F488106
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1010 | 351 | 2020 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300003320|rootH2_10000442|rootH2_1000044248 |
| Length | 241 |
| Sequence | MTTERAGGSLPEGPTLALFLKKGIFADMTNFIPVFPLGIVVYPGETVNLHIFEPRYKQLINECYSEGKPFGIPTVIDNKLNEMGTLVRVTEIVKVHDNGELDIRTLGLKVFRVLELIKSIPDKLFSGAIVNYPDNIEGPGKRELMQKVVNAIRELHRLLNIEKDFKKPDEELAAYDIAHHVGLSLEQEYEVLGLLREEQRQEYIKRHLGKVLPVIAEMETLKERVKLNGHFKNLSSFKFED |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 191 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 202 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 214 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 215 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 216 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 217 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 218 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 219 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 220 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 221 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 222 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 230 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 258 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 259 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 260 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 261 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 278 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 279 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 280 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 282 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 283 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 284 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 285 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 286 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 288 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 289 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 290 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 291 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 292 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 293 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 294 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 295 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 296 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 297 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 298 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 299 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 300 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 303 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 305 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 306 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 307 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 308 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 309 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 310 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 313 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 322 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 323 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 324 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 325 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 326 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 327 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 328 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 329 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 331 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 332 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 333 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 334 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 335 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 338 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 339 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 340 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 343 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 344 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 345 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 346 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 347 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 348 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 349 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 350 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 351 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0 |
| Isolates | 0.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.45 |
| Nodule | 0 |
| Rhizoplane | 0.3 |
| Rhizosphere | 91.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10000442 | 3300003320 | Bacteria | 46233 |
| 2 | MRS1b_contig_7821077 | 2162886011 | Unclassified | 1230 |
| 3 | ARSoilOldRDRAFT_c001321 | 3300000044 | Unclassified | 2317 |
| 4 | JGI24751J29686_10000798 | 3300002459 | Bacteria | 7365 |
| 5 | JGI25153J46596_10007175 | 3300003215 | Bacteria | 5525 |
| 6 | JGI25153J46596_10066346 | 3300003215 | Bacteria | 955 |
| 7 | rootH2_10076151 | 3300003320 | Bacteria | 10907 |
| 8 | rootH2_10252112 | 3300003320 | Bacteria | 1327 |
| 9 | rootH2_10315418 | 3300003320 | Bacteria | 1526 |
| 10 | rootL2_10002141 | 3300003322 | Bacteria | 7623 |
| 11 | rootL2_10002142 | 3300003322 | Bacteria | 6192 |
| 12 | rootL2_10021159 | 3300003322 | Bacteria | 4372 |
| 13 | rootL2_10318402 | 3300003322 | Bacteria | 1216 |
| 14 | rootL2_10359840 | 3300003322 | Bacteria | 1249 |
| 15 | rootH1_10000729 | 3300003323 | Bacteria | 24019 |
| 16 | rootH1_10130251 | 3300003323 | Bacteria | 5565 |
| 17 | JGI25160J50197_1001202 | 3300003354 | Bacteria | 13164 |
| 18 | JGI25160J50197_1013566 | 3300003354 | Bacteria | 2771 |
| 19 | JGI25160J50197_1042189 | 3300003354 | Bacteria | 1040 |
| 20 | Ga0055535_1005062 | 3300003761 | Bacteria | 2999 |
| 21 | Ga0055526_1013821 | 3300003771 | Bacteria | 3378 |
| 22 | Ga0055528_1000076 | 3300003790 | Bacteria | 76002 |
| 23 | Ga0055530_10000023 | 3300003791 | Bacteria | 135890 |
| 24 | Ga0055531_10000005 | 3300003794 | Bacteria | 242179 |
| 25 | Ga0065165_1000110 | 3300005262 | Bacteria | 137063 |
| 26 | Ga0065165_1014384 | 3300005262 | Bacteria | 3076 |
| 27 | Ga0065165_1014542 | 3300005262 | Bacteria | 3050 |
| 28 | Ga0065712_10020475 | 3300005290 | Unclassified | 1218 |
| 29 | Ga0065712_10150071 | 3300005290 | Bacteria | 1365 |
| 30 | Ga0065712_10306517 | 3300005290 | Unclassified | 844 |
| 31 | Ga0065715_10001575 | 3300005293 | Bacteria | 10538 |
| 32 | Ga0065715_10478092 | 3300005293 | Bacteria | 800 |
| 33 | Ga0065707_10116423 | 3300005295 | Bacteria | 2238 |
| 34 | Ga0065707_10145142 | 3300005295 | Bacteria | 1723 |
| 35 | Ga0065707_10305839 | 3300005295 | Unclassified | 995 |
| 36 | Ga0070676_10004140 | 3300005328 | Bacteria | 7619 |
| 37 | Ga0070676_10008614 | 3300005328 | Bacteria | 5500 |
| 38 | Ga0070676_10011952 | 3300005328 | Unclassified | 4732 |
| 39 | Ga0070676_10145648 | 3300005328 | Bacteria | 1512 |
| 40 | Ga0070683_100002522 | 3300005329 | Bacteria | 14587 |
| 41 | Ga0070683_100031464 | 3300005329 | Bacteria | 4825 |
| 42 | Ga0070683_100173052 | 3300005329 | Bacteria | 2049 |
| 43 | Ga0070690_100016123 | 3300005330 | Bacteria | 4470 |
| 44 | Ga0070690_100310816 | 3300005330 | Bacteria | 1133 |
| 45 | Ga0070670_100021580 | 3300005331 | Bacteria | 5538 |
| 46 | Ga0070670_100027216 | 3300005331 | Bacteria | 4919 |
| 47 | Ga0070670_100045357 | 3300005331 | Unclassified | 3778 |
| 48 | Ga0070670_100048501 | 3300005331 | Bacteria | 3654 |
| 49 | Ga0070670_100137532 | 3300005331 | Unclassified | 2111 |
| 50 | Ga0070670_100159398 | 3300005331 | Bacteria | 1955 |
| 51 | Ga0070670_100195605 | 3300005331 | Unclassified | 1757 |
| 52 | Ga0070670_100211594 | 3300005331 | Bacteria | 1686 |
| 53 | Ga0070670_100237135 | 3300005331 | Bacteria | 1588 |
| 54 | Ga0070670_100307893 | 3300005331 | Bacteria | 1386 |
| 55 | Ga0070677_10011175 | 3300005333 | Bacteria | 3089 |
| 56 | Ga0070677_10062168 | 3300005333 | Bacteria | 1544 |
| 57 | Ga0070677_10092219 | 3300005333 | Bacteria | 1320 |
| 58 | Ga0068869_100003068 | 3300005334 | Bacteria | 10160 |
| 59 | Ga0068869_100006133 | 3300005334 | Bacteria | 7608 |
| 60 | Ga0068869_100019321 | 3300005334 | Bacteria | 4652 |
| 61 | Ga0068869_100044205 | 3300005334 | Viruses | 3203 |
| 62 | Ga0068869_100044987 | 3300005334 | Bacteria | 3176 |
| 63 | Ga0068869_100066606 | 3300005334 | Bacteria | 2654 |
| 64 | Ga0068869_100079254 | 3300005334 | Bacteria | 2448 |
| 65 | Ga0068869_100431026 | 3300005334 | Bacteria | 1089 |
| 66 | Ga0068869_100541418 | 3300005334 | Unclassified | 977 |
| 67 | Ga0070666_10000096 | 3300005335 | Bacteria | 60717 |
| 68 | Ga0070666_10001663 | 3300005335 | Bacteria | 13569 |
| 69 | Ga0070666_10041698 | 3300005335 | Bacteria | 3068 |
| 70 | Ga0070666_10076725 | 3300005335 | Unclassified | 2280 |
| 71 | Ga0070666_10082152 | 3300005335 | Bacteria | 2203 |
| 72 | Ga0070666_10085400 | 3300005335 | Bacteria | 2161 |
| 73 | Ga0070666_10498332 | 3300005335 | Bacteria | 883 |
| 74 | Ga0070682_100000008 | 3300005337 | Bacteria | 322125 |
| 75 | Ga0070682_100189001 | 3300005337 | Bacteria | 1445 |
| 76 | Ga0070682_100348156 | 3300005337 | Unclassified | 1104 |
| 77 | Ga0068868_100009492 | 3300005338 | Bacteria | 7007 |
| 78 | Ga0068868_100016796 | 3300005338 | Bacteria | 5444 |
| 79 | Ga0068868_100017003 | 3300005338 | Bacteria | 5411 |
| 80 | Ga0068868_100017243 | 3300005338 | Bacteria | 5375 |
| 81 | Ga0068868_100044099 | 3300005338 | Bacteria | 3486 |
| 82 | Ga0068868_100256916 | 3300005338 | Bacteria | 1472 |
| 83 | Ga0070660_100195872 | 3300005339 | Unclassified | 1638 |
| 84 | Ga0070689_100001434 | 3300005340 | Bacteria | 15205 |
| 85 | Ga0070689_100003780 | 3300005340 | Bacteria | 10139 |
| 86 | Ga0070689_100114610 | 3300005340 | Bacteria | 2148 |
| 87 | Ga0070689_100115147 | 3300005340 | Bacteria | 2142 |
| 88 | Ga0070689_100670556 | 3300005340 | Unclassified | 903 |
| 89 | Ga0070691_10060727 | 3300005341 | Bacteria | 1817 |
| 90 | Ga0070687_100305984 | 3300005343 | Unclassified | 1010 |
| 91 | Ga0070661_100004336 | 3300005344 | Bacteria | 9787 |
| 92 | Ga0070661_100005816 | 3300005344 | Bacteria | 8481 |
| 93 | Ga0070661_100052664 | 3300005344 | Bacteria | 2979 |
| 94 | Ga0070661_100099492 | 3300005344 | Bacteria | 2161 |
| 95 | Ga0070661_100101392 | 3300005344 | Bacteria | 2141 |
| 96 | Ga0070661_100109416 | 3300005344 | Bacteria | 2062 |
| 97 | Ga0070661_100129189 | 3300005344 | Bacteria | 1897 |
| 98 | Ga0070661_100157639 | 3300005344 | Bacteria | 1718 |
| 99 | Ga0070661_100247640 | 3300005344 | Bacteria | 1374 |
| 100 | Ga0070692_10142108 | 3300005345 | Unclassified | 1359 |
| 101 | Ga0070668_100006621 | 3300005347 | Bacteria | 8584 |
| 102 | Ga0070668_100112814 | 3300005347 | Unclassified | 2165 |
| 103 | Ga0070668_100155792 | 3300005347 | Bacteria | 1850 |
| 104 | Ga0070668_100193090 | 3300005347 | Bacteria | 1668 |
| 105 | Ga0070668_100205370 | 3300005347 | Bacteria | 1619 |
| 106 | Ga0070669_100003962 | 3300005353 | Bacteria | 10711 |
| 107 | Ga0070669_100015882 | 3300005353 | Bacteria | 5371 |
| 108 | Ga0070669_100072734 | 3300005353 | Unclassified | 2546 |
| 109 | Ga0070669_100132293 | 3300005353 | Bacteria | 1915 |
| 110 | Ga0070669_100294444 | 3300005353 | Unclassified | 1304 |
| 111 | Ga0070669_100318321 | 3300005353 | Bacteria | 1255 |
| 112 | Ga0070669_101008522 | 3300005353 | Bacteria | 714 |
| 113 | Ga0070675_100012925 | 3300005354 | Bacteria | 6551 |
| 114 | Ga0070675_100069846 | 3300005354 | Bacteria | 2910 |
| 115 | Ga0070675_100098403 | 3300005354 | Unclassified | 2461 |
| 116 | Ga0070675_100129762 | 3300005354 | Bacteria | 2147 |
| 117 | Ga0070675_100177310 | 3300005354 | Bacteria | 1841 |
| 118 | Ga0070675_100354069 | 3300005354 | Bacteria | 1302 |
| 119 | Ga0070675_100771584 | 3300005354 | Bacteria | 878 |
| 120 | Ga0070671_100035316 | 3300005355 | Bacteria | 4141 |
| 121 | Ga0070671_100039606 | 3300005355 | Bacteria | 3912 |
| 122 | Ga0070671_100047720 | 3300005355 | Bacteria | 3560 |
| 123 | Ga0070671_100128602 | 3300005355 | Bacteria | 2133 |
| 124 | Ga0070671_100166135 | 3300005355 | Bacteria | 1866 |
| 125 | Ga0070671_100297023 | 3300005355 | Bacteria | 1375 |
| 126 | Ga0070674_100170743 | 3300005356 | Bacteria | 1658 |
| 127 | Ga0070674_100212780 | 3300005356 | Bacteria | 1499 |
| 128 | Ga0070673_100001237 | 3300005364 | Bacteria | 14803 |
| 129 | Ga0070673_100002858 | 3300005364 | Bacteria | 10625 |
| 130 | Ga0070673_100018742 | 3300005364 | Bacteria | 4955 |
| 131 | Ga0070673_100063800 | 3300005364 | Bacteria | 2932 |
| 132 | Ga0070673_100092490 | 3300005364 | Bacteria | 2474 |
| 133 | Ga0070673_100118165 | 3300005364 | Bacteria | 2207 |
| 134 | Ga0070673_100181369 | 3300005364 | Bacteria | 1803 |
| 135 | Ga0070673_100224341 | 3300005364 | Bacteria | 1628 |
| 136 | Ga0070673_100282423 | 3300005364 | Unclassified | 1456 |
| 137 | Ga0070673_100494168 | 3300005364 | Bacteria | 1106 |
| 138 | Ga0070673_100794744 | 3300005364 | Bacteria | 873 |
| 139 | Ga0070688_100001210 | 3300005365 | Bacteria | 12848 |
| 140 | Ga0070688_100008564 | 3300005365 | Bacteria | 5561 |
| 141 | Ga0070688_100082014 | 3300005365 | Bacteria | 2089 |
| 142 | Ga0070659_100008619 | 3300005366 | Bacteria | 7459 |
| 143 | Ga0070659_100253455 | 3300005366 | Bacteria | 1459 |
| 144 | Ga0070659_100454358 | 3300005366 | Bacteria | 1087 |
| 145 | Ga0070667_100002757 | 3300005367 | Bacteria | 15197 |
| 146 | Ga0070667_100062881 | 3300005367 | Bacteria | 3144 |
| 147 | Ga0070667_100094570 | 3300005367 | Bacteria | 2575 |
| 148 | Ga0070667_100106436 | 3300005367 | Bacteria | 2427 |
| 149 | Ga0070667_100662098 | 3300005367 | Unclassified | 964 |
| 150 | Ga0070701_10041737 | 3300005438 | Unclassified | 2339 |
| 151 | Ga0070701_10449728 | 3300005438 | Bacteria | 826 |
| 152 | Ga0070700_100049548 | 3300005441 | Unclassified | 2608 |
| 153 | Ga0070678_100007568 | 3300005456 | Bacteria | 6452 |
| 154 | Ga0070678_100008039 | 3300005456 | Bacteria | 6291 |
| 155 | Ga0070678_100219911 | 3300005456 | Bacteria | 1578 |
| 156 | Ga0070678_100310192 | 3300005456 | Bacteria | 1344 |
| 157 | Ga0070662_100012053 | 3300005457 | Bacteria | 5724 |
| 158 | Ga0070662_100020333 | 3300005457 | Bacteria | 4520 |
| 159 | Ga0070662_100020971 | 3300005457 | Bacteria | 4457 |
| 160 | Ga0070662_100025524 | 3300005457 | Viruses | 4082 |
| 161 | Ga0070662_100043678 | 3300005457 | Unclassified | 3208 |
| 162 | Ga0070662_100044910 | 3300005457 | Bacteria | 3168 |
| 163 | Ga0070662_100394060 | 3300005457 | Bacteria | 1142 |
| 164 | Ga0070662_100927263 | 3300005457 | Bacteria | 744 |
| 165 | Ga0070681_10731841 | 3300005458 | Bacteria | 905 |
| 166 | Ga0068867_100015409 | 3300005459 | Viruses | 5421 |
| 167 | Ga0068867_100026633 | 3300005459 | Bacteria | 4152 |
| 168 | Ga0068867_100104028 | 3300005459 | Unclassified | 2172 |
| 169 | Ga0068867_100144081 | 3300005459 | Unclassified | 1865 |
| 170 | Ga0068867_100154609 | 3300005459 | Bacteria | 1804 |
| 171 | Ga0068867_100187111 | 3300005459 | Bacteria | 1650 |
| 172 | Ga0068867_100322017 | 3300005459 | Bacteria | 1281 |
| 173 | Ga0068867_100649327 | 3300005459 | Bacteria | 926 |
| 174 | Ga0068867_100864126 | 3300005459 | Unclassified | 811 |
| 175 | Ga0068867_101157514 | 3300005459 | Unclassified | 708 |
| 176 | Ga0070685_10006138 | 3300005466 | Bacteria | 6118 |
| 177 | Ga0070685_10012117 | 3300005466 | Bacteria | 4522 |
| 178 | Ga0070685_10065638 | 3300005466 | Bacteria | 2136 |
| 179 | Ga0070685_10201613 | 3300005466 | Bacteria | 1293 |
| 180 | Ga0070685_10457210 | 3300005466 | Unclassified | 895 |
| 181 | Ga0070698_100000061 | 3300005471 | Bacteria | 78637 |
| 182 | Ga0070698_100092215 | 3300005471 | Bacteria | 3010 |
| 183 | Ga0070698_100875649 | 3300005471 | Unclassified | 843 |
| 184 | Ga0070699_100174637 | 3300005518 | Bacteria | 1905 |
| 185 | Ga0070684_100003744 | 3300005535 | Bacteria | 11476 |
| 186 | Ga0070684_100003772 | 3300005535 | Bacteria | 11441 |
| 187 | Ga0070684_100008074 | 3300005535 | Bacteria | 8217 |
| 188 | Ga0070684_100306077 | 3300005535 | Bacteria | 1459 |
| 189 | Ga0070684_100357174 | 3300005535 | Bacteria | 1344 |
| 190 | Ga0070684_100445667 | 3300005535 | Bacteria | 1196 |
| 191 | Ga0068853_100000796 | 3300005539 | Bacteria | 21890 |
| 192 | Ga0068853_100006503 | 3300005539 | Bacteria | 9298 |
| 193 | Ga0068853_100008344 | 3300005539 | Bacteria | 8314 |
| 194 | Ga0068853_100025487 | 3300005539 | Bacteria | 4963 |
| 195 | Ga0068853_100456127 | 3300005539 | Bacteria | 1203 |
| 196 | Ga0068853_100653138 | 3300005539 | Bacteria | 1001 |
| 197 | Ga0068853_100935750 | 3300005539 | Bacteria | 833 |
| 198 | Ga0068853_101083914 | 3300005539 | Bacteria | 772 |
| 199 | Ga0070672_100015160 | 3300005543 | Bacteria | 5479 |
| 200 | Ga0070672_100018204 | 3300005543 | Bacteria | 5073 |
| 201 | Ga0070672_100156749 | 3300005543 | Bacteria | 1886 |
| 202 | Ga0070672_100210439 | 3300005543 | Bacteria | 1628 |
| 203 | Ga0070672_100541286 | 3300005543 | Bacteria | 1010 |
| 204 | Ga0070686_100032955 | 3300005544 | Bacteria | 3180 |
| 205 | Ga0070686_100127864 | 3300005544 | Unclassified | 1753 |
| 206 | Ga0070686_100383448 | 3300005544 | Bacteria | 1065 |
| 207 | Ga0070695_100073426 | 3300005545 | Bacteria | 2245 |
| 208 | Ga0070693_100360328 | 3300005547 | Bacteria | 998 |
| 209 | Ga0070665_100042819 | 3300005548 | Bacteria | 4551 |
| 210 | Ga0070665_100116197 | 3300005548 | Bacteria | 2678 |
| 211 | Ga0070665_100176199 | 3300005548 | Unclassified | 2139 |
| 212 | Ga0070665_100184428 | 3300005548 | Bacteria | 2087 |
| 213 | Ga0070704_100018118 | 3300005549 | Unclassified | 4493 |
| 214 | Ga0070704_100105673 | 3300005549 | Unclassified | 2132 |
| 215 | Ga0070704_100189425 | 3300005549 | Bacteria | 1652 |
| 216 | Ga0068855_100001457 | 3300005563 | Bacteria | 29525 |
| 217 | Ga0068855_100045261 | 3300005563 | Bacteria | 5205 |
| 218 | Ga0068855_100099029 | 3300005563 | Viruses | 3358 |
| 219 | Ga0068855_100301662 | 3300005563 | Bacteria | 1774 |
| 220 | Ga0068855_100552564 | 3300005563 | Bacteria | 1246 |
| 221 | Ga0070664_100018058 | 3300005564 | Bacteria | 5792 |
| 222 | Ga0070664_100028969 | 3300005564 | Unclassified | 4613 |
| 223 | Ga0070664_100109202 | 3300005564 | Bacteria | 2413 |
| 224 | Ga0070664_100149707 | 3300005564 | Bacteria | 2060 |
| 225 | Ga0070664_100238427 | 3300005564 | Bacteria | 1632 |
| 226 | Ga0070664_100301587 | 3300005564 | Unclassified | 1448 |
| 227 | Ga0070664_100805852 | 3300005564 | Bacteria | 878 |
| 228 | Ga0070664_100920565 | 3300005564 | Bacteria | 820 |
| 229 | Ga0068857_100022605 | 3300005577 | Bacteria | 5530 |
| 230 | Ga0068857_100054252 | 3300005577 | Bacteria | 3556 |
| 231 | Ga0068857_100064624 | 3300005577 | Bacteria | 3254 |
| 232 | Ga0068857_100206122 | 3300005577 | Bacteria | 1793 |
| 233 | Ga0068857_100244235 | 3300005577 | Bacteria | 1644 |
| 234 | Ga0068857_100418397 | 3300005577 | Bacteria | 1249 |
| 235 | Ga0068857_100626621 | 3300005577 | Bacteria | 1018 |
| 236 | Ga0068854_100002878 | 3300005578 | Bacteria | 10707 |
| 237 | Ga0068854_100030880 | 3300005578 | Unclassified | 3720 |
| 238 | Ga0068854_100108428 | 3300005578 | Unclassified | 2091 |
| 239 | Ga0068854_100254433 | 3300005578 | Bacteria | 1404 |
| 240 | Ga0068856_100130056 | 3300005614 | Bacteria | 2522 |
| 241 | Ga0068856_100135868 | 3300005614 | Bacteria | 2464 |
| 242 | Ga0070702_100659484 | 3300005615 | Bacteria | 792 |
| 243 | Ga0068852_100000857 | 3300005616 | Bacteria | 20216 |
| 244 | Ga0068852_100001522 | 3300005616 | Bacteria | 15698 |
| 245 | Ga0068852_100003549 | 3300005616 | Bacteria | 10913 |
| 246 | Ga0068852_100306942 | 3300005616 | Bacteria | 1537 |
| 247 | Ga0068852_100395759 | 3300005616 | Unclassified | 1358 |
| 248 | Ga0068852_100612137 | 3300005616 | Bacteria | 1094 |
| 249 | Ga0068852_101394700 | 3300005616 | Bacteria | 723 |
| 250 | Ga0068859_100000024 | 3300005617 | Bacteria | 217931 |
| 251 | Ga0068859_100019662 | 3300005617 | Bacteria | 6782 |
| 252 | Ga0068859_100025034 | 3300005617 | Bacteria | 5991 |
| 253 | Ga0068859_100036905 | 3300005617 | Bacteria | 4906 |
| 254 | Ga0068859_100042230 | 3300005617 | Bacteria | 4580 |
| 255 | Ga0068859_100096194 | 3300005617 | Bacteria | 3014 |
| 256 | Ga0068859_100173395 | 3300005617 | Bacteria | 2238 |
| 257 | Ga0068859_100306027 | 3300005617 | Unclassified | 1683 |
| 258 | Ga0068859_100371958 | 3300005617 | Bacteria | 1525 |
| 259 | Ga0068859_100404349 | 3300005617 | Bacteria | 1461 |
| 260 | Ga0068859_100902479 | 3300005617 | Bacteria | 968 |
| 261 | Ga0068864_100004575 | 3300005618 | Bacteria | 11358 |
| 262 | Ga0068864_100005883 | 3300005618 | Bacteria | 10052 |
| 263 | Ga0068864_100026240 | 3300005618 | Bacteria | 4912 |
| 264 | Ga0068864_100072091 | 3300005618 | Bacteria | 3009 |
| 265 | Ga0068864_100083040 | 3300005618 | Bacteria | 2813 |
| 266 | Ga0068864_100415053 | 3300005618 | Bacteria | 1281 |
| 267 | Ga0068864_100744095 | 3300005618 | Bacteria | 960 |
| 268 | Ga0068866_10024154 | 3300005718 | Unclassified | 2837 |
| 269 | Ga0068866_10175027 | 3300005718 | Unclassified | 1263 |
| 270 | Ga0068866_10232431 | 3300005718 | Bacteria | 1119 |
| 271 | Ga0068861_100001870 | 3300005719 | Bacteria | 13556 |
| 272 | Ga0068861_100002412 | 3300005719 | Bacteria | 12173 |
| 273 | Ga0068861_100024839 | 3300005719 | Bacteria | 4338 |
| 274 | Ga0068861_100049148 | 3300005719 | Bacteria | 3192 |
| 275 | Ga0068861_100373791 | 3300005719 | Bacteria | 1257 |
| 276 | Ga0068851_10003739 | 3300005834 | Bacteria | 6800 |
| 277 | Ga0068851_10058827 | 3300005834 | Bacteria | 1965 |
| 278 | Ga0068851_10083643 | 3300005834 | Bacteria | 1670 |
| 279 | Ga0068851_10157744 | 3300005834 | Bacteria | 1244 |
| 280 | Ga0068870_10008469 | 3300005840 | Bacteria | 4628 |
| 281 | Ga0068870_10050453 | 3300005840 | Bacteria | 2199 |
| 282 | Ga0068870_10101114 | 3300005840 | Bacteria | 1629 |
| 283 | Ga0068870_10215749 | 3300005840 | Bacteria | 1172 |
| 284 | Ga0068870_10249758 | 3300005840 | Bacteria | 1099 |
| 285 | Ga0068863_100011915 | 3300005841 | Bacteria | 8404 |
| 286 | Ga0068863_100039716 | 3300005841 | Viruses | 4476 |
| 287 | Ga0068863_100060049 | 3300005841 | Bacteria | 3596 |
| 288 | Ga0068863_100081760 | 3300005841 | Bacteria | 3060 |
| 289 | Ga0068863_100341493 | 3300005841 | Bacteria | 1457 |
| 290 | Ga0068863_100523996 | 3300005841 | Bacteria | 1169 |
| 291 | Ga0068863_100657328 | 3300005841 | Bacteria | 1040 |
| 292 | Ga0068858_100003133 | 3300005842 | Bacteria | 16560 |
| 293 | Ga0068858_100003141 | 3300005842 | Bacteria | 16535 |
| 294 | Ga0068858_100085270 | 3300005842 | Unclassified | 2938 |
| 295 | Ga0068858_100123938 | 3300005842 | Bacteria | 2418 |
| 296 | Ga0068858_100322832 | 3300005842 | Bacteria | 1476 |
| 297 | Ga0068858_100510997 | 3300005842 | Bacteria | 1161 |
| 298 | Ga0068860_100000024 | 3300005843 | Bacteria | 271902 |
| 299 | Ga0068860_100001839 | 3300005843 | Bacteria | 22597 |
| 300 | Ga0068860_100008185 | 3300005843 | Bacteria | 10410 |
| 301 | Ga0068860_100019138 | 3300005843 | Bacteria | 6648 |
| 302 | Ga0068860_100025276 | 3300005843 | Bacteria | 5732 |
| 303 | Ga0068860_100029320 | 3300005843 | Bacteria | 5292 |
| 304 | Ga0068860_100065400 | 3300005843 | Bacteria | 3453 |
| 305 | Ga0068860_100066970 | 3300005843 | Bacteria | 3412 |
| 306 | Ga0068860_100204569 | 3300005843 | Unclassified | 1914 |
| 307 | Ga0068860_100383612 | 3300005843 | Bacteria | 1387 |
| 308 | Ga0068862_100002297 | 3300005844 | Bacteria | 17090 |
| 309 | Ga0068862_100125753 | 3300005844 | Bacteria | 2263 |
| 310 | Ga0068862_100271476 | 3300005844 | Bacteria | 1551 |
| 311 | Ga0068862_100830445 | 3300005844 | Bacteria | 904 |
| 312 | Ga0068862_101105773 | 3300005844 | Bacteria | 788 |
| 313 | Ga0081539_10011722 | 3300005985 | Bacteria | 6877 |
| 314 | Ga0070715_10288749 | 3300006163 | Bacteria | 873 |
| 315 | Ga0075366_10025671 | 3300006195 | Bacteria | 3444 |
| 316 | Ga0075366_10145359 | 3300006195 | Bacteria | 1435 |
| 317 | Ga0097621_100042034 | 3300006237 | Bacteria | 3681 |
| 318 | Ga0097621_100043812 | 3300006237 | Viruses | 3608 |
| 319 | Ga0097621_100232858 | 3300006237 | Bacteria | 1608 |
| 320 | Ga0097621_100308030 | 3300006237 | Bacteria | 1400 |
| 321 | Ga0097621_100551238 | 3300006237 | Bacteria | 1049 |
| 322 | Ga0097621_101023324 | 3300006237 | Bacteria | 773 |
| 323 | Ga0075370_10050448 | 3300006353 | Unclassified | 2360 |
| 324 | Ga0068871_100004752 | 3300006358 | Bacteria | 9491 |
| 325 | Ga0068871_100014692 | 3300006358 | Viruses | 5842 |
| 326 | Ga0068871_100466410 | 3300006358 | Bacteria | 1134 |
| 327 | Ga0075428_100303880 | 3300006844 | Bacteria | 1715 |
| 328 | Ga0075430_100013299 | 3300006846 | Bacteria | 7016 |
| 329 | Ga0075430_100111938 | 3300006846 | Bacteria | 2276 |
| 330 | Ga0075431_100016589 | 3300006847 | Bacteria | 7474 |
| 331 | Ga0075434_100017373 | 3300006871 | Bacteria | 6929 |
| 332 | Ga0075434_100682483 | 3300006871 | Bacteria | 1045 |
| 333 | Ga0075429_100001773 | 3300006880 | Bacteria | 17869 |
| 334 | Ga0075429_100074206 | 3300006880 | Bacteria | 2963 |
| 335 | Ga0075429_100778825 | 3300006880 | Unclassified | 838 |
| 336 | Ga0068865_100033972 | 3300006881 | Unclassified | 3418 |
| 337 | Ga0068865_100051723 | 3300006881 | Bacteria | 2845 |
| 338 | Ga0097620_100000024 | 3300006931 | Bacteria | 217931 |
| 339 | Ga0097620_100019662 | 3300006931 | Bacteria | 6782 |
| 340 | Ga0097620_100025034 | 3300006931 | Bacteria | 5991 |
| 341 | Ga0097620_100036905 | 3300006931 | Bacteria | 4906 |
| 342 | Ga0097620_100042231 | 3300006931 | Bacteria | 4580 |
| 343 | Ga0097620_100096193 | 3300006931 | Bacteria | 3014 |
| 344 | Ga0097620_100173390 | 3300006931 | Bacteria | 2238 |
| 345 | Ga0097620_100306012 | 3300006931 | Unclassified | 1683 |
| 346 | Ga0097620_100371916 | 3300006931 | Bacteria | 1525 |
| 347 | Ga0097620_100404342 | 3300006931 | Bacteria | 1461 |
| 348 | Ga0097620_100902584 | 3300006931 | Bacteria | 968 |
| 349 | Ga0105244_10302630 | 3300009036 | Unclassified | 740 |
| 350 | Ga0105240_10000106 | 3300009093 | Bacteria | 171825 |
| 351 | Ga0105240_10000895 | 3300009093 | Bacteria | 53295 |
| 352 | Ga0105240_10002358 | 3300009093 | Bacteria | 30449 |
| 353 | Ga0105240_10004897 | 3300009093 | Bacteria | 20156 |
| 354 | Ga0105240_10074614 | 3300009093 | Bacteria | 4186 |
| 355 | Ga0105240_10088384 | 3300009093 | Unclassified | 3792 |
| 356 | Ga0105240_10122314 | 3300009093 | Bacteria | 3132 |
| 357 | Ga0105240_10181534 | 3300009093 | Bacteria | 2483 |
| 358 | Ga0111539_10004607 | 3300009094 | Bacteria | 18008 |
| 359 | Ga0111539_10007347 | 3300009094 | Bacteria | 14110 |
| 360 | Ga0111539_10207660 | 3300009094 | Bacteria | 2282 |
| 361 | Ga0111539_11396613 | 3300009094 | Bacteria | 812 |
| 362 | Ga0105245_10079189 | 3300009098 | Bacteria | 3000 |
| 363 | Ga0105245_10241255 | 3300009098 | Bacteria | 1752 |
| 364 | Ga0105245_10903443 | 3300009098 | Bacteria | 925 |
| 365 | Ga0105245_10938801 | 3300009098 | Unclassified | 908 |
| 366 | Ga0105247_10001724 | 3300009101 | Bacteria | 15408 |
| 367 | Ga0105247_10297971 | 3300009101 | Bacteria | 1118 |
| 368 | Ga0114129_10243115 | 3300009147 | Bacteria | 2419 |
| 369 | Ga0114129_10349646 | 3300009147 | Unclassified | 1959 |
| 370 | Ga0105243_10080774 | 3300009148 | Bacteria | 2653 |
| 371 | Ga0105243_10237309 | 3300009148 | Bacteria | 1621 |
| 372 | Ga0105241_10000085 | 3300009174 | Bacteria | 69963 |
| 373 | Ga0105241_10005689 | 3300009174 | Bacteria | 9199 |
| 374 | Ga0105241_10138163 | 3300009174 | Bacteria | 1981 |
| 375 | Ga0105241_10156952 | 3300009174 | Bacteria | 1867 |
| 376 | Ga0105241_10237679 | 3300009174 | Bacteria | 1539 |
| 377 | Ga0105242_10005018 | 3300009176 | Bacteria | 10231 |
| 378 | Ga0105242_10070885 | 3300009176 | Viruses | 2891 |
| 379 | Ga0105242_10076884 | 3300009176 | Bacteria | 2784 |
| 380 | Ga0105242_10133369 | 3300009176 | Bacteria | 2147 |
| 381 | Ga0105242_10154328 | 3300009176 | Unclassified | 2004 |
| 382 | Ga0105242_10269890 | 3300009176 | Bacteria | 1541 |
| 383 | Ga0105242_10280589 | 3300009176 | Bacteria | 1513 |
| 384 | Ga0105248_10037895 | 3300009177 | Bacteria | 5393 |
| 385 | Ga0105237_10000453 | 3300009545 | Bacteria | 58200 |
| 386 | Ga0105237_10013660 | 3300009545 | Bacteria | 8504 |
| 387 | Ga0105237_10021915 | 3300009545 | Bacteria | 6562 |
| 388 | Ga0105237_10034777 | 3300009545 | Bacteria | 5099 |
| 389 | Ga0105237_10050819 | 3300009545 | Bacteria | 4165 |
| 390 | Ga0105237_10166996 | 3300009545 | Bacteria | 2200 |
| 391 | Ga0105237_10212082 | 3300009545 | Bacteria | 1936 |
| 392 | Ga0105237_10242616 | 3300009545 | Bacteria | 1803 |
| 393 | Ga0105237_10248689 | 3300009545 | Bacteria | 1780 |
| 394 | Ga0105237_10252864 | 3300009545 | Bacteria | 1764 |
| 395 | Ga0105238_10001678 | 3300009551 | Bacteria | 22261 |
| 396 | Ga0105238_10027955 | 3300009551 | Bacteria | 5747 |
| 397 | Ga0105238_10107405 | 3300009551 | Archaea | 2772 |
| 398 | Ga0105238_10317212 | 3300009551 | Bacteria | 1544 |
| 399 | Ga0105249_10002023 | 3300009553 | Bacteria | 17609 |
| 400 | Ga0105249_10007013 | 3300009553 | Bacteria | 9835 |
| 401 | Ga0105249_10015481 | 3300009553 | Bacteria | 6749 |
| 402 | Ga0105249_10024744 | 3300009553 | Bacteria | 5398 |
| 403 | Ga0105249_10029535 | 3300009553 | Bacteria | 4952 |
| 404 | Ga0105249_10031991 | 3300009553 | Bacteria | 4758 |
| 405 | Ga0105249_10051878 | 3300009553 | Bacteria | 3744 |
| 406 | Ga0105249_10090950 | 3300009553 | Bacteria | 2854 |
| 407 | Ga0105249_10098094 | 3300009553 | Bacteria | 2751 |
| 408 | Ga0105249_10153989 | 3300009553 | Bacteria | 2216 |
| 409 | Ga0105249_10160224 | 3300009553 | Bacteria | 2174 |
| 410 | Ga0105249_10191916 | 3300009553 | Bacteria | 1994 |
| 411 | Ga0105249_10238793 | 3300009553 | Bacteria | 1796 |
| 412 | Ga0105249_11287643 | 3300009553 | Bacteria | 802 |
| 413 | Ga0105239_10000019 | 3300010375 | Bacteria | 273836 |
| 414 | Ga0105239_10000384 | 3300010375 | Bacteria | 64479 |
| 415 | Ga0105239_10003545 | 3300010375 | Bacteria | 19087 |
| 416 | Ga0105239_10012678 | 3300010375 | Bacteria | 9379 |
| 417 | Ga0105239_10034600 | 3300010375 | Bacteria | 5549 |
| 418 | Ga0105239_10053305 | 3300010375 | Bacteria | 4437 |
| 419 | Ga0105239_10062597 | 3300010375 | Unclassified | 4084 |
| 420 | Ga0105239_10087953 | 3300010375 | Bacteria | 3425 |
| 421 | Ga0105239_10089409 | 3300010375 | Bacteria | 3396 |
| 422 | Ga0105239_10636988 | 3300010375 | Bacteria | 1217 |
| 423 | Ga0105239_10668246 | 3300010375 | Unclassified | 1187 |
| 424 | Ga0105239_10794999 | 3300010375 | Bacteria | 1084 |
| 425 | Ga0105239_11498530 | 3300010375 | Bacteria | 779 |
| 426 | Ga0105246_10001022 | 3300011119 | Bacteria | 16075 |
| 427 | Ga0105246_10221717 | 3300011119 | Bacteria | 1483 |
| 428 | Ga0105246_10286352 | 3300011119 | Bacteria | 1324 |
| 429 | Ga0105246_10351717 | 3300011119 | Bacteria | 1208 |
| 430 | Ga0157373_10043948 | 3300013100 | Bacteria | 3190 |
| 431 | Ga0157373_10139222 | 3300013100 | Bacteria | 1706 |
| 432 | Ga0157373_10186084 | 3300013100 | Bacteria | 1463 |
| 433 | Ga0157371_10008920 | 3300013102 | Bacteria | 7941 |
| 434 | Ga0157371_10032938 | 3300013102 | Bacteria | 3726 |
| 435 | Ga0157371_10106778 | 3300013102 | Bacteria | 1987 |
| 436 | Ga0157371_10195696 | 3300013102 | Bacteria | 1448 |
| 437 | Ga0157371_10360272 | 3300013102 | Bacteria | 1060 |
| 438 | Ga0157371_10640225 | 3300013102 | Bacteria | 793 |
| 439 | Ga0157370_10002878 | 3300013104 | Bacteria | 20507 |
| 440 | Ga0157370_10016966 | 3300013104 | Bacteria | 7361 |
| 441 | Ga0157370_10083776 | 3300013104 | Bacteria | 2998 |
| 442 | Ga0157370_10153916 | 3300013104 | Bacteria | 2139 |
| 443 | Ga0157370_10798343 | 3300013104 | Unclassified | 859 |
| 444 | Ga0157369_10192606 | 3300013105 | Unclassified | 2142 |
| 445 | Ga0157369_10399441 | 3300013105 | Bacteria | 1426 |
| 446 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 447 | Ga0157374_10012134 | 3300013296 | Bacteria | 7484 |
| 448 | Ga0157374_10025437 | 3300013296 | Bacteria | 5316 |
| 449 | Ga0157374_10028180 | 3300013296 | Bacteria | 5071 |
| 450 | Ga0157374_10057007 | 3300013296 | Bacteria | 3648 |
| 451 | Ga0157374_10066125 | 3300013296 | Bacteria | 3397 |
| 452 | Ga0157374_10101373 | 3300013296 | Bacteria | 2761 |
| 453 | Ga0157374_10112556 | 3300013296 | Unclassified | 2619 |
| 454 | Ga0157374_10533141 | 3300013296 | Unclassified | 1181 |
| 455 | Ga0157378_10089507 | 3300013297 | Bacteria | 2796 |
| 456 | Ga0157378_10180559 | 3300013297 | Unclassified | 1985 |
| 457 | Ga0157378_10195528 | 3300013297 | Unclassified | 1910 |
| 458 | Ga0157378_10223800 | 3300013297 | Bacteria | 1790 |
| 459 | Ga0157378_10227553 | 3300013297 | Bacteria | 1775 |
| 460 | Ga0157378_10318855 | 3300013297 | Bacteria | 1509 |
| 461 | Ga0157378_10467152 | 3300013297 | Bacteria | 1255 |
| 462 | Ga0157378_10704311 | 3300013297 | Bacteria | 1029 |
| 463 | Ga0163162_10000189 | 3300013306 | Bacteria | 56954 |
| 464 | Ga0163162_10000446 | 3300013306 | Bacteria | 38191 |
| 465 | Ga0163162_10000687 | 3300013306 | Bacteria | 31377 |
| 466 | Ga0163162_10002569 | 3300013306 | Bacteria | 17179 |
| 467 | Ga0163162_10034873 | 3300013306 | Bacteria | 5009 |
| 468 | Ga0163162_10038451 | 3300013306 | Bacteria | 4775 |
| 469 | Ga0163162_10067267 | 3300013306 | Viruses | 3633 |
| 470 | Ga0163162_10194517 | 3300013306 | Bacteria | 2156 |
| 471 | Ga0163162_10367617 | 3300013306 | Bacteria | 1571 |
| 472 | Ga0157372_10006780 | 3300013307 | Bacteria | 12180 |
| 473 | Ga0157372_10013773 | 3300013307 | Bacteria | 8641 |
| 474 | Ga0157372_10017732 | 3300013307 | Bacteria | 7642 |
| 475 | Ga0157372_10043256 | 3300013307 | Unclassified | 4986 |
| 476 | Ga0157372_10063290 | 3300013307 | Bacteria | 4147 |
| 477 | Ga0157372_10064498 | 3300013307 | Bacteria | 4110 |
| 478 | Ga0157372_10246926 | 3300013307 | Bacteria | 2071 |
| 479 | Ga0157372_10251227 | 3300013307 | Bacteria | 2053 |
| 480 | Ga0157372_10280174 | 3300013307 | Bacteria | 1939 |
| 481 | Ga0157372_10384159 | 3300013307 | Bacteria | 1636 |
| 482 | Ga0157372_10452445 | 3300013307 | Bacteria | 1496 |
| 483 | Ga0157372_10498670 | 3300013307 | Bacteria | 1420 |
| 484 | Ga0157372_11449912 | 3300013307 | Unclassified | 791 |
| 485 | Ga0157372_11506528 | 3300013307 | Bacteria | 775 |
| 486 | Ga0157375_10011538 | 3300013308 | Bacteria | 7803 |
| 487 | Ga0157375_10062680 | 3300013308 | Unclassified | 3696 |
| 488 | Ga0157375_10064042 | 3300013308 | Bacteria | 3660 |
| 489 | Ga0157375_10079622 | 3300013308 | Bacteria | 3312 |
| 490 | Ga0157375_10080435 | 3300013308 | Bacteria | 3297 |
| 491 | Ga0157375_10379957 | 3300013308 | Unclassified | 1579 |
| 492 | Ga0157375_10382321 | 3300013308 | Bacteria | 1574 |
| 493 | Ga0157375_10455081 | 3300013308 | Unclassified | 1445 |
| 494 | Ga0157375_10849971 | 3300013308 | Bacteria | 1059 |
| 495 | Ga0157375_10948459 | 3300013308 | Bacteria | 1002 |
| 496 | Ga0163163_10001441 | 3300014325 | Bacteria | 20118 |
| 497 | Ga0163163_10027772 | 3300014325 | Bacteria | 5426 |
| 498 | Ga0163163_10047990 | 3300014325 | Viruses | 4197 |
| 499 | Ga0163163_10115108 | 3300014325 | Bacteria | 2721 |
| 500 | Ga0163163_10191749 | 3300014325 | Bacteria | 2092 |
| 501 | Ga0163163_10195361 | 3300014325 | Bacteria | 2071 |
| 502 | Ga0157380_10000477 | 3300014326 | Bacteria | 24458 |
| 503 | Ga0157380_10236061 | 3300014326 | Bacteria | 1645 |
| 504 | Ga0157380_11047779 | 3300014326 | Bacteria | 852 |
| 505 | Ga0157380_11164558 | 3300014326 | Bacteria | 813 |
| 506 | Ga0157377_10000592 | 3300014745 | Bacteria | 15035 |
| 507 | Ga0157377_10006415 | 3300014745 | Bacteria | 5611 |
| 508 | Ga0157377_10024223 | 3300014745 | Bacteria | 3225 |
| 509 | Ga0157377_10073050 | 3300014745 | Bacteria | 1986 |
| 510 | Ga0157377_10356000 | 3300014745 | Bacteria | 984 |
| 511 | Ga0157377_10420512 | 3300014745 | Bacteria | 915 |
| 512 | Ga0157379_10013944 | 3300014968 | Bacteria | 7044 |
| 513 | Ga0157379_10034749 | 3300014968 | Bacteria | 4496 |
| 514 | Ga0157379_10072795 | 3300014968 | Unclassified | 3075 |
| 515 | Ga0157379_10073080 | 3300014968 | Bacteria | 3069 |
| 516 | Ga0157379_10189739 | 3300014968 | Bacteria | 1857 |
| 517 | Ga0157379_10234775 | 3300014968 | Bacteria | 1663 |
| 518 | Ga0157376_10005632 | 3300014969 | Bacteria | 8765 |
| 519 | Ga0157376_10015084 | 3300014969 | Bacteria | 5826 |
| 520 | Ga0157376_10058509 | 3300014969 | Viruses | 3228 |
| 521 | Ga0157376_10076387 | 3300014969 | Bacteria | 2862 |
| 522 | Ga0157376_10218967 | 3300014969 | Bacteria | 1762 |
| 523 | Ga0157376_10686916 | 3300014969 | Bacteria | 1027 |
| 524 | Ga0157376_10849211 | 3300014969 | Bacteria | 928 |
| 525 | Ga0182005_1000017 | 3300015265 | Bacteria | 331828 |
| 526 | Ga0163161_10006412 | 3300017792 | Bacteria | 8148 |
| 527 | Ga0163161_10063433 | 3300017792 | Bacteria | 2693 |
| 528 | Ga0163161_10124529 | 3300017792 | Bacteria | 1939 |
| 529 | Ga0163161_10231657 | 3300017792 | Unclassified | 1434 |
| 530 | Ga0209436_100787 | 3300025208 | Bacteria | 13111 |
| 531 | Ga0209436_101343 | 3300025208 | Bacteria | 8691 |
| 532 | Ga0209258_100029 | 3300025242 | Bacteria | 490648 |
| 533 | Ga0209646_1000031 | 3300025246 | Bacteria | 381260 |
| 534 | Ga0209026_1000019 | 3300025250 | Bacteria | 381260 |
| 535 | Ga0209148_1000194 | 3300025254 | Bacteria | 112740 |
| 536 | Ga0209129_1017055 | 3300025258 | Bacteria | 1437 |
| 537 | Ga0207666_1020045 | 3300025271 | Unclassified | 979 |
| 538 | Ga0209673_1000501 | 3300025273 | Bacteria | 64685 |
| 539 | Ga0209130_1000333 | 3300025284 | Bacteria | 54192 |
| 540 | Ga0209564_1011975 | 3300025295 | Bacteria | 3826 |
| 541 | Ga0209758_1008947 | 3300025297 | Bacteria | 6344 |
| 542 | Ga0209758_1022289 | 3300025297 | Bacteria | 2912 |
| 543 | Ga0209050_1000216 | 3300025298 | Bacteria | 128896 |
| 544 | Ga0207426_1000024 | 3300025302 | Bacteria | 534075 |
| 545 | Ga0207426_1001331 | 3300025302 | Bacteria | 21001 |
| 546 | Ga0207426_1044975 | 3300025302 | Bacteria | 1346 |
| 547 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 548 | Ga0209257_1009260 | 3300025304 | Bacteria | 5329 |
| 549 | Ga0207697_10008375 | 3300025315 | Unclassified | 4526 |
| 550 | Ga0207697_10055492 | 3300025315 | Unclassified | 1643 |
| 551 | Ga0207656_10002100 | 3300025321 | Bacteria | 6658 |
| 552 | Ga0207682_10016584 | 3300025893 | Bacteria | 2873 |
| 553 | Ga0207642_10003436 | 3300025899 | Bacteria | 5002 |
| 554 | Ga0207642_10439506 | 3300025899 | Bacteria | 788 |
| 555 | Ga0207710_10001848 | 3300025900 | Bacteria | 10199 |
| 556 | Ga0207710_10126357 | 3300025900 | Bacteria | 1225 |
| 557 | Ga0207688_10004807 | 3300025901 | Bacteria | 7363 |
| 558 | Ga0207680_10000455 | 3300025903 | Bacteria | 19322 |
| 559 | Ga0207680_10029903 | 3300025903 | Bacteria | 3066 |
| 560 | Ga0207680_10031451 | 3300025903 | Bacteria | 3006 |
| 561 | Ga0207680_10137965 | 3300025903 | Bacteria | 1614 |
| 562 | Ga0207680_10199681 | 3300025903 | Bacteria | 1362 |
| 563 | Ga0207680_10428209 | 3300025903 | Bacteria | 938 |
| 564 | Ga0207647_10000025 | 3300025904 | Bacteria | 112150 |
| 565 | Ga0207647_10039735 | 3300025904 | Bacteria | 2966 |
| 566 | Ga0207647_10090658 | 3300025904 | Unclassified | 1823 |
| 567 | Ga0207647_10288030 | 3300025904 | Unclassified | 937 |
| 568 | Ga0207645_10000356 | 3300025907 | Bacteria | 37874 |
| 569 | Ga0207645_10005727 | 3300025907 | Bacteria | 8964 |
| 570 | Ga0207645_10017356 | 3300025907 | Bacteria | 4752 |
| 571 | Ga0207645_10028106 | 3300025907 | Bacteria | 3632 |
| 572 | Ga0207643_10004864 | 3300025908 | Bacteria | 7197 |
| 573 | Ga0207643_10004942 | 3300025908 | Bacteria | 7134 |
| 574 | Ga0207705_10005298 | 3300025909 | Bacteria | 9651 |
| 575 | Ga0207654_10000792 | 3300025911 | Bacteria | 17419 |
| 576 | Ga0207654_10000944 | 3300025911 | Bacteria | 15963 |
| 577 | Ga0207654_10256479 | 3300025911 | Bacteria | 1174 |
| 578 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 579 | Ga0207695_10000582 | 3300025913 | Bacteria | 74405 |
| 580 | Ga0207695_10000909 | 3300025913 | Bacteria | 53303 |
| 581 | Ga0207695_10004513 | 3300025913 | Bacteria | 18946 |
| 582 | Ga0207695_10021645 | 3300025913 | Bacteria | 7330 |
| 583 | Ga0207695_10120923 | 3300025913 | Unclassified | 2586 |
| 584 | Ga0207695_10442855 | 3300025913 | Bacteria | 1182 |
| 585 | Ga0207671_10000311 | 3300025914 | Bacteria | 71753 |
| 586 | Ga0207671_10001101 | 3300025914 | Bacteria | 32578 |
| 587 | Ga0207671_10001299 | 3300025914 | Bacteria | 29321 |
| 588 | Ga0207671_10006605 | 3300025914 | Bacteria | 10294 |
| 589 | Ga0207671_10093501 | 3300025914 | Bacteria | 2268 |
| 590 | Ga0207671_10105270 | 3300025914 | Bacteria | 2140 |
| 591 | Ga0207671_10157842 | 3300025914 | Unclassified | 1755 |
| 592 | Ga0207671_10360204 | 3300025914 | Bacteria | 1154 |
| 593 | Ga0207657_10059678 | 3300025919 | Unclassified | 3276 |
| 594 | Ga0207657_10101763 | 3300025919 | Unclassified | 2384 |
| 595 | Ga0207657_10124281 | 3300025919 | Unclassified | 2120 |
| 596 | Ga0207649_10001650 | 3300025920 | Bacteria | 12932 |
| 597 | Ga0207649_10005817 | 3300025920 | Bacteria | 6676 |
| 598 | Ga0207649_10100367 | 3300025920 | Bacteria | 1914 |
| 599 | Ga0207649_10208457 | 3300025920 | Bacteria | 1385 |
| 600 | Ga0207649_10755790 | 3300025920 | Bacteria | 757 |
| 601 | Ga0207681_10053212 | 3300025923 | Bacteria | 2748 |
| 602 | Ga0207681_10182866 | 3300025923 | Bacteria | 1598 |
| 603 | Ga0207681_10391194 | 3300025923 | Unclassified | 1121 |
| 604 | Ga0207694_10007619 | 3300025924 | Bacteria | 8209 |
| 605 | Ga0207694_10083895 | 3300025924 | Unclassified | 2506 |
| 606 | Ga0207650_10014161 | 3300025925 | Bacteria | 5539 |
| 607 | Ga0207650_10033783 | 3300025925 | Unclassified | 3706 |
| 608 | Ga0207650_10059953 | 3300025925 | Bacteria | 2839 |
| 609 | Ga0207650_10073887 | 3300025925 | Bacteria | 2569 |
| 610 | Ga0207650_10086909 | 3300025925 | Unclassified | 2381 |
| 611 | Ga0207650_10091822 | 3300025925 | Unclassified | 2321 |
| 612 | Ga0207650_10386773 | 3300025925 | Bacteria | 1156 |
| 613 | Ga0207650_10529610 | 3300025925 | Unclassified | 986 |
| 614 | Ga0207650_10923473 | 3300025925 | Bacteria | 741 |
| 615 | Ga0207659_10026907 | 3300025926 | Unclassified | 3887 |
| 616 | Ga0207659_10098648 | 3300025926 | Unclassified | 2197 |
| 617 | Ga0207659_10137581 | 3300025926 | Bacteria | 1892 |
| 618 | Ga0207659_10404849 | 3300025926 | Bacteria | 1142 |
| 619 | Ga0207659_10405322 | 3300025926 | Bacteria | 1141 |
| 620 | Ga0207659_10647350 | 3300025926 | Bacteria | 903 |
| 621 | Ga0207644_10022195 | 3300025931 | Unclassified | 4335 |
| 622 | Ga0207644_10174177 | 3300025931 | Bacteria | 1682 |
| 623 | Ga0207644_10470887 | 3300025931 | Bacteria | 1034 |
| 624 | Ga0207690_10022006 | 3300025932 | Bacteria | 3960 |
| 625 | Ga0207690_10271120 | 3300025932 | Bacteria | 1318 |
| 626 | Ga0207706_10003804 | 3300025933 | Bacteria | 14383 |
| 627 | Ga0207706_10017354 | 3300025933 | Bacteria | 6485 |
| 628 | Ga0207706_10041428 | 3300025933 | Viruses | 4082 |
| 629 | Ga0207706_10055020 | 3300025933 | Bacteria | 3511 |
| 630 | Ga0207706_10055030 | 3300025933 | Unclassified | 3510 |
| 631 | Ga0207706_10096912 | 3300025933 | Bacteria | 2594 |
| 632 | Ga0207686_10002454 | 3300025934 | Bacteria | 10071 |
| 633 | Ga0207686_10045017 | 3300025934 | Unclassified | 2713 |
| 634 | Ga0207686_10053668 | 3300025934 | Bacteria | 2521 |
| 635 | Ga0207686_10071919 | 3300025934 | Bacteria | 2227 |
| 636 | Ga0207670_10025851 | 3300025936 | Bacteria | 3691 |
| 637 | Ga0207670_10037372 | 3300025936 | Unclassified | 3164 |
| 638 | Ga0207670_10040648 | 3300025936 | Bacteria | 3053 |
| 639 | Ga0207669_10124133 | 3300025937 | Bacteria | 1759 |
| 640 | Ga0207704_10004256 | 3300025938 | Bacteria | 6539 |
| 641 | Ga0207704_10017379 | 3300025938 | Unclassified | 3727 |
| 642 | Ga0207704_10181642 | 3300025938 | Bacteria | 1521 |
| 643 | Ga0207704_10469024 | 3300025938 | Bacteria | 1008 |
| 644 | Ga0207691_10000753 | 3300025940 | Bacteria | 32051 |
| 645 | Ga0207691_10002055 | 3300025940 | Bacteria | 19671 |
| 646 | Ga0207691_10016839 | 3300025940 | Bacteria | 6935 |
| 647 | Ga0207691_10024972 | 3300025940 | Bacteria | 5615 |
| 648 | Ga0207691_10081293 | 3300025940 | Bacteria | 2913 |
| 649 | Ga0207711_10115112 | 3300025941 | Viruses | 2396 |
| 650 | Ga0207711_10337725 | 3300025941 | Bacteria | 1394 |
| 651 | Ga0207689_10001522 | 3300025942 | Bacteria | 22065 |
| 652 | Ga0207689_10006221 | 3300025942 | Bacteria | 10571 |
| 653 | Ga0207689_10007013 | 3300025942 | Bacteria | 9906 |
| 654 | Ga0207689_10018846 | 3300025942 | Bacteria | 5821 |
| 655 | Ga0207689_10032412 | 3300025942 | Unclassified | 4348 |
| 656 | Ga0207689_10036291 | 3300025942 | Bacteria | 4093 |
| 657 | Ga0207689_10044204 | 3300025942 | Bacteria | 3682 |
| 658 | Ga0207689_10125081 | 3300025942 | Bacteria | 2115 |
| 659 | Ga0207689_10160896 | 3300025942 | Bacteria | 1850 |
| 660 | Ga0207689_10199794 | 3300025942 | Bacteria | 1650 |
| 661 | Ga0207689_10248357 | 3300025942 | Bacteria | 1471 |
| 662 | Ga0207661_10012248 | 3300025944 | Bacteria | 6229 |
| 663 | Ga0207661_10021591 | 3300025944 | Unclassified | 4826 |
| 664 | Ga0207661_10027157 | 3300025944 | Bacteria | 4370 |
| 665 | Ga0207679_10003297 | 3300025945 | Bacteria | 9962 |
| 666 | Ga0207679_10008381 | 3300025945 | Bacteria | 6582 |
| 667 | Ga0207679_10081540 | 3300025945 | Bacteria | 2474 |
| 668 | Ga0207679_10122239 | 3300025945 | Bacteria | 2075 |
| 669 | Ga0207679_10218669 | 3300025945 | Unclassified | 1602 |
| 670 | Ga0207679_10292664 | 3300025945 | Bacteria | 1400 |
| 671 | Ga0207679_10458600 | 3300025945 | Bacteria | 1131 |
| 672 | Ga0207679_10642604 | 3300025945 | Bacteria | 959 |
| 673 | Ga0207667_10000749 | 3300025949 | Bacteria | 42187 |
| 674 | Ga0207667_10001603 | 3300025949 | Bacteria | 28431 |
| 675 | Ga0207667_10054176 | 3300025949 | Bacteria | 4219 |
| 676 | Ga0207667_10090037 | 3300025949 | Viruses | 3171 |
| 677 | Ga0207667_10316599 | 3300025949 | Bacteria | 1594 |
| 678 | Ga0207651_10003277 | 3300025960 | Bacteria | 7925 |
| 679 | Ga0207651_10011989 | 3300025960 | Unclassified | 4880 |
| 680 | Ga0207651_10063829 | 3300025960 | Bacteria | 2574 |
| 681 | Ga0207651_10082088 | 3300025960 | Bacteria | 2326 |
| 682 | Ga0207651_10123247 | 3300025960 | Bacteria | 1970 |
| 683 | Ga0207651_10165074 | 3300025960 | Bacteria | 1740 |
| 684 | Ga0207651_10185776 | 3300025960 | Bacteria | 1653 |
| 685 | Ga0207651_10257187 | 3300025960 | Bacteria | 1432 |
| 686 | Ga0207651_10267556 | 3300025960 | Unclassified | 1406 |
| 687 | Ga0207651_10350564 | 3300025960 | Bacteria | 1243 |
| 688 | Ga0207712_10000442 | 3300025961 | Bacteria | 35214 |
| 689 | Ga0207712_10001446 | 3300025961 | Bacteria | 16193 |
| 690 | Ga0207712_10023884 | 3300025961 | Bacteria | 4041 |
| 691 | Ga0207712_10056005 | 3300025961 | Unclassified | 2776 |
| 692 | Ga0207712_10058531 | 3300025961 | Bacteria | 2723 |
| 693 | Ga0207712_10097017 | 3300025961 | Unclassified | 2183 |
| 694 | Ga0207712_10145969 | 3300025961 | Bacteria | 1821 |
| 695 | Ga0207712_10173373 | 3300025961 | Bacteria | 1688 |
| 696 | Ga0207712_10211159 | 3300025961 | Unclassified | 1546 |
| 697 | Ga0207668_10002845 | 3300025972 | Bacteria | 10140 |
| 698 | Ga0207668_10105256 | 3300025972 | Unclassified | 2105 |
| 699 | Ga0207668_10142040 | 3300025972 | Bacteria | 1848 |
| 700 | Ga0207668_10300971 | 3300025972 | Bacteria | 1323 |
| 701 | Ga0207640_10058951 | 3300025981 | Bacteria | 2531 |
| 702 | Ga0207640_10480674 | 3300025981 | Bacteria | 1030 |
| 703 | Ga0207658_10002695 | 3300025986 | Bacteria | 12827 |
| 704 | Ga0207658_10280033 | 3300025986 | Bacteria | 1429 |
| 705 | Ga0207658_10356937 | 3300025986 | Bacteria | 1274 |
| 706 | Ga0207677_10007162 | 3300026023 | Bacteria | 6143 |
| 707 | Ga0207677_10011819 | 3300026023 | Viruses | 4993 |
| 708 | Ga0207677_10085642 | 3300026023 | Unclassified | 2275 |
| 709 | Ga0207677_10149000 | 3300026023 | Unclassified | 1802 |
| 710 | Ga0207677_10232834 | 3300026023 | Bacteria | 1485 |
| 711 | Ga0207677_10801964 | 3300026023 | Unclassified | 843 |
| 712 | Ga0207677_10820692 | 3300026023 | Bacteria | 834 |
| 713 | Ga0207703_10001511 | 3300026035 | Bacteria | 21202 |
| 714 | Ga0207703_10011137 | 3300026035 | Bacteria | 7003 |
| 715 | Ga0207703_10062783 | 3300026035 | Bacteria | 3043 |
| 716 | Ga0207703_10098192 | 3300026035 | Bacteria | 2476 |
| 717 | Ga0207703_11100573 | 3300026035 | Bacteria | 763 |
| 718 | Ga0207639_10013633 | 3300026041 | Bacteria | 5698 |
| 719 | Ga0207639_10018748 | 3300026041 | Bacteria | 4920 |
| 720 | Ga0207639_10036134 | 3300026041 | Unclassified | 3659 |
| 721 | Ga0207639_10053897 | 3300026041 | Viruses | 3071 |
| 722 | Ga0207639_10096729 | 3300026041 | Bacteria | 2376 |
| 723 | Ga0207639_10188907 | 3300026041 | Unclassified | 1758 |
| 724 | Ga0207678_10052063 | 3300026067 | Unclassified | 3533 |
| 725 | Ga0207702_10108627 | 3300026078 | Bacteria | 2462 |
| 726 | Ga0207702_10176519 | 3300026078 | Bacteria | 1964 |
| 727 | Ga0207641_10000058 | 3300026088 | Bacteria | 166385 |
| 728 | Ga0207641_10000318 | 3300026088 | Bacteria | 59432 |
| 729 | Ga0207641_10010791 | 3300026088 | Bacteria | 7489 |
| 730 | Ga0207641_10064798 | 3300026088 | Bacteria | 3124 |
| 731 | Ga0207641_10344123 | 3300026088 | Bacteria | 1420 |
| 732 | Ga0207641_10791786 | 3300026088 | Bacteria | 937 |
| 733 | Ga0207641_10910603 | 3300026088 | Bacteria | 873 |
| 734 | Ga0207648_10003234 | 3300026089 | Bacteria | 17145 |
| 735 | Ga0207648_10016590 | 3300026089 | Bacteria | 6724 |
| 736 | Ga0207648_10060659 | 3300026089 | Bacteria | 3298 |
| 737 | Ga0207648_10096767 | 3300026089 | Bacteria | 2583 |
| 738 | Ga0207648_10170137 | 3300026089 | Unclassified | 1926 |
| 739 | Ga0207648_10214810 | 3300026089 | Bacteria | 1708 |
| 740 | Ga0207648_10418979 | 3300026089 | Bacteria | 1216 |
| 741 | Ga0207648_10547378 | 3300026089 | Bacteria | 1063 |
| 742 | Ga0207676_10006124 | 3300026095 | Bacteria | 8493 |
| 743 | Ga0207676_10008870 | 3300026095 | Bacteria | 7154 |
| 744 | Ga0207676_10036656 | 3300026095 | Bacteria | 3733 |
| 745 | Ga0207676_10040663 | 3300026095 | Unclassified | 3563 |
| 746 | Ga0207676_10180689 | 3300026095 | Bacteria | 1847 |
| 747 | Ga0207676_10340431 | 3300026095 | Bacteria | 1384 |
| 748 | Ga0207676_10553010 | 3300026095 | Bacteria | 1100 |
| 749 | Ga0207674_10007295 | 3300026116 | Bacteria | 12888 |
| 750 | Ga0207674_10009391 | 3300026116 | Bacteria | 11181 |
| 751 | Ga0207674_10034232 | 3300026116 | Bacteria | 5314 |
| 752 | Ga0207674_10072442 | 3300026116 | Bacteria | 3461 |
| 753 | Ga0207674_10234294 | 3300026116 | Bacteria | 1783 |
| 754 | Ga0207674_10485752 | 3300026116 | Bacteria | 1194 |
| 755 | Ga0207674_10914607 | 3300026116 | Bacteria | 846 |
| 756 | Ga0207675_100000790 | 3300026118 | Bacteria | 31482 |
| 757 | Ga0207675_100002654 | 3300026118 | Bacteria | 17641 |
| 758 | Ga0207675_100053934 | 3300026118 | Bacteria | 3751 |
| 759 | Ga0207675_100084175 | 3300026118 | Bacteria | 2984 |
| 760 | Ga0207675_100134574 | 3300026118 | Bacteria | 2344 |
| 761 | Ga0207675_100161463 | 3300026118 | Bacteria | 2138 |
| 762 | Ga0207675_100248553 | 3300026118 | Bacteria | 1721 |
| 763 | Ga0207675_100315986 | 3300026118 | Bacteria | 1524 |
| 764 | Ga0207675_100330655 | 3300026118 | Bacteria | 1490 |
| 765 | Ga0207675_100435819 | 3300026118 | Bacteria | 1296 |
| 766 | Ga0207675_100474197 | 3300026118 | Bacteria | 1243 |
| 767 | Ga0207683_10001338 | 3300026121 | Bacteria | 22249 |
| 768 | Ga0207683_10020387 | 3300026121 | Bacteria | 5670 |
| 769 | Ga0207683_10039715 | 3300026121 | Bacteria | 4106 |
| 770 | Ga0207698_10006234 | 3300026142 | Bacteria | 7426 |
| 771 | Ga0207698_10018280 | 3300026142 | Bacteria | 4772 |
| 772 | Ga0207698_10036127 | 3300026142 | Bacteria | 3623 |
| 773 | Ga0207698_10154393 | 3300026142 | Bacteria | 1997 |
| 774 | Ga0207698_10245859 | 3300026142 | Unclassified | 1634 |
| 775 | Ga0209971_1026924 | 3300027682 | Unclassified | 1375 |
| 776 | Ga0209974_10028498 | 3300027876 | Unclassified | 1850 |
| 777 | Ga0207428_10033663 | 3300027907 | Unclassified | 4206 |
| 778 | Ga0268266_10000048 | 3300028379 | Bacteria | 310336 |
| 779 | Ga0268266_10066374 | 3300028379 | Viruses | 3120 |
| 780 | Ga0268266_10067339 | 3300028379 | Unclassified | 3099 |
| 781 | Ga0268266_10078214 | 3300028379 | Bacteria | 2878 |
| 782 | Ga0268266_10447242 | 3300028379 | Bacteria | 1228 |
| 783 | Ga0268265_10006349 | 3300028380 | Bacteria | 8013 |
| 784 | Ga0268265_10104831 | 3300028380 | Unclassified | 2293 |
| 785 | Ga0268265_10391446 | 3300028380 | Bacteria | 1282 |
| 786 | Ga0268265_10826962 | 3300028380 | Bacteria | 904 |
| 787 | Ga0268265_10895094 | 3300028380 | Bacteria | 871 |
| 788 | Ga0268264_10000079 | 3300028381 | Bacteria | 249516 |
| 789 | Ga0268264_10001298 | 3300028381 | Bacteria | 23546 |
| 790 | Ga0268264_10002782 | 3300028381 | Bacteria | 15265 |
| 791 | Ga0268264_10012206 | 3300028381 | Bacteria | 7069 |
| 792 | Ga0268264_10018091 | 3300028381 | Bacteria | 5764 |
| 793 | Ga0268264_10093930 | 3300028381 | Unclassified | 2592 |
| 794 | Ga0268264_10160122 | 3300028381 | Unclassified | 2027 |
| 795 | Ga0268264_10169504 | 3300028381 | Bacteria | 1973 |
| 796 | Ga0268264_10212417 | 3300028381 | Unclassified | 1777 |
| 797 | Ga0268264_10290764 | 3300028381 | Unclassified | 1534 |
| 798 | Ga0268264_10362809 | 3300028381 | Bacteria | 1382 |
| 799 | Ga0268264_10471255 | 3300028381 | Unclassified | 1220 |
| 800 | Ga0307517_10000268 | 3300028786 | Bacteria | 89531 |
| 801 | Ga0307517_10134171 | 3300028786 | Unclassified | 1768 |
| 802 | Ga0265324_10014663 | 3300029957 | Bacteria | 2895 |
| 803 | Ga0307511_10000076 | 3300030521 | Bacteria | 82520 |
| 804 | Ga0307509_10218304 | 3300031507 | Bacteria | 1723 |
| 805 | Ga0307408_100409350 | 3300031548 | Bacteria | 1167 |
| 806 | Ga0307516_10353469 | 3300031730 | Bacteria | 1135 |
| 807 | Ga0307405_10469345 | 3300031731 | Bacteria | 1002 |
| 808 | Ga0307410_10076275 | 3300031852 | Unclassified | 2340 |
| 809 | Ga0307410_10399607 | 3300031852 | Bacteria | 1110 |
| 810 | Ga0307406_10265547 | 3300031901 | Unclassified | 1301 |
| 811 | Ga0307416_100765350 | 3300032002 | Unclassified | 1059 |
| 812 | Ga0307414_10155668 | 3300032004 | Bacteria | 1809 |
| 813 | Ga0307414_10507231 | 3300032004 | Bacteria | 1068 |
| 814 | Ga0307414_10876378 | 3300032004 | Bacteria | 822 |
| 815 | Ga0307510_10001791 | 3300033180 | Bacteria | 23975 |
| 816 | Ga0373934_0088553 | 3300035086 | Bacteria | 1247 |
| 817 | Ga0373936_0127699 | 3300035113 | Bacteria | 1091 |
| 818 | Ga0373943_0067354 | 3300035170 | Bacteria | 1806 |
| 819 | Ga0373924_0081716 | 3300035410 | Bacteria | 1375 |
| 820 | Ga0373935_0084399 | 3300035692 | Bacteria | 2069 |
| 821 | Ga0373935_0567782 | 3300035692 | Bacteria | 828 |
| 822 | Ga0373933_0386141 | 3300035724 | Bacteria | 912 |
| 823 | Ga0373947_0656145 | 3300035725 | Bacteria | 715 |
| 824 | Ga0395900_0086331 | 3300037418 | Bacteria | 3225 |
| 825 | Ga0395900_0108156 | 3300037418 | Bacteria | 2857 |
| 826 | Ga0395905_0007118 | 3300037471 | Bacteria | 11179 |
| 827 | Ga0395901_0364220 | 3300038443 | Bacteria | 1490 |
| 828 | Ga0436365_1871658 | 3300039437 | Bacteria | 39500 |
| 829 | Ga0439465_0049696 | 3300041413 | Bacteria | 1371 |
| 830 | Ga0439431_0012671 | 3300041997 | Bacteria | 1940 |
| 831 | Ga0439431_0043338 | 3300041997 | Bacteria | 1151 |
| 832 | Ga0439442_036545 | 3300042002 | Bacteria | 1028 |
| 833 | Ga0439449_0007877 | 3300042007 | Bacteria | 4046 |
| 834 | Ga0439462_0070206 | 3300042015 | Bacteria | 951 |
| 835 | Ga0450923_028531 | 3300042125 | Bacteria | 1127 |
| 836 | Ga0450896_029285 | 3300042133 | Unclassified | 829 |
| 837 | Ga0450898_001962 | 3300042134 | Bacteria | 2808 |
| 838 | Ga0450899_004449 | 3300042135 | Bacteria | 1501 |
| 839 | Ga0439434_0035935 | 3300042435 | Bacteria | 1515 |
| 840 | Ga0451577_0012952 | 3300042876 | Bacteria | 7826 |
| 841 | Ga0451577_0145235 | 3300042876 | Unclassified | 2133 |
| 842 | Ga0466972_0001452 | 3300044658 | Bacteria | 11515 |
| 843 | Ga0466972_0062913 | 3300044658 | Bacteria | 1778 |
| 844 | Ga0453683_0254115 | 3300044673 | Bacteria | 1120 |
| 845 | Ga0466965_0079722 | 3300044683 | Bacteria | 1654 |
| 846 | Ga0466966_0000015 | 3300044684 | Bacteria | 127402 |
| 847 | Ga0466964_0058135 | 3300044706 | Bacteria | 1602 |
| 848 | Ga0453684_0062563 | 3300044712 | Unclassified | 4766 |
| 849 | Ga0453684_0134027 | 3300044712 | Bacteria | 2969 |
| 850 | Ga0453684_0297820 | 3300044712 | Bacteria | 1834 |
| 851 | Ga0453684_0550104 | 3300044712 | Bacteria | 1271 |
| 852 | Ga0453684_0699024 | 3300044712 | Bacteria | 1102 |
| 853 | Ga0466968_0018459 | 3300044735 | Bacteria | 2798 |
| 854 | Ga0466970_0012769 | 3300044765 | Bacteria | 4299 |
| 855 | Ga0466970_0048566 | 3300044765 | Unclassified | 2263 |
| 856 | Ga0466957_0066710 | 3300044842 | Unclassified | 2219 |
| 857 | Ga0466959_0000030 | 3300045049 | Bacteria | 111343 |
| 858 | Ga0466959_0016186 | 3300045049 | Bacteria | 5444 |
| 859 | Ga0466959_0035316 | 3300045049 | Bacteria | 3699 |
| 860 | Ga0451576_0235849 | 3300045051 | Bacteria | 1911 |
| 861 | Ga0466958_0050233 | 3300045836 | Unclassified | 2525 |
| 862 | Ga0495603_0442249 | 3300046455 | Bacteria | 745 |
| 863 | Ga0495650_0129811 | 3300046471 | Bacteria | 920 |
| 864 | Ga0495582_0354770 | 3300046473 | Bacteria | 845 |
| 865 | Ga0495594_0022461 | 3300046499 | Bacteria | 3375 |
| 866 | Ga0495606_0023076 | 3300046507 | Unclassified | 4518 |
| 867 | Ga0495643_0041211 | 3300046522 | Bacteria | 2518 |
| 868 | Ga0495633_0000036 | 3300046558 | Bacteria | 184999 |
| 869 | Ga0495634_0071073 | 3300046642 | Bacteria | 2293 |
| 870 | Ga0495611_0000215 | 3300046648 | Bacteria | 40810 |
| 871 | Ga0495611_0188123 | 3300046648 | Unclassified | 964 |
| 872 | Ga0495625_0051193 | 3300046660 | Bacteria | 2961 |
| 873 | Ga0495657_0178654 | 3300046675 | Bacteria | 1304 |
| 874 | Ga0495649_0057325 | 3300046694 | Bacteria | 2101 |
| 875 | Ga0495672_0085311 | 3300047320 | Bacteria | 1750 |
| 876 | Ga0495687_000429 | 3300047443 | Bacteria | 51940 |
| 877 | Ga0495684_0056004 | 3300047471 | Bacteria | 3007 |
| 878 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 879 | Ga0496101_0373677 | 3300048904 | Bacteria | 1121 |
| 880 | Ga0496104_0572615 | 3300048907 | Bacteria | 1040 |
| 881 | Ga0496110_0167800 | 3300048913 | Bacteria | 1991 |
| 882 | Ga0496121_0000082 | 3300048924 | Bacteria | 228557 |
| 883 | Ga0496126_0548457 | 3300048929 | Bacteria | 918 |
| 884 | Ga0501290_012573 | 3300049513 | Bacteria | 1098 |
| 885 | Ga0501290_012778 | 3300049513 | Bacteria | 1091 |
| 886 | Ga0501290_016113 | 3300049513 | Bacteria | 994 |
| 887 | Ga0501292_003376 | 3300049515 | Bacteria | 2131 |
| 888 | Ga0501293_001922 | 3300049516 | Bacteria | 1567 |
| 889 | Ga0501296_001139 | 3300049519 | Bacteria | 2666 |
| 890 | Ga0501296_001461 | 3300049519 | Bacteria | 2399 |
| 891 | Ga0501298_006493 | 3300049521 | Bacteria | 1913 |
| 892 | Ga0501031_0021747 | 3300049568 | Unclassified | 4181 |
| 893 | Ga0501032_0001908 | 3300049569 | Bacteria | 16464 |
| 894 | Ga0501033_0148537 | 3300049570 | Bacteria | 1692 |
| 895 | Ga0501033_0165547 | 3300049570 | Bacteria | 1590 |
| 896 | Ga0501034_0002670 | 3300049571 | Bacteria | 21081 |
| 897 | Ga0501034_0105205 | 3300049571 | Bacteria | 2815 |
| 898 | Ga0501036_0005284 | 3300049572 | Bacteria | 10447 |
| 899 | Ga0501036_0034800 | 3300049572 | Unclassified | 4261 |
| 900 | Ga0501037_0019028 | 3300049573 | Bacteria | 5062 |
| 901 | Ga0501037_0047331 | 3300049573 | Unclassified | 3152 |
| 902 | Ga0501038_0029172 | 3300049574 | Bacteria | 4892 |
| 903 | Ga0501038_0178935 | 3300049574 | Unclassified | 1712 |
| 904 | Ga0501039_0269398 | 3300049575 | Unclassified | 1338 |
| 905 | Ga0501040_0356475 | 3300049576 | Bacteria | 1048 |
| 906 | Ga0501043_0006363 | 3300049579 | Bacteria | 9485 |
| 907 | Ga0501043_0315340 | 3300049579 | Bacteria | 1193 |
| 908 | Ga0501046_0009293 | 3300049580 | Bacteria | 8511 |
| 909 | Ga0501048_0000884 | 3300049582 | Bacteria | 22148 |
| 910 | Ga0501070_0003735 | 3300049586 | Bacteria | 13145 |
| 911 | Ga0501072_0054714 | 3300049588 | Bacteria | 3145 |
| 912 | Ga0501072_0064403 | 3300049588 | Unclassified | 2891 |
| 913 | Ga0501073_0002238 | 3300049589 | Bacteria | 14472 |
| 914 | Ga0501198_004001 | 3300049649 | Bacteria | 2034 |
| 915 | Ga0501199_001228 | 3300049650 | Bacteria | 2306 |
| 916 | Ga0501201_004280 | 3300049651 | Bacteria | 1320 |
| 917 | Ga0501202_013518 | 3300049652 | Bacteria | 1553 |
| 918 | Ga0501202_022773 | 3300049652 | Bacteria | 1260 |
| 919 | Ga0501206_003906 | 3300049653 | Bacteria | 1893 |
| 920 | Ga0501207_002206 | 3300049654 | Bacteria | 2502 |
| 921 | Ga0501207_012585 | 3300049654 | Bacteria | 1273 |
| 922 | Ga0501208_023192 | 3300049655 | Bacteria | 1036 |
| 923 | Ga0501217_000732 | 3300049661 | Bacteria | 5675 |
| 924 | Ga0501217_002135 | 3300049661 | Bacteria | 3839 |
| 925 | Ga0501217_002809 | 3300049661 | Bacteria | 3468 |
| 926 | Ga0501222_002695 | 3300049662 | Bacteria | 2460 |
| 927 | Ga0501223_014943 | 3300049663 | Bacteria | 1538 |
| 928 | Ga0501227_026664 | 3300049665 | Bacteria | 1363 |
| 929 | Ga0501235_000607 | 3300049669 | Bacteria | 7220 |
| 930 | Ga0501235_008309 | 3300049669 | Bacteria | 2265 |
| 931 | Ga0501239_026478 | 3300049672 | Bacteria | 740 |
| 932 | Ga0501242_003136 | 3300049674 | Bacteria | 1774 |
| 933 | Ga0501242_005678 | 3300049674 | Bacteria | 1409 |
| 934 | Ga0501243_000309 | 3300049675 | Bacteria | 6287 |
| 935 | Ga0501243_017204 | 3300049675 | Bacteria | 1172 |
| 936 | Ga0501250_001258 | 3300049680 | Bacteria | 2037 |
| 937 | Ga0501251_007325 | 3300049681 | Bacteria | 1225 |
| 938 | Ga0501251_015790 | 3300049681 | Bacteria | 953 |
| 939 | Ga0501252_000860 | 3300049682 | Bacteria | 2591 |
| 940 | Ga0501252_001699 | 3300049682 | Bacteria | 2085 |
| 941 | Ga0501257_007503 | 3300049686 | Bacteria | 2438 |
| 942 | Ga0501257_009781 | 3300049686 | Bacteria | 2168 |
| 943 | Ga0501258_007068 | 3300049687 | Bacteria | 1129 |
| 944 | Ga0501259_000337 | 3300049688 | Bacteria | 7391 |
| 945 | Ga0501259_002718 | 3300049688 | Bacteria | 2847 |
| 946 | Ga0501259_004027 | 3300049688 | Bacteria | 2335 |
| 947 | Ga0501261_002085 | 3300049690 | Bacteria | 2459 |
| 948 | Ga0501221_007138 | 3300049704 | Bacteria | 1908 |
| 949 | Ga0501221_012654 | 3300049704 | Bacteria | 1538 |
| 950 | Ga0501225_0037643 | 3300049705 | Bacteria | 1333 |
| 951 | Ga0501234_003971 | 3300049707 | Bacteria | 2323 |
| 952 | Ga0501234_029389 | 3300049707 | Unclassified | 886 |
| 953 | Ga0501245_001061 | 3300049708 | Bacteria | 3542 |
| 954 | Ga0501245_001715 | 3300049708 | Bacteria | 2866 |
| 955 | Ga0501245_021526 | 3300049708 | Bacteria | 1012 |
| 956 | Ga0501080_0007927 | 3300049742 | Bacteria | 9620 |
| 957 | Ga0501241_000612 | 3300049758 | Bacteria | 7656 |
| 958 | Ga0501268_000938 | 3300049765 | Bacteria | 3431 |
| 959 | Ga0501268_002093 | 3300049765 | Bacteria | 2586 |
| 960 | Ga0501270_008108 | 3300049767 | Bacteria | 1320 |
| 961 | Ga0501271_001812 | 3300049768 | Bacteria | 1850 |
| 962 | Ga0501279_002027 | 3300049775 | Bacteria | 2680 |
| 963 | Ga0501280_028199 | 3300049776 | Unclassified | 867 |
| 964 | Ga0501035_0003312 | 3300049822 | Bacteria | 15431 |
| 965 | Ga0501044_0014451 | 3300049823 | Bacteria | 8523 |
| 966 | Ga0501044_0035989 | 3300049823 | Bacteria | 5181 |
| 967 | Ga0501044_0171508 | 3300049823 | Bacteria | 2141 |
| 968 | Ga0501204_015306 | 3300049850 | Bacteria | 951 |
| 969 | nmdc:mga07m45_76123_c1 | 3300050496 | Unclassified | 1913 |
| 970 | nmdc:mga05p37_746139_c1 | 3300050507 | Bacteria | 1080 |
| 971 | nmdc:mga09592_31144_c1 | 3300050508 | Bacteria | 4443 |
| 972 | nmdc:mga0qj67_260418_c1 | 3300050509 | Bacteria | 1407 |
| 973 | nmdc:mga06r32_79393_c1 | 3300050510 | Bacteria | 3192 |
| 974 | nmdc:mga08y16_144811_c1 | 3300050511 | Unclassified | 2470 |
| 975 | nmdc:mga08y16_890566_c1 | 3300050511 | Unclassified | 877 |
| 976 | nmdc:mga0n895_14080_c1 | 3300050512 | Bacteria | 7251 |
| 977 | Ga0500644_0000403 | 3300053088 | Bacteria | 20587 |
| 978 | Ga0500646_0001212 | 3300053090 | Bacteria | 6921 |
| 979 | Ga0500583_0002840 | 3300053092 | Bacteria | 5317 |
| 980 | Ga0500583_0003678 | 3300053092 | Unclassified | 4878 |
| 981 | Ga0500651_0211237 | 3300053093 | Bacteria | 1141 |
| 982 | Ga0500569_000388 | 3300053109 | Bacteria | 7133 |
| 983 | Ga0500597_135470 | 3300053120 | Unclassified | 1063 |
| 984 | Ga0500607_116542 | 3300053121 | Bacteria | 1300 |
| 985 | Ga0500642_0003621 | 3300053130 | Unclassified | 4702 |
| 986 | Ga0500652_027381 | 3300053131 | Bacteria | 2203 |
| 987 | Ga0500658_0003607 | 3300053134 | Bacteria | 5836 |
| 988 | Ga0500559_0093793 | 3300053136 | Bacteria | 1377 |
| 989 | Ga0500568_0033011 | 3300053139 | Bacteria | 2126 |
| 990 | Ga0500577_0002818 | 3300053142 | Bacteria | 4463 |
| 991 | Ga0500588_0019572 | 3300053146 | Bacteria | 1802 |
| 992 | Ga0500589_021250 | 3300053147 | Bacteria | 2973 |
| 993 | Ga0500590_043338 | 3300053148 | Bacteria | 2308 |
| 994 | Ga0500616_0105690 | 3300053153 | Bacteria | 1368 |
| 995 | Ga0500622_0000085 | 3300053156 | Bacteria | 100276 |
| 996 | Ga0500622_0001758 | 3300053156 | Bacteria | 16652 |
| 997 | Ga0500633_0008215 | 3300053160 | Bacteria | 2678 |
| 998 | Ga0500636_0081473 | 3300053177 | Bacteria | 1864 |
| 999 | Ga0501084_0087064 | 3300054114 | Bacteria | 2623 |
| 1000 | Ga0501082_0111728 | 3300060353 | Unclassified | 2365 |
| 1001 | 2819575177 | 2818991442 | Bacteria | 8318214 |
| 1002 | 2819677159 | 2818991460 | Bacteria | 7595395 |
| 1003 | 2821141280 | 2821136567 | Bacteria | 8080116 |
| 1004 | 2840678551 | 2840677318 | Bacteria | 2664183 |
| 1005 | 2883071468 | 2883068021 | Bacteria | 6192739 |
| 1006 | 2884797007 | 2884791551 | Bacteria | 8511252 |
| 1007 | 2896086369 | 2896085136 | Bacteria | 6129793 |
| 1008 | 2904471115 | 2904467357 | Bacteria | 8057758 |
| 1009 | 2929239887 | 2929239360 | Bacteria | 7745570 |
| 1010 | 2946014328 | 2946013367 | Bacteria | 7766675 |
| 1011 | rootH2_10000442 | |||
| 1012 | MRS1b_contig_7821077 | |||
| 1013 | ARSoilOldRDRAFT_c001321 | |||
| 1014 | JGI24751J29686_10000798 | |||
| 1015 | JGI25153J46596_10007175 | |||
| 1016 | JGI25153J46596_10066346 | |||
| 1017 | rootH2_10076151 | |||
| 1018 | rootH2_10252112 | |||
| 1019 | rootH2_10315418 | |||
| 1020 | rootL2_10002141 | |||
| 1021 | rootL2_10002142 | |||
| 1022 | rootL2_10021159 | |||
| 1023 | rootL2_10318402 | |||
| 1024 | rootL2_10359840 | |||
| 1025 | rootH1_10000729 | |||
| 1026 | rootH1_10130251 | |||
| 1027 | JGI25160J50197_1001202 | |||
| 1028 | JGI25160J50197_1013566 | |||
| 1029 | JGI25160J50197_1042189 | |||
| 1030 | Ga0055535_1005062 | |||
| 1031 | Ga0055526_1013821 | |||
| 1032 | Ga0055528_1000076 | |||
| 1033 | Ga0055530_10000023 | |||
| 1034 | Ga0055531_10000005 | |||
| 1035 | Ga0065165_1000110 | |||
| 1036 | Ga0065165_1014384 | |||
| 1037 | Ga0065165_1014542 | |||
| 1038 | Ga0065712_10020475 | |||
| 1039 | Ga0065712_10150071 | |||
| 1040 | Ga0065712_10306517 | |||
| 1041 | Ga0065715_10001575 | |||
| 1042 | Ga0065715_10478092 | |||
| 1043 | Ga0065707_10116423 | |||
| 1044 | Ga0065707_10145142 | |||
| 1045 | Ga0065707_10305839 | |||
| 1046 | Ga0070676_10004140 | |||
| 1047 | Ga0070676_10008614 | |||
| 1048 | Ga0070676_10011952 | |||
| 1049 | Ga0070676_10145648 | |||
| 1050 | Ga0070683_100002522 | |||
| 1051 | Ga0070683_100031464 | |||
| 1052 | Ga0070683_100173052 | |||
| 1053 | Ga0070690_100016123 | |||
| 1054 | Ga0070690_100310816 | |||
| 1055 | Ga0070670_100021580 | |||
| 1056 | Ga0070670_100027216 | |||
| 1057 | Ga0070670_100045357 | |||
| 1058 | Ga0070670_100048501 | |||
| 1059 | Ga0070670_100137532 | |||
| 1060 | Ga0070670_100159398 | |||
| 1061 | Ga0070670_100195605 | |||
| 1062 | Ga0070670_100211594 | |||
| 1063 | Ga0070670_100237135 | |||
| 1064 | Ga0070670_100307893 | |||
| 1065 | Ga0070677_10011175 | |||
| 1066 | Ga0070677_10062168 | |||
| 1067 | Ga0070677_10092219 | |||
| 1068 | Ga0068869_100003068 | |||
| 1069 | Ga0068869_100006133 | |||
| 1070 | Ga0068869_100019321 | |||
| 1071 | Ga0068869_100044205 | |||
| 1072 | Ga0068869_100044987 | |||
| 1073 | Ga0068869_100066606 | |||
| 1074 | Ga0068869_100079254 | |||
| 1075 | Ga0068869_100431026 | |||
| 1076 | Ga0068869_100541418 | |||
| 1077 | Ga0070666_10000096 | |||
| 1078 | Ga0070666_10001663 | |||
| 1079 | Ga0070666_10041698 | |||
| 1080 | Ga0070666_10076725 | |||
| 1081 | Ga0070666_10082152 | |||
| 1082 | Ga0070666_10085400 | |||
| 1083 | Ga0070666_10498332 | |||
| 1084 | Ga0070682_100000008 | |||
| 1085 | Ga0070682_100189001 | |||
| 1086 | Ga0070682_100348156 | |||
| 1087 | Ga0068868_100009492 | |||
| 1088 | Ga0068868_100016796 | |||
| 1089 | Ga0068868_100017003 | |||
| 1090 | Ga0068868_100017243 | |||
| 1091 | Ga0068868_100044099 | |||
| 1092 | Ga0068868_100256916 | |||
| 1093 | Ga0070660_100195872 | |||
| 1094 | Ga0070689_100001434 | |||
| 1095 | Ga0070689_100003780 | |||
| 1096 | Ga0070689_100114610 | |||
| 1097 | Ga0070689_100115147 | |||
| 1098 | Ga0070689_100670556 | |||
| 1099 | Ga0070691_10060727 | |||
| 1100 | Ga0070687_100305984 | |||
| 1101 | Ga0070661_100004336 | |||
| 1102 | Ga0070661_100005816 | |||
| 1103 | Ga0070661_100052664 | |||
| 1104 | Ga0070661_100099492 | |||
| 1105 | Ga0070661_100101392 | |||
| 1106 | Ga0070661_100109416 | |||
| 1107 | Ga0070661_100129189 | |||
| 1108 | Ga0070661_100157639 | |||
| 1109 | Ga0070661_100247640 | |||
| 1110 | Ga0070692_10142108 | |||
| 1111 | Ga0070668_100006621 | |||
| 1112 | Ga0070668_100112814 | |||
| 1113 | Ga0070668_100155792 | |||
| 1114 | Ga0070668_100193090 | |||
| 1115 | Ga0070668_100205370 | |||
| 1116 | Ga0070669_100003962 | |||
| 1117 | Ga0070669_100015882 | |||
| 1118 | Ga0070669_100072734 | |||
| 1119 | Ga0070669_100132293 | |||
| 1120 | Ga0070669_100294444 | |||
| 1121 | Ga0070669_100318321 | |||
| 1122 | Ga0070669_101008522 | |||
| 1123 | Ga0070675_100012925 | |||
| 1124 | Ga0070675_100069846 | |||
| 1125 | Ga0070675_100098403 | |||
| 1126 | Ga0070675_100129762 | |||
| 1127 | Ga0070675_100177310 | |||
| 1128 | Ga0070675_100354069 | |||
| 1129 | Ga0070675_100771584 | |||
| 1130 | Ga0070671_100035316 | |||
| 1131 | Ga0070671_100039606 | |||
| 1132 | Ga0070671_100047720 | |||
| 1133 | Ga0070671_100128602 | |||
| 1134 | Ga0070671_100166135 | |||
| 1135 | Ga0070671_100297023 | |||
| 1136 | Ga0070674_100170743 | |||
| 1137 | Ga0070674_100212780 | |||
| 1138 | Ga0070673_100001237 | |||
| 1139 | Ga0070673_100002858 | |||
| 1140 | Ga0070673_100018742 | |||
| 1141 | Ga0070673_100063800 | |||
| 1142 | Ga0070673_100092490 | |||
| 1143 | Ga0070673_100118165 | |||
| 1144 | Ga0070673_100181369 | |||
| 1145 | Ga0070673_100224341 | |||
| 1146 | Ga0070673_100282423 | |||
| 1147 | Ga0070673_100494168 | |||
| 1148 | Ga0070673_100794744 | |||
| 1149 | Ga0070688_100001210 | |||
| 1150 | Ga0070688_100008564 | |||
| 1151 | Ga0070688_100082014 | |||
| 1152 | Ga0070659_100008619 | |||
| 1153 | Ga0070659_100253455 | |||
| 1154 | Ga0070659_100454358 | |||
| 1155 | Ga0070667_100002757 | |||
| 1156 | Ga0070667_100062881 | |||
| 1157 | Ga0070667_100094570 | |||
| 1158 | Ga0070667_100106436 | |||
| 1159 | Ga0070667_100662098 | |||
| 1160 | Ga0070701_10041737 | |||
| 1161 | Ga0070701_10449728 | |||
| 1162 | Ga0070700_100049548 | |||
| 1163 | Ga0070678_100007568 | |||
| 1164 | Ga0070678_100008039 | |||
| 1165 | Ga0070678_100219911 | |||
| 1166 | Ga0070678_100310192 | |||
| 1167 | Ga0070662_100012053 | |||
| 1168 | Ga0070662_100020333 | |||
| 1169 | Ga0070662_100020971 | |||
| 1170 | Ga0070662_100025524 | |||
| 1171 | Ga0070662_100043678 | |||
| 1172 | Ga0070662_100044910 | |||
| 1173 | Ga0070662_100394060 | |||
| 1174 | Ga0070662_100927263 | |||
| 1175 | Ga0070681_10731841 | |||
| 1176 | Ga0068867_100015409 | |||
| 1177 | Ga0068867_100026633 | |||
| 1178 | Ga0068867_100104028 | |||
| 1179 | Ga0068867_100144081 | |||
| 1180 | Ga0068867_100154609 | |||
| 1181 | Ga0068867_100187111 | |||
| 1182 | Ga0068867_100322017 | |||
| 1183 | Ga0068867_100649327 | |||
| 1184 | Ga0068867_100864126 | |||
| 1185 | Ga0068867_101157514 | |||
| 1186 | Ga0070685_10006138 | |||
| 1187 | Ga0070685_10012117 | |||
| 1188 | Ga0070685_10065638 | |||
| 1189 | Ga0070685_10201613 | |||
| 1190 | Ga0070685_10457210 | |||
| 1191 | Ga0070698_100000061 | |||
| 1192 | Ga0070698_100092215 | |||
| 1193 | Ga0070698_100875649 | |||
| 1194 | Ga0070699_100174637 | |||
| 1195 | Ga0070684_100003744 | |||
| 1196 | Ga0070684_100003772 | |||
| 1197 | Ga0070684_100008074 | |||
| 1198 | Ga0070684_100306077 | |||
| 1199 | Ga0070684_100357174 | |||
| 1200 | Ga0070684_100445667 | |||
| 1201 | Ga0068853_100000796 | |||
| 1202 | Ga0068853_100006503 | |||
| 1203 | Ga0068853_100008344 | |||
| 1204 | Ga0068853_100025487 | |||
| 1205 | Ga0068853_100456127 | |||
| 1206 | Ga0068853_100653138 | |||
| 1207 | Ga0068853_100935750 | |||
| 1208 | Ga0068853_101083914 | |||
| 1209 | Ga0070672_100015160 | |||
| 1210 | Ga0070672_100018204 | |||
| 1211 | Ga0070672_100156749 | |||
| 1212 | Ga0070672_100210439 | |||
| 1213 | Ga0070672_100541286 | |||
| 1214 | Ga0070686_100032955 | |||
| 1215 | Ga0070686_100127864 | |||
| 1216 | Ga0070686_100383448 | |||
| 1217 | Ga0070695_100073426 | |||
| 1218 | Ga0070693_100360328 | |||
| 1219 | Ga0070665_100042819 | |||
| 1220 | Ga0070665_100116197 | |||
| 1221 | Ga0070665_100176199 | |||
| 1222 | Ga0070665_100184428 | |||
| 1223 | Ga0070704_100018118 | |||
| 1224 | Ga0070704_100105673 | |||
| 1225 | Ga0070704_100189425 | |||
| 1226 | Ga0068855_100001457 | |||
| 1227 | Ga0068855_100045261 | |||
| 1228 | Ga0068855_100099029 | |||
| 1229 | Ga0068855_100301662 | |||
| 1230 | Ga0068855_100552564 | |||
| 1231 | Ga0070664_100018058 | |||
| 1232 | Ga0070664_100028969 | |||
| 1233 | Ga0070664_100109202 | |||
| 1234 | Ga0070664_100149707 | |||
| 1235 | Ga0070664_100238427 | |||
| 1236 | Ga0070664_100301587 | |||
| 1237 | Ga0070664_100805852 | |||
| 1238 | Ga0070664_100920565 | |||
| 1239 | Ga0068857_100022605 | |||
| 1240 | Ga0068857_100054252 | |||
| 1241 | Ga0068857_100064624 | |||
| 1242 | Ga0068857_100206122 | |||
| 1243 | Ga0068857_100244235 | |||
| 1244 | Ga0068857_100418397 | |||
| 1245 | Ga0068857_100626621 | |||
| 1246 | Ga0068854_100002878 | |||
| 1247 | Ga0068854_100030880 | |||
| 1248 | Ga0068854_100108428 | |||
| 1249 | Ga0068854_100254433 | |||
| 1250 | Ga0068856_100130056 | |||
| 1251 | Ga0068856_100135868 | |||
| 1252 | Ga0070702_100659484 | |||
| 1253 | Ga0068852_100000857 | |||
| 1254 | Ga0068852_100001522 | |||
| 1255 | Ga0068852_100003549 | |||
| 1256 | Ga0068852_100306942 | |||
| 1257 | Ga0068852_100395759 | |||
| 1258 | Ga0068852_100612137 | |||
| 1259 | Ga0068852_101394700 | |||
| 1260 | Ga0068859_100000024 | |||
| 1261 | Ga0068859_100019662 | |||
| 1262 | Ga0068859_100025034 | |||
| 1263 | Ga0068859_100036905 | |||
| 1264 | Ga0068859_100042230 | |||
| 1265 | Ga0068859_100096194 | |||
| 1266 | Ga0068859_100173395 | |||
| 1267 | Ga0068859_100306027 | |||
| 1268 | Ga0068859_100371958 | |||
| 1269 | Ga0068859_100404349 | |||
| 1270 | Ga0068859_100902479 | |||
| 1271 | Ga0068864_100004575 | |||
| 1272 | Ga0068864_100005883 | |||
| 1273 | Ga0068864_100026240 | |||
| 1274 | Ga0068864_100072091 | |||
| 1275 | Ga0068864_100083040 | |||
| 1276 | Ga0068864_100415053 | |||
| 1277 | Ga0068864_100744095 | |||
| 1278 | Ga0068866_10024154 | |||
| 1279 | Ga0068866_10175027 | |||
| 1280 | Ga0068866_10232431 | |||
| 1281 | Ga0068861_100001870 | |||
| 1282 | Ga0068861_100002412 | |||
| 1283 | Ga0068861_100024839 | |||
| 1284 | Ga0068861_100049148 | |||
| 1285 | Ga0068861_100373791 | |||
| 1286 | Ga0068851_10003739 | |||
| 1287 | Ga0068851_10058827 | |||
| 1288 | Ga0068851_10083643 | |||
| 1289 | Ga0068851_10157744 | |||
| 1290 | Ga0068870_10008469 | |||
| 1291 | Ga0068870_10050453 | |||
| 1292 | Ga0068870_10101114 | |||
| 1293 | Ga0068870_10215749 | |||
| 1294 | Ga0068870_10249758 | |||
| 1295 | Ga0068863_100011915 | |||
| 1296 | Ga0068863_100039716 | |||
| 1297 | Ga0068863_100060049 | |||
| 1298 | Ga0068863_100081760 | |||
| 1299 | Ga0068863_100341493 | |||
| 1300 | Ga0068863_100523996 | |||
| 1301 | Ga0068863_100657328 | |||
| 1302 | Ga0068858_100003133 | |||
| 1303 | Ga0068858_100003141 | |||
| 1304 | Ga0068858_100085270 | |||
| 1305 | Ga0068858_100123938 | |||
| 1306 | Ga0068858_100322832 | |||
| 1307 | Ga0068858_100510997 | |||
| 1308 | Ga0068860_100000024 | |||
| 1309 | Ga0068860_100001839 | |||
| 1310 | Ga0068860_100008185 | |||
| 1311 | Ga0068860_100019138 | |||
| 1312 | Ga0068860_100025276 | |||
| 1313 | Ga0068860_100029320 | |||
| 1314 | Ga0068860_100065400 | |||
| 1315 | Ga0068860_100066970 | |||
| 1316 | Ga0068860_100204569 | |||
| 1317 | Ga0068860_100383612 | |||
| 1318 | Ga0068862_100002297 | |||
| 1319 | Ga0068862_100125753 | |||
| 1320 | Ga0068862_100271476 | |||
| 1321 | Ga0068862_100830445 | |||
| 1322 | Ga0068862_101105773 | |||
| 1323 | Ga0081539_10011722 | |||
| 1324 | Ga0070715_10288749 | |||
| 1325 | Ga0075366_10025671 | |||
| 1326 | Ga0075366_10145359 | |||
| 1327 | Ga0097621_100042034 | |||
| 1328 | Ga0097621_100043812 | |||
| 1329 | Ga0097621_100232858 | |||
| 1330 | Ga0097621_100308030 | |||
| 1331 | Ga0097621_100551238 | |||
| 1332 | Ga0097621_101023324 | |||
| 1333 | Ga0075370_10050448 | |||
| 1334 | Ga0068871_100004752 | |||
| 1335 | Ga0068871_100014692 | |||
| 1336 | Ga0068871_100466410 | |||
| 1337 | Ga0075428_100303880 | |||
| 1338 | Ga0075430_100013299 | |||
| 1339 | Ga0075430_100111938 | |||
| 1340 | Ga0075431_100016589 | |||
| 1341 | Ga0075434_100017373 | |||
| 1342 | Ga0075434_100682483 | |||
| 1343 | Ga0075429_100001773 | |||
| 1344 | Ga0075429_100074206 | |||
| 1345 | Ga0075429_100778825 | |||
| 1346 | Ga0068865_100033972 | |||
| 1347 | Ga0068865_100051723 | |||
| 1348 | Ga0097620_100000024 | |||
| 1349 | Ga0097620_100019662 | |||
| 1350 | Ga0097620_100025034 | |||
| 1351 | Ga0097620_100036905 | |||
| 1352 | Ga0097620_100042231 | |||
| 1353 | Ga0097620_100096193 | |||
| 1354 | Ga0097620_100173390 | |||
| 1355 | Ga0097620_100306012 | |||
| 1356 | Ga0097620_100371916 | |||
| 1357 | Ga0097620_100404342 | |||
| 1358 | Ga0097620_100902584 | |||
| 1359 | Ga0105244_10302630 | |||
| 1360 | Ga0105240_10000106 | |||
| 1361 | Ga0105240_10000895 | |||
| 1362 | Ga0105240_10002358 | |||
| 1363 | Ga0105240_10004897 | |||
| 1364 | Ga0105240_10074614 | |||
| 1365 | Ga0105240_10088384 | |||
| 1366 | Ga0105240_10122314 | |||
| 1367 | Ga0105240_10181534 | |||
| 1368 | Ga0111539_10004607 | |||
| 1369 | Ga0111539_10007347 | |||
| 1370 | Ga0111539_10207660 | |||
| 1371 | Ga0111539_11396613 | |||
| 1372 | Ga0105245_10079189 | |||
| 1373 | Ga0105245_10241255 | |||
| 1374 | Ga0105245_10903443 | |||
| 1375 | Ga0105245_10938801 | |||
| 1376 | Ga0105247_10001724 | |||
| 1377 | Ga0105247_10297971 | |||
| 1378 | Ga0114129_10243115 | |||
| 1379 | Ga0114129_10349646 | |||
| 1380 | Ga0105243_10080774 | |||
| 1381 | Ga0105243_10237309 | |||
| 1382 | Ga0105241_10000085 | |||
| 1383 | Ga0105241_10005689 | |||
| 1384 | Ga0105241_10138163 | |||
| 1385 | Ga0105241_10156952 | |||
| 1386 | Ga0105241_10237679 | |||
| 1387 | Ga0105242_10005018 | |||
| 1388 | Ga0105242_10070885 | |||
| 1389 | Ga0105242_10076884 | |||
| 1390 | Ga0105242_10133369 | |||
| 1391 | Ga0105242_10154328 | |||
| 1392 | Ga0105242_10269890 | |||
| 1393 | Ga0105242_10280589 | |||
| 1394 | Ga0105248_10037895 | |||
| 1395 | Ga0105237_10000453 | |||
| 1396 | Ga0105237_10013660 | |||
| 1397 | Ga0105237_10021915 | |||
| 1398 | Ga0105237_10034777 | |||
| 1399 | Ga0105237_10050819 | |||
| 1400 | Ga0105237_10166996 | |||
| 1401 | Ga0105237_10212082 | |||
| 1402 | Ga0105237_10242616 | |||
| 1403 | Ga0105237_10248689 | |||
| 1404 | Ga0105237_10252864 | |||
| 1405 | Ga0105238_10001678 | |||
| 1406 | Ga0105238_10027955 | |||
| 1407 | Ga0105238_10107405 | |||
| 1408 | Ga0105238_10317212 | |||
| 1409 | Ga0105249_10002023 | |||
| 1410 | Ga0105249_10007013 | |||
| 1411 | Ga0105249_10015481 | |||
| 1412 | Ga0105249_10024744 | |||
| 1413 | Ga0105249_10029535 | |||
| 1414 | Ga0105249_10031991 | |||
| 1415 | Ga0105249_10051878 | |||
| 1416 | Ga0105249_10090950 | |||
| 1417 | Ga0105249_10098094 | |||
| 1418 | Ga0105249_10153989 | |||
| 1419 | Ga0105249_10160224 | |||
| 1420 | Ga0105249_10191916 | |||
| 1421 | Ga0105249_10238793 | |||
| 1422 | Ga0105249_11287643 | |||
| 1423 | Ga0105239_10000019 | |||
| 1424 | Ga0105239_10000384 | |||
| 1425 | Ga0105239_10003545 | |||
| 1426 | Ga0105239_10012678 | |||
| 1427 | Ga0105239_10034600 | |||
| 1428 | Ga0105239_10053305 | |||
| 1429 | Ga0105239_10062597 | |||
| 1430 | Ga0105239_10087953 | |||
| 1431 | Ga0105239_10089409 | |||
| 1432 | Ga0105239_10636988 | |||
| 1433 | Ga0105239_10668246 | |||
| 1434 | Ga0105239_10794999 | |||
| 1435 | Ga0105239_11498530 | |||
| 1436 | Ga0105246_10001022 | |||
| 1437 | Ga0105246_10221717 | |||
| 1438 | Ga0105246_10286352 | |||
| 1439 | Ga0105246_10351717 | |||
| 1440 | Ga0157373_10043948 | |||
| 1441 | Ga0157373_10139222 | |||
| 1442 | Ga0157373_10186084 | |||
| 1443 | Ga0157371_10008920 | |||
| 1444 | Ga0157371_10032938 | |||
| 1445 | Ga0157371_10106778 | |||
| 1446 | Ga0157371_10195696 | |||
| 1447 | Ga0157371_10360272 | |||
| 1448 | Ga0157371_10640225 | |||
| 1449 | Ga0157370_10002878 | |||
| 1450 | Ga0157370_10016966 | |||
| 1451 | Ga0157370_10083776 | |||
| 1452 | Ga0157370_10153916 | |||
| 1453 | Ga0157370_10798343 | |||
| 1454 | Ga0157369_10192606 | |||
| 1455 | Ga0157369_10399441 | |||
| 1456 | Ga0157374_10000011 | |||
| 1457 | Ga0157374_10012134 | |||
| 1458 | Ga0157374_10025437 | |||
| 1459 | Ga0157374_10028180 | |||
| 1460 | Ga0157374_10057007 | |||
| 1461 | Ga0157374_10066125 | |||
| 1462 | Ga0157374_10101373 | |||
| 1463 | Ga0157374_10112556 | |||
| 1464 | Ga0157374_10533141 | |||
| 1465 | Ga0157378_10089507 | |||
| 1466 | Ga0157378_10180559 | |||
| 1467 | Ga0157378_10195528 | |||
| 1468 | Ga0157378_10223800 | |||
| 1469 | Ga0157378_10227553 | |||
| 1470 | Ga0157378_10318855 | |||
| 1471 | Ga0157378_10467152 | |||
| 1472 | Ga0157378_10704311 | |||
| 1473 | Ga0163162_10000189 | |||
| 1474 | Ga0163162_10000446 | |||
| 1475 | Ga0163162_10000687 | |||
| 1476 | Ga0163162_10002569 | |||
| 1477 | Ga0163162_10034873 | |||
| 1478 | Ga0163162_10038451 | |||
| 1479 | Ga0163162_10067267 | |||
| 1480 | Ga0163162_10194517 | |||
| 1481 | Ga0163162_10367617 | |||
| 1482 | Ga0157372_10006780 | |||
| 1483 | Ga0157372_10013773 | |||
| 1484 | Ga0157372_10017732 | |||
| 1485 | Ga0157372_10043256 | |||
| 1486 | Ga0157372_10063290 | |||
| 1487 | Ga0157372_10064498 | |||
| 1488 | Ga0157372_10246926 | |||
| 1489 | Ga0157372_10251227 | |||
| 1490 | Ga0157372_10280174 | |||
| 1491 | Ga0157372_10384159 | |||
| 1492 | Ga0157372_10452445 | |||
| 1493 | Ga0157372_10498670 | |||
| 1494 | Ga0157372_11449912 | |||
| 1495 | Ga0157372_11506528 | |||
| 1496 | Ga0157375_10011538 | |||
| 1497 | Ga0157375_10062680 | |||
| 1498 | Ga0157375_10064042 | |||
| 1499 | Ga0157375_10079622 | |||
| 1500 | Ga0157375_10080435 | |||
| 1501 | Ga0157375_10379957 | |||
| 1502 | Ga0157375_10382321 | |||
| 1503 | Ga0157375_10455081 | |||
| 1504 | Ga0157375_10849971 | |||
| 1505 | Ga0157375_10948459 | |||
| 1506 | Ga0163163_10001441 | |||
| 1507 | Ga0163163_10027772 | |||
| 1508 | Ga0163163_10047990 | |||
| 1509 | Ga0163163_10115108 | |||
| 1510 | Ga0163163_10191749 | |||
| 1511 | Ga0163163_10195361 | |||
| 1512 | Ga0157380_10000477 | |||
| 1513 | Ga0157380_10236061 | |||
| 1514 | Ga0157380_11047779 | |||
| 1515 | Ga0157380_11164558 | |||
| 1516 | Ga0157377_10000592 | |||
| 1517 | Ga0157377_10006415 | |||
| 1518 | Ga0157377_10024223 | |||
| 1519 | Ga0157377_10073050 | |||
| 1520 | Ga0157377_10356000 | |||
| 1521 | Ga0157377_10420512 | |||
| 1522 | Ga0157379_10013944 | |||
| 1523 | Ga0157379_10034749 | |||
| 1524 | Ga0157379_10072795 | |||
| 1525 | Ga0157379_10073080 | |||
| 1526 | Ga0157379_10189739 | |||
| 1527 | Ga0157379_10234775 | |||
| 1528 | Ga0157376_10005632 | |||
| 1529 | Ga0157376_10015084 | |||
| 1530 | Ga0157376_10058509 | |||
| 1531 | Ga0157376_10076387 | |||
| 1532 | Ga0157376_10218967 | |||
| 1533 | Ga0157376_10686916 | |||
| 1534 | Ga0157376_10849211 | |||
| 1535 | Ga0182005_1000017 | |||
| 1536 | Ga0163161_10006412 | |||
| 1537 | Ga0163161_10063433 | |||
| 1538 | Ga0163161_10124529 | |||
| 1539 | Ga0163161_10231657 | |||
| 1540 | Ga0209436_100787 | |||
| 1541 | Ga0209436_101343 | |||
| 1542 | Ga0209258_100029 | |||
| 1543 | Ga0209646_1000031 | |||
| 1544 | Ga0209026_1000019 | |||
| 1545 | Ga0209148_1000194 | |||
| 1546 | Ga0209129_1017055 | |||
| 1547 | Ga0207666_1020045 | |||
| 1548 | Ga0209673_1000501 | |||
| 1549 | Ga0209130_1000333 | |||
| 1550 | Ga0209564_1011975 | |||
| 1551 | Ga0209758_1008947 | |||
| 1552 | Ga0209758_1022289 | |||
| 1553 | Ga0209050_1000216 | |||
| 1554 | Ga0207426_1000024 | |||
| 1555 | Ga0207426_1001331 | |||
| 1556 | Ga0207426_1044975 | |||
| 1557 | Ga0209257_1000004 | |||
| 1558 | Ga0209257_1009260 | |||
| 1559 | Ga0207697_10008375 | |||
| 1560 | Ga0207697_10055492 | |||
| 1561 | Ga0207656_10002100 | |||
| 1562 | Ga0207682_10016584 | |||
| 1563 | Ga0207642_10003436 | |||
| 1564 | Ga0207642_10439506 | |||
| 1565 | Ga0207710_10001848 | |||
| 1566 | Ga0207710_10126357 | |||
| 1567 | Ga0207688_10004807 | |||
| 1568 | Ga0207680_10000455 | |||
| 1569 | Ga0207680_10029903 | |||
| 1570 | Ga0207680_10031451 | |||
| 1571 | Ga0207680_10137965 | |||
| 1572 | Ga0207680_10199681 | |||
| 1573 | Ga0207680_10428209 | |||
| 1574 | Ga0207647_10000025 | |||
| 1575 | Ga0207647_10039735 | |||
| 1576 | Ga0207647_10090658 | |||
| 1577 | Ga0207647_10288030 | |||
| 1578 | Ga0207645_10000356 | |||
| 1579 | Ga0207645_10005727 | |||
| 1580 | Ga0207645_10017356 | |||
| 1581 | Ga0207645_10028106 | |||
| 1582 | Ga0207643_10004864 | |||
| 1583 | Ga0207643_10004942 | |||
| 1584 | Ga0207705_10005298 | |||
| 1585 | Ga0207654_10000792 | |||
| 1586 | Ga0207654_10000944 | |||
| 1587 | Ga0207654_10256479 | |||
| 1588 | Ga0207695_10000087 | |||
| 1589 | Ga0207695_10000582 | |||
| 1590 | Ga0207695_10000909 | |||
| 1591 | Ga0207695_10004513 | |||
| 1592 | Ga0207695_10021645 | |||
| 1593 | Ga0207695_10120923 | |||
| 1594 | Ga0207695_10442855 | |||
| 1595 | Ga0207671_10000311 | |||
| 1596 | Ga0207671_10001101 | |||
| 1597 | Ga0207671_10001299 | |||
| 1598 | Ga0207671_10006605 | |||
| 1599 | Ga0207671_10093501 | |||
| 1600 | Ga0207671_10105270 | |||
| 1601 | Ga0207671_10157842 | |||
| 1602 | Ga0207671_10360204 | |||
| 1603 | Ga0207657_10059678 | |||
| 1604 | Ga0207657_10101763 | |||
| 1605 | Ga0207657_10124281 | |||
| 1606 | Ga0207649_10001650 | |||
| 1607 | Ga0207649_10005817 | |||
| 1608 | Ga0207649_10100367 | |||
| 1609 | Ga0207649_10208457 | |||
| 1610 | Ga0207649_10755790 | |||
| 1611 | Ga0207681_10053212 | |||
| 1612 | Ga0207681_10182866 | |||
| 1613 | Ga0207681_10391194 | |||
| 1614 | Ga0207694_10007619 | |||
| 1615 | Ga0207694_10083895 | |||
| 1616 | Ga0207650_10014161 | |||
| 1617 | Ga0207650_10033783 | |||
| 1618 | Ga0207650_10059953 | |||
| 1619 | Ga0207650_10073887 | |||
| 1620 | Ga0207650_10086909 | |||
| 1621 | Ga0207650_10091822 | |||
| 1622 | Ga0207650_10386773 | |||
| 1623 | Ga0207650_10529610 | |||
| 1624 | Ga0207650_10923473 | |||
| 1625 | Ga0207659_10026907 | |||
| 1626 | Ga0207659_10098648 | |||
| 1627 | Ga0207659_10137581 | |||
| 1628 | Ga0207659_10404849 | |||
| 1629 | Ga0207659_10405322 | |||
| 1630 | Ga0207659_10647350 | |||
| 1631 | Ga0207644_10022195 | |||
| 1632 | Ga0207644_10174177 | |||
| 1633 | Ga0207644_10470887 | |||
| 1634 | Ga0207690_10022006 | |||
| 1635 | Ga0207690_10271120 | |||
| 1636 | Ga0207706_10003804 | |||
| 1637 | Ga0207706_10017354 | |||
| 1638 | Ga0207706_10041428 | |||
| 1639 | Ga0207706_10055020 | |||
| 1640 | Ga0207706_10055030 | |||
| 1641 | Ga0207706_10096912 | |||
| 1642 | Ga0207686_10002454 | |||
| 1643 | Ga0207686_10045017 | |||
| 1644 | Ga0207686_10053668 | |||
| 1645 | Ga0207686_10071919 | |||
| 1646 | Ga0207670_10025851 | |||
| 1647 | Ga0207670_10037372 | |||
| 1648 | Ga0207670_10040648 | |||
| 1649 | Ga0207669_10124133 | |||
| 1650 | Ga0207704_10004256 | |||
| 1651 | Ga0207704_10017379 | |||
| 1652 | Ga0207704_10181642 | |||
| 1653 | Ga0207704_10469024 | |||
| 1654 | Ga0207691_10000753 | |||
| 1655 | Ga0207691_10002055 | |||
| 1656 | Ga0207691_10016839 | |||
| 1657 | Ga0207691_10024972 | |||
| 1658 | Ga0207691_10081293 | |||
| 1659 | Ga0207711_10115112 | |||
| 1660 | Ga0207711_10337725 | |||
| 1661 | Ga0207689_10001522 | |||
| 1662 | Ga0207689_10006221 | |||
| 1663 | Ga0207689_10007013 | |||
| 1664 | Ga0207689_10018846 | |||
| 1665 | Ga0207689_10032412 | |||
| 1666 | Ga0207689_10036291 | |||
| 1667 | Ga0207689_10044204 | |||
| 1668 | Ga0207689_10125081 | |||
| 1669 | Ga0207689_10160896 | |||
| 1670 | Ga0207689_10199794 | |||
| 1671 | Ga0207689_10248357 | |||
| 1672 | Ga0207661_10012248 | |||
| 1673 | Ga0207661_10021591 | |||
| 1674 | Ga0207661_10027157 | |||
| 1675 | Ga0207679_10003297 | |||
| 1676 | Ga0207679_10008381 | |||
| 1677 | Ga0207679_10081540 | |||
| 1678 | Ga0207679_10122239 | |||
| 1679 | Ga0207679_10218669 | |||
| 1680 | Ga0207679_10292664 | |||
| 1681 | Ga0207679_10458600 | |||
| 1682 | Ga0207679_10642604 | |||
| 1683 | Ga0207667_10000749 | |||
| 1684 | Ga0207667_10001603 | |||
| 1685 | Ga0207667_10054176 | |||
| 1686 | Ga0207667_10090037 | |||
| 1687 | Ga0207667_10316599 | |||
| 1688 | Ga0207651_10003277 | |||
| 1689 | Ga0207651_10011989 | |||
| 1690 | Ga0207651_10063829 | |||
| 1691 | Ga0207651_10082088 | |||
| 1692 | Ga0207651_10123247 | |||
| 1693 | Ga0207651_10165074 | |||
| 1694 | Ga0207651_10185776 | |||
| 1695 | Ga0207651_10257187 | |||
| 1696 | Ga0207651_10267556 | |||
| 1697 | Ga0207651_10350564 | |||
| 1698 | Ga0207712_10000442 | |||
| 1699 | Ga0207712_10001446 | |||
| 1700 | Ga0207712_10023884 | |||
| 1701 | Ga0207712_10056005 | |||
| 1702 | Ga0207712_10058531 | |||
| 1703 | Ga0207712_10097017 | |||
| 1704 | Ga0207712_10145969 | |||
| 1705 | Ga0207712_10173373 | |||
| 1706 | Ga0207712_10211159 | |||
| 1707 | Ga0207668_10002845 | |||
| 1708 | Ga0207668_10105256 | |||
| 1709 | Ga0207668_10142040 | |||
| 1710 | Ga0207668_10300971 | |||
| 1711 | Ga0207640_10058951 | |||
| 1712 | Ga0207640_10480674 | |||
| 1713 | Ga0207658_10002695 | |||
| 1714 | Ga0207658_10280033 | |||
| 1715 | Ga0207658_10356937 | |||
| 1716 | Ga0207677_10007162 | |||
| 1717 | Ga0207677_10011819 | |||
| 1718 | Ga0207677_10085642 | |||
| 1719 | Ga0207677_10149000 | |||
| 1720 | Ga0207677_10232834 | |||
| 1721 | Ga0207677_10801964 | |||
| 1722 | Ga0207677_10820692 | |||
| 1723 | Ga0207703_10001511 | |||
| 1724 | Ga0207703_10011137 | |||
| 1725 | Ga0207703_10062783 | |||
| 1726 | Ga0207703_10098192 | |||
| 1727 | Ga0207703_11100573 | |||
| 1728 | Ga0207639_10013633 | |||
| 1729 | Ga0207639_10018748 | |||
| 1730 | Ga0207639_10036134 | |||
| 1731 | Ga0207639_10053897 | |||
| 1732 | Ga0207639_10096729 | |||
| 1733 | Ga0207639_10188907 | |||
| 1734 | Ga0207678_10052063 | |||
| 1735 | Ga0207702_10108627 | |||
| 1736 | Ga0207702_10176519 | |||
| 1737 | Ga0207641_10000058 | |||
| 1738 | Ga0207641_10000318 | |||
| 1739 | Ga0207641_10010791 | |||
| 1740 | Ga0207641_10064798 | |||
| 1741 | Ga0207641_10344123 | |||
| 1742 | Ga0207641_10791786 | |||
| 1743 | Ga0207641_10910603 | |||
| 1744 | Ga0207648_10003234 | |||
| 1745 | Ga0207648_10016590 | |||
| 1746 | Ga0207648_10060659 | |||
| 1747 | Ga0207648_10096767 | |||
| 1748 | Ga0207648_10170137 | |||
| 1749 | Ga0207648_10214810 | |||
| 1750 | Ga0207648_10418979 | |||
| 1751 | Ga0207648_10547378 | |||
| 1752 | Ga0207676_10006124 | |||
| 1753 | Ga0207676_10008870 | |||
| 1754 | Ga0207676_10036656 | |||
| 1755 | Ga0207676_10040663 | |||
| 1756 | Ga0207676_10180689 | |||
| 1757 | Ga0207676_10340431 | |||
| 1758 | Ga0207676_10553010 | |||
| 1759 | Ga0207674_10007295 | |||
| 1760 | Ga0207674_10009391 | |||
| 1761 | Ga0207674_10034232 | |||
| 1762 | Ga0207674_10072442 | |||
| 1763 | Ga0207674_10234294 | |||
| 1764 | Ga0207674_10485752 | |||
| 1765 | Ga0207674_10914607 | |||
| 1766 | Ga0207675_100000790 | |||
| 1767 | Ga0207675_100002654 | |||
| 1768 | Ga0207675_100053934 | |||
| 1769 | Ga0207675_100084175 | |||
| 1770 | Ga0207675_100134574 | |||
| 1771 | Ga0207675_100161463 | |||
| 1772 | Ga0207675_100248553 | |||
| 1773 | Ga0207675_100315986 | |||
| 1774 | Ga0207675_100330655 | |||
| 1775 | Ga0207675_100435819 | |||
| 1776 | Ga0207675_100474197 | |||
| 1777 | Ga0207683_10001338 | |||
| 1778 | Ga0207683_10020387 | |||
| 1779 | Ga0207683_10039715 | |||
| 1780 | Ga0207698_10006234 | |||
| 1781 | Ga0207698_10018280 | |||
| 1782 | Ga0207698_10036127 | |||
| 1783 | Ga0207698_10154393 | |||
| 1784 | Ga0207698_10245859 | |||
| 1785 | Ga0209971_1026924 | |||
| 1786 | Ga0209974_10028498 | |||
| 1787 | Ga0207428_10033663 | |||
| 1788 | Ga0268266_10000048 | |||
| 1789 | Ga0268266_10066374 | |||
| 1790 | Ga0268266_10067339 | |||
| 1791 | Ga0268266_10078214 | |||
| 1792 | Ga0268266_10447242 | |||
| 1793 | Ga0268265_10006349 | |||
| 1794 | Ga0268265_10104831 | |||
| 1795 | Ga0268265_10391446 | |||
| 1796 | Ga0268265_10826962 | |||
| 1797 | Ga0268265_10895094 | |||
| 1798 | Ga0268264_10000079 | |||
| 1799 | Ga0268264_10001298 | |||
| 1800 | Ga0268264_10002782 | |||
| 1801 | Ga0268264_10012206 | |||
| 1802 | Ga0268264_10018091 | |||
| 1803 | Ga0268264_10093930 | |||
| 1804 | Ga0268264_10160122 | |||
| 1805 | Ga0268264_10169504 | |||
| 1806 | Ga0268264_10212417 | |||
| 1807 | Ga0268264_10290764 | |||
| 1808 | Ga0268264_10362809 | |||
| 1809 | Ga0268264_10471255 | |||
| 1810 | Ga0307517_10000268 | |||
| 1811 | Ga0307517_10134171 | |||
| 1812 | Ga0265324_10014663 | |||
| 1813 | Ga0307511_10000076 | |||
| 1814 | Ga0307509_10218304 | |||
| 1815 | Ga0307408_100409350 | |||
| 1816 | Ga0307516_10353469 | |||
| 1817 | Ga0307405_10469345 | |||
| 1818 | Ga0307410_10076275 | |||
| 1819 | Ga0307410_10399607 | |||
| 1820 | Ga0307406_10265547 | |||
| 1821 | Ga0307416_100765350 | |||
| 1822 | Ga0307414_10155668 | |||
| 1823 | Ga0307414_10507231 | |||
| 1824 | Ga0307414_10876378 | |||
| 1825 | Ga0307510_10001791 | |||
| 1826 | Ga0373934_0088553 | |||
| 1827 | Ga0373936_0127699 | |||
| 1828 | Ga0373943_0067354 | |||
| 1829 | Ga0373924_0081716 | |||
| 1830 | Ga0373935_0084399 | |||
| 1831 | Ga0373935_0567782 | |||
| 1832 | Ga0373933_0386141 | |||
| 1833 | Ga0373947_0656145 | |||
| 1834 | Ga0395900_0086331 | |||
| 1835 | Ga0395900_0108156 | |||
| 1836 | Ga0395905_0007118 | |||
| 1837 | Ga0395901_0364220 | |||
| 1838 | Ga0436365_1871658 | |||
| 1839 | Ga0439465_0049696 | |||
| 1840 | Ga0439431_0012671 | |||
| 1841 | Ga0439431_0043338 | |||
| 1842 | Ga0439442_036545 | |||
| 1843 | Ga0439449_0007877 | |||
| 1844 | Ga0439462_0070206 | |||
| 1845 | Ga0450923_028531 | |||
| 1846 | Ga0450896_029285 | |||
| 1847 | Ga0450898_001962 | |||
| 1848 | Ga0450899_004449 | |||
| 1849 | Ga0439434_0035935 | |||
| 1850 | Ga0451577_0012952 | |||
| 1851 | Ga0451577_0145235 | |||
| 1852 | Ga0466972_0001452 | |||
| 1853 | Ga0466972_0062913 | |||
| 1854 | Ga0453683_0254115 | |||
| 1855 | Ga0466965_0079722 | |||
| 1856 | Ga0466966_0000015 | |||
| 1857 | Ga0466964_0058135 | |||
| 1858 | Ga0453684_0062563 | |||
| 1859 | Ga0453684_0134027 | |||
| 1860 | Ga0453684_0297820 | |||
| 1861 | Ga0453684_0550104 | |||
| 1862 | Ga0453684_0699024 | |||
| 1863 | Ga0466968_0018459 | |||
| 1864 | Ga0466970_0012769 | |||
| 1865 | Ga0466970_0048566 | |||
| 1866 | Ga0466957_0066710 | |||
| 1867 | Ga0466959_0000030 | |||
| 1868 | Ga0466959_0016186 | |||
| 1869 | Ga0466959_0035316 | |||
| 1870 | Ga0451576_0235849 | |||
| 1871 | Ga0466958_0050233 | |||
| 1872 | Ga0495603_0442249 | |||
| 1873 | Ga0495650_0129811 | |||
| 1874 | Ga0495582_0354770 | |||
| 1875 | Ga0495594_0022461 | |||
| 1876 | Ga0495606_0023076 | |||
| 1877 | Ga0495643_0041211 | |||
| 1878 | Ga0495633_0000036 | |||
| 1879 | Ga0495634_0071073 | |||
| 1880 | Ga0495611_0000215 | |||
| 1881 | Ga0495611_0188123 | |||
| 1882 | Ga0495625_0051193 | |||
| 1883 | Ga0495657_0178654 | |||
| 1884 | Ga0495649_0057325 | |||
| 1885 | Ga0495672_0085311 | |||
| 1886 | Ga0495687_000429 | |||
| 1887 | Ga0495684_0056004 | |||
| 1888 | Ga0495686_0000005 | |||
| 1889 | Ga0496101_0373677 | |||
| 1890 | Ga0496104_0572615 | |||
| 1891 | Ga0496110_0167800 | |||
| 1892 | Ga0496121_0000082 | |||
| 1893 | Ga0496126_0548457 | |||
| 1894 | Ga0501290_012573 | |||
| 1895 | Ga0501290_012778 | |||
| 1896 | Ga0501290_016113 | |||
| 1897 | Ga0501292_003376 | |||
| 1898 | Ga0501293_001922 | |||
| 1899 | Ga0501296_001139 | |||
| 1900 | Ga0501296_001461 | |||
| 1901 | Ga0501298_006493 | |||
| 1902 | Ga0501031_0021747 | |||
| 1903 | Ga0501032_0001908 | |||
| 1904 | Ga0501033_0148537 | |||
| 1905 | Ga0501033_0165547 | |||
| 1906 | Ga0501034_0002670 | |||
| 1907 | Ga0501034_0105205 | |||
| 1908 | Ga0501036_0005284 | |||
| 1909 | Ga0501036_0034800 | |||
| 1910 | Ga0501037_0019028 | |||
| 1911 | Ga0501037_0047331 | |||
| 1912 | Ga0501038_0029172 | |||
| 1913 | Ga0501038_0178935 | |||
| 1914 | Ga0501039_0269398 | |||
| 1915 | Ga0501040_0356475 | |||
| 1916 | Ga0501043_0006363 | |||
| 1917 | Ga0501043_0315340 | |||
| 1918 | Ga0501046_0009293 | |||
| 1919 | Ga0501048_0000884 | |||
| 1920 | Ga0501070_0003735 | |||
| 1921 | Ga0501072_0054714 | |||
| 1922 | Ga0501072_0064403 | |||
| 1923 | Ga0501073_0002238 | |||
| 1924 | Ga0501198_004001 | |||
| 1925 | Ga0501199_001228 | |||
| 1926 | Ga0501201_004280 | |||
| 1927 | Ga0501202_013518 | |||
| 1928 | Ga0501202_022773 | |||
| 1929 | Ga0501206_003906 | |||
| 1930 | Ga0501207_002206 | |||
| 1931 | Ga0501207_012585 | |||
| 1932 | Ga0501208_023192 | |||
| 1933 | Ga0501217_000732 | |||
| 1934 | Ga0501217_002135 | |||
| 1935 | Ga0501217_002809 | |||
| 1936 | Ga0501222_002695 | |||
| 1937 | Ga0501223_014943 | |||
| 1938 | Ga0501227_026664 | |||
| 1939 | Ga0501235_000607 | |||
| 1940 | Ga0501235_008309 | |||
| 1941 | Ga0501239_026478 | |||
| 1942 | Ga0501242_003136 | |||
| 1943 | Ga0501242_005678 | |||
| 1944 | Ga0501243_000309 | |||
| 1945 | Ga0501243_017204 | |||
| 1946 | Ga0501250_001258 | |||
| 1947 | Ga0501251_007325 | |||
| 1948 | Ga0501251_015790 | |||
| 1949 | Ga0501252_000860 | |||
| 1950 | Ga0501252_001699 | |||
| 1951 | Ga0501257_007503 | |||
| 1952 | Ga0501257_009781 | |||
| 1953 | Ga0501258_007068 | |||
| 1954 | Ga0501259_000337 | |||
| 1955 | Ga0501259_002718 | |||
| 1956 | Ga0501259_004027 | |||
| 1957 | Ga0501261_002085 | |||
| 1958 | Ga0501221_007138 | |||
| 1959 | Ga0501221_012654 | |||
| 1960 | Ga0501225_0037643 | |||
| 1961 | Ga0501234_003971 | |||
| 1962 | Ga0501234_029389 | |||
| 1963 | Ga0501245_001061 | |||
| 1964 | Ga0501245_001715 | |||
| 1965 | Ga0501245_021526 | |||
| 1966 | Ga0501080_0007927 | |||
| 1967 | Ga0501241_000612 | |||
| 1968 | Ga0501268_000938 | |||
| 1969 | Ga0501268_002093 | |||
| 1970 | Ga0501270_008108 | |||
| 1971 | Ga0501271_001812 | |||
| 1972 | Ga0501279_002027 | |||
| 1973 | Ga0501280_028199 | |||
| 1974 | Ga0501035_0003312 | |||
| 1975 | Ga0501044_0014451 | |||
| 1976 | Ga0501044_0035989 | |||
| 1977 | Ga0501044_0171508 | |||
| 1978 | Ga0501204_015306 | |||
| 1979 | nmdc:mga07m45_76123_c1 | |||
| 1980 | nmdc:mga05p37_746139_c1 | |||
| 1981 | nmdc:mga09592_31144_c1 | |||
| 1982 | nmdc:mga0qj67_260418_c1 | |||
| 1983 | nmdc:mga06r32_79393_c1 | |||
| 1984 | nmdc:mga08y16_144811_c1 | |||
| 1985 | nmdc:mga08y16_890566_c1 | |||
| 1986 | nmdc:mga0n895_14080_c1 | |||
| 1987 | Ga0500644_0000403 | |||
| 1988 | Ga0500646_0001212 | |||
| 1989 | Ga0500583_0002840 | |||
| 1990 | Ga0500583_0003678 | |||
| 1991 | Ga0500651_0211237 | |||
| 1992 | Ga0500569_000388 | |||
| 1993 | Ga0500597_135470 | |||
| 1994 | Ga0500607_116542 | |||
| 1995 | Ga0500642_0003621 | |||
| 1996 | Ga0500652_027381 | |||
| 1997 | Ga0500658_0003607 | |||
| 1998 | Ga0500559_0093793 | |||
| 1999 | Ga0500568_0033011 | |||
| 2000 | Ga0500577_0002818 | |||
| 2001 | Ga0500588_0019572 | |||
| 2002 | Ga0500589_021250 | |||
| 2003 | Ga0500590_043338 | |||
| 2004 | Ga0500616_0105690 | |||
| 2005 | Ga0500622_0000085 | |||
| 2006 | Ga0500622_0001758 | |||
| 2007 | Ga0500633_0008215 | |||
| 2008 | Ga0500636_0081473 | |||
| 2009 | Ga0501084_0087064 | |||
| 2010 | Ga0501082_0111728 | |||
| 2011 | 2819575177 | |||
| 2012 | 2819677159 | |||
| 2013 | 2821141280 | |||
| 2014 | 2840678551 | |||
| 2015 | 2883071468 | |||
| 2016 | 2884797007 | |||
| 2017 | 2896086369 | |||
| 2018 | 2904471115 | |||
| 2019 | 2929239887 | |||
| 2020 | 2946014328 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ljc-assembly1.cif.gz_A | crystal structure of lon n-terminal domain. | 0.8379 | 1 | 198 |
| 7p6u-assembly1.cif.gz_C | lon protease from thermus thermophilus | 0.8375 | 3 | 198 |
| 7cay-assembly1.cif.gz_A | crystal structure of lon n-terminal domain protein from xanthomonas campestris | 0.8206 | 3 | 176 |
| 7p6u-assembly1.cif.gz_F | lon protease from thermus thermophilus | 0.8075 | 3 | 198 |
| 8d81-assembly1.cif.gz_B | cereblon~ddb1 bound to pomalidomide | 0.8029 | 2 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1K7N5_54_171_2.30.130.40 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like | 0.9246 | 2 | 106 | 2.30.130.40 |
| af_B4FM67_80_193_2.30.130.40 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like | 0.9159 | 1 | 106 | 2.30.130.40 |
| af_K7KDV3_6_113_2.30.130.40 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like | 0.897 | 5 | 95 | 2.30.130.40 |
| af_I1KCV7_279_380_2.30.130.40 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like | 0.8949 | 3 | 108 | 2.30.130.40 |
| af_A0A2R8PXH8_356_472_2.30.130.40 | Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like | 0.8937 | 5 | 106 | 2.30.130.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537JS05-F1-model_v4 | Peptidase S16 | 0.988 | 1 | 184 |
|
| AF-A0A537JS05-F1-model_v4 | Peptidase S16 | 0.9827 | 1 | 184 |
|
| AF-A0A3M1JAX0-F1-model_v4 | Peptidase | 0.9703 | 1 | 106 |
|
| AF-A0A537TLV3-F1-model_v4 | Lon N-terminal domain-containing protein | 0.9637 | 5 | 82 |
|
| AF-A0A537ZW03-F1-model_v4 | Lon N-terminal domain-containing protein | 0.9629 | 2 | 105 |
|