F488106

General Info

Members Datasets Scaffolds Average Seq Length
1010 351 2020 213

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10000442|rootH2_1000044248
Length 241
Sequence MTTERAGGSLPEGPTLALFLKKGIFADMTNFIPVFPLGIVVYPGETVNLHIFEPRYKQLINECYSEGKPFGIPTVIDNKLNEMGTLVRVTEIVKVHDNGELDIRTLGLKVFRVLELIKSIPDKLFSGAIVNYPDNIEGPGKRELMQKVVNAIRELHRLLNIEKDFKKPDEELAAYDIAHHVGLSLEQEYEVLGLLREEQRQEYIKRHLGKVLPVIAEMETLKERVKLNGHFKNLSSFKFED

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
123 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
191 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
214 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
215 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
216 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
217 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
218 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
219 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
220 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
221 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
244 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
258 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
259 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
260 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
261 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
278 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
279 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
280 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
281 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
282 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
283 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
284 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
285 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
286 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
287 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
288 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
289 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
290 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
291 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
292 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
293 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
294 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
295 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
296 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
297 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
298 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
299 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
300 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
301 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
302 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
305 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
306 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
307 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
308 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
309 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
313 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
321 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
322 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
323 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
324 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
325 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
326 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
327 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
328 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
329 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
330 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
331 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
332 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
333 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
334 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
335 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
338 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
339 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
342 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
343 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
344 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
345 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
346 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
347 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
348 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
349 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
350 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
351 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.45
Nodule 0
Rhizoplane 0.3
Rhizosphere 91.29
Stem 0
Stem Tuber 0
Unclassified 14.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10000442 3300003320 Bacteria 46233
2 MRS1b_contig_7821077 2162886011 Unclassified 1230
3 ARSoilOldRDRAFT_c001321 3300000044 Unclassified 2317
4 JGI24751J29686_10000798 3300002459 Bacteria 7365
5 JGI25153J46596_10007175 3300003215 Bacteria 5525
6 JGI25153J46596_10066346 3300003215 Bacteria 955
7 rootH2_10076151 3300003320 Bacteria 10907
8 rootH2_10252112 3300003320 Bacteria 1327
9 rootH2_10315418 3300003320 Bacteria 1526
10 rootL2_10002141 3300003322 Bacteria 7623
11 rootL2_10002142 3300003322 Bacteria 6192
12 rootL2_10021159 3300003322 Bacteria 4372
13 rootL2_10318402 3300003322 Bacteria 1216
14 rootL2_10359840 3300003322 Bacteria 1249
15 rootH1_10000729 3300003323 Bacteria 24019
16 rootH1_10130251 3300003323 Bacteria 5565
17 JGI25160J50197_1001202 3300003354 Bacteria 13164
18 JGI25160J50197_1013566 3300003354 Bacteria 2771
19 JGI25160J50197_1042189 3300003354 Bacteria 1040
20 Ga0055535_1005062 3300003761 Bacteria 2999
21 Ga0055526_1013821 3300003771 Bacteria 3378
22 Ga0055528_1000076 3300003790 Bacteria 76002
23 Ga0055530_10000023 3300003791 Bacteria 135890
24 Ga0055531_10000005 3300003794 Bacteria 242179
25 Ga0065165_1000110 3300005262 Bacteria 137063
26 Ga0065165_1014384 3300005262 Bacteria 3076
27 Ga0065165_1014542 3300005262 Bacteria 3050
28 Ga0065712_10020475 3300005290 Unclassified 1218
29 Ga0065712_10150071 3300005290 Bacteria 1365
30 Ga0065712_10306517 3300005290 Unclassified 844
31 Ga0065715_10001575 3300005293 Bacteria 10538
32 Ga0065715_10478092 3300005293 Bacteria 800
33 Ga0065707_10116423 3300005295 Bacteria 2238
34 Ga0065707_10145142 3300005295 Bacteria 1723
35 Ga0065707_10305839 3300005295 Unclassified 995
36 Ga0070676_10004140 3300005328 Bacteria 7619
37 Ga0070676_10008614 3300005328 Bacteria 5500
38 Ga0070676_10011952 3300005328 Unclassified 4732
39 Ga0070676_10145648 3300005328 Bacteria 1512
40 Ga0070683_100002522 3300005329 Bacteria 14587
41 Ga0070683_100031464 3300005329 Bacteria 4825
42 Ga0070683_100173052 3300005329 Bacteria 2049
43 Ga0070690_100016123 3300005330 Bacteria 4470
44 Ga0070690_100310816 3300005330 Bacteria 1133
45 Ga0070670_100021580 3300005331 Bacteria 5538
46 Ga0070670_100027216 3300005331 Bacteria 4919
47 Ga0070670_100045357 3300005331 Unclassified 3778
48 Ga0070670_100048501 3300005331 Bacteria 3654
49 Ga0070670_100137532 3300005331 Unclassified 2111
50 Ga0070670_100159398 3300005331 Bacteria 1955
51 Ga0070670_100195605 3300005331 Unclassified 1757
52 Ga0070670_100211594 3300005331 Bacteria 1686
53 Ga0070670_100237135 3300005331 Bacteria 1588
54 Ga0070670_100307893 3300005331 Bacteria 1386
55 Ga0070677_10011175 3300005333 Bacteria 3089
56 Ga0070677_10062168 3300005333 Bacteria 1544
57 Ga0070677_10092219 3300005333 Bacteria 1320
58 Ga0068869_100003068 3300005334 Bacteria 10160
59 Ga0068869_100006133 3300005334 Bacteria 7608
60 Ga0068869_100019321 3300005334 Bacteria 4652
61 Ga0068869_100044205 3300005334 Viruses 3203
62 Ga0068869_100044987 3300005334 Bacteria 3176
63 Ga0068869_100066606 3300005334 Bacteria 2654
64 Ga0068869_100079254 3300005334 Bacteria 2448
65 Ga0068869_100431026 3300005334 Bacteria 1089
66 Ga0068869_100541418 3300005334 Unclassified 977
67 Ga0070666_10000096 3300005335 Bacteria 60717
68 Ga0070666_10001663 3300005335 Bacteria 13569
69 Ga0070666_10041698 3300005335 Bacteria 3068
70 Ga0070666_10076725 3300005335 Unclassified 2280
71 Ga0070666_10082152 3300005335 Bacteria 2203
72 Ga0070666_10085400 3300005335 Bacteria 2161
73 Ga0070666_10498332 3300005335 Bacteria 883
74 Ga0070682_100000008 3300005337 Bacteria 322125
75 Ga0070682_100189001 3300005337 Bacteria 1445
76 Ga0070682_100348156 3300005337 Unclassified 1104
77 Ga0068868_100009492 3300005338 Bacteria 7007
78 Ga0068868_100016796 3300005338 Bacteria 5444
79 Ga0068868_100017003 3300005338 Bacteria 5411
80 Ga0068868_100017243 3300005338 Bacteria 5375
81 Ga0068868_100044099 3300005338 Bacteria 3486
82 Ga0068868_100256916 3300005338 Bacteria 1472
83 Ga0070660_100195872 3300005339 Unclassified 1638
84 Ga0070689_100001434 3300005340 Bacteria 15205
85 Ga0070689_100003780 3300005340 Bacteria 10139
86 Ga0070689_100114610 3300005340 Bacteria 2148
87 Ga0070689_100115147 3300005340 Bacteria 2142
88 Ga0070689_100670556 3300005340 Unclassified 903
89 Ga0070691_10060727 3300005341 Bacteria 1817
90 Ga0070687_100305984 3300005343 Unclassified 1010
91 Ga0070661_100004336 3300005344 Bacteria 9787
92 Ga0070661_100005816 3300005344 Bacteria 8481
93 Ga0070661_100052664 3300005344 Bacteria 2979
94 Ga0070661_100099492 3300005344 Bacteria 2161
95 Ga0070661_100101392 3300005344 Bacteria 2141
96 Ga0070661_100109416 3300005344 Bacteria 2062
97 Ga0070661_100129189 3300005344 Bacteria 1897
98 Ga0070661_100157639 3300005344 Bacteria 1718
99 Ga0070661_100247640 3300005344 Bacteria 1374
100 Ga0070692_10142108 3300005345 Unclassified 1359
101 Ga0070668_100006621 3300005347 Bacteria 8584
102 Ga0070668_100112814 3300005347 Unclassified 2165
103 Ga0070668_100155792 3300005347 Bacteria 1850
104 Ga0070668_100193090 3300005347 Bacteria 1668
105 Ga0070668_100205370 3300005347 Bacteria 1619
106 Ga0070669_100003962 3300005353 Bacteria 10711
107 Ga0070669_100015882 3300005353 Bacteria 5371
108 Ga0070669_100072734 3300005353 Unclassified 2546
109 Ga0070669_100132293 3300005353 Bacteria 1915
110 Ga0070669_100294444 3300005353 Unclassified 1304
111 Ga0070669_100318321 3300005353 Bacteria 1255
112 Ga0070669_101008522 3300005353 Bacteria 714
113 Ga0070675_100012925 3300005354 Bacteria 6551
114 Ga0070675_100069846 3300005354 Bacteria 2910
115 Ga0070675_100098403 3300005354 Unclassified 2461
116 Ga0070675_100129762 3300005354 Bacteria 2147
117 Ga0070675_100177310 3300005354 Bacteria 1841
118 Ga0070675_100354069 3300005354 Bacteria 1302
119 Ga0070675_100771584 3300005354 Bacteria 878
120 Ga0070671_100035316 3300005355 Bacteria 4141
121 Ga0070671_100039606 3300005355 Bacteria 3912
122 Ga0070671_100047720 3300005355 Bacteria 3560
123 Ga0070671_100128602 3300005355 Bacteria 2133
124 Ga0070671_100166135 3300005355 Bacteria 1866
125 Ga0070671_100297023 3300005355 Bacteria 1375
126 Ga0070674_100170743 3300005356 Bacteria 1658
127 Ga0070674_100212780 3300005356 Bacteria 1499
128 Ga0070673_100001237 3300005364 Bacteria 14803
129 Ga0070673_100002858 3300005364 Bacteria 10625
130 Ga0070673_100018742 3300005364 Bacteria 4955
131 Ga0070673_100063800 3300005364 Bacteria 2932
132 Ga0070673_100092490 3300005364 Bacteria 2474
133 Ga0070673_100118165 3300005364 Bacteria 2207
134 Ga0070673_100181369 3300005364 Bacteria 1803
135 Ga0070673_100224341 3300005364 Bacteria 1628
136 Ga0070673_100282423 3300005364 Unclassified 1456
137 Ga0070673_100494168 3300005364 Bacteria 1106
138 Ga0070673_100794744 3300005364 Bacteria 873
139 Ga0070688_100001210 3300005365 Bacteria 12848
140 Ga0070688_100008564 3300005365 Bacteria 5561
141 Ga0070688_100082014 3300005365 Bacteria 2089
142 Ga0070659_100008619 3300005366 Bacteria 7459
143 Ga0070659_100253455 3300005366 Bacteria 1459
144 Ga0070659_100454358 3300005366 Bacteria 1087
145 Ga0070667_100002757 3300005367 Bacteria 15197
146 Ga0070667_100062881 3300005367 Bacteria 3144
147 Ga0070667_100094570 3300005367 Bacteria 2575
148 Ga0070667_100106436 3300005367 Bacteria 2427
149 Ga0070667_100662098 3300005367 Unclassified 964
150 Ga0070701_10041737 3300005438 Unclassified 2339
151 Ga0070701_10449728 3300005438 Bacteria 826
152 Ga0070700_100049548 3300005441 Unclassified 2608
153 Ga0070678_100007568 3300005456 Bacteria 6452
154 Ga0070678_100008039 3300005456 Bacteria 6291
155 Ga0070678_100219911 3300005456 Bacteria 1578
156 Ga0070678_100310192 3300005456 Bacteria 1344
157 Ga0070662_100012053 3300005457 Bacteria 5724
158 Ga0070662_100020333 3300005457 Bacteria 4520
159 Ga0070662_100020971 3300005457 Bacteria 4457
160 Ga0070662_100025524 3300005457 Viruses 4082
161 Ga0070662_100043678 3300005457 Unclassified 3208
162 Ga0070662_100044910 3300005457 Bacteria 3168
163 Ga0070662_100394060 3300005457 Bacteria 1142
164 Ga0070662_100927263 3300005457 Bacteria 744
165 Ga0070681_10731841 3300005458 Bacteria 905
166 Ga0068867_100015409 3300005459 Viruses 5421
167 Ga0068867_100026633 3300005459 Bacteria 4152
168 Ga0068867_100104028 3300005459 Unclassified 2172
169 Ga0068867_100144081 3300005459 Unclassified 1865
170 Ga0068867_100154609 3300005459 Bacteria 1804
171 Ga0068867_100187111 3300005459 Bacteria 1650
172 Ga0068867_100322017 3300005459 Bacteria 1281
173 Ga0068867_100649327 3300005459 Bacteria 926
174 Ga0068867_100864126 3300005459 Unclassified 811
175 Ga0068867_101157514 3300005459 Unclassified 708
176 Ga0070685_10006138 3300005466 Bacteria 6118
177 Ga0070685_10012117 3300005466 Bacteria 4522
178 Ga0070685_10065638 3300005466 Bacteria 2136
179 Ga0070685_10201613 3300005466 Bacteria 1293
180 Ga0070685_10457210 3300005466 Unclassified 895
181 Ga0070698_100000061 3300005471 Bacteria 78637
182 Ga0070698_100092215 3300005471 Bacteria 3010
183 Ga0070698_100875649 3300005471 Unclassified 843
184 Ga0070699_100174637 3300005518 Bacteria 1905
185 Ga0070684_100003744 3300005535 Bacteria 11476
186 Ga0070684_100003772 3300005535 Bacteria 11441
187 Ga0070684_100008074 3300005535 Bacteria 8217
188 Ga0070684_100306077 3300005535 Bacteria 1459
189 Ga0070684_100357174 3300005535 Bacteria 1344
190 Ga0070684_100445667 3300005535 Bacteria 1196
191 Ga0068853_100000796 3300005539 Bacteria 21890
192 Ga0068853_100006503 3300005539 Bacteria 9298
193 Ga0068853_100008344 3300005539 Bacteria 8314
194 Ga0068853_100025487 3300005539 Bacteria 4963
195 Ga0068853_100456127 3300005539 Bacteria 1203
196 Ga0068853_100653138 3300005539 Bacteria 1001
197 Ga0068853_100935750 3300005539 Bacteria 833
198 Ga0068853_101083914 3300005539 Bacteria 772
199 Ga0070672_100015160 3300005543 Bacteria 5479
200 Ga0070672_100018204 3300005543 Bacteria 5073
201 Ga0070672_100156749 3300005543 Bacteria 1886
202 Ga0070672_100210439 3300005543 Bacteria 1628
203 Ga0070672_100541286 3300005543 Bacteria 1010
204 Ga0070686_100032955 3300005544 Bacteria 3180
205 Ga0070686_100127864 3300005544 Unclassified 1753
206 Ga0070686_100383448 3300005544 Bacteria 1065
207 Ga0070695_100073426 3300005545 Bacteria 2245
208 Ga0070693_100360328 3300005547 Bacteria 998
209 Ga0070665_100042819 3300005548 Bacteria 4551
210 Ga0070665_100116197 3300005548 Bacteria 2678
211 Ga0070665_100176199 3300005548 Unclassified 2139
212 Ga0070665_100184428 3300005548 Bacteria 2087
213 Ga0070704_100018118 3300005549 Unclassified 4493
214 Ga0070704_100105673 3300005549 Unclassified 2132
215 Ga0070704_100189425 3300005549 Bacteria 1652
216 Ga0068855_100001457 3300005563 Bacteria 29525
217 Ga0068855_100045261 3300005563 Bacteria 5205
218 Ga0068855_100099029 3300005563 Viruses 3358
219 Ga0068855_100301662 3300005563 Bacteria 1774
220 Ga0068855_100552564 3300005563 Bacteria 1246
221 Ga0070664_100018058 3300005564 Bacteria 5792
222 Ga0070664_100028969 3300005564 Unclassified 4613
223 Ga0070664_100109202 3300005564 Bacteria 2413
224 Ga0070664_100149707 3300005564 Bacteria 2060
225 Ga0070664_100238427 3300005564 Bacteria 1632
226 Ga0070664_100301587 3300005564 Unclassified 1448
227 Ga0070664_100805852 3300005564 Bacteria 878
228 Ga0070664_100920565 3300005564 Bacteria 820
229 Ga0068857_100022605 3300005577 Bacteria 5530
230 Ga0068857_100054252 3300005577 Bacteria 3556
231 Ga0068857_100064624 3300005577 Bacteria 3254
232 Ga0068857_100206122 3300005577 Bacteria 1793
233 Ga0068857_100244235 3300005577 Bacteria 1644
234 Ga0068857_100418397 3300005577 Bacteria 1249
235 Ga0068857_100626621 3300005577 Bacteria 1018
236 Ga0068854_100002878 3300005578 Bacteria 10707
237 Ga0068854_100030880 3300005578 Unclassified 3720
238 Ga0068854_100108428 3300005578 Unclassified 2091
239 Ga0068854_100254433 3300005578 Bacteria 1404
240 Ga0068856_100130056 3300005614 Bacteria 2522
241 Ga0068856_100135868 3300005614 Bacteria 2464
242 Ga0070702_100659484 3300005615 Bacteria 792
243 Ga0068852_100000857 3300005616 Bacteria 20216
244 Ga0068852_100001522 3300005616 Bacteria 15698
245 Ga0068852_100003549 3300005616 Bacteria 10913
246 Ga0068852_100306942 3300005616 Bacteria 1537
247 Ga0068852_100395759 3300005616 Unclassified 1358
248 Ga0068852_100612137 3300005616 Bacteria 1094
249 Ga0068852_101394700 3300005616 Bacteria 723
250 Ga0068859_100000024 3300005617 Bacteria 217931
251 Ga0068859_100019662 3300005617 Bacteria 6782
252 Ga0068859_100025034 3300005617 Bacteria 5991
253 Ga0068859_100036905 3300005617 Bacteria 4906
254 Ga0068859_100042230 3300005617 Bacteria 4580
255 Ga0068859_100096194 3300005617 Bacteria 3014
256 Ga0068859_100173395 3300005617 Bacteria 2238
257 Ga0068859_100306027 3300005617 Unclassified 1683
258 Ga0068859_100371958 3300005617 Bacteria 1525
259 Ga0068859_100404349 3300005617 Bacteria 1461
260 Ga0068859_100902479 3300005617 Bacteria 968
261 Ga0068864_100004575 3300005618 Bacteria 11358
262 Ga0068864_100005883 3300005618 Bacteria 10052
263 Ga0068864_100026240 3300005618 Bacteria 4912
264 Ga0068864_100072091 3300005618 Bacteria 3009
265 Ga0068864_100083040 3300005618 Bacteria 2813
266 Ga0068864_100415053 3300005618 Bacteria 1281
267 Ga0068864_100744095 3300005618 Bacteria 960
268 Ga0068866_10024154 3300005718 Unclassified 2837
269 Ga0068866_10175027 3300005718 Unclassified 1263
270 Ga0068866_10232431 3300005718 Bacteria 1119
271 Ga0068861_100001870 3300005719 Bacteria 13556
272 Ga0068861_100002412 3300005719 Bacteria 12173
273 Ga0068861_100024839 3300005719 Bacteria 4338
274 Ga0068861_100049148 3300005719 Bacteria 3192
275 Ga0068861_100373791 3300005719 Bacteria 1257
276 Ga0068851_10003739 3300005834 Bacteria 6800
277 Ga0068851_10058827 3300005834 Bacteria 1965
278 Ga0068851_10083643 3300005834 Bacteria 1670
279 Ga0068851_10157744 3300005834 Bacteria 1244
280 Ga0068870_10008469 3300005840 Bacteria 4628
281 Ga0068870_10050453 3300005840 Bacteria 2199
282 Ga0068870_10101114 3300005840 Bacteria 1629
283 Ga0068870_10215749 3300005840 Bacteria 1172
284 Ga0068870_10249758 3300005840 Bacteria 1099
285 Ga0068863_100011915 3300005841 Bacteria 8404
286 Ga0068863_100039716 3300005841 Viruses 4476
287 Ga0068863_100060049 3300005841 Bacteria 3596
288 Ga0068863_100081760 3300005841 Bacteria 3060
289 Ga0068863_100341493 3300005841 Bacteria 1457
290 Ga0068863_100523996 3300005841 Bacteria 1169
291 Ga0068863_100657328 3300005841 Bacteria 1040
292 Ga0068858_100003133 3300005842 Bacteria 16560
293 Ga0068858_100003141 3300005842 Bacteria 16535
294 Ga0068858_100085270 3300005842 Unclassified 2938
295 Ga0068858_100123938 3300005842 Bacteria 2418
296 Ga0068858_100322832 3300005842 Bacteria 1476
297 Ga0068858_100510997 3300005842 Bacteria 1161
298 Ga0068860_100000024 3300005843 Bacteria 271902
299 Ga0068860_100001839 3300005843 Bacteria 22597
300 Ga0068860_100008185 3300005843 Bacteria 10410
301 Ga0068860_100019138 3300005843 Bacteria 6648
302 Ga0068860_100025276 3300005843 Bacteria 5732
303 Ga0068860_100029320 3300005843 Bacteria 5292
304 Ga0068860_100065400 3300005843 Bacteria 3453
305 Ga0068860_100066970 3300005843 Bacteria 3412
306 Ga0068860_100204569 3300005843 Unclassified 1914
307 Ga0068860_100383612 3300005843 Bacteria 1387
308 Ga0068862_100002297 3300005844 Bacteria 17090
309 Ga0068862_100125753 3300005844 Bacteria 2263
310 Ga0068862_100271476 3300005844 Bacteria 1551
311 Ga0068862_100830445 3300005844 Bacteria 904
312 Ga0068862_101105773 3300005844 Bacteria 788
313 Ga0081539_10011722 3300005985 Bacteria 6877
314 Ga0070715_10288749 3300006163 Bacteria 873
315 Ga0075366_10025671 3300006195 Bacteria 3444
316 Ga0075366_10145359 3300006195 Bacteria 1435
317 Ga0097621_100042034 3300006237 Bacteria 3681
318 Ga0097621_100043812 3300006237 Viruses 3608
319 Ga0097621_100232858 3300006237 Bacteria 1608
320 Ga0097621_100308030 3300006237 Bacteria 1400
321 Ga0097621_100551238 3300006237 Bacteria 1049
322 Ga0097621_101023324 3300006237 Bacteria 773
323 Ga0075370_10050448 3300006353 Unclassified 2360
324 Ga0068871_100004752 3300006358 Bacteria 9491
325 Ga0068871_100014692 3300006358 Viruses 5842
326 Ga0068871_100466410 3300006358 Bacteria 1134
327 Ga0075428_100303880 3300006844 Bacteria 1715
328 Ga0075430_100013299 3300006846 Bacteria 7016
329 Ga0075430_100111938 3300006846 Bacteria 2276
330 Ga0075431_100016589 3300006847 Bacteria 7474
331 Ga0075434_100017373 3300006871 Bacteria 6929
332 Ga0075434_100682483 3300006871 Bacteria 1045
333 Ga0075429_100001773 3300006880 Bacteria 17869
334 Ga0075429_100074206 3300006880 Bacteria 2963
335 Ga0075429_100778825 3300006880 Unclassified 838
336 Ga0068865_100033972 3300006881 Unclassified 3418
337 Ga0068865_100051723 3300006881 Bacteria 2845
338 Ga0097620_100000024 3300006931 Bacteria 217931
339 Ga0097620_100019662 3300006931 Bacteria 6782
340 Ga0097620_100025034 3300006931 Bacteria 5991
341 Ga0097620_100036905 3300006931 Bacteria 4906
342 Ga0097620_100042231 3300006931 Bacteria 4580
343 Ga0097620_100096193 3300006931 Bacteria 3014
344 Ga0097620_100173390 3300006931 Bacteria 2238
345 Ga0097620_100306012 3300006931 Unclassified 1683
346 Ga0097620_100371916 3300006931 Bacteria 1525
347 Ga0097620_100404342 3300006931 Bacteria 1461
348 Ga0097620_100902584 3300006931 Bacteria 968
349 Ga0105244_10302630 3300009036 Unclassified 740
350 Ga0105240_10000106 3300009093 Bacteria 171825
351 Ga0105240_10000895 3300009093 Bacteria 53295
352 Ga0105240_10002358 3300009093 Bacteria 30449
353 Ga0105240_10004897 3300009093 Bacteria 20156
354 Ga0105240_10074614 3300009093 Bacteria 4186
355 Ga0105240_10088384 3300009093 Unclassified 3792
356 Ga0105240_10122314 3300009093 Bacteria 3132
357 Ga0105240_10181534 3300009093 Bacteria 2483
358 Ga0111539_10004607 3300009094 Bacteria 18008
359 Ga0111539_10007347 3300009094 Bacteria 14110
360 Ga0111539_10207660 3300009094 Bacteria 2282
361 Ga0111539_11396613 3300009094 Bacteria 812
362 Ga0105245_10079189 3300009098 Bacteria 3000
363 Ga0105245_10241255 3300009098 Bacteria 1752
364 Ga0105245_10903443 3300009098 Bacteria 925
365 Ga0105245_10938801 3300009098 Unclassified 908
366 Ga0105247_10001724 3300009101 Bacteria 15408
367 Ga0105247_10297971 3300009101 Bacteria 1118
368 Ga0114129_10243115 3300009147 Bacteria 2419
369 Ga0114129_10349646 3300009147 Unclassified 1959
370 Ga0105243_10080774 3300009148 Bacteria 2653
371 Ga0105243_10237309 3300009148 Bacteria 1621
372 Ga0105241_10000085 3300009174 Bacteria 69963
373 Ga0105241_10005689 3300009174 Bacteria 9199
374 Ga0105241_10138163 3300009174 Bacteria 1981
375 Ga0105241_10156952 3300009174 Bacteria 1867
376 Ga0105241_10237679 3300009174 Bacteria 1539
377 Ga0105242_10005018 3300009176 Bacteria 10231
378 Ga0105242_10070885 3300009176 Viruses 2891
379 Ga0105242_10076884 3300009176 Bacteria 2784
380 Ga0105242_10133369 3300009176 Bacteria 2147
381 Ga0105242_10154328 3300009176 Unclassified 2004
382 Ga0105242_10269890 3300009176 Bacteria 1541
383 Ga0105242_10280589 3300009176 Bacteria 1513
384 Ga0105248_10037895 3300009177 Bacteria 5393
385 Ga0105237_10000453 3300009545 Bacteria 58200
386 Ga0105237_10013660 3300009545 Bacteria 8504
387 Ga0105237_10021915 3300009545 Bacteria 6562
388 Ga0105237_10034777 3300009545 Bacteria 5099
389 Ga0105237_10050819 3300009545 Bacteria 4165
390 Ga0105237_10166996 3300009545 Bacteria 2200
391 Ga0105237_10212082 3300009545 Bacteria 1936
392 Ga0105237_10242616 3300009545 Bacteria 1803
393 Ga0105237_10248689 3300009545 Bacteria 1780
394 Ga0105237_10252864 3300009545 Bacteria 1764
395 Ga0105238_10001678 3300009551 Bacteria 22261
396 Ga0105238_10027955 3300009551 Bacteria 5747
397 Ga0105238_10107405 3300009551 Archaea 2772
398 Ga0105238_10317212 3300009551 Bacteria 1544
399 Ga0105249_10002023 3300009553 Bacteria 17609
400 Ga0105249_10007013 3300009553 Bacteria 9835
401 Ga0105249_10015481 3300009553 Bacteria 6749
402 Ga0105249_10024744 3300009553 Bacteria 5398
403 Ga0105249_10029535 3300009553 Bacteria 4952
404 Ga0105249_10031991 3300009553 Bacteria 4758
405 Ga0105249_10051878 3300009553 Bacteria 3744
406 Ga0105249_10090950 3300009553 Bacteria 2854
407 Ga0105249_10098094 3300009553 Bacteria 2751
408 Ga0105249_10153989 3300009553 Bacteria 2216
409 Ga0105249_10160224 3300009553 Bacteria 2174
410 Ga0105249_10191916 3300009553 Bacteria 1994
411 Ga0105249_10238793 3300009553 Bacteria 1796
412 Ga0105249_11287643 3300009553 Bacteria 802
413 Ga0105239_10000019 3300010375 Bacteria 273836
414 Ga0105239_10000384 3300010375 Bacteria 64479
415 Ga0105239_10003545 3300010375 Bacteria 19087
416 Ga0105239_10012678 3300010375 Bacteria 9379
417 Ga0105239_10034600 3300010375 Bacteria 5549
418 Ga0105239_10053305 3300010375 Bacteria 4437
419 Ga0105239_10062597 3300010375 Unclassified 4084
420 Ga0105239_10087953 3300010375 Bacteria 3425
421 Ga0105239_10089409 3300010375 Bacteria 3396
422 Ga0105239_10636988 3300010375 Bacteria 1217
423 Ga0105239_10668246 3300010375 Unclassified 1187
424 Ga0105239_10794999 3300010375 Bacteria 1084
425 Ga0105239_11498530 3300010375 Bacteria 779
426 Ga0105246_10001022 3300011119 Bacteria 16075
427 Ga0105246_10221717 3300011119 Bacteria 1483
428 Ga0105246_10286352 3300011119 Bacteria 1324
429 Ga0105246_10351717 3300011119 Bacteria 1208
430 Ga0157373_10043948 3300013100 Bacteria 3190
431 Ga0157373_10139222 3300013100 Bacteria 1706
432 Ga0157373_10186084 3300013100 Bacteria 1463
433 Ga0157371_10008920 3300013102 Bacteria 7941
434 Ga0157371_10032938 3300013102 Bacteria 3726
435 Ga0157371_10106778 3300013102 Bacteria 1987
436 Ga0157371_10195696 3300013102 Bacteria 1448
437 Ga0157371_10360272 3300013102 Bacteria 1060
438 Ga0157371_10640225 3300013102 Bacteria 793
439 Ga0157370_10002878 3300013104 Bacteria 20507
440 Ga0157370_10016966 3300013104 Bacteria 7361
441 Ga0157370_10083776 3300013104 Bacteria 2998
442 Ga0157370_10153916 3300013104 Bacteria 2139
443 Ga0157370_10798343 3300013104 Unclassified 859
444 Ga0157369_10192606 3300013105 Unclassified 2142
445 Ga0157369_10399441 3300013105 Bacteria 1426
446 Ga0157374_10000011 3300013296 Bacteria 466749
447 Ga0157374_10012134 3300013296 Bacteria 7484
448 Ga0157374_10025437 3300013296 Bacteria 5316
449 Ga0157374_10028180 3300013296 Bacteria 5071
450 Ga0157374_10057007 3300013296 Bacteria 3648
451 Ga0157374_10066125 3300013296 Bacteria 3397
452 Ga0157374_10101373 3300013296 Bacteria 2761
453 Ga0157374_10112556 3300013296 Unclassified 2619
454 Ga0157374_10533141 3300013296 Unclassified 1181
455 Ga0157378_10089507 3300013297 Bacteria 2796
456 Ga0157378_10180559 3300013297 Unclassified 1985
457 Ga0157378_10195528 3300013297 Unclassified 1910
458 Ga0157378_10223800 3300013297 Bacteria 1790
459 Ga0157378_10227553 3300013297 Bacteria 1775
460 Ga0157378_10318855 3300013297 Bacteria 1509
461 Ga0157378_10467152 3300013297 Bacteria 1255
462 Ga0157378_10704311 3300013297 Bacteria 1029
463 Ga0163162_10000189 3300013306 Bacteria 56954
464 Ga0163162_10000446 3300013306 Bacteria 38191
465 Ga0163162_10000687 3300013306 Bacteria 31377
466 Ga0163162_10002569 3300013306 Bacteria 17179
467 Ga0163162_10034873 3300013306 Bacteria 5009
468 Ga0163162_10038451 3300013306 Bacteria 4775
469 Ga0163162_10067267 3300013306 Viruses 3633
470 Ga0163162_10194517 3300013306 Bacteria 2156
471 Ga0163162_10367617 3300013306 Bacteria 1571
472 Ga0157372_10006780 3300013307 Bacteria 12180
473 Ga0157372_10013773 3300013307 Bacteria 8641
474 Ga0157372_10017732 3300013307 Bacteria 7642
475 Ga0157372_10043256 3300013307 Unclassified 4986
476 Ga0157372_10063290 3300013307 Bacteria 4147
477 Ga0157372_10064498 3300013307 Bacteria 4110
478 Ga0157372_10246926 3300013307 Bacteria 2071
479 Ga0157372_10251227 3300013307 Bacteria 2053
480 Ga0157372_10280174 3300013307 Bacteria 1939
481 Ga0157372_10384159 3300013307 Bacteria 1636
482 Ga0157372_10452445 3300013307 Bacteria 1496
483 Ga0157372_10498670 3300013307 Bacteria 1420
484 Ga0157372_11449912 3300013307 Unclassified 791
485 Ga0157372_11506528 3300013307 Bacteria 775
486 Ga0157375_10011538 3300013308 Bacteria 7803
487 Ga0157375_10062680 3300013308 Unclassified 3696
488 Ga0157375_10064042 3300013308 Bacteria 3660
489 Ga0157375_10079622 3300013308 Bacteria 3312
490 Ga0157375_10080435 3300013308 Bacteria 3297
491 Ga0157375_10379957 3300013308 Unclassified 1579
492 Ga0157375_10382321 3300013308 Bacteria 1574
493 Ga0157375_10455081 3300013308 Unclassified 1445
494 Ga0157375_10849971 3300013308 Bacteria 1059
495 Ga0157375_10948459 3300013308 Bacteria 1002
496 Ga0163163_10001441 3300014325 Bacteria 20118
497 Ga0163163_10027772 3300014325 Bacteria 5426
498 Ga0163163_10047990 3300014325 Viruses 4197
499 Ga0163163_10115108 3300014325 Bacteria 2721
500 Ga0163163_10191749 3300014325 Bacteria 2092
501 Ga0163163_10195361 3300014325 Bacteria 2071
502 Ga0157380_10000477 3300014326 Bacteria 24458
503 Ga0157380_10236061 3300014326 Bacteria 1645
504 Ga0157380_11047779 3300014326 Bacteria 852
505 Ga0157380_11164558 3300014326 Bacteria 813
506 Ga0157377_10000592 3300014745 Bacteria 15035
507 Ga0157377_10006415 3300014745 Bacteria 5611
508 Ga0157377_10024223 3300014745 Bacteria 3225
509 Ga0157377_10073050 3300014745 Bacteria 1986
510 Ga0157377_10356000 3300014745 Bacteria 984
511 Ga0157377_10420512 3300014745 Bacteria 915
512 Ga0157379_10013944 3300014968 Bacteria 7044
513 Ga0157379_10034749 3300014968 Bacteria 4496
514 Ga0157379_10072795 3300014968 Unclassified 3075
515 Ga0157379_10073080 3300014968 Bacteria 3069
516 Ga0157379_10189739 3300014968 Bacteria 1857
517 Ga0157379_10234775 3300014968 Bacteria 1663
518 Ga0157376_10005632 3300014969 Bacteria 8765
519 Ga0157376_10015084 3300014969 Bacteria 5826
520 Ga0157376_10058509 3300014969 Viruses 3228
521 Ga0157376_10076387 3300014969 Bacteria 2862
522 Ga0157376_10218967 3300014969 Bacteria 1762
523 Ga0157376_10686916 3300014969 Bacteria 1027
524 Ga0157376_10849211 3300014969 Bacteria 928
525 Ga0182005_1000017 3300015265 Bacteria 331828
526 Ga0163161_10006412 3300017792 Bacteria 8148
527 Ga0163161_10063433 3300017792 Bacteria 2693
528 Ga0163161_10124529 3300017792 Bacteria 1939
529 Ga0163161_10231657 3300017792 Unclassified 1434
530 Ga0209436_100787 3300025208 Bacteria 13111
531 Ga0209436_101343 3300025208 Bacteria 8691
532 Ga0209258_100029 3300025242 Bacteria 490648
533 Ga0209646_1000031 3300025246 Bacteria 381260
534 Ga0209026_1000019 3300025250 Bacteria 381260
535 Ga0209148_1000194 3300025254 Bacteria 112740
536 Ga0209129_1017055 3300025258 Bacteria 1437
537 Ga0207666_1020045 3300025271 Unclassified 979
538 Ga0209673_1000501 3300025273 Bacteria 64685
539 Ga0209130_1000333 3300025284 Bacteria 54192
540 Ga0209564_1011975 3300025295 Bacteria 3826
541 Ga0209758_1008947 3300025297 Bacteria 6344
542 Ga0209758_1022289 3300025297 Bacteria 2912
543 Ga0209050_1000216 3300025298 Bacteria 128896
544 Ga0207426_1000024 3300025302 Bacteria 534075
545 Ga0207426_1001331 3300025302 Bacteria 21001
546 Ga0207426_1044975 3300025302 Bacteria 1346
547 Ga0209257_1000004 3300025304 Bacteria 1678347
548 Ga0209257_1009260 3300025304 Bacteria 5329
549 Ga0207697_10008375 3300025315 Unclassified 4526
550 Ga0207697_10055492 3300025315 Unclassified 1643
551 Ga0207656_10002100 3300025321 Bacteria 6658
552 Ga0207682_10016584 3300025893 Bacteria 2873
553 Ga0207642_10003436 3300025899 Bacteria 5002
554 Ga0207642_10439506 3300025899 Bacteria 788
555 Ga0207710_10001848 3300025900 Bacteria 10199
556 Ga0207710_10126357 3300025900 Bacteria 1225
557 Ga0207688_10004807 3300025901 Bacteria 7363
558 Ga0207680_10000455 3300025903 Bacteria 19322
559 Ga0207680_10029903 3300025903 Bacteria 3066
560 Ga0207680_10031451 3300025903 Bacteria 3006
561 Ga0207680_10137965 3300025903 Bacteria 1614
562 Ga0207680_10199681 3300025903 Bacteria 1362
563 Ga0207680_10428209 3300025903 Bacteria 938
564 Ga0207647_10000025 3300025904 Bacteria 112150
565 Ga0207647_10039735 3300025904 Bacteria 2966
566 Ga0207647_10090658 3300025904 Unclassified 1823
567 Ga0207647_10288030 3300025904 Unclassified 937
568 Ga0207645_10000356 3300025907 Bacteria 37874
569 Ga0207645_10005727 3300025907 Bacteria 8964
570 Ga0207645_10017356 3300025907 Bacteria 4752
571 Ga0207645_10028106 3300025907 Bacteria 3632
572 Ga0207643_10004864 3300025908 Bacteria 7197
573 Ga0207643_10004942 3300025908 Bacteria 7134
574 Ga0207705_10005298 3300025909 Bacteria 9651
575 Ga0207654_10000792 3300025911 Bacteria 17419
576 Ga0207654_10000944 3300025911 Bacteria 15963
577 Ga0207654_10256479 3300025911 Bacteria 1174
578 Ga0207695_10000087 3300025913 Bacteria 276412
579 Ga0207695_10000582 3300025913 Bacteria 74405
580 Ga0207695_10000909 3300025913 Bacteria 53303
581 Ga0207695_10004513 3300025913 Bacteria 18946
582 Ga0207695_10021645 3300025913 Bacteria 7330
583 Ga0207695_10120923 3300025913 Unclassified 2586
584 Ga0207695_10442855 3300025913 Bacteria 1182
585 Ga0207671_10000311 3300025914 Bacteria 71753
586 Ga0207671_10001101 3300025914 Bacteria 32578
587 Ga0207671_10001299 3300025914 Bacteria 29321
588 Ga0207671_10006605 3300025914 Bacteria 10294
589 Ga0207671_10093501 3300025914 Bacteria 2268
590 Ga0207671_10105270 3300025914 Bacteria 2140
591 Ga0207671_10157842 3300025914 Unclassified 1755
592 Ga0207671_10360204 3300025914 Bacteria 1154
593 Ga0207657_10059678 3300025919 Unclassified 3276
594 Ga0207657_10101763 3300025919 Unclassified 2384
595 Ga0207657_10124281 3300025919 Unclassified 2120
596 Ga0207649_10001650 3300025920 Bacteria 12932
597 Ga0207649_10005817 3300025920 Bacteria 6676
598 Ga0207649_10100367 3300025920 Bacteria 1914
599 Ga0207649_10208457 3300025920 Bacteria 1385
600 Ga0207649_10755790 3300025920 Bacteria 757
601 Ga0207681_10053212 3300025923 Bacteria 2748
602 Ga0207681_10182866 3300025923 Bacteria 1598
603 Ga0207681_10391194 3300025923 Unclassified 1121
604 Ga0207694_10007619 3300025924 Bacteria 8209
605 Ga0207694_10083895 3300025924 Unclassified 2506
606 Ga0207650_10014161 3300025925 Bacteria 5539
607 Ga0207650_10033783 3300025925 Unclassified 3706
608 Ga0207650_10059953 3300025925 Bacteria 2839
609 Ga0207650_10073887 3300025925 Bacteria 2569
610 Ga0207650_10086909 3300025925 Unclassified 2381
611 Ga0207650_10091822 3300025925 Unclassified 2321
612 Ga0207650_10386773 3300025925 Bacteria 1156
613 Ga0207650_10529610 3300025925 Unclassified 986
614 Ga0207650_10923473 3300025925 Bacteria 741
615 Ga0207659_10026907 3300025926 Unclassified 3887
616 Ga0207659_10098648 3300025926 Unclassified 2197
617 Ga0207659_10137581 3300025926 Bacteria 1892
618 Ga0207659_10404849 3300025926 Bacteria 1142
619 Ga0207659_10405322 3300025926 Bacteria 1141
620 Ga0207659_10647350 3300025926 Bacteria 903
621 Ga0207644_10022195 3300025931 Unclassified 4335
622 Ga0207644_10174177 3300025931 Bacteria 1682
623 Ga0207644_10470887 3300025931 Bacteria 1034
624 Ga0207690_10022006 3300025932 Bacteria 3960
625 Ga0207690_10271120 3300025932 Bacteria 1318
626 Ga0207706_10003804 3300025933 Bacteria 14383
627 Ga0207706_10017354 3300025933 Bacteria 6485
628 Ga0207706_10041428 3300025933 Viruses 4082
629 Ga0207706_10055020 3300025933 Bacteria 3511
630 Ga0207706_10055030 3300025933 Unclassified 3510
631 Ga0207706_10096912 3300025933 Bacteria 2594
632 Ga0207686_10002454 3300025934 Bacteria 10071
633 Ga0207686_10045017 3300025934 Unclassified 2713
634 Ga0207686_10053668 3300025934 Bacteria 2521
635 Ga0207686_10071919 3300025934 Bacteria 2227
636 Ga0207670_10025851 3300025936 Bacteria 3691
637 Ga0207670_10037372 3300025936 Unclassified 3164
638 Ga0207670_10040648 3300025936 Bacteria 3053
639 Ga0207669_10124133 3300025937 Bacteria 1759
640 Ga0207704_10004256 3300025938 Bacteria 6539
641 Ga0207704_10017379 3300025938 Unclassified 3727
642 Ga0207704_10181642 3300025938 Bacteria 1521
643 Ga0207704_10469024 3300025938 Bacteria 1008
644 Ga0207691_10000753 3300025940 Bacteria 32051
645 Ga0207691_10002055 3300025940 Bacteria 19671
646 Ga0207691_10016839 3300025940 Bacteria 6935
647 Ga0207691_10024972 3300025940 Bacteria 5615
648 Ga0207691_10081293 3300025940 Bacteria 2913
649 Ga0207711_10115112 3300025941 Viruses 2396
650 Ga0207711_10337725 3300025941 Bacteria 1394
651 Ga0207689_10001522 3300025942 Bacteria 22065
652 Ga0207689_10006221 3300025942 Bacteria 10571
653 Ga0207689_10007013 3300025942 Bacteria 9906
654 Ga0207689_10018846 3300025942 Bacteria 5821
655 Ga0207689_10032412 3300025942 Unclassified 4348
656 Ga0207689_10036291 3300025942 Bacteria 4093
657 Ga0207689_10044204 3300025942 Bacteria 3682
658 Ga0207689_10125081 3300025942 Bacteria 2115
659 Ga0207689_10160896 3300025942 Bacteria 1850
660 Ga0207689_10199794 3300025942 Bacteria 1650
661 Ga0207689_10248357 3300025942 Bacteria 1471
662 Ga0207661_10012248 3300025944 Bacteria 6229
663 Ga0207661_10021591 3300025944 Unclassified 4826
664 Ga0207661_10027157 3300025944 Bacteria 4370
665 Ga0207679_10003297 3300025945 Bacteria 9962
666 Ga0207679_10008381 3300025945 Bacteria 6582
667 Ga0207679_10081540 3300025945 Bacteria 2474
668 Ga0207679_10122239 3300025945 Bacteria 2075
669 Ga0207679_10218669 3300025945 Unclassified 1602
670 Ga0207679_10292664 3300025945 Bacteria 1400
671 Ga0207679_10458600 3300025945 Bacteria 1131
672 Ga0207679_10642604 3300025945 Bacteria 959
673 Ga0207667_10000749 3300025949 Bacteria 42187
674 Ga0207667_10001603 3300025949 Bacteria 28431
675 Ga0207667_10054176 3300025949 Bacteria 4219
676 Ga0207667_10090037 3300025949 Viruses 3171
677 Ga0207667_10316599 3300025949 Bacteria 1594
678 Ga0207651_10003277 3300025960 Bacteria 7925
679 Ga0207651_10011989 3300025960 Unclassified 4880
680 Ga0207651_10063829 3300025960 Bacteria 2574
681 Ga0207651_10082088 3300025960 Bacteria 2326
682 Ga0207651_10123247 3300025960 Bacteria 1970
683 Ga0207651_10165074 3300025960 Bacteria 1740
684 Ga0207651_10185776 3300025960 Bacteria 1653
685 Ga0207651_10257187 3300025960 Bacteria 1432
686 Ga0207651_10267556 3300025960 Unclassified 1406
687 Ga0207651_10350564 3300025960 Bacteria 1243
688 Ga0207712_10000442 3300025961 Bacteria 35214
689 Ga0207712_10001446 3300025961 Bacteria 16193
690 Ga0207712_10023884 3300025961 Bacteria 4041
691 Ga0207712_10056005 3300025961 Unclassified 2776
692 Ga0207712_10058531 3300025961 Bacteria 2723
693 Ga0207712_10097017 3300025961 Unclassified 2183
694 Ga0207712_10145969 3300025961 Bacteria 1821
695 Ga0207712_10173373 3300025961 Bacteria 1688
696 Ga0207712_10211159 3300025961 Unclassified 1546
697 Ga0207668_10002845 3300025972 Bacteria 10140
698 Ga0207668_10105256 3300025972 Unclassified 2105
699 Ga0207668_10142040 3300025972 Bacteria 1848
700 Ga0207668_10300971 3300025972 Bacteria 1323
701 Ga0207640_10058951 3300025981 Bacteria 2531
702 Ga0207640_10480674 3300025981 Bacteria 1030
703 Ga0207658_10002695 3300025986 Bacteria 12827
704 Ga0207658_10280033 3300025986 Bacteria 1429
705 Ga0207658_10356937 3300025986 Bacteria 1274
706 Ga0207677_10007162 3300026023 Bacteria 6143
707 Ga0207677_10011819 3300026023 Viruses 4993
708 Ga0207677_10085642 3300026023 Unclassified 2275
709 Ga0207677_10149000 3300026023 Unclassified 1802
710 Ga0207677_10232834 3300026023 Bacteria 1485
711 Ga0207677_10801964 3300026023 Unclassified 843
712 Ga0207677_10820692 3300026023 Bacteria 834
713 Ga0207703_10001511 3300026035 Bacteria 21202
714 Ga0207703_10011137 3300026035 Bacteria 7003
715 Ga0207703_10062783 3300026035 Bacteria 3043
716 Ga0207703_10098192 3300026035 Bacteria 2476
717 Ga0207703_11100573 3300026035 Bacteria 763
718 Ga0207639_10013633 3300026041 Bacteria 5698
719 Ga0207639_10018748 3300026041 Bacteria 4920
720 Ga0207639_10036134 3300026041 Unclassified 3659
721 Ga0207639_10053897 3300026041 Viruses 3071
722 Ga0207639_10096729 3300026041 Bacteria 2376
723 Ga0207639_10188907 3300026041 Unclassified 1758
724 Ga0207678_10052063 3300026067 Unclassified 3533
725 Ga0207702_10108627 3300026078 Bacteria 2462
726 Ga0207702_10176519 3300026078 Bacteria 1964
727 Ga0207641_10000058 3300026088 Bacteria 166385
728 Ga0207641_10000318 3300026088 Bacteria 59432
729 Ga0207641_10010791 3300026088 Bacteria 7489
730 Ga0207641_10064798 3300026088 Bacteria 3124
731 Ga0207641_10344123 3300026088 Bacteria 1420
732 Ga0207641_10791786 3300026088 Bacteria 937
733 Ga0207641_10910603 3300026088 Bacteria 873
734 Ga0207648_10003234 3300026089 Bacteria 17145
735 Ga0207648_10016590 3300026089 Bacteria 6724
736 Ga0207648_10060659 3300026089 Bacteria 3298
737 Ga0207648_10096767 3300026089 Bacteria 2583
738 Ga0207648_10170137 3300026089 Unclassified 1926
739 Ga0207648_10214810 3300026089 Bacteria 1708
740 Ga0207648_10418979 3300026089 Bacteria 1216
741 Ga0207648_10547378 3300026089 Bacteria 1063
742 Ga0207676_10006124 3300026095 Bacteria 8493
743 Ga0207676_10008870 3300026095 Bacteria 7154
744 Ga0207676_10036656 3300026095 Bacteria 3733
745 Ga0207676_10040663 3300026095 Unclassified 3563
746 Ga0207676_10180689 3300026095 Bacteria 1847
747 Ga0207676_10340431 3300026095 Bacteria 1384
748 Ga0207676_10553010 3300026095 Bacteria 1100
749 Ga0207674_10007295 3300026116 Bacteria 12888
750 Ga0207674_10009391 3300026116 Bacteria 11181
751 Ga0207674_10034232 3300026116 Bacteria 5314
752 Ga0207674_10072442 3300026116 Bacteria 3461
753 Ga0207674_10234294 3300026116 Bacteria 1783
754 Ga0207674_10485752 3300026116 Bacteria 1194
755 Ga0207674_10914607 3300026116 Bacteria 846
756 Ga0207675_100000790 3300026118 Bacteria 31482
757 Ga0207675_100002654 3300026118 Bacteria 17641
758 Ga0207675_100053934 3300026118 Bacteria 3751
759 Ga0207675_100084175 3300026118 Bacteria 2984
760 Ga0207675_100134574 3300026118 Bacteria 2344
761 Ga0207675_100161463 3300026118 Bacteria 2138
762 Ga0207675_100248553 3300026118 Bacteria 1721
763 Ga0207675_100315986 3300026118 Bacteria 1524
764 Ga0207675_100330655 3300026118 Bacteria 1490
765 Ga0207675_100435819 3300026118 Bacteria 1296
766 Ga0207675_100474197 3300026118 Bacteria 1243
767 Ga0207683_10001338 3300026121 Bacteria 22249
768 Ga0207683_10020387 3300026121 Bacteria 5670
769 Ga0207683_10039715 3300026121 Bacteria 4106
770 Ga0207698_10006234 3300026142 Bacteria 7426
771 Ga0207698_10018280 3300026142 Bacteria 4772
772 Ga0207698_10036127 3300026142 Bacteria 3623
773 Ga0207698_10154393 3300026142 Bacteria 1997
774 Ga0207698_10245859 3300026142 Unclassified 1634
775 Ga0209971_1026924 3300027682 Unclassified 1375
776 Ga0209974_10028498 3300027876 Unclassified 1850
777 Ga0207428_10033663 3300027907 Unclassified 4206
778 Ga0268266_10000048 3300028379 Bacteria 310336
779 Ga0268266_10066374 3300028379 Viruses 3120
780 Ga0268266_10067339 3300028379 Unclassified 3099
781 Ga0268266_10078214 3300028379 Bacteria 2878
782 Ga0268266_10447242 3300028379 Bacteria 1228
783 Ga0268265_10006349 3300028380 Bacteria 8013
784 Ga0268265_10104831 3300028380 Unclassified 2293
785 Ga0268265_10391446 3300028380 Bacteria 1282
786 Ga0268265_10826962 3300028380 Bacteria 904
787 Ga0268265_10895094 3300028380 Bacteria 871
788 Ga0268264_10000079 3300028381 Bacteria 249516
789 Ga0268264_10001298 3300028381 Bacteria 23546
790 Ga0268264_10002782 3300028381 Bacteria 15265
791 Ga0268264_10012206 3300028381 Bacteria 7069
792 Ga0268264_10018091 3300028381 Bacteria 5764
793 Ga0268264_10093930 3300028381 Unclassified 2592
794 Ga0268264_10160122 3300028381 Unclassified 2027
795 Ga0268264_10169504 3300028381 Bacteria 1973
796 Ga0268264_10212417 3300028381 Unclassified 1777
797 Ga0268264_10290764 3300028381 Unclassified 1534
798 Ga0268264_10362809 3300028381 Bacteria 1382
799 Ga0268264_10471255 3300028381 Unclassified 1220
800 Ga0307517_10000268 3300028786 Bacteria 89531
801 Ga0307517_10134171 3300028786 Unclassified 1768
802 Ga0265324_10014663 3300029957 Bacteria 2895
803 Ga0307511_10000076 3300030521 Bacteria 82520
804 Ga0307509_10218304 3300031507 Bacteria 1723
805 Ga0307408_100409350 3300031548 Bacteria 1167
806 Ga0307516_10353469 3300031730 Bacteria 1135
807 Ga0307405_10469345 3300031731 Bacteria 1002
808 Ga0307410_10076275 3300031852 Unclassified 2340
809 Ga0307410_10399607 3300031852 Bacteria 1110
810 Ga0307406_10265547 3300031901 Unclassified 1301
811 Ga0307416_100765350 3300032002 Unclassified 1059
812 Ga0307414_10155668 3300032004 Bacteria 1809
813 Ga0307414_10507231 3300032004 Bacteria 1068
814 Ga0307414_10876378 3300032004 Bacteria 822
815 Ga0307510_10001791 3300033180 Bacteria 23975
816 Ga0373934_0088553 3300035086 Bacteria 1247
817 Ga0373936_0127699 3300035113 Bacteria 1091
818 Ga0373943_0067354 3300035170 Bacteria 1806
819 Ga0373924_0081716 3300035410 Bacteria 1375
820 Ga0373935_0084399 3300035692 Bacteria 2069
821 Ga0373935_0567782 3300035692 Bacteria 828
822 Ga0373933_0386141 3300035724 Bacteria 912
823 Ga0373947_0656145 3300035725 Bacteria 715
824 Ga0395900_0086331 3300037418 Bacteria 3225
825 Ga0395900_0108156 3300037418 Bacteria 2857
826 Ga0395905_0007118 3300037471 Bacteria 11179
827 Ga0395901_0364220 3300038443 Bacteria 1490
828 Ga0436365_1871658 3300039437 Bacteria 39500
829 Ga0439465_0049696 3300041413 Bacteria 1371
830 Ga0439431_0012671 3300041997 Bacteria 1940
831 Ga0439431_0043338 3300041997 Bacteria 1151
832 Ga0439442_036545 3300042002 Bacteria 1028
833 Ga0439449_0007877 3300042007 Bacteria 4046
834 Ga0439462_0070206 3300042015 Bacteria 951
835 Ga0450923_028531 3300042125 Bacteria 1127
836 Ga0450896_029285 3300042133 Unclassified 829
837 Ga0450898_001962 3300042134 Bacteria 2808
838 Ga0450899_004449 3300042135 Bacteria 1501
839 Ga0439434_0035935 3300042435 Bacteria 1515
840 Ga0451577_0012952 3300042876 Bacteria 7826
841 Ga0451577_0145235 3300042876 Unclassified 2133
842 Ga0466972_0001452 3300044658 Bacteria 11515
843 Ga0466972_0062913 3300044658 Bacteria 1778
844 Ga0453683_0254115 3300044673 Bacteria 1120
845 Ga0466965_0079722 3300044683 Bacteria 1654
846 Ga0466966_0000015 3300044684 Bacteria 127402
847 Ga0466964_0058135 3300044706 Bacteria 1602
848 Ga0453684_0062563 3300044712 Unclassified 4766
849 Ga0453684_0134027 3300044712 Bacteria 2969
850 Ga0453684_0297820 3300044712 Bacteria 1834
851 Ga0453684_0550104 3300044712 Bacteria 1271
852 Ga0453684_0699024 3300044712 Bacteria 1102
853 Ga0466968_0018459 3300044735 Bacteria 2798
854 Ga0466970_0012769 3300044765 Bacteria 4299
855 Ga0466970_0048566 3300044765 Unclassified 2263
856 Ga0466957_0066710 3300044842 Unclassified 2219
857 Ga0466959_0000030 3300045049 Bacteria 111343
858 Ga0466959_0016186 3300045049 Bacteria 5444
859 Ga0466959_0035316 3300045049 Bacteria 3699
860 Ga0451576_0235849 3300045051 Bacteria 1911
861 Ga0466958_0050233 3300045836 Unclassified 2525
862 Ga0495603_0442249 3300046455 Bacteria 745
863 Ga0495650_0129811 3300046471 Bacteria 920
864 Ga0495582_0354770 3300046473 Bacteria 845
865 Ga0495594_0022461 3300046499 Bacteria 3375
866 Ga0495606_0023076 3300046507 Unclassified 4518
867 Ga0495643_0041211 3300046522 Bacteria 2518
868 Ga0495633_0000036 3300046558 Bacteria 184999
869 Ga0495634_0071073 3300046642 Bacteria 2293
870 Ga0495611_0000215 3300046648 Bacteria 40810
871 Ga0495611_0188123 3300046648 Unclassified 964
872 Ga0495625_0051193 3300046660 Bacteria 2961
873 Ga0495657_0178654 3300046675 Bacteria 1304
874 Ga0495649_0057325 3300046694 Bacteria 2101
875 Ga0495672_0085311 3300047320 Bacteria 1750
876 Ga0495687_000429 3300047443 Bacteria 51940
877 Ga0495684_0056004 3300047471 Bacteria 3007
878 Ga0495686_0000005 3300047472 Bacteria 827143
879 Ga0496101_0373677 3300048904 Bacteria 1121
880 Ga0496104_0572615 3300048907 Bacteria 1040
881 Ga0496110_0167800 3300048913 Bacteria 1991
882 Ga0496121_0000082 3300048924 Bacteria 228557
883 Ga0496126_0548457 3300048929 Bacteria 918
884 Ga0501290_012573 3300049513 Bacteria 1098
885 Ga0501290_012778 3300049513 Bacteria 1091
886 Ga0501290_016113 3300049513 Bacteria 994
887 Ga0501292_003376 3300049515 Bacteria 2131
888 Ga0501293_001922 3300049516 Bacteria 1567
889 Ga0501296_001139 3300049519 Bacteria 2666
890 Ga0501296_001461 3300049519 Bacteria 2399
891 Ga0501298_006493 3300049521 Bacteria 1913
892 Ga0501031_0021747 3300049568 Unclassified 4181
893 Ga0501032_0001908 3300049569 Bacteria 16464
894 Ga0501033_0148537 3300049570 Bacteria 1692
895 Ga0501033_0165547 3300049570 Bacteria 1590
896 Ga0501034_0002670 3300049571 Bacteria 21081
897 Ga0501034_0105205 3300049571 Bacteria 2815
898 Ga0501036_0005284 3300049572 Bacteria 10447
899 Ga0501036_0034800 3300049572 Unclassified 4261
900 Ga0501037_0019028 3300049573 Bacteria 5062
901 Ga0501037_0047331 3300049573 Unclassified 3152
902 Ga0501038_0029172 3300049574 Bacteria 4892
903 Ga0501038_0178935 3300049574 Unclassified 1712
904 Ga0501039_0269398 3300049575 Unclassified 1338
905 Ga0501040_0356475 3300049576 Bacteria 1048
906 Ga0501043_0006363 3300049579 Bacteria 9485
907 Ga0501043_0315340 3300049579 Bacteria 1193
908 Ga0501046_0009293 3300049580 Bacteria 8511
909 Ga0501048_0000884 3300049582 Bacteria 22148
910 Ga0501070_0003735 3300049586 Bacteria 13145
911 Ga0501072_0054714 3300049588 Bacteria 3145
912 Ga0501072_0064403 3300049588 Unclassified 2891
913 Ga0501073_0002238 3300049589 Bacteria 14472
914 Ga0501198_004001 3300049649 Bacteria 2034
915 Ga0501199_001228 3300049650 Bacteria 2306
916 Ga0501201_004280 3300049651 Bacteria 1320
917 Ga0501202_013518 3300049652 Bacteria 1553
918 Ga0501202_022773 3300049652 Bacteria 1260
919 Ga0501206_003906 3300049653 Bacteria 1893
920 Ga0501207_002206 3300049654 Bacteria 2502
921 Ga0501207_012585 3300049654 Bacteria 1273
922 Ga0501208_023192 3300049655 Bacteria 1036
923 Ga0501217_000732 3300049661 Bacteria 5675
924 Ga0501217_002135 3300049661 Bacteria 3839
925 Ga0501217_002809 3300049661 Bacteria 3468
926 Ga0501222_002695 3300049662 Bacteria 2460
927 Ga0501223_014943 3300049663 Bacteria 1538
928 Ga0501227_026664 3300049665 Bacteria 1363
929 Ga0501235_000607 3300049669 Bacteria 7220
930 Ga0501235_008309 3300049669 Bacteria 2265
931 Ga0501239_026478 3300049672 Bacteria 740
932 Ga0501242_003136 3300049674 Bacteria 1774
933 Ga0501242_005678 3300049674 Bacteria 1409
934 Ga0501243_000309 3300049675 Bacteria 6287
935 Ga0501243_017204 3300049675 Bacteria 1172
936 Ga0501250_001258 3300049680 Bacteria 2037
937 Ga0501251_007325 3300049681 Bacteria 1225
938 Ga0501251_015790 3300049681 Bacteria 953
939 Ga0501252_000860 3300049682 Bacteria 2591
940 Ga0501252_001699 3300049682 Bacteria 2085
941 Ga0501257_007503 3300049686 Bacteria 2438
942 Ga0501257_009781 3300049686 Bacteria 2168
943 Ga0501258_007068 3300049687 Bacteria 1129
944 Ga0501259_000337 3300049688 Bacteria 7391
945 Ga0501259_002718 3300049688 Bacteria 2847
946 Ga0501259_004027 3300049688 Bacteria 2335
947 Ga0501261_002085 3300049690 Bacteria 2459
948 Ga0501221_007138 3300049704 Bacteria 1908
949 Ga0501221_012654 3300049704 Bacteria 1538
950 Ga0501225_0037643 3300049705 Bacteria 1333
951 Ga0501234_003971 3300049707 Bacteria 2323
952 Ga0501234_029389 3300049707 Unclassified 886
953 Ga0501245_001061 3300049708 Bacteria 3542
954 Ga0501245_001715 3300049708 Bacteria 2866
955 Ga0501245_021526 3300049708 Bacteria 1012
956 Ga0501080_0007927 3300049742 Bacteria 9620
957 Ga0501241_000612 3300049758 Bacteria 7656
958 Ga0501268_000938 3300049765 Bacteria 3431
959 Ga0501268_002093 3300049765 Bacteria 2586
960 Ga0501270_008108 3300049767 Bacteria 1320
961 Ga0501271_001812 3300049768 Bacteria 1850
962 Ga0501279_002027 3300049775 Bacteria 2680
963 Ga0501280_028199 3300049776 Unclassified 867
964 Ga0501035_0003312 3300049822 Bacteria 15431
965 Ga0501044_0014451 3300049823 Bacteria 8523
966 Ga0501044_0035989 3300049823 Bacteria 5181
967 Ga0501044_0171508 3300049823 Bacteria 2141
968 Ga0501204_015306 3300049850 Bacteria 951
969 nmdc:mga07m45_76123_c1 3300050496 Unclassified 1913
970 nmdc:mga05p37_746139_c1 3300050507 Bacteria 1080
971 nmdc:mga09592_31144_c1 3300050508 Bacteria 4443
972 nmdc:mga0qj67_260418_c1 3300050509 Bacteria 1407
973 nmdc:mga06r32_79393_c1 3300050510 Bacteria 3192
974 nmdc:mga08y16_144811_c1 3300050511 Unclassified 2470
975 nmdc:mga08y16_890566_c1 3300050511 Unclassified 877
976 nmdc:mga0n895_14080_c1 3300050512 Bacteria 7251
977 Ga0500644_0000403 3300053088 Bacteria 20587
978 Ga0500646_0001212 3300053090 Bacteria 6921
979 Ga0500583_0002840 3300053092 Bacteria 5317
980 Ga0500583_0003678 3300053092 Unclassified 4878
981 Ga0500651_0211237 3300053093 Bacteria 1141
982 Ga0500569_000388 3300053109 Bacteria 7133
983 Ga0500597_135470 3300053120 Unclassified 1063
984 Ga0500607_116542 3300053121 Bacteria 1300
985 Ga0500642_0003621 3300053130 Unclassified 4702
986 Ga0500652_027381 3300053131 Bacteria 2203
987 Ga0500658_0003607 3300053134 Bacteria 5836
988 Ga0500559_0093793 3300053136 Bacteria 1377
989 Ga0500568_0033011 3300053139 Bacteria 2126
990 Ga0500577_0002818 3300053142 Bacteria 4463
991 Ga0500588_0019572 3300053146 Bacteria 1802
992 Ga0500589_021250 3300053147 Bacteria 2973
993 Ga0500590_043338 3300053148 Bacteria 2308
994 Ga0500616_0105690 3300053153 Bacteria 1368
995 Ga0500622_0000085 3300053156 Bacteria 100276
996 Ga0500622_0001758 3300053156 Bacteria 16652
997 Ga0500633_0008215 3300053160 Bacteria 2678
998 Ga0500636_0081473 3300053177 Bacteria 1864
999 Ga0501084_0087064 3300054114 Bacteria 2623
1000 Ga0501082_0111728 3300060353 Unclassified 2365
1001 2819575177 2818991442 Bacteria 8318214
1002 2819677159 2818991460 Bacteria 7595395
1003 2821141280 2821136567 Bacteria 8080116
1004 2840678551 2840677318 Bacteria 2664183
1005 2883071468 2883068021 Bacteria 6192739
1006 2884797007 2884791551 Bacteria 8511252
1007 2896086369 2896085136 Bacteria 6129793
1008 2904471115 2904467357 Bacteria 8057758
1009 2929239887 2929239360 Bacteria 7745570
1010 2946014328 2946013367 Bacteria 7766675
1011 rootH2_10000442
1012 MRS1b_contig_7821077
1013 ARSoilOldRDRAFT_c001321
1014 JGI24751J29686_10000798
1015 JGI25153J46596_10007175
1016 JGI25153J46596_10066346
1017 rootH2_10076151
1018 rootH2_10252112
1019 rootH2_10315418
1020 rootL2_10002141
1021 rootL2_10002142
1022 rootL2_10021159
1023 rootL2_10318402
1024 rootL2_10359840
1025 rootH1_10000729
1026 rootH1_10130251
1027 JGI25160J50197_1001202
1028 JGI25160J50197_1013566
1029 JGI25160J50197_1042189
1030 Ga0055535_1005062
1031 Ga0055526_1013821
1032 Ga0055528_1000076
1033 Ga0055530_10000023
1034 Ga0055531_10000005
1035 Ga0065165_1000110
1036 Ga0065165_1014384
1037 Ga0065165_1014542
1038 Ga0065712_10020475
1039 Ga0065712_10150071
1040 Ga0065712_10306517
1041 Ga0065715_10001575
1042 Ga0065715_10478092
1043 Ga0065707_10116423
1044 Ga0065707_10145142
1045 Ga0065707_10305839
1046 Ga0070676_10004140
1047 Ga0070676_10008614
1048 Ga0070676_10011952
1049 Ga0070676_10145648
1050 Ga0070683_100002522
1051 Ga0070683_100031464
1052 Ga0070683_100173052
1053 Ga0070690_100016123
1054 Ga0070690_100310816
1055 Ga0070670_100021580
1056 Ga0070670_100027216
1057 Ga0070670_100045357
1058 Ga0070670_100048501
1059 Ga0070670_100137532
1060 Ga0070670_100159398
1061 Ga0070670_100195605
1062 Ga0070670_100211594
1063 Ga0070670_100237135
1064 Ga0070670_100307893
1065 Ga0070677_10011175
1066 Ga0070677_10062168
1067 Ga0070677_10092219
1068 Ga0068869_100003068
1069 Ga0068869_100006133
1070 Ga0068869_100019321
1071 Ga0068869_100044205
1072 Ga0068869_100044987
1073 Ga0068869_100066606
1074 Ga0068869_100079254
1075 Ga0068869_100431026
1076 Ga0068869_100541418
1077 Ga0070666_10000096
1078 Ga0070666_10001663
1079 Ga0070666_10041698
1080 Ga0070666_10076725
1081 Ga0070666_10082152
1082 Ga0070666_10085400
1083 Ga0070666_10498332
1084 Ga0070682_100000008
1085 Ga0070682_100189001
1086 Ga0070682_100348156
1087 Ga0068868_100009492
1088 Ga0068868_100016796
1089 Ga0068868_100017003
1090 Ga0068868_100017243
1091 Ga0068868_100044099
1092 Ga0068868_100256916
1093 Ga0070660_100195872
1094 Ga0070689_100001434
1095 Ga0070689_100003780
1096 Ga0070689_100114610
1097 Ga0070689_100115147
1098 Ga0070689_100670556
1099 Ga0070691_10060727
1100 Ga0070687_100305984
1101 Ga0070661_100004336
1102 Ga0070661_100005816
1103 Ga0070661_100052664
1104 Ga0070661_100099492
1105 Ga0070661_100101392
1106 Ga0070661_100109416
1107 Ga0070661_100129189
1108 Ga0070661_100157639
1109 Ga0070661_100247640
1110 Ga0070692_10142108
1111 Ga0070668_100006621
1112 Ga0070668_100112814
1113 Ga0070668_100155792
1114 Ga0070668_100193090
1115 Ga0070668_100205370
1116 Ga0070669_100003962
1117 Ga0070669_100015882
1118 Ga0070669_100072734
1119 Ga0070669_100132293
1120 Ga0070669_100294444
1121 Ga0070669_100318321
1122 Ga0070669_101008522
1123 Ga0070675_100012925
1124 Ga0070675_100069846
1125 Ga0070675_100098403
1126 Ga0070675_100129762
1127 Ga0070675_100177310
1128 Ga0070675_100354069
1129 Ga0070675_100771584
1130 Ga0070671_100035316
1131 Ga0070671_100039606
1132 Ga0070671_100047720
1133 Ga0070671_100128602
1134 Ga0070671_100166135
1135 Ga0070671_100297023
1136 Ga0070674_100170743
1137 Ga0070674_100212780
1138 Ga0070673_100001237
1139 Ga0070673_100002858
1140 Ga0070673_100018742
1141 Ga0070673_100063800
1142 Ga0070673_100092490
1143 Ga0070673_100118165
1144 Ga0070673_100181369
1145 Ga0070673_100224341
1146 Ga0070673_100282423
1147 Ga0070673_100494168
1148 Ga0070673_100794744
1149 Ga0070688_100001210
1150 Ga0070688_100008564
1151 Ga0070688_100082014
1152 Ga0070659_100008619
1153 Ga0070659_100253455
1154 Ga0070659_100454358
1155 Ga0070667_100002757
1156 Ga0070667_100062881
1157 Ga0070667_100094570
1158 Ga0070667_100106436
1159 Ga0070667_100662098
1160 Ga0070701_10041737
1161 Ga0070701_10449728
1162 Ga0070700_100049548
1163 Ga0070678_100007568
1164 Ga0070678_100008039
1165 Ga0070678_100219911
1166 Ga0070678_100310192
1167 Ga0070662_100012053
1168 Ga0070662_100020333
1169 Ga0070662_100020971
1170 Ga0070662_100025524
1171 Ga0070662_100043678
1172 Ga0070662_100044910
1173 Ga0070662_100394060
1174 Ga0070662_100927263
1175 Ga0070681_10731841
1176 Ga0068867_100015409
1177 Ga0068867_100026633
1178 Ga0068867_100104028
1179 Ga0068867_100144081
1180 Ga0068867_100154609
1181 Ga0068867_100187111
1182 Ga0068867_100322017
1183 Ga0068867_100649327
1184 Ga0068867_100864126
1185 Ga0068867_101157514
1186 Ga0070685_10006138
1187 Ga0070685_10012117
1188 Ga0070685_10065638
1189 Ga0070685_10201613
1190 Ga0070685_10457210
1191 Ga0070698_100000061
1192 Ga0070698_100092215
1193 Ga0070698_100875649
1194 Ga0070699_100174637
1195 Ga0070684_100003744
1196 Ga0070684_100003772
1197 Ga0070684_100008074
1198 Ga0070684_100306077
1199 Ga0070684_100357174
1200 Ga0070684_100445667
1201 Ga0068853_100000796
1202 Ga0068853_100006503
1203 Ga0068853_100008344
1204 Ga0068853_100025487
1205 Ga0068853_100456127
1206 Ga0068853_100653138
1207 Ga0068853_100935750
1208 Ga0068853_101083914
1209 Ga0070672_100015160
1210 Ga0070672_100018204
1211 Ga0070672_100156749
1212 Ga0070672_100210439
1213 Ga0070672_100541286
1214 Ga0070686_100032955
1215 Ga0070686_100127864
1216 Ga0070686_100383448
1217 Ga0070695_100073426
1218 Ga0070693_100360328
1219 Ga0070665_100042819
1220 Ga0070665_100116197
1221 Ga0070665_100176199
1222 Ga0070665_100184428
1223 Ga0070704_100018118
1224 Ga0070704_100105673
1225 Ga0070704_100189425
1226 Ga0068855_100001457
1227 Ga0068855_100045261
1228 Ga0068855_100099029
1229 Ga0068855_100301662
1230 Ga0068855_100552564
1231 Ga0070664_100018058
1232 Ga0070664_100028969
1233 Ga0070664_100109202
1234 Ga0070664_100149707
1235 Ga0070664_100238427
1236 Ga0070664_100301587
1237 Ga0070664_100805852
1238 Ga0070664_100920565
1239 Ga0068857_100022605
1240 Ga0068857_100054252
1241 Ga0068857_100064624
1242 Ga0068857_100206122
1243 Ga0068857_100244235
1244 Ga0068857_100418397
1245 Ga0068857_100626621
1246 Ga0068854_100002878
1247 Ga0068854_100030880
1248 Ga0068854_100108428
1249 Ga0068854_100254433
1250 Ga0068856_100130056
1251 Ga0068856_100135868
1252 Ga0070702_100659484
1253 Ga0068852_100000857
1254 Ga0068852_100001522
1255 Ga0068852_100003549
1256 Ga0068852_100306942
1257 Ga0068852_100395759
1258 Ga0068852_100612137
1259 Ga0068852_101394700
1260 Ga0068859_100000024
1261 Ga0068859_100019662
1262 Ga0068859_100025034
1263 Ga0068859_100036905
1264 Ga0068859_100042230
1265 Ga0068859_100096194
1266 Ga0068859_100173395
1267 Ga0068859_100306027
1268 Ga0068859_100371958
1269 Ga0068859_100404349
1270 Ga0068859_100902479
1271 Ga0068864_100004575
1272 Ga0068864_100005883
1273 Ga0068864_100026240
1274 Ga0068864_100072091
1275 Ga0068864_100083040
1276 Ga0068864_100415053
1277 Ga0068864_100744095
1278 Ga0068866_10024154
1279 Ga0068866_10175027
1280 Ga0068866_10232431
1281 Ga0068861_100001870
1282 Ga0068861_100002412
1283 Ga0068861_100024839
1284 Ga0068861_100049148
1285 Ga0068861_100373791
1286 Ga0068851_10003739
1287 Ga0068851_10058827
1288 Ga0068851_10083643
1289 Ga0068851_10157744
1290 Ga0068870_10008469
1291 Ga0068870_10050453
1292 Ga0068870_10101114
1293 Ga0068870_10215749
1294 Ga0068870_10249758
1295 Ga0068863_100011915
1296 Ga0068863_100039716
1297 Ga0068863_100060049
1298 Ga0068863_100081760
1299 Ga0068863_100341493
1300 Ga0068863_100523996
1301 Ga0068863_100657328
1302 Ga0068858_100003133
1303 Ga0068858_100003141
1304 Ga0068858_100085270
1305 Ga0068858_100123938
1306 Ga0068858_100322832
1307 Ga0068858_100510997
1308 Ga0068860_100000024
1309 Ga0068860_100001839
1310 Ga0068860_100008185
1311 Ga0068860_100019138
1312 Ga0068860_100025276
1313 Ga0068860_100029320
1314 Ga0068860_100065400
1315 Ga0068860_100066970
1316 Ga0068860_100204569
1317 Ga0068860_100383612
1318 Ga0068862_100002297
1319 Ga0068862_100125753
1320 Ga0068862_100271476
1321 Ga0068862_100830445
1322 Ga0068862_101105773
1323 Ga0081539_10011722
1324 Ga0070715_10288749
1325 Ga0075366_10025671
1326 Ga0075366_10145359
1327 Ga0097621_100042034
1328 Ga0097621_100043812
1329 Ga0097621_100232858
1330 Ga0097621_100308030
1331 Ga0097621_100551238
1332 Ga0097621_101023324
1333 Ga0075370_10050448
1334 Ga0068871_100004752
1335 Ga0068871_100014692
1336 Ga0068871_100466410
1337 Ga0075428_100303880
1338 Ga0075430_100013299
1339 Ga0075430_100111938
1340 Ga0075431_100016589
1341 Ga0075434_100017373
1342 Ga0075434_100682483
1343 Ga0075429_100001773
1344 Ga0075429_100074206
1345 Ga0075429_100778825
1346 Ga0068865_100033972
1347 Ga0068865_100051723
1348 Ga0097620_100000024
1349 Ga0097620_100019662
1350 Ga0097620_100025034
1351 Ga0097620_100036905
1352 Ga0097620_100042231
1353 Ga0097620_100096193
1354 Ga0097620_100173390
1355 Ga0097620_100306012
1356 Ga0097620_100371916
1357 Ga0097620_100404342
1358 Ga0097620_100902584
1359 Ga0105244_10302630
1360 Ga0105240_10000106
1361 Ga0105240_10000895
1362 Ga0105240_10002358
1363 Ga0105240_10004897
1364 Ga0105240_10074614
1365 Ga0105240_10088384
1366 Ga0105240_10122314
1367 Ga0105240_10181534
1368 Ga0111539_10004607
1369 Ga0111539_10007347
1370 Ga0111539_10207660
1371 Ga0111539_11396613
1372 Ga0105245_10079189
1373 Ga0105245_10241255
1374 Ga0105245_10903443
1375 Ga0105245_10938801
1376 Ga0105247_10001724
1377 Ga0105247_10297971
1378 Ga0114129_10243115
1379 Ga0114129_10349646
1380 Ga0105243_10080774
1381 Ga0105243_10237309
1382 Ga0105241_10000085
1383 Ga0105241_10005689
1384 Ga0105241_10138163
1385 Ga0105241_10156952
1386 Ga0105241_10237679
1387 Ga0105242_10005018
1388 Ga0105242_10070885
1389 Ga0105242_10076884
1390 Ga0105242_10133369
1391 Ga0105242_10154328
1392 Ga0105242_10269890
1393 Ga0105242_10280589
1394 Ga0105248_10037895
1395 Ga0105237_10000453
1396 Ga0105237_10013660
1397 Ga0105237_10021915
1398 Ga0105237_10034777
1399 Ga0105237_10050819
1400 Ga0105237_10166996
1401 Ga0105237_10212082
1402 Ga0105237_10242616
1403 Ga0105237_10248689
1404 Ga0105237_10252864
1405 Ga0105238_10001678
1406 Ga0105238_10027955
1407 Ga0105238_10107405
1408 Ga0105238_10317212
1409 Ga0105249_10002023
1410 Ga0105249_10007013
1411 Ga0105249_10015481
1412 Ga0105249_10024744
1413 Ga0105249_10029535
1414 Ga0105249_10031991
1415 Ga0105249_10051878
1416 Ga0105249_10090950
1417 Ga0105249_10098094
1418 Ga0105249_10153989
1419 Ga0105249_10160224
1420 Ga0105249_10191916
1421 Ga0105249_10238793
1422 Ga0105249_11287643
1423 Ga0105239_10000019
1424 Ga0105239_10000384
1425 Ga0105239_10003545
1426 Ga0105239_10012678
1427 Ga0105239_10034600
1428 Ga0105239_10053305
1429 Ga0105239_10062597
1430 Ga0105239_10087953
1431 Ga0105239_10089409
1432 Ga0105239_10636988
1433 Ga0105239_10668246
1434 Ga0105239_10794999
1435 Ga0105239_11498530
1436 Ga0105246_10001022
1437 Ga0105246_10221717
1438 Ga0105246_10286352
1439 Ga0105246_10351717
1440 Ga0157373_10043948
1441 Ga0157373_10139222
1442 Ga0157373_10186084
1443 Ga0157371_10008920
1444 Ga0157371_10032938
1445 Ga0157371_10106778
1446 Ga0157371_10195696
1447 Ga0157371_10360272
1448 Ga0157371_10640225
1449 Ga0157370_10002878
1450 Ga0157370_10016966
1451 Ga0157370_10083776
1452 Ga0157370_10153916
1453 Ga0157370_10798343
1454 Ga0157369_10192606
1455 Ga0157369_10399441
1456 Ga0157374_10000011
1457 Ga0157374_10012134
1458 Ga0157374_10025437
1459 Ga0157374_10028180
1460 Ga0157374_10057007
1461 Ga0157374_10066125
1462 Ga0157374_10101373
1463 Ga0157374_10112556
1464 Ga0157374_10533141
1465 Ga0157378_10089507
1466 Ga0157378_10180559
1467 Ga0157378_10195528
1468 Ga0157378_10223800
1469 Ga0157378_10227553
1470 Ga0157378_10318855
1471 Ga0157378_10467152
1472 Ga0157378_10704311
1473 Ga0163162_10000189
1474 Ga0163162_10000446
1475 Ga0163162_10000687
1476 Ga0163162_10002569
1477 Ga0163162_10034873
1478 Ga0163162_10038451
1479 Ga0163162_10067267
1480 Ga0163162_10194517
1481 Ga0163162_10367617
1482 Ga0157372_10006780
1483 Ga0157372_10013773
1484 Ga0157372_10017732
1485 Ga0157372_10043256
1486 Ga0157372_10063290
1487 Ga0157372_10064498
1488 Ga0157372_10246926
1489 Ga0157372_10251227
1490 Ga0157372_10280174
1491 Ga0157372_10384159
1492 Ga0157372_10452445
1493 Ga0157372_10498670
1494 Ga0157372_11449912
1495 Ga0157372_11506528
1496 Ga0157375_10011538
1497 Ga0157375_10062680
1498 Ga0157375_10064042
1499 Ga0157375_10079622
1500 Ga0157375_10080435
1501 Ga0157375_10379957
1502 Ga0157375_10382321
1503 Ga0157375_10455081
1504 Ga0157375_10849971
1505 Ga0157375_10948459
1506 Ga0163163_10001441
1507 Ga0163163_10027772
1508 Ga0163163_10047990
1509 Ga0163163_10115108
1510 Ga0163163_10191749
1511 Ga0163163_10195361
1512 Ga0157380_10000477
1513 Ga0157380_10236061
1514 Ga0157380_11047779
1515 Ga0157380_11164558
1516 Ga0157377_10000592
1517 Ga0157377_10006415
1518 Ga0157377_10024223
1519 Ga0157377_10073050
1520 Ga0157377_10356000
1521 Ga0157377_10420512
1522 Ga0157379_10013944
1523 Ga0157379_10034749
1524 Ga0157379_10072795
1525 Ga0157379_10073080
1526 Ga0157379_10189739
1527 Ga0157379_10234775
1528 Ga0157376_10005632
1529 Ga0157376_10015084
1530 Ga0157376_10058509
1531 Ga0157376_10076387
1532 Ga0157376_10218967
1533 Ga0157376_10686916
1534 Ga0157376_10849211
1535 Ga0182005_1000017
1536 Ga0163161_10006412
1537 Ga0163161_10063433
1538 Ga0163161_10124529
1539 Ga0163161_10231657
1540 Ga0209436_100787
1541 Ga0209436_101343
1542 Ga0209258_100029
1543 Ga0209646_1000031
1544 Ga0209026_1000019
1545 Ga0209148_1000194
1546 Ga0209129_1017055
1547 Ga0207666_1020045
1548 Ga0209673_1000501
1549 Ga0209130_1000333
1550 Ga0209564_1011975
1551 Ga0209758_1008947
1552 Ga0209758_1022289
1553 Ga0209050_1000216
1554 Ga0207426_1000024
1555 Ga0207426_1001331
1556 Ga0207426_1044975
1557 Ga0209257_1000004
1558 Ga0209257_1009260
1559 Ga0207697_10008375
1560 Ga0207697_10055492
1561 Ga0207656_10002100
1562 Ga0207682_10016584
1563 Ga0207642_10003436
1564 Ga0207642_10439506
1565 Ga0207710_10001848
1566 Ga0207710_10126357
1567 Ga0207688_10004807
1568 Ga0207680_10000455
1569 Ga0207680_10029903
1570 Ga0207680_10031451
1571 Ga0207680_10137965
1572 Ga0207680_10199681
1573 Ga0207680_10428209
1574 Ga0207647_10000025
1575 Ga0207647_10039735
1576 Ga0207647_10090658
1577 Ga0207647_10288030
1578 Ga0207645_10000356
1579 Ga0207645_10005727
1580 Ga0207645_10017356
1581 Ga0207645_10028106
1582 Ga0207643_10004864
1583 Ga0207643_10004942
1584 Ga0207705_10005298
1585 Ga0207654_10000792
1586 Ga0207654_10000944
1587 Ga0207654_10256479
1588 Ga0207695_10000087
1589 Ga0207695_10000582
1590 Ga0207695_10000909
1591 Ga0207695_10004513
1592 Ga0207695_10021645
1593 Ga0207695_10120923
1594 Ga0207695_10442855
1595 Ga0207671_10000311
1596 Ga0207671_10001101
1597 Ga0207671_10001299
1598 Ga0207671_10006605
1599 Ga0207671_10093501
1600 Ga0207671_10105270
1601 Ga0207671_10157842
1602 Ga0207671_10360204
1603 Ga0207657_10059678
1604 Ga0207657_10101763
1605 Ga0207657_10124281
1606 Ga0207649_10001650
1607 Ga0207649_10005817
1608 Ga0207649_10100367
1609 Ga0207649_10208457
1610 Ga0207649_10755790
1611 Ga0207681_10053212
1612 Ga0207681_10182866
1613 Ga0207681_10391194
1614 Ga0207694_10007619
1615 Ga0207694_10083895
1616 Ga0207650_10014161
1617 Ga0207650_10033783
1618 Ga0207650_10059953
1619 Ga0207650_10073887
1620 Ga0207650_10086909
1621 Ga0207650_10091822
1622 Ga0207650_10386773
1623 Ga0207650_10529610
1624 Ga0207650_10923473
1625 Ga0207659_10026907
1626 Ga0207659_10098648
1627 Ga0207659_10137581
1628 Ga0207659_10404849
1629 Ga0207659_10405322
1630 Ga0207659_10647350
1631 Ga0207644_10022195
1632 Ga0207644_10174177
1633 Ga0207644_10470887
1634 Ga0207690_10022006
1635 Ga0207690_10271120
1636 Ga0207706_10003804
1637 Ga0207706_10017354
1638 Ga0207706_10041428
1639 Ga0207706_10055020
1640 Ga0207706_10055030
1641 Ga0207706_10096912
1642 Ga0207686_10002454
1643 Ga0207686_10045017
1644 Ga0207686_10053668
1645 Ga0207686_10071919
1646 Ga0207670_10025851
1647 Ga0207670_10037372
1648 Ga0207670_10040648
1649 Ga0207669_10124133
1650 Ga0207704_10004256
1651 Ga0207704_10017379
1652 Ga0207704_10181642
1653 Ga0207704_10469024
1654 Ga0207691_10000753
1655 Ga0207691_10002055
1656 Ga0207691_10016839
1657 Ga0207691_10024972
1658 Ga0207691_10081293
1659 Ga0207711_10115112
1660 Ga0207711_10337725
1661 Ga0207689_10001522
1662 Ga0207689_10006221
1663 Ga0207689_10007013
1664 Ga0207689_10018846
1665 Ga0207689_10032412
1666 Ga0207689_10036291
1667 Ga0207689_10044204
1668 Ga0207689_10125081
1669 Ga0207689_10160896
1670 Ga0207689_10199794
1671 Ga0207689_10248357
1672 Ga0207661_10012248
1673 Ga0207661_10021591
1674 Ga0207661_10027157
1675 Ga0207679_10003297
1676 Ga0207679_10008381
1677 Ga0207679_10081540
1678 Ga0207679_10122239
1679 Ga0207679_10218669
1680 Ga0207679_10292664
1681 Ga0207679_10458600
1682 Ga0207679_10642604
1683 Ga0207667_10000749
1684 Ga0207667_10001603
1685 Ga0207667_10054176
1686 Ga0207667_10090037
1687 Ga0207667_10316599
1688 Ga0207651_10003277
1689 Ga0207651_10011989
1690 Ga0207651_10063829
1691 Ga0207651_10082088
1692 Ga0207651_10123247
1693 Ga0207651_10165074
1694 Ga0207651_10185776
1695 Ga0207651_10257187
1696 Ga0207651_10267556
1697 Ga0207651_10350564
1698 Ga0207712_10000442
1699 Ga0207712_10001446
1700 Ga0207712_10023884
1701 Ga0207712_10056005
1702 Ga0207712_10058531
1703 Ga0207712_10097017
1704 Ga0207712_10145969
1705 Ga0207712_10173373
1706 Ga0207712_10211159
1707 Ga0207668_10002845
1708 Ga0207668_10105256
1709 Ga0207668_10142040
1710 Ga0207668_10300971
1711 Ga0207640_10058951
1712 Ga0207640_10480674
1713 Ga0207658_10002695
1714 Ga0207658_10280033
1715 Ga0207658_10356937
1716 Ga0207677_10007162
1717 Ga0207677_10011819
1718 Ga0207677_10085642
1719 Ga0207677_10149000
1720 Ga0207677_10232834
1721 Ga0207677_10801964
1722 Ga0207677_10820692
1723 Ga0207703_10001511
1724 Ga0207703_10011137
1725 Ga0207703_10062783
1726 Ga0207703_10098192
1727 Ga0207703_11100573
1728 Ga0207639_10013633
1729 Ga0207639_10018748
1730 Ga0207639_10036134
1731 Ga0207639_10053897
1732 Ga0207639_10096729
1733 Ga0207639_10188907
1734 Ga0207678_10052063
1735 Ga0207702_10108627
1736 Ga0207702_10176519
1737 Ga0207641_10000058
1738 Ga0207641_10000318
1739 Ga0207641_10010791
1740 Ga0207641_10064798
1741 Ga0207641_10344123
1742 Ga0207641_10791786
1743 Ga0207641_10910603
1744 Ga0207648_10003234
1745 Ga0207648_10016590
1746 Ga0207648_10060659
1747 Ga0207648_10096767
1748 Ga0207648_10170137
1749 Ga0207648_10214810
1750 Ga0207648_10418979
1751 Ga0207648_10547378
1752 Ga0207676_10006124
1753 Ga0207676_10008870
1754 Ga0207676_10036656
1755 Ga0207676_10040663
1756 Ga0207676_10180689
1757 Ga0207676_10340431
1758 Ga0207676_10553010
1759 Ga0207674_10007295
1760 Ga0207674_10009391
1761 Ga0207674_10034232
1762 Ga0207674_10072442
1763 Ga0207674_10234294
1764 Ga0207674_10485752
1765 Ga0207674_10914607
1766 Ga0207675_100000790
1767 Ga0207675_100002654
1768 Ga0207675_100053934
1769 Ga0207675_100084175
1770 Ga0207675_100134574
1771 Ga0207675_100161463
1772 Ga0207675_100248553
1773 Ga0207675_100315986
1774 Ga0207675_100330655
1775 Ga0207675_100435819
1776 Ga0207675_100474197
1777 Ga0207683_10001338
1778 Ga0207683_10020387
1779 Ga0207683_10039715
1780 Ga0207698_10006234
1781 Ga0207698_10018280
1782 Ga0207698_10036127
1783 Ga0207698_10154393
1784 Ga0207698_10245859
1785 Ga0209971_1026924
1786 Ga0209974_10028498
1787 Ga0207428_10033663
1788 Ga0268266_10000048
1789 Ga0268266_10066374
1790 Ga0268266_10067339
1791 Ga0268266_10078214
1792 Ga0268266_10447242
1793 Ga0268265_10006349
1794 Ga0268265_10104831
1795 Ga0268265_10391446
1796 Ga0268265_10826962
1797 Ga0268265_10895094
1798 Ga0268264_10000079
1799 Ga0268264_10001298
1800 Ga0268264_10002782
1801 Ga0268264_10012206
1802 Ga0268264_10018091
1803 Ga0268264_10093930
1804 Ga0268264_10160122
1805 Ga0268264_10169504
1806 Ga0268264_10212417
1807 Ga0268264_10290764
1808 Ga0268264_10362809
1809 Ga0268264_10471255
1810 Ga0307517_10000268
1811 Ga0307517_10134171
1812 Ga0265324_10014663
1813 Ga0307511_10000076
1814 Ga0307509_10218304
1815 Ga0307408_100409350
1816 Ga0307516_10353469
1817 Ga0307405_10469345
1818 Ga0307410_10076275
1819 Ga0307410_10399607
1820 Ga0307406_10265547
1821 Ga0307416_100765350
1822 Ga0307414_10155668
1823 Ga0307414_10507231
1824 Ga0307414_10876378
1825 Ga0307510_10001791
1826 Ga0373934_0088553
1827 Ga0373936_0127699
1828 Ga0373943_0067354
1829 Ga0373924_0081716
1830 Ga0373935_0084399
1831 Ga0373935_0567782
1832 Ga0373933_0386141
1833 Ga0373947_0656145
1834 Ga0395900_0086331
1835 Ga0395900_0108156
1836 Ga0395905_0007118
1837 Ga0395901_0364220
1838 Ga0436365_1871658
1839 Ga0439465_0049696
1840 Ga0439431_0012671
1841 Ga0439431_0043338
1842 Ga0439442_036545
1843 Ga0439449_0007877
1844 Ga0439462_0070206
1845 Ga0450923_028531
1846 Ga0450896_029285
1847 Ga0450898_001962
1848 Ga0450899_004449
1849 Ga0439434_0035935
1850 Ga0451577_0012952
1851 Ga0451577_0145235
1852 Ga0466972_0001452
1853 Ga0466972_0062913
1854 Ga0453683_0254115
1855 Ga0466965_0079722
1856 Ga0466966_0000015
1857 Ga0466964_0058135
1858 Ga0453684_0062563
1859 Ga0453684_0134027
1860 Ga0453684_0297820
1861 Ga0453684_0550104
1862 Ga0453684_0699024
1863 Ga0466968_0018459
1864 Ga0466970_0012769
1865 Ga0466970_0048566
1866 Ga0466957_0066710
1867 Ga0466959_0000030
1868 Ga0466959_0016186
1869 Ga0466959_0035316
1870 Ga0451576_0235849
1871 Ga0466958_0050233
1872 Ga0495603_0442249
1873 Ga0495650_0129811
1874 Ga0495582_0354770
1875 Ga0495594_0022461
1876 Ga0495606_0023076
1877 Ga0495643_0041211
1878 Ga0495633_0000036
1879 Ga0495634_0071073
1880 Ga0495611_0000215
1881 Ga0495611_0188123
1882 Ga0495625_0051193
1883 Ga0495657_0178654
1884 Ga0495649_0057325
1885 Ga0495672_0085311
1886 Ga0495687_000429
1887 Ga0495684_0056004
1888 Ga0495686_0000005
1889 Ga0496101_0373677
1890 Ga0496104_0572615
1891 Ga0496110_0167800
1892 Ga0496121_0000082
1893 Ga0496126_0548457
1894 Ga0501290_012573
1895 Ga0501290_012778
1896 Ga0501290_016113
1897 Ga0501292_003376
1898 Ga0501293_001922
1899 Ga0501296_001139
1900 Ga0501296_001461
1901 Ga0501298_006493
1902 Ga0501031_0021747
1903 Ga0501032_0001908
1904 Ga0501033_0148537
1905 Ga0501033_0165547
1906 Ga0501034_0002670
1907 Ga0501034_0105205
1908 Ga0501036_0005284
1909 Ga0501036_0034800
1910 Ga0501037_0019028
1911 Ga0501037_0047331
1912 Ga0501038_0029172
1913 Ga0501038_0178935
1914 Ga0501039_0269398
1915 Ga0501040_0356475
1916 Ga0501043_0006363
1917 Ga0501043_0315340
1918 Ga0501046_0009293
1919 Ga0501048_0000884
1920 Ga0501070_0003735
1921 Ga0501072_0054714
1922 Ga0501072_0064403
1923 Ga0501073_0002238
1924 Ga0501198_004001
1925 Ga0501199_001228
1926 Ga0501201_004280
1927 Ga0501202_013518
1928 Ga0501202_022773
1929 Ga0501206_003906
1930 Ga0501207_002206
1931 Ga0501207_012585
1932 Ga0501208_023192
1933 Ga0501217_000732
1934 Ga0501217_002135
1935 Ga0501217_002809
1936 Ga0501222_002695
1937 Ga0501223_014943
1938 Ga0501227_026664
1939 Ga0501235_000607
1940 Ga0501235_008309
1941 Ga0501239_026478
1942 Ga0501242_003136
1943 Ga0501242_005678
1944 Ga0501243_000309
1945 Ga0501243_017204
1946 Ga0501250_001258
1947 Ga0501251_007325
1948 Ga0501251_015790
1949 Ga0501252_000860
1950 Ga0501252_001699
1951 Ga0501257_007503
1952 Ga0501257_009781
1953 Ga0501258_007068
1954 Ga0501259_000337
1955 Ga0501259_002718
1956 Ga0501259_004027
1957 Ga0501261_002085
1958 Ga0501221_007138
1959 Ga0501221_012654
1960 Ga0501225_0037643
1961 Ga0501234_003971
1962 Ga0501234_029389
1963 Ga0501245_001061
1964 Ga0501245_001715
1965 Ga0501245_021526
1966 Ga0501080_0007927
1967 Ga0501241_000612
1968 Ga0501268_000938
1969 Ga0501268_002093
1970 Ga0501270_008108
1971 Ga0501271_001812
1972 Ga0501279_002027
1973 Ga0501280_028199
1974 Ga0501035_0003312
1975 Ga0501044_0014451
1976 Ga0501044_0035989
1977 Ga0501044_0171508
1978 Ga0501204_015306
1979 nmdc:mga07m45_76123_c1
1980 nmdc:mga05p37_746139_c1
1981 nmdc:mga09592_31144_c1
1982 nmdc:mga0qj67_260418_c1
1983 nmdc:mga06r32_79393_c1
1984 nmdc:mga08y16_144811_c1
1985 nmdc:mga08y16_890566_c1
1986 nmdc:mga0n895_14080_c1
1987 Ga0500644_0000403
1988 Ga0500646_0001212
1989 Ga0500583_0002840
1990 Ga0500583_0003678
1991 Ga0500651_0211237
1992 Ga0500569_000388
1993 Ga0500597_135470
1994 Ga0500607_116542
1995 Ga0500642_0003621
1996 Ga0500652_027381
1997 Ga0500658_0003607
1998 Ga0500559_0093793
1999 Ga0500568_0033011
2000 Ga0500577_0002818
2001 Ga0500588_0019572
2002 Ga0500589_021250
2003 Ga0500590_043338
2004 Ga0500616_0105690
2005 Ga0500622_0000085
2006 Ga0500622_0001758
2007 Ga0500633_0008215
2008 Ga0500636_0081473
2009 Ga0501084_0087064
2010 Ga0501082_0111728
2011 2819575177
2012 2819677159
2013 2821141280
2014 2840678551
2015 2883071468
2016 2884797007
2017 2896086369
2018 2904471115
2019 2929239887
2020 2946014328

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02190

LON_substr_bdg

ATP-dependent protease La (LON) substrate-binding domain

32

210

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ljc-assembly1.cif.gz_A crystal structure of lon n-terminal domain. 0.8379 1 198
7p6u-assembly1.cif.gz_C lon protease from thermus thermophilus 0.8375 3 198
7cay-assembly1.cif.gz_A crystal structure of lon n-terminal domain protein from xanthomonas campestris 0.8206 3 176
7p6u-assembly1.cif.gz_F lon protease from thermus thermophilus 0.8075 3 198
8d81-assembly1.cif.gz_B cereblon~ddb1 bound to pomalidomide 0.8029 2 182
ID Description Score Start End Superfamily
af_I1K7N5_54_171_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9246 2 106 2.30.130.40
af_B4FM67_80_193_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.9159 1 106 2.30.130.40
af_K7KDV3_6_113_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.897 5 95 2.30.130.40
af_I1KCV7_279_380_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.8949 3 108 2.30.130.40
af_A0A2R8PXH8_356_472_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.8937 5 106 2.30.130.40
ID Description Score Start End GO Terms
AF-A0A537JS05-F1-model_v4 Peptidase S16 0.988 1 184
AF-A0A537JS05-F1-model_v4 Peptidase S16 0.9827 1 184
AF-A0A3M1JAX0-F1-model_v4 Peptidase 0.9703 1 106
AF-A0A537TLV3-F1-model_v4 Lon N-terminal domain-containing protein 0.9637 5 82
AF-A0A537ZW03-F1-model_v4 Lon N-terminal domain-containing protein 0.9629 2 105

Map