1301 | 268 |
| 37 | 3300053153 | Ga0500616_0000030 | Ga0500616_0000030_276584_277399 | 268 |
| 38 | 3300005289 | Ga0065704_10105224 | Ga0065704_101052242 | 272 |
| 39 | 3300005295 | Ga0065707_10081774 | Ga0065707_1008177434 | 272 |
| 40 | 3300005548 | Ga0070665_100000226 | Ga0070665_10000022611 | 272 |
| 41 | 3300005548 | Ga0070665_100000532 | Ga0070665_1000005329 | 272 |
| 42 | 3300014326 | Ga0157380_10000788 | Ga0157380_1000078814 | 272 |
| 43 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000022804 | 272 |
| 44 | 3300028379 | Ga0268266_10000641 | Ga0268266_1000064149 | 272 |
| 45 | 3300048928 | Ga0496125_0173880 | Ga0496125_0173880_524_1375 | 273 |
| 46 | 3300049743 | Ga0501081_0318302 | Ga0501081_0318302_25_846 | 273 |
| 47 | 3300060353 | Ga0501082_0131512 | Ga0501082_0131512_450_1364 | 273 |
| 48 | 3300005563 | Ga0068855_100309074 | Ga0068855_1003090743 | 274 |
| 49 | 3300013104 | Ga0157370_10036824 | Ga0157370_100368244 | 274 |
| 50 | 3300013105 | Ga0157369_10096183 | Ga0157369_100961834 | 274 |
| 51 | iso_pu_bacteria | 2643221605 | 2644036637 | 274 |
| 52 | 3300001976 | JGI24752J21851_1000508 | JGI24752J21851_10005083 | 275 |
| 53 | 3300002070 | JGI24750J21931_1000309 | JGI24750J21931_10003092 | 275 |
| 54 | 3300002074 | JGI24748J21848_1000110 | JGI24748J21848_100011013 | 275 |
| 55 | 3300002076 | JGI24749J21850_1001980 | JGI24749J21850_10019802 | 275 |
| 56 | 3300002239 | JGI24034J26672_10000018 | JGI24034J26672_10000018115 | 275 |
| 57 | 3300002244 | JGI24742J22300_10009297 | JGI24742J22300_100092971 | 275 |
| 58 | 3300005330 | Ga0070690_100000008 | Ga0070690_100000008114 | 275 |
| 59 | 3300005335 | Ga0070666_10000032 | Ga0070666_100000329 | 275 |
| 60 | 3300005355 | Ga0070671_100040801 | Ga0070671_1000408013 | 275 |
| 61 | 3300005365 | Ga0070688_100010545 | Ga0070688_1000105453 | 275 |
| 62 | 3300005367 | Ga0070667_100227156 | Ga0070667_1002271562 | 275 |
| 63 | 3300005466 | Ga0070685_10000774 | Ga0070685_1000077411 | 275 |
| 64 | 3300005544 | Ga0070686_100000030 | Ga0070686_10000003011 | 275 |
| 65 | 3300005548 | Ga0070665_100000056 | Ga0070665_10000005671 | 275 |
| 66 | 3300005617 | Ga0068859_100019606 | Ga0068859_1000196067 | 275 |
| 67 | 3300005841 | Ga0068863_100000065 | Ga0068863_100000065118 | 275 |
| 68 | 3300005842 | Ga0068858_100018905 | Ga0068858_1000189057 | 275 |
| 69 | 3300005843 | Ga0068860_100000132 | Ga0068860_100000132120 | 275 |
| 70 | 3300006931 | Ga0097620_100019605 | Ga0097620_1000196053 | 275 |
| 71 | 3300009101 | Ga0105247_10081818 | Ga0105247_100818183 | 275 |
| 72 | 3300014326 | Ga0157380_10017753 | Ga0157380_100177533 | 275 |
| 73 | 3300014968 | Ga0157379_10010360 | Ga0157379_100103605 | 275 |
| 74 | 3300017792 | Ga0163161_10000084 | Ga0163161_100000843 | 275 |
| 75 | 3300025900 | Ga0207710_10017082 | Ga0207710_100170821 | 275 |
| 76 | 3300025903 | Ga0207680_10000009 | Ga0207680_10000009437 | 275 |
| 77 | 3300025923 | Ga0207681_10001567 | Ga0207681_100015677 | 275 |
| 78 | 3300025931 | Ga0207644_10002084 | Ga0207644_100020842 | 275 |
| 79 | 3300025936 | Ga0207670_10001908 | Ga0207670_100019082 | 275 |
| 80 | 3300025941 | Ga0207711_10014519 | Ga0207711_100145198 | 275 |
| 81 | 3300025961 | Ga0207712_10000046 | Ga0207712_10000046125 | 275 |
| 82 | 3300025986 | Ga0207658_10005994 | Ga0207658_100059949 | 275 |
| 83 | 3300026035 | Ga0207703_10000948 | Ga0207703_1000094818 | 275 |
| 84 | 3300026088 | Ga0207641_10000063 | Ga0207641_1000006349 | 275 |
| 85 | 3300026095 | Ga0207676_10001111 | Ga0207676_100011116 | 275 |
| 86 | 3300026118 | Ga0207675_100006391 | Ga0207675_1000063919 | 275 |
| 87 | 3300028379 | Ga0268266_10000066 | Ga0268266_10000066182 | 275 |
| 88 | 3300028380 | Ga0268265_10001076 | Ga0268265_1000107614 | 275 |
| 89 | 3300028381 | Ga0268264_10000130 | Ga0268264_10000130144 | 275 |
| 90 | 3300048905 | Ga0496102_0004071 | Ga0496102_0004071_5177_6028 | 275 |
| 91 | 3300048906 | Ga0496103_0000590 | Ga0496103_0000590_5796_6647 | 275 |
| 92 | 3300048910 | Ga0496107_0198261 | Ga0496107_0198261_474_1325 | 275 |
| 93 | 3300048919 | Ga0496116_0100041 | Ga0496116_0100041_327_1178 | 275 |
| 94 | 3300048920 | Ga0496117_0007224 | Ga0496117_0007224_816_1667 | 275 |
| 95 | iso_pu_bacteria | 2510917021 | 2511130982 | 275 |
| 96 | iso_pu_bacteria | 2524023250 | 2524612631 | 275 |
| 97 | iso_pu_bacteria | 2643221541 | 2643729490 | 275 |
| 98 | iso_pu_bacteria | 2643221605 | 2644041072 | 275 |
| 99 | iso_pu_bacteria | 2643221606 | 2644043847 | 275 |
| 100 | iso_pu_bacteria | 2643221671 | 2644392318 | 275 |
| 101 | iso_pu_bacteria | 2751185897 | 2753767229 | 275 |
| 102 | iso_pu_bacteria | 2818991438 | 2819552009 | 275 |
| 103 | iso_pu_bacteria | 2512564014 | 2512643210 | 276 |
| 104 | iso_pu_bacteria | 2582581305 | 2585262750 | 276 |
| 105 | iso_pu_bacteria | 2599185359 | 2600227209 | 276 |
| 106 | iso_pu_bacteria | 2643221605 | 2644041100 | 276 |
| 107 | iso_pu_bacteria | 2643221606 | 2644042462 | 276 |
| 108 | iso_pu_bacteria | 2738541275 | 2738711416 | 276 |
| 109 | iso_pu_bacteria | 2738541301 | 2738849841 | 276 |
| 110 | iso_pu_bacteria | 2738541304 | 2738865570 | 276 |
| 111 | iso_pu_bacteria | 2738543022 | 2739298088 | 276 |
| 112 | iso_pu_bacteria | 2738543033 | 2739359766 | 276 |
| 113 | iso_pu_bacteria | 2739367664 | 2739648787 | 276 |
| 114 | iso_pu_bacteria | 2739367865 | 2740027260 | 276 |
| 115 | iso_pu_bacteria | 2808606401 | 2809064119 | 276 |
| 116 | iso_pu_bacteria | 2808606404 | 2809080087 | 276 |
| 117 | iso_pu_bacteria | 2808606405 | 2809084560 | 276 |
| 118 | iso_pu_bacteria | 2879163058 | 2879163233 | 276 |
| 119 | iso_pu_bacteria | 2880518877 | 2880523049 | 276 |
| 120 | iso_pu_bacteria | 2919138771 | 2919141223 | 276 |
| 121 | iso_pu_bacteria | 2919709256 | 2919713058 | 276 |
| 122 | iso_pu_bacteria | 2928100450 | 2928103191 | 276 |
| 123 | iso_pu_bacteria | 2928959182 | 2928962668 | 276 |
| 124 | iso_pu_bacteria | 3000865235 | 3000867504 | 276 |
| 125 | iso_pu_bacteria | 8057101203 | 8057104426 | 276 |
| 126 | 2162886007 | SwRhRL2b_contig_3826517 | SwRhRL2b_0415.00003500 | 279 |
| 127 | 2162886007 | SwRhRL2b_contig_58648 | SwRhRL2b_0969.00006940 | 279 |
| 128 | 3300005289 | Ga0065704_10000815 | Ga0065704_100008155 | 279 |
| 129 | 3300005289 | Ga0065704_10070525 | Ga0065704_1007052520 | 279 |
| 130 | 3300005289 | Ga0065704_10105062 | Ga0065704_101050622 | 279 |
| 131 | 3300005295 | Ga0065707_10000429 | Ga0065707_100004293 | 279 |
| 132 | 3300005295 | Ga0065707_10115320 | Ga0065707_101153201 | 279 |
| 133 | 3300005331 | Ga0070670_100098177 | Ga0070670_1000981772 | 279 |
| 134 | 3300005347 | Ga0070668_100005438 | Ga0070668_10000543811 | 279 |
| 135 | 3300005347 | Ga0070668_100080184 | Ga0070668_1000801844 | 279 |
| 136 | 3300005353 | Ga0070669_100002597 | Ga0070669_1000025978 | 279 |
| 137 | 3300005353 | Ga0070669_100013431 | Ga0070669_1000134315 | 279 |
| 138 | 3300005353 | Ga0070669_100273297 | Ga0070669_1002732972 | 279 |
| 139 | 3300005355 | Ga0070671_100000093 | Ga0070671_10000009346 | 279 |
| 140 | 3300005355 | Ga0070671_100001928 | Ga0070671_1000019285 | 279 |
| 141 | 3300005367 | Ga0070667_100000985 | Ga0070667_10000098519 | 279 |
| 142 | 3300005548 | Ga0070665_100000169 | Ga0070665_10000016974 | 279 |
| 143 | 3300005548 | Ga0070665_100296005 | Ga0070665_1002960052 | 279 |
| 144 | 3300005563 | Ga0068855_100437920 | Ga0068855_1004379202 | 279 |
| 145 | 3300005617 | Ga0068859_100517827 | Ga0068859_1005178272 | 279 |
| 146 | 3300005618 | Ga0068864_100235371 | Ga0068864_1002353712 | 279 |
| 147 | 3300005841 | Ga0068863_100000645 | Ga0068863_10000064527 | 279 |
| 148 | 3300005841 | Ga0068863_100008798 | Ga0068863_1000087988 | 279 |
| 149 | 3300005842 | Ga0068858_100457179 | Ga0068858_1004571792 | 279 |
| 150 | 3300005843 | Ga0068860_100006559 | Ga0068860_1000065595 | 279 |
| 151 | 3300005843 | Ga0068860_100028234 | Ga0068860_1000282347 | 279 |
| 152 | 3300005843 | Ga0068860_100186099 | Ga0068860_1001860992 | 279 |
| 153 | 3300005844 | Ga0068862_100000095 | Ga0068862_1000000951 | 279 |
| 154 | 3300005844 | Ga0068862_100001939 | Ga0068862_1000019394 | 279 |
| 155 | 3300006931 | Ga0097620_100517802 | Ga0097620_1005178021 | 279 |
| 156 | 3300009011 | Ga0105251_10004488 | Ga0105251_100044887 | 279 |
| 157 | 3300009177 | Ga0105248_10091229 | Ga0105248_100912292 | 279 |
| 158 | 3300009177 | Ga0105248_10283139 | Ga0105248_102831392 | 279 |
| 159 | 3300009551 | Ga0105238_10129713 | Ga0105238_101297134 | 279 |
| 160 | 3300009978 | Ga0105148_100197 | Ga0105148_1001979 | 279 |
| 161 | 3300013102 | Ga0157371_10302742 | Ga0157371_103027422 | 279 |
| 162 | 3300013306 | Ga0163162_10000458 | Ga0163162_1000045815 | 279 |
| 163 | 3300013306 | Ga0163162_10914008 | Ga0163162_109140081 | 279 |
| 164 | 3300017792 | Ga0163161_10001082 | Ga0163161_100010829 | 279 |
| 165 | 3300021384 | Ga0213876_10006914 | Ga0213876_100069146 | 279 |
| 166 | 3300025298 | Ga0209050_1000299 | Ga0209050_100029985 | 279 |
| 167 | 3300025315 | Ga0207697_10073900 | Ga0207697_100739002 | 279 |
| 168 | 3300025735 | Ga0207713_1002844 | Ga0207713_10028446 | 279 |
| 169 | 3300025903 | Ga0207680_10015096 | Ga0207680_100150964 | 279 |
| 170 | 3300025923 | Ga0207681_10002247 | Ga0207681_100022479 | 279 |
| 171 | 3300025923 | Ga0207681_10034479 | Ga0207681_100344792 | 279 |
| 172 | 3300025925 | Ga0207650_10093885 | Ga0207650_100938852 | 279 |
| 173 | 3300025931 | Ga0207644_10000122 | Ga0207644_1000012246 | 279 |
| 174 | 3300025931 | Ga0207644_10000409 | Ga0207644_1000040918 | 279 |
| 175 | 3300025937 | Ga0207669_10368727 | Ga0207669_103687272 | 279 |
| 176 | 3300025941 | Ga0207711_10135230 | Ga0207711_101352303 | 279 |
| 177 | 3300025949 | Ga0207667_10503941 | Ga0207667_105039412 | 279 |
| 178 | 3300025972 | Ga0207668_10015096 | Ga0207668_100150964 | 279 |
| 179 | 3300025972 | Ga0207668_10017068 | Ga0207668_100170683 | 279 |
| 180 | 3300025986 | Ga0207658_10012892 | Ga0207658_100128923 | 279 |
| 181 | 3300026035 | Ga0207703_10089780 | Ga0207703_100897802 | 279 |
| 182 | 3300026035 | Ga0207703_10179687 | Ga0207703_101796872 | 279 |
| 183 | 3300026035 | Ga0207703_10214866 | Ga0207703_102148663 | 279 |
| 184 | 3300026088 | Ga0207641_10000632 | Ga0207641_1000063227 | 279 |
| 185 | 3300026088 | Ga0207641_10068073 | Ga0207641_100680734 | 279 |
| 186 | 3300028379 | Ga0268266_10001173 | Ga0268266_1000117325 | 279 |
| 187 | 3300028379 | Ga0268266_10101557 | Ga0268266_101015572 | 279 |
| 188 | 3300028380 | Ga0268265_10003845 | Ga0268265_100038451 | 279 |
| 189 | 3300028381 | Ga0268264_10001891 | Ga0268264_1000189110 | 279 |
| 190 | 3300028381 | Ga0268264_10003658 | Ga0268264_100036585 | 279 |
| 191 | 3300028381 | Ga0268264_10015461 | Ga0268264_100154614 | 279 |
| 192 | 3300031548 | Ga0307408_100430033 | Ga0307408_1004300331 | 279 |
| 193 | 3300031731 | Ga0307405_10010561 | Ga0307405_100105614 | 279 |
| 194 | 3300031824 | Ga0307413_10147452 | Ga0307413_101474522 | 279 |
| 195 | 3300031901 | Ga0307406_10024351 | Ga0307406_100243515 | 279 |
| 196 | 3300037068 | Ga0373925_0000010 | Ga0373925_0000010_208850_209689 | 279 |
| 197 | 3300037312 | Ga0395899_0146250 | Ga0395899_0146250_512_1351 | 279 |
| 198 | 3300037418 | Ga0395900_0323100 | Ga0395900_0323100_528_1367 | 279 |
| 199 | 3300037466 | Ga0395898_0010266 | Ga0395898_0010266_2306_3145 | 279 |
| 200 | 3300037466 | Ga0395898_0072742 | Ga0395898_0072742_1673_2512 | 279 |
| 201 | 3300039437 | Ga0436365_0712898 | Ga0436365_0712898_494_1333 | 279 |
| 202 | 3300039453 | Ga0436362_0783629 | Ga0436362_0783629_340_1179 | 279 |
| 203 | 3300044684 | Ga0466966_0125352 | Ga0466966_0125352_340_1179 | 279 |
| 204 | 3300046453 | Ga0495627_000162 | Ga0495627_000162_47857_48765 | 279 |
| 205 | 3300046460 | Ga0495638_0000021 | Ga0495638_0000021_15892_16734 | 279 |
| 206 | 3300046460 | Ga0495638_0000209 | Ga0495638_0000209_58981_59820 | 279 |
| 207 | 3300046461 | Ga0495641_0026727 | Ga0495641_0026727_1776_2627 | 279 |
| 208 | 3300046501 | Ga0495607_0010179 | Ga0495607_0010179_4088_4993 | 279 |
| 209 | 3300046506 | Ga0495583_0000184 | Ga0495583_0000184_54613_55455 | 279 |
| 210 | 3300046506 | Ga0495583_0000840 | Ga0495583_0000840_6775_7614 | 279 |
| 211 | 3300046507 | Ga0495606_0088792 | Ga0495606_0088792_838_1677 | 279 |
| 212 | 3300046512 | Ga0495610_0000059 | Ga0495610_0000059_27117_28025 | 279 |
| 213 | 3300046519 | Ga0495632_0000410 | Ga0495632_0000410_902_1810 | 279 |
| 214 | 3300046519 | Ga0495632_0001694 | Ga0495632_0001694_15898_16740 | 279 |
| 215 | 3300046522 | Ga0495643_0003968 | Ga0495643_0003968_4857_5762 | 279 |
| 216 | 3300046524 | Ga0495648_0000026 | Ga0495648_0000026_15864_16706 | 279 |
| 217 | 3300046528 | Ga0495642_0086585 | Ga0495642_0086585_191_1030 | 279 |
| 218 | 3300046530 | Ga0495654_0044744 | Ga0495654_0044744_265_1104 | 279 |
| 219 | 3300046538 | Ga0495609_0005517 | Ga0495609_0005517_146_1051 | 279 |
| 220 | 3300046660 | Ga0495625_0014355 | Ga0495625_0014355_1226_2131 | 279 |
| 221 | 3300046691 | Ga0495670_0022796 | Ga0495670_0022796_22_861 | 279 |
| 222 | 3300046691 | Ga0495670_0037214 | Ga0495670_0037214_368_1207 | 279 |
| 223 | 3300046692 | Ga0495671_0000050 | Ga0495671_0000050_125266_126108 | 279 |
| 224 | 3300047469 | Ga0495673_0000125 | Ga0495673_0000125_15830_16672 | 279 |
| 225 | 3300047470 | Ga0495681_0000045 | Ga0495681_0000045_47847_48755 | 279 |
| 226 | 3300047472 | Ga0495686_0000606 | Ga0495686_0000606_29944_30783 | 279 |
| 227 | 3300047472 | Ga0495686_0039861 | Ga0495686_0039861_1387_2226 | 279 |
| 228 | 3300048904 | Ga0496101_0227536 | Ga0496101_0227536_27_932 | 279 |
| 229 | 3300048905 | Ga0496102_0289784 | Ga0496102_0289784_633_1472 | 279 |
| 230 | 3300048906 | Ga0496103_0012080 | Ga0496103_0012080_2638_3477 | 279 |
| 231 | 3300048906 | Ga0496103_0117595 | Ga0496103_0117595_148_999 | 279 |
| 232 | 3300048913 | Ga0496110_0267995 | Ga0496110_0267995_44_886 | 279 |
| 233 | 3300048915 | Ga0496112_0524528 | Ga0496112_0524528_241_1080 | 279 |
| 234 | 3300048916 | Ga0496113_0320951 | Ga0496113_0320951_362_1204 | 279 |
| 235 | 3300048919 | Ga0496116_0000060 | Ga0496116_0000060_108349_109254 | 279 |
| 236 | 3300048920 | Ga0496117_0022967 | Ga0496117_0022967_1431_2282 | 279 |
| 237 | 3300048920 | Ga0496117_0052366 | Ga0496117_0052366_354_1193 | 279 |
| 238 | 3300048920 | Ga0496117_0079561 | Ga0496117_0079561_1026_1931 | 279 |
| 239 | 3300048921 | Ga0496118_0003977 | Ga0496118_0003977_162_1001 | 279 |
| 240 | 3300048921 | Ga0496118_0027984 | Ga0496118_0027984_1869_2720 | 279 |
| 241 | 3300048924 | Ga0496121_0001672 | Ga0496121_0001672_7438_8337 | 279 |
| 242 | 3300048924 | Ga0496121_0009918 | Ga0496121_0009918_8721_9560 | 279 |
| 243 | 3300048925 | Ga0496122_0003693 | Ga0496122_0003693_16623_17528 | 279 |
| 244 | 3300048925 | Ga0496122_0194130 | Ga0496122_0194130_44_886 | 279 |
| 245 | 3300048926 | Ga0496123_0000457 | Ga0496123_0000457_133_1038 | 279 |
| 246 | 3300048927 | Ga0496124_0006822 | Ga0496124_0006822_8200_9039 | 279 |
| 247 | 3300048927 | Ga0496124_0006882 | Ga0496124_0006882_11121_12020 | 279 |
| 248 | 3300048927 | Ga0496124_0171459 | Ga0496124_0171459_283_1125 | 279 |
| 249 | 3300048927 | Ga0496124_0293529 | Ga0496124_0293529_310_1149 | 279 |
| 250 | 3300048928 | Ga0496125_0004371 | Ga0496125_0004371_9526_10377 | 279 |
| 251 | 3300048928 | Ga0496125_0013788 | Ga0496125_0013788_3122_4021 | 279 |
| 252 | 3300048928 | Ga0496125_0092833 | Ga0496125_0092833_1286_2128 | 279 |
| 253 | 3300048928 | Ga0496125_0318063 | Ga0496125_0318063_11_862 | 279 |
| 254 | 3300048929 | Ga0496126_0002255 | Ga0496126_0002255_5973_6878 | 279 |
| 255 | 3300049460 | Ga0495682_0021473 | Ga0495682_0021473_14_853 | 279 |
| 256 | 3300049570 | Ga0501033_0236429 | Ga0501033_0236429_285_1124 | 279 |
| 257 | 3300049575 | Ga0501039_0242575 | Ga0501039_0242575_502_1341 | 279 |
| 258 | 3300049578 | Ga0501042_0143009 | Ga0501042_0143009_355_1194 | 279 |
| 259 | 3300049582 | Ga0501048_0222911 | Ga0501048_0222911_313_1152 | 279 |
| 260 | 3300049587 | Ga0501071_0323612 | Ga0501071_0323612_30_869 | 279 |
| 261 | 3300049587 | Ga0501071_0505370 | Ga0501071_0505370_59_898 | 279 |
| 262 | 3300049592 | Ga0501076_0153344 | Ga0501076_0153344_171_1010 | 279 |
| 263 | 3300049758 | Ga0501241_023346 | Ga0501241_023346_189_1028 | 279 |
| 264 | 3300053096 | Ga0500641_0013275 | Ga0500641_0013275_892_1731 | 279 |
| 265 | 3300053103 | Ga0500555_000886 | Ga0500555_000886_7781_8620 | 279 |
| 266 | 3300053104 | Ga0500556_0039178 | Ga0500556_0039178_796_1635 | 279 |
| 267 | 3300053118 | Ga0500594_0001273 | Ga0500594_0001273_49_888 | 279 |
| 268 | 3300053118 | Ga0500594_0041625 | Ga0500594_0041625_324_1163 | 279 |
| 269 | 3300053122 | Ga0500608_000298 | Ga0500608_000298_12015_12854 | 279 |
| 270 | 3300053125 | Ga0500618_018611 | Ga0500618_018611_37_876 | 279 |
| 271 | 3300053134 | Ga0500658_0000284 | Ga0500658_0000284_19030_19869 | 279 |
| 272 | 3300053138 | Ga0500564_004573 | Ga0500564_004573_1270_2109 | 279 |
| 273 | 3300053142 | Ga0500577_0145193 | Ga0500577_0145193_126_965 | 279 |
| 274 | 3300053153 | Ga0500616_0012922 | Ga0500616_0012922_1899_2738 | 279 |
| 275 | 3300053154 | Ga0500619_000038 | Ga0500619_000038_26497_27336 | 279 |
| 276 | 3300053729 | Ga0500625_000001 | Ga0500625_000001_102569_103408 | 279 |
| 277 | 3300054114 | Ga0501084_0306092 | Ga0501084_0306092_114_953 | 279 |
| 278 | 2162886006 | SwRhRL3b_contig_728105 | SwRhRL3b_0067.00001710 | 280 |
| 279 | 2162886007 | SwRhRL2b_contig_1724569 | SwRhRL2b_0374.00002730 | 280 |
| 280 | 2162886007 | SwRhRL2b_contig_2992305 | SwRhRL2b_0795.00001290 | 280 |
| 281 | 3300000043 | ARcpr5yngRDRAFT_c001119 | ARcpr5yngRDRAFT_0011192 | 280 |
| 282 | 3300001904 | JGI24736J21556_1000628 | JGI24736J21556_10006284 | 280 |
| 283 | 3300001915 | JGI24741J21665_1000412 | JGI24741J21665_10004129 | 280 |
| 284 | 3300001915 | JGI24741J21665_1001567 | JGI24741J21665_10015675 | 280 |
| 285 | 3300001915 | JGI24741J21665_1007882 | JGI24741J21665_10078823 | 280 |
| 286 | 3300001979 | JGI24740J21852_10001161 | JGI24740J21852_100011613 | 280 |
| 287 | 3300001979 | JGI24740J21852_10002608 | JGI24740J21852_100026084 | 280 |
| 288 | 3300001979 | JGI24740J21852_10002728 | JGI24740J21852_1000272810 | 280 |
| 289 | 3300001979 | JGI24740J21852_10044008 | JGI24740J21852_100440082 | 280 |
| 290 | 3300001989 | JGI24739J22299_10000474 | JGI24739J22299_100004744 | 280 |
| 291 | 3300001989 | JGI24739J22299_10000894 | JGI24739J22299_100008949 | 280 |
| 292 | 3300001989 | JGI24739J22299_10002269 | JGI24739J22299_100022695 | 280 |
| 293 | 3300001989 | JGI24739J22299_10043286 | JGI24739J22299_100432863 | 280 |
| 294 | 3300001990 | JGI24737J22298_10000777 | JGI24737J22298_100007774 | 280 |
| 295 | 3300001990 | JGI24737J22298_10004720 | JGI24737J22298_100047202 | 280 |
| 296 | 3300001990 | JGI24737J22298_10022827 | JGI24737J22298_100228273 | 280 |
| 297 | 3300002067 | JGI24735J21928_10001703 | JGI24735J21928_100017035 | 280 |
| 298 | 3300002067 | JGI24735J21928_10007611 | JGI24735J21928_100076114 | 280 |
| 299 | 3300002067 | JGI24735J21928_10012271 | JGI24735J21928_100122711 | 280 |
| 300 | 3300002070 | JGI24750J21931_1000672 | JGI24750J21931_10006726 | 280 |
| 301 | 3300002074 | JGI24748J21848_1000084 | JGI24748J21848_100008429 | 280 |
| 302 | 3300002074 | JGI24748J21848_1001561 | JGI24748J21848_10015612 | 280 |
| 303 | 3300002075 | JGI24738J21930_10000342 | JGI24738J21930_100003428 | 280 |
| 304 | 3300002075 | JGI24738J21930_10001583 | JGI24738J21930_100015834 | 280 |
| 305 | 3300002075 | JGI24738J21930_10002238 | JGI24738J21930_100022385 | 280 |
| 306 | 3300002075 | JGI24738J21930_10002496 | JGI24738J21930_100024962 | 280 |
| 307 | 3300002076 | JGI24749J21850_1000368 | JGI24749J21850_10003682 | 280 |
| 308 | 3300002077 | JGI24744J21845_10002073 | JGI24744J21845_100020733 | 280 |
| 309 | 3300002239 | JGI24034J26672_10000018 | JGI24034J26672_10000018127 | 280 |
| 310 | 3300002244 | JGI24742J22300_10002759 | JGI24742J22300_100027594 | 280 |
| 311 | 3300002459 | JGI24751J29686_10000254 | JGI24751J29686_1000025410 | 280 |
| 312 | 3300003214 | JGI25165J46597_1000021 | JGI25165J46597_1000021184 | 280 |
| 313 | 3300003215 | JGI25153J46596_10000006 | JGI25153J46596_10000006119 | 280 |
| 314 | 3300003215 | JGI25153J46596_10002634 | JGI25153J46596_100026348 | 280 |
| 315 | 3300003771 | Ga0055526_1000009 | Ga0055526_1000009181 | 280 |
| 316 | 3300003773 | Ga0055537_1000650 | Ga0055537_100065010 | 280 |
| 317 | 3300003775 | Ga0055524_1000115 | Ga0055524_100011515 | 280 |
| 318 | 3300003784 | Ga0055534_1003258 | Ga0055534_10032584 | 280 |
| 319 | 3300003791 | Ga0055530_10004411 | Ga0055530_100044118 | 280 |
| 320 | 3300003794 | Ga0055531_10000961 | Ga0055531_100009617 | 280 |
| 321 | 3300005262 | Ga0065165_1002167 | Ga0065165_100216716 | 280 |
| 322 | 3300005262 | Ga0065165_1003474 | Ga0065165_10034748 | 280 |
| 323 | 3300005262 | Ga0065165_1005126 | Ga0065165_10051262 | 280 |
| 324 | 3300005289 | Ga0065704_10001087 | Ga0065704_100010875 | 280 |
| 325 | 3300005289 | Ga0065704_10070333 | Ga0065704_1007033318 | 280 |
| 326 | 3300005289 | Ga0065704_10122357 | Ga0065704_101223572 | 280 |
| 327 | 3300005295 | Ga0065707_10082048 | Ga0065707_100820489 | 280 |
| 328 | 3300005295 | Ga0065707_10087646 | Ga0065707_100876464 | 280 |
| 329 | 3300005295 | Ga0065707_10090188 | Ga0065707_100901883 | 280 |
| 330 | 3300005295 | Ga0065707_10091077 | Ga0065707_100910773 | 280 |
| 331 | 3300005295 | Ga0065707_10101741 | Ga0065707_101017411 | 280 |
| 332 | 3300005327 | Ga0070658_10000167 | Ga0070658_1000016750 | 280 |
| 333 | 3300005327 | Ga0070658_10001013 | Ga0070658_100010133 | 280 |
| 334 | 3300005327 | Ga0070658_10005110 | Ga0070658_100051102 | 280 |
| 335 | 3300005327 | Ga0070658_10011645 | Ga0070658_100116452 | 280 |
| 336 | 3300005327 | Ga0070658_10012920 | Ga0070658_100129202 | 280 |
| 337 | 3300005327 | Ga0070658_10064528 | Ga0070658_100645284 | 280 |
| 338 | 3300005327 | Ga0070658_10157304 | Ga0070658_101573042 | 280 |
| 339 | 3300005327 | Ga0070658_10325650 | Ga0070658_103256502 | 280 |
| 340 | 3300005328 | Ga0070676_10000192 | Ga0070676_1000019214 | 280 |
| 341 | 3300005328 | Ga0070676_10057017 | Ga0070676_100570171 | 280 |
| 342 | 3300005329 | Ga0070683_100418141 | Ga0070683_1004181411 | 280 |
| 343 | 3300005330 | Ga0070690_100000212 | Ga0070690_10000021240 | 280 |
| 344 | 3300005331 | Ga0070670_100330408 | Ga0070670_1003304082 | 280 |
| 345 | 3300005334 | Ga0068869_100000163 | Ga0068869_1000001635 | 280 |
| 346 | 3300005335 | Ga0070666_10326247 | Ga0070666_103262471 | 280 |
| 347 | 3300005338 | Ga0068868_100001386 | Ga0068868_1000013861 | 280 |
| 348 | 3300005338 | Ga0068868_100138869 | Ga0068868_1001388692 | 280 |
| 349 | 3300005339 | Ga0070660_100000222 | Ga0070660_10000022219 | 280 |
| 350 | 3300005339 | Ga0070660_100038822 | Ga0070660_1000388223 | 280 |
| 351 | 3300005339 | Ga0070660_100045768 | Ga0070660_1000457682 | 280 |
| 352 | 3300005339 | Ga0070660_100070757 | Ga0070660_1000707573 | 280 |
| 353 | 3300005339 | Ga0070660_100121179 | Ga0070660_1001211793 | 280 |
| 354 | 3300005340 | Ga0070689_100001547 | Ga0070689_10000154714 | 280 |
| 355 | 3300005344 | Ga0070661_100000327 | Ga0070661_10000032716 | 280 |
| 356 | 3300005344 | Ga0070661_100274660 | Ga0070661_1002746602 | 280 |
| 357 | 3300005344 | Ga0070661_100380887 | Ga0070661_1003808871 | 280 |
| 358 | 3300005347 | Ga0070668_100023619 | Ga0070668_1000236193 | 280 |
| 359 | 3300005347 | Ga0070668_100073194 | Ga0070668_1000731943 | 280 |
| 360 | 3300005347 | Ga0070668_100219096 | Ga0070668_1002190963 | 280 |
| 361 | 3300005353 | Ga0070669_100000143 | Ga0070669_10000014317 | 280 |
| 362 | 3300005353 | Ga0070669_100001464 | Ga0070669_1000014645 | 280 |
| 363 | 3300005354 | Ga0070675_100011917 | Ga0070675_1000119173 | 280 |
| 364 | 3300005354 | Ga0070675_100453006 | Ga0070675_1004530061 | 280 |
| 365 | 3300005355 | Ga0070671_100011033 | Ga0070671_1000110338 | 280 |
| 366 | 3300005355 | Ga0070671_100019820 | Ga0070671_1000198202 | 280 |
| 367 | 3300005355 | Ga0070671_100073254 | Ga0070671_1000732543 | 280 |
| 368 | 3300005356 | Ga0070674_100001288 | Ga0070674_1000012881 | 280 |
| 369 | 3300005356 | Ga0070674_100005654 | Ga0070674_1000056544 | 280 |
| 370 | 3300005364 | Ga0070673_100000011 | Ga0070673_10000001131 | 280 |
| 371 | 3300005365 | Ga0070688_100002657 | Ga0070688_1000026579 | 280 |
| 372 | 3300005366 | Ga0070659_100047972 | Ga0070659_1000479723 | 280 |
| 373 | 3300005366 | Ga0070659_100455523 | Ga0070659_1004555231 | 280 |
| 374 | 3300005367 | Ga0070667_100000210 | Ga0070667_10000021031 | 280 |
| 375 | 3300005367 | Ga0070667_100041142 | Ga0070667_1000411423 | 280 |
| 376 | 3300005367 | Ga0070667_100297097 | Ga0070667_1002970972 | 280 |
| 377 | 3300005439 | Ga0070711_100324583 | Ga0070711_1003245832 | 280 |
| 378 | 3300005455 | Ga0070663_100000422 | Ga0070663_10000042221 | 280 |
| 379 | 3300005455 | Ga0070663_100001266 | Ga0070663_1000012668 | 280 |
| 380 | 3300005456 | Ga0070678_100011088 | Ga0070678_1000110882 | 280 |
| 381 | 3300005457 | Ga0070662_100029752 | Ga0070662_1000297524 | 280 |
| 382 | 3300005457 | Ga0070662_100044323 | Ga0070662_1000443233 | 280 |
| 383 | 3300005457 | Ga0070662_100049006 | Ga0070662_1000490063 | 280 |
| 384 | 3300005458 | Ga0070681_10008671 | Ga0070681_100086713 | 280 |
| 385 | 3300005459 | Ga0068867_100000049 | Ga0068867_10000004939 | 280 |
| 386 | 3300005466 | Ga0070685_10003150 | Ga0070685_100031502 | 280 |
| 387 | 3300005471 | Ga0070698_100032618 | Ga0070698_1000326183 | 280 |
| 388 | 3300005530 | Ga0070679_100361108 | Ga0070679_1003611082 | 280 |
| 389 | 3300005535 | Ga0070684_100174406 | Ga0070684_1001744062 | 280 |
| 390 | 3300005535 | Ga0070684_100237583 | Ga0070684_1002375832 | 280 |
| 391 | 3300005539 | Ga0068853_100027452 | Ga0068853_1000274522 | 280 |
| 392 | 3300005539 | Ga0068853_100126808 | Ga0068853_1001268082 | 280 |
| 393 | 3300005539 | Ga0068853_100178407 | Ga0068853_1001784073 | 280 |
| 394 | 3300005539 | Ga0068853_100376794 | Ga0068853_1003767942 | 280 |
| 395 | 3300005543 | Ga0070672_100017723 | Ga0070672_1000177235 | 280 |
| 396 | 3300005544 | Ga0070686_100000331 | Ga0070686_1000003312 | 280 |
| 397 | 3300005548 | Ga0070665_100000011 | Ga0070665_10000001196 | 280 |
| 398 | 3300005548 | Ga0070665_100000056 | Ga0070665_10000005659 | 280 |
| 399 | 3300005548 | Ga0070665_100089019 | Ga0070665_1000890193 | 280 |
| 400 | 3300005548 | Ga0070665_100239550 | Ga0070665_1002395502 | 280 |
| 401 | 3300005563 | Ga0068855_100000265 | Ga0068855_10000026525 | 280 |
| 402 | 3300005563 | Ga0068855_100002478 | Ga0068855_10000247812 | 280 |
| 403 | 3300005563 | Ga0068855_100032538 | Ga0068855_1000325386 | 280 |
| 404 | 3300005563 | Ga0068855_100429644 | Ga0068855_1004296442 | 280 |
| 405 | 3300005563 | Ga0068855_100508820 | Ga0068855_1005088202 | 280 |
| 406 | 3300005564 | Ga0070664_100105392 | Ga0070664_1001053922 | 280 |
| 407 | 3300005564 | Ga0070664_100253589 | Ga0070664_1002535892 | 280 |
| 408 | 3300005564 | Ga0070664_100404610 | Ga0070664_1004046102 | 280 |
| 409 | 3300005577 | Ga0068857_100039516 | Ga0068857_1000395166 | 280 |
| 410 | 3300005577 | Ga0068857_100041607 | Ga0068857_1000416075 | 280 |
| 411 | 3300005577 | Ga0068857_100113403 | Ga0068857_1001134032 | 280 |
| 412 | 3300005577 | Ga0068857_100132375 | Ga0068857_1001323753 | 280 |
| 413 | 3300005577 | Ga0068857_100135121 | Ga0068857_1001351213 | 280 |
| 414 | 3300005578 | Ga0068854_100000405 | Ga0068854_1000004056 | 280 |
| 415 | 3300005578 | Ga0068854_100004023 | Ga0068854_1000040238 | 280 |
| 416 | 3300005578 | Ga0068854_100079912 | Ga0068854_1000799123 | 280 |
| 417 | 3300005578 | Ga0068854_100264040 | Ga0068854_1002640402 | 280 |
| 418 | 3300005614 | Ga0068856_100004268 | Ga0068856_1000042686 | 280 |
| 419 | 3300005614 | Ga0068856_100005115 | Ga0068856_1000051155 | 280 |
| 420 | 3300005615 | Ga0070702_100443588 | Ga0070702_1004435881 | 280 |
| 421 | 3300005616 | Ga0068852_100000544 | Ga0068852_1000005447 | 280 |
| 422 | 3300005616 | Ga0068852_100030135 | Ga0068852_1000301355 | 280 |
| 423 | 3300005616 | Ga0068852_100272273 | Ga0068852_1002722732 | 280 |
| 424 | 3300005616 | Ga0068852_100305815 | Ga0068852_1003058152 | 280 |
| 425 | 3300005618 | Ga0068864_100000088 | Ga0068864_10000008818 | 280 |
| 426 | 3300005618 | Ga0068864_100001540 | Ga0068864_10000154010 | 280 |
| 427 | 3300005841 | Ga0068863_100000158 | Ga0068863_10000015832 | 280 |
| 428 | 3300005841 | Ga0068863_100000925 | Ga0068863_10000092538 | 280 |
| 429 | 3300005842 | Ga0068858_100000094 | Ga0068858_10000009438 | 280 |
| 430 | 3300005842 | Ga0068858_100000149 | Ga0068858_10000014968 | 280 |
| 431 | 3300005842 | Ga0068858_100002113 | Ga0068858_1000021133 | 280 |
| 432 | 3300005842 | Ga0068858_100009628 | Ga0068858_1000096282 | 280 |
| 433 | 3300005843 | Ga0068860_100001798 | Ga0068860_10000179831 | 280 |
| 434 | 3300005844 | Ga0068862_100003339 | Ga0068862_10000333910 | 280 |
| 435 | 3300005844 | Ga0068862_100012900 | Ga0068862_1000129007 | 280 |
| 436 | 3300005844 | Ga0068862_100191054 | Ga0068862_1001910543 | 280 |
| 437 | 3300005937 | Ga0081455_10000072 | Ga0081455_1000007237 | 280 |
| 438 | 3300005937 | Ga0081455_10014422 | Ga0081455_100144228 | 280 |
| 439 | 3300005985 | Ga0081539_10019600 | Ga0081539_100196003 | 280 |
| 440 | 3300006042 | Ga0075368_10000367 | Ga0075368_100003672 | 280 |
| 441 | 3300006058 | Ga0075432_10001680 | Ga0075432_100016805 | 280 |
| 442 | 3300006178 | Ga0075367_10001292 | Ga0075367_100012925 | 280 |
| 443 | 3300006186 | Ga0075369_10070024 | Ga0075369_100700242 | 280 |
| 444 | 3300006195 | Ga0075366_10000082 | Ga0075366_1000008212 | 280 |
| 445 | 3300006195 | Ga0075366_10042459 | Ga0075366_100424592 | 280 |
| 446 | 3300006195 | Ga0075366_10147536 | Ga0075366_101475362 | 280 |
| 447 | 3300006195 | Ga0075366_10152320 | Ga0075366_101523202 | 280 |
| 448 | 3300006237 | Ga0097621_100003864 | Ga0097621_1000038641 | 280 |
| 449 | 3300006237 | Ga0097621_100116871 | Ga0097621_1001168711 | 280 |
| 450 | 3300006353 | Ga0075370_10007132 | Ga0075370_100071325 | 280 |
| 451 | 3300006353 | Ga0075370_10024315 | Ga0075370_100243153 | 280 |
| 452 | 3300006358 | Ga0068871_100016763 | Ga0068871_1000167633 | 280 |
| 453 | 3300006358 | Ga0068871_100025482 | Ga0068871_1000254825 | 280 |
| 454 | 3300006871 | Ga0075434_100092271 | Ga0075434_1000922713 | 280 |
| 455 | 3300006881 | Ga0068865_100000012 | Ga0068865_10000001293 | 280 |
| 456 | 3300006881 | Ga0068865_100114330 | Ga0068865_1001143302 | 280 |
| 457 | 3300006914 | Ga0075436_100051150 | Ga0075436_1000511502 | 280 |
| 458 | 3300006931 | Ga0097620_100271514 | Ga0097620_1002715142 | 280 |
| 459 | 3300006946 | Ga0079104_1010088 | Ga0079104_10100884 | 280 |
| 460 | 3300009011 | Ga0105251_10091874 | Ga0105251_100918742 | 280 |
| 461 | 3300009092 | Ga0105250_10000014 | Ga0105250_1000001411 | 280 |
| 462 | 3300009092 | Ga0105250_10008693 | Ga0105250_100086933 | 280 |
| 463 | 3300009093 | Ga0105240_10016880 | Ga0105240_100168808 | 280 |
| 464 | 3300009093 | Ga0105240_10078124 | Ga0105240_100781245 | 280 |
| 465 | 3300009093 | Ga0105240_10325764 | Ga0105240_103257643 | 280 |
| 466 | 3300009098 | Ga0105245_10000097 | Ga0105245_100000979 | 280 |
| 467 | 3300009098 | Ga0105245_10000529 | Ga0105245_1000052912 | 280 |
| 468 | 3300009098 | Ga0105245_10070673 | Ga0105245_100706733 | 280 |
| 469 | 3300009098 | Ga0105245_10584711 | Ga0105245_105847112 | 280 |
| 470 | 3300009101 | Ga0105247_10030374 | Ga0105247_100303744 | 280 |
| 471 | 3300009147 | Ga0114129_10431909 | Ga0114129_104319092 | 280 |
| 472 | 3300009148 | Ga0105243_10000164 | Ga0105243_100001646 | 280 |
| 473 | 3300009148 | Ga0105243_10000297 | Ga0105243_1000029731 | 280 |
| 474 | 3300009148 | Ga0105243_10087297 | Ga0105243_100872974 | 280 |
| 475 | 3300009174 | Ga0105241_10005018 | Ga0105241_1000501810 | 280 |
| 476 | 3300009174 | Ga0105241_10025210 | Ga0105241_100252104 | 280 |
| 477 | 3300009176 | Ga0105242_10000645 | Ga0105242_100006452 | 280 |
| 478 | 3300009176 | Ga0105242_10248497 | Ga0105242_102484973 | 280 |
| 479 | 3300009177 | Ga0105248_10004976 | Ga0105248_100049769 | 280 |
| 480 | 3300009177 | Ga0105248_10021768 | Ga0105248_100217685 | 280 |
| 481 | 3300009177 | Ga0105248_10111946 | Ga0105248_101119463 | 280 |
| 482 | 3300009177 | Ga0105248_10284510 | Ga0105248_102845101 | 280 |
| 483 | 3300009545 | Ga0105237_10075160 | Ga0105237_100751604 | 280 |
| 484 | 3300009545 | Ga0105237_10086697 | Ga0105237_100866972 | 280 |
| 485 | 3300009551 | Ga0105238_10017041 | Ga0105238_100170416 | 280 |
| 486 | 3300009551 | Ga0105238_10394997 | Ga0105238_103949971 | 280 |
| 487 | 3300009553 | Ga0105249_10000079 | Ga0105249_1000007943 | 280 |
| 488 | 3300009553 | Ga0105249_10000443 | Ga0105249_1000044313 | 280 |
| 489 | 3300009553 | Ga0105249_10021563 | Ga0105249_100215637 | 280 |
| 490 | 3300010375 | Ga0105239_10063344 | Ga0105239_100633444 | 280 |
| 491 | 3300010375 | Ga0105239_10200749 | Ga0105239_102007493 | 280 |
| 492 | 3300011119 | Ga0105246_10006686 | Ga0105246_100066862 | 280 |
| 493 | 3300011119 | Ga0105246_10036288 | Ga0105246_100362883 | 280 |
| 494 | 3300012475 | Ga0157317_1000219 | Ga0157317_10002192 | 280 |
| 495 | 3300012513 | Ga0157326_1001312 | Ga0157326_10013122 | 280 |
| 496 | 3300013100 | Ga0157373_10014308 | Ga0157373_100143087 | 280 |
| 497 | 3300013100 | Ga0157373_10073403 | Ga0157373_100734032 | 280 |
| 498 | 3300013102 | Ga0157371_10000024 | Ga0157371_10000024153 | 280 |
| 499 | 3300013102 | Ga0157371_10047887 | Ga0157371_100478873 | 280 |
| 500 | 3300013104 | Ga0157370_10025702 | Ga0157370_100257026 | 280 |
| 501 | 3300013105 | Ga0157369_10057118 | Ga0157369_100571185 | 280 |
| 502 | 3300013296 | Ga0157374_10000936 | Ga0157374_1000093610 | 280 |
| 503 | 3300013296 | Ga0157374_10010980 | Ga0157374_100109806 | 280 |
| 504 | 3300013297 | Ga0157378_10001079 | Ga0157378_1000107910 | 280 |
| 505 | 3300013297 | Ga0157378_10091580 | Ga0157378_100915804 | 280 |
| 506 | 3300013306 | Ga0163162_10007763 | Ga0163162_100077634 | 280 |
| 507 | 3300013306 | Ga0163162_10062932 | Ga0163162_100629324 | 280 |
| 508 | 3300013306 | Ga0163162_10166472 | Ga0163162_101664723 | 280 |
| 509 | 3300013306 | Ga0163162_10185255 | Ga0163162_101852552 | 280 |
| 510 | 3300013306 | Ga0163162_10442795 | Ga0163162_104427952 | 280 |
| 511 | 3300013306 | Ga0163162_10601930 | Ga0163162_106019302 | 280 |
| 512 | 3300013307 | Ga0157372_10059106 | Ga0157372_100591063 | 280 |
| 513 | 3300013307 | Ga0157372_10177386 | Ga0157372_101773862 | 280 |
| 514 | 3300013308 | Ga0157375_10000294 | Ga0157375_100002949 | 280 |
| 515 | 3300013308 | Ga0157375_10381607 | Ga0157375_103816071 | 280 |
| 516 | 3300014325 | Ga0163163_10220316 | Ga0163163_102203163 | 280 |
| 517 | 3300014325 | Ga0163163_10486933 | Ga0163163_104869332 | 280 |
| 518 | 3300014326 | Ga0157380_10013680 | Ga0157380_100136803 | 280 |
| 519 | 3300014326 | Ga0157380_10032883 | Ga0157380_100328835 | 280 |
| 520 | 3300014326 | Ga0157380_10058373 | Ga0157380_100583734 | 280 |
| 521 | 3300014968 | Ga0157379_10000278 | Ga0157379_1000027812 | 280 |
| 522 | 3300014968 | Ga0157379_10041193 | Ga0157379_100411934 | 280 |
| 523 | 3300014968 | Ga0157379_10113552 | Ga0157379_101135522 | 280 |
| 524 | 3300014969 | Ga0157376_10000251 | Ga0157376_100002517 | 280 |
| 525 | 3300017792 | Ga0163161_10140722 | Ga0163161_101407223 | 280 |
| 526 | 3300017792 | Ga0163161_10155666 | Ga0163161_101556663 | 280 |
| 527 | 3300025223 | Ga0207672_1000210 | Ga0207672_10002104 | 280 |
| 528 | 3300025226 | Ga0209674_106031 | Ga0209674_1060312 | 280 |
| 529 | 3300025229 | Ga0209147_100302 | Ga0209147_10030227 | 280 |
| 530 | 3300025229 | Ga0209147_100780 | Ga0209147_10078014 | 280 |
| 531 | 3300025233 | Ga0209437_102017 | Ga0209437_1020172 | 280 |
| 532 | 3300025245 | Ga0207425_1004019 | Ga0207425_10040194 | 280 |
| 533 | 3300025253 | Ga0209677_106712 | Ga0209677_1067123 | 280 |
| 534 | 3300025261 | Ga0209233_1000065 | Ga0209233_1000065185 | 280 |
| 535 | 3300025263 | Ga0209565_1000008 | Ga0209565_100000864 | 280 |
| 536 | 3300025272 | Ga0209455_1014561 | Ga0209455_10145612 | 280 |
| 537 | 3300025273 | Ga0209673_1001306 | Ga0209673_10013062 | 280 |
| 538 | 3300025291 | Ga0209675_1000248 | Ga0209675_100024816 | 280 |
| 539 | 3300025291 | Ga0209675_1036876 | Ga0209675_10368762 | 280 |
| 540 | 3300025295 | Ga0209564_1000069 | Ga0209564_100006934 | 280 |
| 541 | 3300025297 | Ga0209758_1000001 | Ga0209758_10000011706 | 280 |
| 542 | 3300025297 | Ga0209758_1008432 | Ga0209758_10084322 | 280 |
| 543 | 3300025298 | Ga0209050_1006717 | Ga0209050_10067174 | 280 |
| 544 | 3300025299 | Ga0209256_1000009 | Ga0209256_1000009807 | 280 |
| 545 | 3300025299 | Ga0209256_1000010 | Ga0209256_1000010731 | 280 |
| 546 | 3300025304 | Ga0209257_1000524 | Ga0209257_10005248 | 280 |
| 547 | 3300025315 | Ga0207697_10007182 | Ga0207697_100071826 | 280 |
| 548 | 3300025321 | Ga0207656_10046123 | Ga0207656_100461232 | 280 |
| 549 | 3300025711 | Ga0207696_1000087 | Ga0207696_100008711 | 280 |
| 550 | 3300025711 | Ga0207696_1006001 | Ga0207696_10060013 | 280 |
| 551 | 3300025901 | Ga0207688_10040012 | Ga0207688_100400122 | 280 |
| 552 | 3300025903 | Ga0207680_10000009 | Ga0207680_10000009449 | 280 |
| 553 | 3300025903 | Ga0207680_10241635 | Ga0207680_102416352 | 280 |
| 554 | 3300025904 | Ga0207647_10000997 | Ga0207647_1000099724 | 280 |
| 555 | 3300025904 | Ga0207647_10004006 | Ga0207647_100040062 | 280 |
| 556 | 3300025904 | Ga0207647_10012963 | Ga0207647_100129635 | 280 |
| 557 | 3300025904 | Ga0207647_10018514 | Ga0207647_100185145 | 280 |
| 558 | 3300025904 | Ga0207647_10027052 | Ga0207647_100270523 | 280 |
| 559 | 3300025904 | Ga0207647_10114361 | Ga0207647_101143612 | 280 |
| 560 | 3300025907 | Ga0207645_10001889 | Ga0207645_1000188913 | 280 |
| 561 | 3300025907 | Ga0207645_10113318 | Ga0207645_101133183 | 280 |
| 562 | 3300025907 | Ga0207645_10214863 | Ga0207645_102148632 | 280 |
| 563 | 3300025907 | Ga0207645_10222713 | Ga0207645_102227131 | 280 |
| 564 | 3300025909 | Ga0207705_10000004 | Ga0207705_10000004203 | 280 |
| 565 | 3300025909 | Ga0207705_10000018 | Ga0207705_1000001824 | 280 |
| 566 | 3300025909 | Ga0207705_10000366 | Ga0207705_1000036620 | 280 |
| 567 | 3300025909 | Ga0207705_10000816 | Ga0207705_1000081610 | 280 |
| 568 | 3300025909 | Ga0207705_10042421 | Ga0207705_100424212 | 280 |
| 569 | 3300025909 | Ga0207705_10106866 | Ga0207705_101068662 | 280 |
| 570 | 3300025909 | Ga0207705_10149239 | Ga0207705_101492392 | 280 |
| 571 | 3300025909 | Ga0207705_10223750 | Ga0207705_102237501 | 280 |
| 572 | 3300025910 | Ga0207684_10201298 | Ga0207684_102012982 | 280 |
| 573 | 3300025911 | Ga0207654_10000319 | Ga0207654_100003196 | 280 |
| 574 | 3300025911 | Ga0207654_10001192 | Ga0207654_1000119210 | 280 |
| 575 | 3300025911 | Ga0207654_10028014 | Ga0207654_100280144 | 280 |
| 576 | 3300025913 | Ga0207695_10004104 | Ga0207695_1000410422 | 280 |
| 577 | 3300025913 | Ga0207695_10008455 | Ga0207695_1000845512 | 280 |
| 578 | 3300025913 | Ga0207695_10010364 | Ga0207695_100103648 | 280 |
| 579 | 3300025913 | Ga0207695_10016957 | Ga0207695_100169577 | 280 |
| 580 | 3300025913 | Ga0207695_10231605 | Ga0207695_102316053 | 280 |
| 581 | 3300025914 | Ga0207671_10000800 | Ga0207671_100008003 | 280 |
| 582 | 3300025914 | Ga0207671_10011333 | Ga0207671_100113334 | 280 |
| 583 | 3300025914 | Ga0207671_10070919 | Ga0207671_100709192 | 280 |
| 584 | 3300025919 | Ga0207657_10000606 | Ga0207657_1000060620 | 280 |
| 585 | 3300025919 | Ga0207657_10002728 | Ga0207657_100027288 | 280 |
| 586 | 3300025919 | Ga0207657_10003773 | Ga0207657_1000377311 | 280 |
| 587 | 3300025919 | Ga0207657_10013446 | Ga0207657_100134464 | 280 |
| 588 | 3300025919 | Ga0207657_10014710 | Ga0207657_100147104 | 280 |
| 589 | 3300025920 | Ga0207649_10055431 | Ga0207649_100554313 | 280 |
| 590 | 3300025921 | Ga0207652_10417777 | Ga0207652_104177771 | 280 |
| 591 | 3300025923 | Ga0207681_10000512 | Ga0207681_1000051219 | 280 |
| 592 | 3300025923 | Ga0207681_10000789 | Ga0207681_100007899 | 280 |
| 593 | 3300025924 | Ga0207694_10006783 | Ga0207694_100067838 | 280 |
| 594 | 3300025924 | Ga0207694_10011155 | Ga0207694_100111556 | 280 |
| 595 | 3300025924 | Ga0207694_10044196 | Ga0207694_100441964 | 280 |
| 596 | 3300025924 | Ga0207694_10135189 | Ga0207694_101351892 | 280 |
| 597 | 3300025924 | Ga0207694_10156565 | Ga0207694_101565652 | 280 |
| 598 | 3300025924 | Ga0207694_10157367 | Ga0207694_101573672 | 280 |
| 599 | 3300025924 | Ga0207694_10220676 | Ga0207694_102206762 | 280 |
| 600 | 3300025925 | Ga0207650_10000008 | Ga0207650_10000008404 | 280 |
| 601 | 3300025925 | Ga0207650_10285822 | Ga0207650_102858222 | 280 |
| 602 | 3300025926 | Ga0207659_10027564 | Ga0207659_100275645 | 280 |
| 603 | 3300025926 | Ga0207659_10180091 | Ga0207659_101800913 | 280 |
| 604 | 3300025927 | Ga0207687_10000580 | Ga0207687_1000058012 | 280 |
| 605 | 3300025927 | Ga0207687_10002448 | Ga0207687_100024488 | 280 |
| 606 | 3300025928 | Ga0207700_10196489 | Ga0207700_101964891 | 280 |
| 607 | 3300025931 | Ga0207644_10002084 | Ga0207644_1000208414 | 280 |
| 608 | 3300025931 | Ga0207644_10020510 | Ga0207644_100205103 | 280 |
| 609 | 3300025931 | Ga0207644_10216448 | Ga0207644_102164482 | 280 |
| 610 | 3300025932 | Ga0207690_10000213 | Ga0207690_1000021335 | 280 |
| 611 | 3300025932 | Ga0207690_10005085 | Ga0207690_100050857 | 280 |
| 612 | 3300025932 | Ga0207690_10085971 | Ga0207690_100859714 | 280 |
| 613 | 3300025933 | Ga0207706_10006648 | Ga0207706_100066485 | 280 |
| 614 | 3300025933 | Ga0207706_10047748 | Ga0207706_100477485 | 280 |
| 615 | 3300025933 | Ga0207706_10140539 | Ga0207706_101405393 | 280 |
| 616 | 3300025933 | Ga0207706_10147934 | Ga0207706_101479341 | 280 |
| 617 | 3300025934 | Ga0207686_10097603 | Ga0207686_100976033 | 280 |
| 618 | 3300025934 | Ga0207686_10365410 | Ga0207686_103654102 | 280 |
| 619 | 3300025935 | Ga0207709_10000123 | Ga0207709_1000012396 | 280 |
| 620 | 3300025935 | Ga0207709_10000299 | Ga0207709_100002999 | 280 |
| 621 | 3300025935 | Ga0207709_10300296 | Ga0207709_103002962 | 280 |
| 622 | 3300025935 | Ga0207709_10428996 | Ga0207709_104289962 | 280 |
| 623 | 3300025937 | Ga0207669_10000230 | Ga0207669_1000023019 | 280 |
| 624 | 3300025938 | Ga0207704_10000021 | Ga0207704_1000002131 | 280 |
| 625 | 3300025941 | Ga0207711_10005756 | Ga0207711_100057569 | 280 |
| 626 | 3300025941 | Ga0207711_10008938 | Ga0207711_100089383 | 280 |
| 627 | 3300025941 | Ga0207711_10026559 | Ga0207711_100265592 | 280 |
| 628 | 3300025941 | Ga0207711_10411374 | Ga0207711_104113742 | 280 |
| 629 | 3300025942 | Ga0207689_10000132 | Ga0207689_1000013230 | 280 |
| 630 | 3300025944 | Ga0207661_10511129 | Ga0207661_105111292 | 280 |
| 631 | 3300025945 | Ga0207679_10523028 | Ga0207679_105230282 | 280 |
| 632 | 3300025949 | Ga0207667_10000010 | Ga0207667_10000010115 | 280 |
| 633 | 3300025949 | Ga0207667_10000029 | Ga0207667_1000002938 | 280 |
| 634 | 3300025949 | Ga0207667_10004694 | Ga0207667_1000469412 | 280 |
| 635 | 3300025949 | Ga0207667_10122183 | Ga0207667_101221833 | 280 |
| 636 | 3300025949 | Ga0207667_10149916 | Ga0207667_101499163 | 280 |
| 637 | 3300025960 | Ga0207651_10000012 | Ga0207651_1000001291 | 280 |
| 638 | 3300025960 | Ga0207651_10200065 | Ga0207651_102000651 | 280 |
| 639 | 3300025961 | Ga0207712_10000030 | Ga0207712_10000030112 | 280 |
| 640 | 3300025961 | Ga0207712_10000046 | Ga0207712_10000046137 | 280 |
| 641 | 3300025961 | Ga0207712_10059600 | Ga0207712_100596002 | 280 |
| 642 | 3300025972 | Ga0207668_10017042 | Ga0207668_100170424 | 280 |
| 643 | 3300025972 | Ga0207668_10123084 | Ga0207668_101230842 | 280 |
| 644 | 3300025972 | Ga0207668_10183025 | Ga0207668_101830251 | 280 |
| 645 | 3300025972 | Ga0207668_10398703 | Ga0207668_103987032 | 280 |
| 646 | 3300025981 | Ga0207640_10000021 | Ga0207640_1000002141 | 280 |
| 647 | 3300025981 | Ga0207640_10001341 | Ga0207640_1000134112 | 280 |
| 648 | 3300025981 | Ga0207640_10007006 | Ga0207640_100070063 | 280 |
| 649 | 3300025981 | Ga0207640_10103477 | Ga0207640_101034772 | 280 |
| 650 | 3300025981 | Ga0207640_10281135 | Ga0207640_102811352 | 280 |
| 651 | 3300025981 | Ga0207640_10551790 | Ga0207640_105517901 | 280 |
| 652 | 3300025986 | Ga0207658_10000333 | Ga0207658_1000033329 | 280 |
| 653 | 3300025986 | Ga0207658_10007736 | Ga0207658_100077362 | 280 |
| 654 | 3300026023 | Ga0207677_10000170 | Ga0207677_1000017019 | 280 |
| 655 | 3300026023 | Ga0207677_10282750 | Ga0207677_102827502 | 280 |
| 656 | 3300026035 | Ga0207703_10000050 | Ga0207703_100000508 | 280 |
| 657 | 3300026035 | Ga0207703_10000665 | Ga0207703_1000066530 | 280 |
| 658 | 3300026035 | Ga0207703_10000948 | Ga0207703_100009486 | 280 |
| 659 | 3300026035 | Ga0207703_10001637 | Ga0207703_1000163717 | 280 |
| 660 | 3300026041 | Ga0207639_10011454 | Ga0207639_100114542 | 280 |
| 661 | 3300026041 | Ga0207639_10014903 | Ga0207639_100149034 | 280 |
| 662 | 3300026041 | Ga0207639_10034145 | Ga0207639_100341453 | 280 |
| 663 | 3300026041 | Ga0207639_10052337 | Ga0207639_100523373 | 280 |
| 664 | 3300026041 | Ga0207639_10240416 | Ga0207639_102404162 | 280 |
| 665 | 3300026041 | Ga0207639_10275067 | Ga0207639_102750672 | 280 |
| 666 | 3300026067 | Ga0207678_10000400 | Ga0207678_1000040038 | 280 |
| 667 | 3300026067 | Ga0207678_10002548 | Ga0207678_1000254810 | 280 |
| 668 | 3300026067 | Ga0207678_10003044 | Ga0207678_100030448 | 280 |
| 669 | 3300026067 | Ga0207678_10003534 | Ga0207678_100035346 | 280 |
| 670 | 3300026067 | Ga0207678_10064027 | Ga0207678_100640272 | 280 |
| 671 | 3300026078 | Ga0207702_10001123 | Ga0207702_1000112326 | 280 |
| 672 | 3300026078 | Ga0207702_10001257 | Ga0207702_100012579 | 280 |
| 673 | 3300026078 | Ga0207702_10004107 | Ga0207702_1000410710 | 280 |
| 674 | 3300026078 | Ga0207702_10004976 | Ga0207702_100049765 | 280 |
| 675 | 3300026078 | Ga0207702_10067961 | Ga0207702_100679614 | 280 |
| 676 | 3300026078 | Ga0207702_10271500 | Ga0207702_102715001 | 280 |
| 677 | 3300026088 | Ga0207641_10000063 | Ga0207641_1000006337 | 280 |
| 678 | 3300026088 | Ga0207641_10000118 | Ga0207641_10000118111 | 280 |
| 679 | 3300026089 | Ga0207648_10000051 | Ga0207648_1000005162 | 280 |
| 680 | 3300026095 | Ga0207676_10000312 | Ga0207676_1000031231 | 280 |
| 681 | 3300026095 | Ga0207676_10000362 | Ga0207676_100003626 | 280 |
| 682 | 3300026095 | Ga0207676_10001060 | Ga0207676_100010609 | 280 |
| 683 | 3300026095 | Ga0207676_10001111 | Ga0207676_1000111118 | 280 |
| 684 | 3300026116 | Ga0207674_10008204 | Ga0207674_1000820412 | 280 |
| 685 | 3300026116 | Ga0207674_10022081 | Ga0207674_100220813 | 280 |
| 686 | 3300026116 | Ga0207674_10038184 | Ga0207674_100381845 | 280 |
| 687 | 3300026116 | Ga0207674_10094103 | Ga0207674_100941032 | 280 |
| 688 | 3300026116 | Ga0207674_10123014 | Ga0207674_101230143 | 280 |
| 689 | 3300026121 | Ga0207683_10000449 | Ga0207683_1000044929 | 280 |
| 690 | 3300026142 | Ga0207698_10000019 | Ga0207698_1000001910 | 280 |
| 691 | 3300026142 | Ga0207698_10000595 | Ga0207698_1000059517 | 280 |
| 692 | 3300026142 | Ga0207698_10004840 | Ga0207698_100048406 | 280 |
| 693 | 3300026142 | Ga0207698_10032269 | Ga0207698_100322692 | 280 |
| 694 | 3300026142 | Ga0207698_10194280 | Ga0207698_101942803 | 280 |
| 695 | 3300026142 | Ga0207698_10358874 | Ga0207698_103588742 | 280 |
| 696 | 3300027866 | Ga0209813_10000040 | Ga0209813_1000004047 | 280 |
| 697 | 3300027876 | Ga0209974_10065527 | Ga0209974_100655271 | 280 |
| 698 | 3300027907 | Ga0207428_10010319 | Ga0207428_100103196 | 280 |
| 699 | 3300028379 | Ga0268266_10000063 | Ga0268266_1000006393 | 280 |
| 700 | 3300028379 | Ga0268266_10000066 | Ga0268266_10000066194 | 280 |
| 701 | 3300028379 | Ga0268266_10070145 | Ga0268266_100701453 | 280 |
| 702 | 3300028379 | Ga0268266_10168697 | Ga0268266_101686972 | 280 |
| 703 | 3300028380 | Ga0268265_10001366 | Ga0268265_100013669 | 280 |
| 704 | 3300028380 | Ga0268265_10063532 | Ga0268265_100635324 | 280 |
| 705 | 3300028381 | Ga0268264_10000130 | Ga0268264_10000130156 | 280 |
| 706 | 3300028786 | Ga0307517_10028837 | Ga0307517_100288373 | 280 |
| 707 | 3300028786 | Ga0307517_10033389 | Ga0307517_100333894 | 280 |
| 708 | 3300028786 | Ga0307517_10129486 | Ga0307517_101294862 | 280 |
| 709 | 3300028800 | Ga0265338_10010111 | Ga0265338_100101117 | 280 |
| 710 | 3300031251 | Ga0265327_10001037 | Ga0265327_1000103718 | 280 |
| 711 | 3300031251 | Ga0265327_10052803 | Ga0265327_100528032 | 280 |
| 712 | 3300031456 | Ga0307513_10030702 | Ga0307513_100307025 | 280 |
| 713 | 3300031616 | Ga0307508_10002212 | Ga0307508_100022126 | 280 |
| 714 | 3300031711 | Ga0265314_10000565 | Ga0265314_1000056511 | 280 |
| 715 | 3300031712 | Ga0265342_10001962 | Ga0265342_1000196211 | 280 |
| 716 | 3300031730 | Ga0307516_10000427 | Ga0307516_1000042712 | 280 |
| 717 | 3300031731 | Ga0307405_10003283 | Ga0307405_100032832 | 280 |
| 718 | 3300031824 | Ga0307413_10171546 | Ga0307413_101715461 | 280 |
| 719 | 3300031911 | Ga0307412_10000470 | Ga0307412_1000047017 | 280 |
| 720 | 3300031911 | Ga0307412_10009099 | Ga0307412_100090992 | 280 |
| 721 | 3300031911 | Ga0307412_10014154 | Ga0307412_100141543 | 280 |
| 722 | 3300031911 | Ga0307412_10016021 | Ga0307412_100160215 | 280 |
| 723 | 3300031911 | Ga0307412_10205603 | Ga0307412_102056032 | 280 |
| 724 | 3300032004 | Ga0307414_10000390 | Ga0307414_1000039013 | 280 |
| 725 | 3300032004 | Ga0307414_10000984 | Ga0307414_100009844 | 280 |
| 726 | 3300032004 | Ga0307414_10024875 | Ga0307414_100248753 | 280 |
| 727 | 3300032004 | Ga0307414_10481750 | Ga0307414_104817502 | 280 |
| 728 | 3300033180 | Ga0307510_10101383 | Ga0307510_101013833 | 280 |
| 729 | 3300035398 | Ga0316574_0082162 | Ga0316574_0082162_1090_1935 | 280 |
| 730 | 3300035691 | Ga0373931_0055613 | Ga0373931_0055613_878_1723 | 280 |
| 731 | 3300035724 | Ga0373933_0231521 | Ga0373933_0231521_232_1083 | 280 |
| 732 | 3300035725 | Ga0373947_0224754 | Ga0373947_0224754_186_1028 | 280 |
| 733 | 3300036401 | Ga0373937_0285570 | Ga0373937_0285570_354_1226 | 280 |
| 734 | 3300037068 | Ga0373925_0017278 | Ga0373925_0017278_640_1482 | 280 |
| 735 | 3300037312 | Ga0395899_0100903 | Ga0395899_0100903_105_950 | 280 |
| 736 | 3300037312 | Ga0395899_0105521 | Ga0395899_0105521_1090_1986 | 280 |
| 737 | 3300037312 | Ga0395899_0120549 | Ga0395899_0120549_346_1188 | 280 |
| 738 | 3300037418 | Ga0395900_0001466 | Ga0395900_0001466_124_1020 | 280 |
| 739 | 3300037418 | Ga0395900_0017250 | Ga0395900_0017250_4666_5508 | 280 |
| 740 | 3300037418 | Ga0395900_0386517 | Ga0395900_0386517_438_1283 | 280 |
| 741 | 3300037466 | Ga0395898_0055931 | Ga0395898_0055931_744_1586 | 280 |
| 742 | 3300037466 | Ga0395898_0069062 | Ga0395898_0069062_1902_2798 | 280 |
| 743 | 3300037466 | Ga0395898_0322527 | Ga0395898_0322527_551_1396 | 280 |
| 744 | 3300037471 | Ga0395905_0000335 | Ga0395905_0000335_28997_29893 | 280 |
| 745 | 3300037471 | Ga0395905_0003607 | Ga0395905_0003607_7758_8654 | 280 |
| 746 | 3300037471 | Ga0395905_0035512 | Ga0395905_0035512_3023_3919 | 280 |
| 747 | 3300037471 | Ga0395905_0073570 | Ga0395905_0073570_1796_2692 | 280 |
| 748 | 3300037471 | Ga0395905_0102393 | Ga0395905_0102393_836_1732 | 280 |
| 749 | 3300037471 | Ga0395905_0455196 | Ga0395905_0455196_140_1039 | 280 |
| 750 | 3300038443 | Ga0395901_0031477 | Ga0395901_0031477_806_1648 | 280 |
| 751 | 3300038443 | Ga0395901_0052148 | Ga0395901_0052148_2870_3766 | 280 |
| 752 | 3300038443 | Ga0395901_0161719 | Ga0395901_0161719_1178_2023 | 280 |
| 753 | 3300038443 | Ga0395901_0308758 | Ga0395901_0308758_394_1236 | 280 |
| 754 | 3300041462 | Ga0451806_192368 | Ga0451806_192368_177_1034 | 280 |
| 755 | 3300041498 | Ga0451841_0006845 | Ga0451841_0006845_212_1054 | 280 |
| 756 | 3300042005 | Ga0439448_0017020 | Ga0439448_0017020_1111_1953 | 280 |
| 757 | 3300042005 | Ga0439448_0020590 | Ga0439448_0020590_1017_1859 | 280 |
| 758 | 3300042007 | Ga0439449_0005387 | Ga0439449_0005387_666_1508 | 280 |
| 759 | 3300042012 | Ga0439455_0034219 | Ga0439455_0034219_71_913 | 280 |
| 760 | 3300042157 | Ga0439458_0000017 | Ga0439458_0000017_24848_25744 | 280 |
| 761 | 3300042157 | Ga0439458_0001648 | Ga0439458_0001648_1535_2389 | 280 |
| 762 | 3300042157 | Ga0439458_0003585 | Ga0439458_0003585_1225_2067 | 280 |
| 763 | 3300044658 | Ga0466972_0002717 | Ga0466972_0002717_1315_2157 | 280 |
| 764 | 3300044693 | Ga0466961_0042863 | Ga0466961_0042863_1565_2407 | 280 |
| 765 | 3300044693 | Ga0466961_0207696 | Ga0466961_0207696_68_910 | 280 |
| 766 | 3300044694 | Ga0466963_0017972 | Ga0466963_0017972_799_1641 | 280 |
| 767 | 3300044706 | Ga0466964_0007648 | Ga0466964_0007648_967_1809 | 280 |
| 768 | 3300044719 | Ga0466971_0000962 | Ga0466971_0000962_4817_5659 | 280 |
| 769 | 3300044842 | Ga0466957_0103183 | Ga0466957_0103183_190_1032 | 280 |
| 770 | 3300045836 | Ga0466958_0069852 | Ga0466958_0069852_582_1424 | 280 |
| 771 | 3300046452 | Ga0495617_004384 | Ga0495617_004384_3978_4874 | 280 |
| 772 | 3300046453 | Ga0495627_000127 | Ga0495627_000127_12537_13433 | 280 |
| 773 | 3300046453 | Ga0495627_002778 | Ga0495627_002778_2308_3243 | 280 |
| 774 | 3300046460 | Ga0495638_0000893 | Ga0495638_0000893_22013_22879 | 280 |
| 775 | 3300046471 | Ga0495650_0000116 | Ga0495650_0000116_111453_112349 | 280 |
| 776 | 3300046471 | Ga0495650_0001253 | Ga0495650_0001253_11088_11933 | 280 |
| 777 | 3300046491 | Ga0495584_0025735 | Ga0495584_0025735_568_1461 | 280 |
| 778 | 3300046492 | Ga0495585_0001465 | Ga0495585_0001465_4195_5091 | 280 |
| 779 | 3300046506 | Ga0495583_0000657 | Ga0495583_0000657_14075_14971 | 280 |
| 780 | 3300046506 | Ga0495583_0011117 | Ga0495583_0011117_1888_2784 | 280 |
| 781 | 3300046506 | Ga0495583_0023034 | Ga0495583_0023034_1324_2220 | 280 |
| 782 | 3300046506 | Ga0495583_0024408 | Ga0495583_0024408_881_1777 | 280 |
| 783 | 3300046507 | Ga0495606_0000977 | Ga0495606_0000977_821_1714 | 280 |
| 784 | 3300046507 | Ga0495606_0003584 | Ga0495606_0003584_2385_3230 | 280 |
| 785 | 3300046512 | Ga0495610_0000041 | Ga0495610_0000041_33733_34641 | 280 |
| 786 | 3300046512 | Ga0495610_0002305 | Ga0495610_0002305_10699_11595 | 280 |
| 787 | 3300046512 | Ga0495610_0164618 | Ga0495610_0164618_79_921 | 280 |
| 788 | 3300046513 | Ga0495616_0087226 | Ga0495616_0087226_533_1429 | 280 |
| 789 | 3300046518 | Ga0495631_0089509 | Ga0495631_0089509_164_1060 | 280 |
| 790 | 3300046519 | Ga0495632_0000038 | Ga0495632_0000038_141355_142287 | 280 |
| 791 | 3300046520 | Ga0495637_0003726 | Ga0495637_0003726_561_1454 | 280 |
| 792 | 3300046520 | Ga0495637_0011549 | Ga0495637_0011549_2847_3689 | 280 |
| 793 | 3300046520 | Ga0495637_0016583 | Ga0495637_0016583_567_1502 | 280 |
| 794 | 3300046522 | Ga0495643_0000004 | Ga0495643_0000004_265462_266370 | 280 |
| 795 | 3300046522 | Ga0495643_0000088 | Ga0495643_0000088_13353_14246 | 280 |
| 796 | 3300046522 | Ga0495643_0014694 | Ga0495643_0014694_983_1876 | 280 |
| 797 | 3300046522 | Ga0495643_0152261 | Ga0495643_0152261_175_1068 | 280 |
| 798 | 3300046522 | Ga0495643_0152295 | Ga0495643_0152295_28_870 | 280 |
| 799 | 3300046524 | Ga0495648_0000108 | Ga0495648_0000108_90214_91107 | 280 |
| 800 | 3300046524 | Ga0495648_0007834 | Ga0495648_0007834_7368_8303 | 280 |
| 801 | 3300046524 | Ga0495648_0032071 | Ga0495648_0032071_1867_2760 | 280 |
| 802 | 3300046524 | Ga0495648_0224910 | Ga0495648_0224910_21_863 | 280 |
| 803 | 3300046525 | Ga0495663_0000013 | Ga0495663_0000013_13350_14243 | 280 |
| 804 | 3300046525 | Ga0495663_0005255 | Ga0495663_0005255_337_1233 | 280 |
| 805 | 3300046542 | Ga0495597_0033805 | Ga0495597_0033805_649_1491 | 280 |
| 806 | 3300046558 | Ga0495633_0000212 | Ga0495633_0000212_13477_14370 | 280 |
| 807 | 3300046558 | Ga0495633_0000670 | Ga0495633_0000670_17173_18066 | 280 |
| 808 | 3300046558 | Ga0495633_0013362 | Ga0495633_0013362_324_1169 | 280 |
| 809 | 3300046558 | Ga0495633_0014845 | Ga0495633_0014845_2780_3676 | 280 |
| 810 | 3300046616 | Ga0495668_0000085 | Ga0495668_0000085_28954_29847 | 280 |
| 811 | 3300046616 | Ga0495668_0067012 | Ga0495668_0067012_693_1535 | 280 |
| 812 | 3300046660 | Ga0495625_0000014 | Ga0495625_0000014_254039_254881 | 280 |
| 813 | 3300046660 | Ga0495625_0000072 | Ga0495625_0000072_110444_111340 | 280 |
| 814 | 3300046660 | Ga0495625_0005016 | Ga0495625_0005016_1245_2141 | 280 |
| 815 | 3300046660 | Ga0495625_0013733 | Ga0495625_0013733_1015_1881 | 280 |
| 816 | 3300046660 | Ga0495625_0027330 | Ga0495625_0027330_1121_1963 | 280 |
| 817 | 3300046660 | Ga0495625_0063251 | Ga0495625_0063251_252_1148 | 280 |
| 818 | 3300046684 | Ga0495669_0000192 | Ga0495669_0000192_22349_23245 | 280 |
| 819 | 3300046684 | Ga0495669_0022153 | Ga0495669_0022153_633_1475 | 280 |
| 820 | 3300046689 | Ga0495613_0000380 | Ga0495613_0000380_36148_37020 | 280 |
| 821 | 3300046692 | Ga0495671_0000048 | Ga0495671_0000048_13480_14373 | 280 |
| 822 | 3300046692 | Ga0495671_0009905 | Ga0495671_0009905_2590_3471 | 280 |
| 823 | 3300047323 | Ga0495683_0001323 | Ga0495683_0001323_2021_2917 | 280 |
| 824 | 3300047443 | Ga0495687_000217 | Ga0495687_000217_30317_31213 | 280 |
| 825 | 3300047443 | Ga0495687_000270 | Ga0495687_000270_28368_29261 | 280 |
| 826 | 3300047445 | Ga0495677_0003186 | Ga0495677_0003186_1915_2808 | 280 |
| 827 | 3300047445 | Ga0495677_0003823 | Ga0495677_0003823_2142_3038 | 280 |
| 828 | 3300047470 | Ga0495681_0000022 | Ga0495681_0000022_21038_21934 | 280 |
| 829 | 3300047472 | Ga0495686_0000736 | Ga0495686_0000736_37531_38436 | 280 |
| 830 | 3300047472 | Ga0495686_0006128 | Ga0495686_0006128_1218_2114 | 280 |
| 831 | 3300047472 | Ga0495686_0015268 | Ga0495686_0015268_1350_2282 | 280 |
| 832 | 3300047472 | Ga0495686_0019225 | Ga0495686_0019225_507_1352 | 280 |
| 833 | 3300047472 | Ga0495686_0050645 | Ga0495686_0050645_1264_2196 | 280 |
| 834 | 3300047472 | Ga0495686_0070463 | Ga0495686_0070463_26_931 | 280 |
| 835 | 3300048090 | Ga0495615_0000018 | Ga0495615_0000018_44895_45806 | 280 |
| 836 | 3300048903 | Ga0496100_0007205 | Ga0496100_0007205_2642_3502 | 280 |
| 837 | 3300048904 | Ga0496101_0027708 | Ga0496101_0027708_2703_3563 | 280 |
| 838 | 3300048905 | Ga0496102_0000230 | Ga0496102_0000230_33905_34801 | 280 |
| 839 | 3300048905 | Ga0496102_0000648 | Ga0496102_0000648_24090_24950 | 280 |
| 840 | 3300048905 | Ga0496102_0023975 | Ga0496102_0023975_2296_3138 | 280 |
| 841 | 3300048905 | Ga0496102_0099079 | Ga0496102_0099079_695_1552 | 280 |
| 842 | 3300048906 | Ga0496103_0000110 | Ga0496103_0000110_10176_11036 | 280 |
| 843 | 3300048906 | Ga0496103_0000200 | Ga0496103_0000200_38171_39067 | 280 |
| 844 | 3300048906 | Ga0496103_0002993 | Ga0496103_0002993_2414_3256 | 280 |
| 845 | 3300048906 | Ga0496103_0051853 | Ga0496103_0051853_109_966 | 280 |
| 846 | 3300048907 | Ga0496104_0000047 | Ga0496104_0000047_79078_79938 | 280 |
| 847 | 3300048907 | Ga0496104_0023430 | Ga0496104_0023430_4738_5634 | 280 |
| 848 | 3300048907 | Ga0496104_0093584 | Ga0496104_0093584_1106_1948 | 280 |
| 849 | 3300048908 | Ga0496105_0000081 | Ga0496105_0000081_59217_60077 | 280 |
| 850 | 3300048908 | Ga0496105_0008602 | Ga0496105_0008602_6848_7744 | 280 |
| 851 | 3300048909 | Ga0496106_0382945 | Ga0496106_0382945_227_1069 | 280 |
| 852 | 3300048910 | Ga0496107_0025653 | Ga0496107_0025653_1029_1871 | 280 |
| 853 | 3300048911 | Ga0496108_0003387 | Ga0496108_0003387_5511_6356 | 280 |
| 854 | 3300048913 | Ga0496110_0213150 | Ga0496110_0213150_693_1535 | 280 |
| 855 | 3300048913 | Ga0496110_0308948 | Ga0496110_0308948_429_1325 | 280 |
| 856 | 3300048915 | Ga0496112_0073551 | Ga0496112_0073551_1572_2432 | 280 |
| 857 | 3300048916 | Ga0496113_0000020 | Ga0496113_0000020_12286_13146 | 280 |
| 858 | 3300048918 | Ga0496115_0000173 | Ga0496115_0000173_38201_39097 | 280 |
| 859 | 3300048918 | Ga0496115_0097188 | Ga0496115_0097188_814_1686 | 280 |
| 860 | 3300048919 | Ga0496116_0035405 | Ga0496116_0035405_50_895 | 280 |
| 861 | 3300048919 | Ga0496116_0047529 | Ga0496116_0047529_911_1753 | 280 |
| 862 | 3300048920 | Ga0496117_0000670 | Ga0496117_0000670_15841_16737 | 280 |
| 863 | 3300048920 | Ga0496117_0006958 | Ga0496117_0006958_446_1297 | 280 |
| 864 | 3300048920 | Ga0496117_0010423 | Ga0496117_0010423_6951_7793 | 280 |
| 865 | 3300048920 | Ga0496117_0014334 | Ga0496117_0014334_642_1502 | 280 |
| 866 | 3300048921 | Ga0496118_0000592 | Ga0496118_0000592_38202_39098 | 280 |
| 867 | 3300048921 | Ga0496118_0006353 | Ga0496118_0006353_7728_8579 | 280 |
| 868 | 3300048921 | Ga0496118_0082566 | Ga0496118_0082566_956_1822 | 280 |
| 869 | 3300048921 | Ga0496118_0084510 | Ga0496118_0084510_398_1240 | 280 |
| 870 | 3300048922 | Ga0496119_0000699 | Ga0496119_0000699_31033_31893 | 280 |
| 871 | 3300048922 | Ga0496119_0008055 | Ga0496119_0008055_2060_2956 | 280 |
| 872 | 3300048922 | Ga0496119_0016331 | Ga0496119_0016331_4654_5505 | 280 |
| 873 | 3300048922 | Ga0496119_0124694 | Ga0496119_0124694_75_920 | 280 |
| 874 | 3300048923 | Ga0496120_0001199 | Ga0496120_0001199_21855_22715 | 280 |
| 875 | 3300048923 | Ga0496120_0005962 | Ga0496120_0005962_2150_2995 | 280 |
| 876 | 3300048923 | Ga0496120_0008143 | Ga0496120_0008143_345_1241 | 280 |
| 877 | 3300048924 | Ga0496121_0000009 | Ga0496121_0000009_398254_399105 | 280 |
| 878 | 3300048924 | Ga0496121_0000176 | Ga0496121_0000176_80947_81831 | 280 |
| 879 | 3300048924 | Ga0496121_0000295 | Ga0496121_0000295_38071_38967 | 280 |
| 880 | 3300048924 | Ga0496121_0000670 | Ga0496121_0000670_8064_8909 | 280 |
| 881 | 3300048924 | Ga0496121_0005579 | Ga0496121_0005579_11437_12297 | 280 |
| 882 | 3300048924 | Ga0496121_0042811 | Ga0496121_0042811_490_1332 | 280 |
| 883 | 3300048924 | Ga0496121_0081751 | Ga0496121_0081751_396_1238 | 280 |
| 884 | 3300048925 | Ga0496122_0000735 | Ga0496122_0000735_53567_54427 | 280 |
| 885 | 3300048925 | Ga0496122_0003067 | Ga0496122_0003067_9030_9941 | 280 |
| 886 | 3300048925 | Ga0496122_0006224 | Ga0496122_0006224_3232_4125 | 280 |
| 887 | 3300048925 | Ga0496122_0012217 | Ga0496122_0012217_3624_4469 | 280 |
| 888 | 3300048926 | Ga0496123_0000362 | Ga0496123_0000362_32773_33633 | 280 |
| 889 | 3300048926 | Ga0496123_0000503 | Ga0496123_0000503_9001_9912 | 280 |
| 890 | 3300048926 | Ga0496123_0007175 | Ga0496123_0007175_6942_7787 | 280 |
| 891 | 3300048926 | Ga0496123_0008453 | Ga0496123_0008453_2502_3347 | 280 |
| 892 | 3300048926 | Ga0496123_0021763 | Ga0496123_0021763_2652_3545 | 280 |
| 893 | 3300048926 | Ga0496123_0121090 | Ga0496123_0121090_29_871 | 280 |
| 894 | 3300048926 | Ga0496123_0178549 | Ga0496123_0178549_214_1056 | 280 |
| 895 | 3300048927 | Ga0496124_0000116 | Ga0496124_0000116_28180_29025 | 280 |
| 896 | 3300048927 | Ga0496124_0000177 | Ga0496124_0000177_106627_107523 | 280 |
| 897 | 3300048927 | Ga0496124_0001084 | Ga0496124_0001084_2502_3362 | 280 |
| 898 | 3300048927 | Ga0496124_0002381 | Ga0496124_0002381_13268_14113 | 280 |
| 899 | 3300048927 | Ga0496124_0003896 | Ga0496124_0003896_8606_9451 | 280 |
| 900 | 3300048927 | Ga0496124_0008630 | Ga0496124_0008630_8884_9729 | 280 |
| 901 | 3300048928 | Ga0496125_0000336 | Ga0496125_0000336_31888_32781 | 280 |
| 902 | 3300048928 | Ga0496125_0000555 | Ga0496125_0000555_22971_23831 | 280 |
| 903 | 3300048928 | Ga0496125_0002945 | Ga0496125_0002945_10376_11221 | 280 |
| 904 | 3300048928 | Ga0496125_0018419 | Ga0496125_0018419_4620_5465 | 280 |
| 905 | 3300048928 | Ga0496125_0032022 | Ga0496125_0032022_3011_3907 | 280 |
| 906 | 3300048928 | Ga0496125_0060032 | Ga0496125_0060032_1746_2657 | 280 |
| 907 | 3300048928 | Ga0496125_0213285 | Ga0496125_0213285_371_1219 | 280 |
| 908 | 3300048929 | Ga0496126_0000028 | Ga0496126_0000028_4556_5416 | 280 |
| 909 | 3300048929 | Ga0496126_0000725 | Ga0496126_0000725_38107_39003 | 280 |
| 910 | 3300048929 | Ga0496126_0083927 | Ga0496126_0083927_503_1348 | 280 |
| 911 | 3300048929 | Ga0496126_0177984 | Ga0496126_0177984_659_1504 | 280 |
| 912 | 3300049513 | Ga0501290_000118 | Ga0501290_000118_4778_5641 | 280 |
| 913 | 3300049513 | Ga0501290_001907 | Ga0501290_001907_1434_2276 | 280 |
| 914 | 3300049515 | Ga0501292_000010 | Ga0501292_000010_4109_4972 | 280 |
| 915 | 3300049516 | Ga0501293_000480 | Ga0501293_000480_898_1740 | 280 |
| 916 | 3300049521 | Ga0501298_001906 | Ga0501298_001906_1948_2790 | 280 |
| 917 | 3300049522 | Ga0501299_014103 | Ga0501299_014103_146_988 | 280 |
| 918 | 3300049523 | Ga0501300_000865 | Ga0501300_000865_2370_3233 | 280 |
| 919 | 3300049523 | Ga0501300_000897 | Ga0501300_000897_1236_2078 | 280 |
| 920 | 3300049571 | Ga0501034_0006776 | Ga0501034_0006776_7820_8665 | 280 |
| 921 | 3300049574 | Ga0501038_0058246 | Ga0501038_0058246_345_1235 | 280 |
| 922 | 3300049581 | Ga0501047_0002891 | Ga0501047_0002891_12385_13227 | 280 |
| 923 | 3300049587 | Ga0501071_0044196 | Ga0501071_0044196_1806_2696 | 280 |
| 924 | 3300049653 | Ga0501206_000946 | Ga0501206_000946_559_1422 | 280 |
| 925 | 3300049658 | Ga0501211_001628 | Ga0501211_001628_95_940 | 280 |
| 926 | 3300049662 | Ga0501222_000177 | Ga0501222_000177_994_1857 | 280 |
| 927 | 3300049663 | Ga0501223_000017 | Ga0501223_000017_31975_32817 | 280 |
| 928 | 3300049663 | Ga0501223_000107 | Ga0501223_000107_8572_9417 | 280 |
| 929 | 3300049663 | Ga0501223_001340 | Ga0501223_001340_2188_3051 | 280 |
| 930 | 3300049664 | Ga0501224_000031 | Ga0501224_000031_14502_15347 | 280 |
| 931 | 3300049664 | Ga0501224_001407 | Ga0501224_001407_888_1751 | 280 |
| 932 | 3300049668 | Ga0501233_000040 | Ga0501233_000040_4711_5556 | 280 |
| 933 | 3300049668 | Ga0501233_001211 | Ga0501233_001211_2449_3312 | 280 |
| 934 | 3300049668 | Ga0501233_036130 | Ga0501233_036130_170_1015 | 280 |
| 935 | 3300049669 | Ga0501235_005127 | Ga0501235_005127_1032_1877 | 280 |
| 936 | 3300049669 | Ga0501235_022608 | Ga0501235_022608_202_1047 | 280 |
| 937 | 3300049676 | Ga0501246_001831 | Ga0501246_001831_515_1357 | 280 |
| 938 | 3300049686 | Ga0501257_000001 | Ga0501257_000001_30302_31144 | 280 |
| 939 | 3300049688 | Ga0501259_000145 | Ga0501259_000145_4049_4912 | 280 |
| 940 | 3300049690 | Ga0501261_000003 | Ga0501261_000003_38015_38878 | 280 |
| 941 | 3300049705 | Ga0501225_0000004 | Ga0501225_0000004_16073_16915 | 280 |
| 942 | 3300049705 | Ga0501225_0000070 | Ga0501225_0000070_27987_28832 | 280 |
| 943 | 3300049707 | Ga0501234_000164 | Ga0501234_000164_3550_4395 | 280 |
| 944 | 3300049758 | Ga0501241_002348 | Ga0501241_002348_803_1660 | 280 |
| 945 | 3300049775 | Ga0501279_000007 | Ga0501279_000007_64352_65215 | 280 |
| 946 | 3300049776 | Ga0501280_000007 | Ga0501280_000007_8897_9760 | 280 |
| 947 | 3300049776 | Ga0501280_000464 | Ga0501280_000464_1022_1864 | 280 |
| 948 | 3300049777 | Ga0501281_00034 | Ga0501281_00034_2150_3013 | 280 |
| 949 | 3300049778 | Ga0501282_000352 | Ga0501282_000352_656_1519 | 280 |
| 950 | 3300049778 | Ga0501282_001648 | Ga0501282_001648_681_1535 | 280 |
| 951 | 3300049823 | Ga0501044_0148718 | Ga0501044_0148718_79_954 | 280 |
| 952 | 3300049853 | Ga0501226_000051 | Ga0501226_000051_20482_21327 | 280 |
| 953 | 3300050489 | nmdc:mga03683_25400_c1 | nmdc:mga03683_25400_c1_687_1538 | 280 |
| 954 | 3300050490 | nmdc:mga03n38_1084_c1 | nmdc:mga03n38_1084_c1_5065_5913 | 280 |
| 955 | 3300050493 | nmdc:mga0k408_5_c1 | nmdc:mga0k408_5_c1_44752_45594 | 280 |
| 956 | 3300050493 | nmdc:mga0k408_63905_c1 | nmdc:mga0k408_63905_c1_237_1079 | 280 |
| 957 | 3300050494 | nmdc:mga06z11_132_c1 | nmdc:mga06z11_132_c1_4134_4982 | 280 |
| 958 | 3300050495 | nmdc:mga04h51_262_c1 | nmdc:mga04h51_262_c1_4134_4982 | 280 |
| 959 | 3300050496 | nmdc:mga07m45_18825_c1 | nmdc:mga07m45_18825_c1_2682_3524 | 280 |
| 960 | 3300050512 | nmdc:mga0n895_40845_c1 | nmdc:mga0n895_40845_c1_1619_2461 | 280 |
| 961 | 3300050516 | nmdc:mga0sz30_12658_c1 | nmdc:mga0sz30_12658_c1_1232_2074 | 280 |
| 962 | 3300053079 | Ga0500610_0000057 | Ga0500610_0000057_25463_26356 | 280 |
| 963 | 3300053087 | Ga0500643_000199 | Ga0500643_000199_50003_50845 | 280 |
| 964 | 3300053087 | Ga0500643_000221 | Ga0500643_000221_23162_24058 | 280 |
| 965 | 3300053087 | Ga0500643_000295 | Ga0500643_000295_30244_31086 | 280 |
| 966 | 3300053090 | Ga0500646_0034180 | Ga0500646_0034180_71_967 | 280 |
| 967 | 3300053090 | Ga0500646_0056539 | Ga0500646_0056539_167_1009 | 280 |
| 968 | 3300053091 | Ga0500647_0018734 | Ga0500647_0018734_594_1436 | 280 |
| 969 | 3300053093 | Ga0500651_0000843 | Ga0500651_0000843_9122_9964 | 280 |
| 970 | 3300053096 | Ga0500641_0003958 | Ga0500641_0003958_4356_5198 | 280 |
| 971 | 3300053096 | Ga0500641_0009125 | Ga0500641_0009125_1822_2664 | 280 |
| 972 | 3300053096 | Ga0500641_0033688 | Ga0500641_0033688_124_978 | 280 |
| 973 | 3300053108 | Ga0500562_028756 | Ga0500562_028756_566_1408 | 280 |
| 974 | 3300053119 | Ga0500595_000150 | Ga0500595_000150_11340_12236 | 280 |
| 975 | 3300053119 | Ga0500595_003849 | Ga0500595_003849_3175_4020 | 280 |
| 976 | 3300053119 | Ga0500595_048610 | Ga0500595_048610_362_1228 | 280 |
| 977 | 3300053120 | Ga0500597_007599 | Ga0500597_007599_2361_3203 | 280 |
| 978 | 3300053121 | Ga0500607_000006 | Ga0500607_000006_117942_118784 | 280 |
| 979 | 3300053123 | Ga0500614_025073 | Ga0500614_025073_267_1109 | 280 |
| 980 | 3300053125 | Ga0500618_000817 | Ga0500618_000817_4392_5234 | 280 |
| 981 | 3300053130 | Ga0500642_0001829 | Ga0500642_0001829_206_1048 | 280 |
| 982 | 3300053130 | Ga0500642_0026441 | Ga0500642_0026441_37_933 | 280 |
| 983 | 3300053133 | Ga0500655_000020 | Ga0500655_000020_18376_19218 | 280 |
| 984 | 3300053136 | Ga0500559_0000698 | Ga0500559_0000698_2437_3279 | 280 |
| 985 | 3300053136 | Ga0500559_0004182 | Ga0500559_0004182_1513_2355 | 280 |
| 986 | 3300053136 | Ga0500559_0027412 | Ga0500559_0027412_49_945 | 280 |
| 987 | 3300053139 | Ga0500568_0000916 | Ga0500568_0000916_2039_2881 | 280 |
| 988 | 3300053140 | Ga0500573_0000235 | Ga0500573_0000235_19015_19926 | 280 |
| 989 | 3300053142 | Ga0500577_0004769 | Ga0500577_0004769_1669_2511 | 280 |
| 990 | 3300053148 | Ga0500590_001132 | Ga0500590_001132_8490_9332 | 280 |
| 991 | 3300053148 | Ga0500590_010918 | Ga0500590_010918_3737_4582 | 280 |
| 992 | 3300053151 | Ga0500604_0000011 | Ga0500604_0000011_99379_100221 | 280 |
| 993 | 3300053153 | Ga0500616_0000123 | Ga0500616_0000123_120465_121307 | 280 |
| 994 | 3300053153 | Ga0500616_0047289 | Ga0500616_0047289_1400_2242 | 280 |
| 995 | 3300053156 | Ga0500622_0001376 | Ga0500622_0001376_442_1284 | 280 |
| 996 | 3300053156 | Ga0500622_0006319 | Ga0500622_0006319_1910_2752 | 280 |
| 997 | 3300053157 | Ga0500624_000007 | Ga0500624_000007_113947_114792 | 280 |
| 998 | 3300053157 | Ga0500624_000032 | Ga0500624_000032_36790_37632 | 280 |
| 999 | 3300053177 | Ga0500636_0001312 | Ga0500636_0001312_12110_13006 | 280 |
| 1000 | 3300053178 | Ga0500637_0000109 | Ga0500637_0000109_1753_2595 | 280 |
| 1001 | 3300053178 | Ga0500637_0002011 | Ga0500637_0002011_4731_5573 | 280 |
| 1002 | 3300053724 | Ga0500570_000051 | Ga0500570_000051_13078_13920 | 280 |
| 1003 | 3300053730 | Ga0500645_000037 | Ga0500645_000037_69810_70706 | 280 |
| 1004 | 3300053730 | Ga0500645_000215 | Ga0500645_000215_30244_31086 | 280 |
| 1005 | 3300053730 | Ga0500645_001429 | Ga0500645_001429_419_1273 | 280 |
| 1006 | 3300053730 | Ga0500645_006747 | Ga0500645_006747_1042_1884 | 280 |
| 1007 | 3300053730 | Ga0500645_012901 | Ga0500645_012901_783_1625 | 280 |
| 1008 | 3300059510 | Ga0587090_004497 | Ga0587090_004497_25_876 | 280 |
| 1009 | 3300061719 | Ga0466962_0000343 | Ga0466962_0000343_13035_13877 | 280 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1bou-assembly1.cif.gz_D | three-dimensional structure of ligab | 0.983 | 3 | 278 |
| 3wku-assembly1.cif.gz_B | crystal structure of the anaerobic desb-gallate complex | 0.968 | 3 | 280 |
| 1bou-assembly1.cif.gz_D | three-dimensional structure of ligab | 0.9657 | 3 | 278 |
| 3wrb-assembly1.cif.gz_A | crystal structure of the anaerobic h124f desb-gallate complex | 0.9609 | 3 | 280 |
| 3wrc-assembly1.cif.gz_A | crystal structure of the anaerobic desb-protocatechuate (pca) complex | 0.9588 | 3 | 280 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1bouB00 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9829 | 3 | 278 | 3.40.830.10 |
| 1bouB00 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9656 | 3 | 278 | 3.40.830.10 |
| 3wrcA01 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.9526 | 1 | 280 | 3.40.830.10 |
| 3wrcA01 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.8969 | 1 | 280 | 3.40.830.10 |
| af_P0ABR9_4_309_3.40.830.10 | Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like | 0.8178 | 7 | 274 | 3.40.830.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258WZS1-F1-model_v4 | Protocatechuate 3,4-dioxygenase | 0.9893 | 1 | 184 |
GO:0008198
GO:0051213 |
| AF-A0A3D0WE34-F1-model_v4 | Protocatechuate 3,4-dioxygenase | 0.9884 | 1 | 195 |
GO:0008198
GO:0051213 |
| AF-A0A537VV32-F1-model_v4 | Protocatechuate 3,4-dioxygenase | 0.9858 | 1 | 278 |
GO:0008198
GO:0051213 |
| AF-A0A3N5PII1-F1-model_v4 | Glycosyltransferase | 0.985 | 10 | 151 |
GO:0006487
GO:0008198 GO:0016491 GO:0016740 |
| AF-A0A1Q4BMP0-F1-model_v4 | Protocatechuate 3,4-dioxygenase | 0.9849 | 1 | 279 |
GO:0008198
GO:0051213 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar