F488136

General Info

Members Datasets Scaffolds Average Seq Length
1011 618 2022 333

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100003617|Ga0068858_10000361717
Length 372
Sequence VTLLTNWCVESAHVVISINRFAAGTNATMDWMGHSRRWIALGIAIFSISFAAPTPASAQKISIGVLRLASSGAIFIAHDKGYFAAEGLETDIKPFTAAQQVPLAVTSGDVDFGVTGLTAGFFNLAGKGALKIIAAQSREEPAFHLVGYMVSNVAYERGFHSLQEFPGKRVGITTVGSTLEYSLGLLARKYRFDIKSVTLVPLQSLPNMAAAFKGGQVDAILAPANVARQLEADKAGRVLGWVGDETPWQLGALFTSPRMIETRRPVVGKFIRAYLRATADYNRAFNSKDAAGKLMKSPGYDELLAILAKWVQQPPERVAEALPFVDAGGRLNVGDIYEQVAFWQRQGQVDPSVDAKTILDLSWVAGHYNLPH

Samples

Sample ID Description Type Environment
1 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
74 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
75 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
76 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
102 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
103 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
104 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
111 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
170 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
171 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
172 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
173 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
179 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
180 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
181 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
182 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
183 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
186 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
187 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
206 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
232 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
233 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
234 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
235 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
282 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
296 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
305 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
335 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
336 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
343 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
344 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
350 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
351 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
352 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
355 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
356 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
357 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
358 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
359 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
360 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
361 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
362 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
363 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
364 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
365 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
366 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
370 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
371 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
372 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
373 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
374 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
375 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
376 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
377 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
378 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
379 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
380 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
381 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
382 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
383 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
384 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
385 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
386 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
387 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
388 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
389 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
390 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
391 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
392 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
393 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
394 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
395 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
396 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
397 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
398 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
399 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
400 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
401 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
402 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
403 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
404 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
405 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
406 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
407 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
408 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
409 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
410 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
411 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
412 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
413 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
414 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
415 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
416 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
417 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
418 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
419 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
420 2791355199
421 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
422 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
423 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
424 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
425 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
426 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
427 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
428 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
429 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
430 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
431 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
432 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
433 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
434 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
435 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
436 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
437 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
438 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
439 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
440 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
441 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
442 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
443 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
444 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
445 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
446 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
447 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
448 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
449 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
450 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
451 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
452 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
453 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
454 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
455 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
456 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
457 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
458 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
459 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
460 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
461 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
462 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
463 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
464 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
465 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
466 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
467 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
468 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
469 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
470 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
471 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
472 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
473 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
474 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
475 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
476 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
477 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
478 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
479 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
480 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
481 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
482 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
483 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
484 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
485 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
486 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
487 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
488 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
489 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
490 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
491 2904699407
492 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
493 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
494 2906610324
495 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
496 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
497 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
498 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
499 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
500 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
501 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
502 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
503 2922368715
504 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
505 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
506 2922425934
507 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
508 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
509 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
510 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
511 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
512 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
513 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
514 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
515 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
516 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
517 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
518 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
519 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
520 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
521 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
522 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
523 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
524 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
525 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
526 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
527 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
528 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
529 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
530 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
531 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
532 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
533 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
534 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
535 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
536 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
537 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
538 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
539 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
540 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
541 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
542 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
543 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
544 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
545 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
546 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
547 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
548 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
549 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
550 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
551 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
552 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
553 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
554 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
555 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
556 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
557 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
558 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
559 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
560 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
561 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
562 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
563 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
564 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
565 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
566 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
567 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
568 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
569 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
570 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
571 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
572 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
573 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
574 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
575 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
576 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
577 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
578 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
579 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
580 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
581 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
582 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
583 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
584 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
585 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
586 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
587 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
588 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
589 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
590 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
591 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
592 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
593 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
594 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
595 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
596 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
597 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
598 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
599 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
600 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
601 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
602 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
603 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
604 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
605 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
606 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
607 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
608 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
609 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
610 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
611 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
612 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
613 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
614 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
615 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
616 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
617 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
618 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.24
Metatranscriptomes 0.1
Isolates 22.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.59
Nodule 18.2
Rhizoplane 5.04
Rhizosphere 53.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068858_100003617 3300005842 Bacteria 15292
2 JGI25406J46586_10000548 3300003203 Bacteria 17633
3 JGI25406J46586_10003583 3300003203 Bacteria 7282
4 JGI25153J46596_10008332 3300003215 Bacteria 4972
5 JGI25153J46596_10013566 3300003215 Bacteria 3436
6 JGI25160J50197_1001957 3300003354 Bacteria 9824
7 JGI25160J50197_1014546 3300003354 Bacteria 2628
8 JGI25404J52841_10012584 3300003659 Bacteria 1834
9 Ga0055539_1001606 3300003752 Bacteria 4074
10 Ga0055542_1004373 3300003762 Bacteria 3456
11 Ga0055531_10011060 3300003794 Bacteria 4404
12 Ga0055543_1013159 3300004625 Bacteria 1643
13 Ga0065165_1001520 3300005262 Bacteria 24424
14 Ga0065165_1001837 3300005262 Bacteria 20724
15 Ga0065704_10018294 3300005289 Bacteria 1584
16 Ga0070658_10092036 3300005327 Bacteria 2500
17 Ga0070676_10202550 3300005328 Bacteria 1302
18 Ga0070683_100160581 3300005329 Bacteria 2132
19 Ga0070680_100103205 3300005336 Bacteria 2369
20 Ga0070680_100198741 3300005336 Bacteria 1690
21 Ga0070680_100333307 3300005336 Bacteria 1289
22 Ga0070682_100075032 3300005337 Bacteria 2174
23 Ga0068868_100161319 3300005338 Bacteria 1852
24 Ga0068868_100202384 3300005338 Bacteria 1656
25 Ga0070689_100174967 3300005340 Bacteria 1740
26 Ga0070661_100120056 3300005344 Bacteria 1969
27 Ga0070661_100255036 3300005344 Bacteria 1355
28 Ga0070669_100181263 3300005353 Bacteria 1648
29 Ga0070671_100000510 3300005355 Bacteria 27158
30 Ga0070671_100081793 3300005355 Bacteria 2700
31 Ga0070674_100077749 3300005356 Bacteria 2363
32 Ga0070659_100010343 3300005366 Bacteria 6862
33 Ga0070659_100394996 3300005366 Bacteria 1167
34 Ga0070667_100004404 3300005367 Bacteria 11873
35 Ga0070709_10000581 3300005434 Bacteria 21399
36 Ga0070709_10002279 3300005434 Bacteria 10406
37 Ga0070709_10252281 3300005434 Bacteria 1272
38 Ga0070714_100044686 3300005435 Bacteria 3751
39 Ga0070714_100122560 3300005435 Bacteria 2314
40 Ga0070713_100054076 3300005436 Bacteria 3329
41 Ga0070713_100060562 3300005436 Bacteria 3164
42 Ga0070713_100076313 3300005436 Bacteria 2846
43 Ga0070713_100126906 3300005436 Bacteria 2245
44 Ga0070713_100194139 3300005436 Bacteria 1831
45 Ga0070710_10000569 3300005437 Bacteria 17506
46 Ga0070710_10041821 3300005437 Bacteria 2532
47 Ga0070710_10181296 3300005437 Bacteria 1319
48 Ga0070711_100014888 3300005439 Bacteria 4913
49 Ga0070711_100017698 3300005439 Bacteria 4540
50 Ga0070711_100017955 3300005439 Bacteria 4510
51 Ga0070700_100082445 3300005441 Bacteria 2080
52 Ga0070663_100009437 3300005455 Bacteria 6041
53 Ga0070663_100124336 3300005455 Bacteria 1952
54 Ga0070663_100133977 3300005455 Bacteria 1885
55 Ga0070678_100085020 3300005456 Bacteria 2410
56 Ga0070678_100213781 3300005456 Bacteria 1599
57 Ga0070662_100172749 3300005457 Bacteria 1698
58 Ga0070681_10009764 3300005458 Bacteria 9444
59 Ga0070681_10010624 3300005458 Bacteria 9099
60 Ga0070681_10072420 3300005458 Bacteria 3409
61 Ga0070681_10194601 3300005458 Bacteria 1947
62 Ga0070685_10103007 3300005466 Bacteria 1746
63 Ga0070698_100023342 3300005471 Bacteria 6466
64 Ga0070698_100257979 3300005471 Bacteria 1675
65 Ga0070679_100090365 3300005530 Bacteria 3050
66 Ga0070679_100335768 3300005530 Bacteria 1459
67 Ga0070679_100488369 3300005530 Bacteria 1176
68 Ga0070684_100008775 3300005535 Bacteria 7926
69 Ga0070684_100013449 3300005535 Bacteria 6599
70 Ga0070684_100077390 3300005535 Bacteria 2937
71 Ga0070684_100087323 3300005535 Bacteria 2769
72 Ga0070697_100350069 3300005536 Bacteria 1276
73 Ga0068853_100377911 3300005539 Bacteria 1323
74 Ga0068853_100514941 3300005539 Bacteria 1130
75 Ga0070672_100101973 3300005543 Bacteria 2329
76 Ga0070665_100004959 3300005548 Bacteria 13802
77 Ga0070665_100020484 3300005548 Bacteria 6641
78 Ga0070665_100244323 3300005548 Bacteria 1795
79 Ga0068855_100038282 3300005563 Bacteria 5698
80 Ga0068855_100052781 3300005563 Bacteria 4785
81 Ga0068855_100104294 3300005563 Bacteria 3262
82 Ga0068855_100172793 3300005563 Bacteria 2446
83 Ga0068857_100078760 3300005577 Bacteria 2942
84 Ga0068856_100002546 3300005614 Bacteria 18781
85 Ga0068856_100159913 3300005614 Bacteria 2263
86 Ga0070702_100061453 3300005615 Bacteria 2187
87 Ga0070702_100289741 3300005615 Bacteria 1128
88 Ga0068852_100043069 3300005616 Bacteria 3826
89 Ga0068852_100045537 3300005616 Bacteria 3732
90 Ga0068852_100306508 3300005616 Bacteria 1539
91 Ga0068852_100373982 3300005616 Bacteria 1396
92 Ga0068859_100000676 3300005617 Bacteria 34199
93 Ga0068859_100144065 3300005617 Bacteria 2457
94 Ga0068859_100192186 3300005617 Bacteria 2125
95 Ga0068864_100040896 3300005618 Bacteria 3964
96 Ga0068864_100196823 3300005618 Bacteria 1850
97 Ga0068864_100343086 3300005618 Bacteria 1408
98 Ga0068861_100042845 3300005719 Bacteria 3394
99 Ga0068861_100100193 3300005719 Bacteria 2302
100 Ga0068851_10045383 3300005834 Bacteria 2221
101 Ga0068863_100016729 3300005841 Bacteria 7037
102 Ga0068863_100279801 3300005841 Bacteria 1616
103 Ga0068858_100089775 3300005842 Bacteria 2859
104 Ga0068858_100137112 3300005842 Bacteria 2296
105 Ga0068858_100234429 3300005842 Bacteria 1740
106 Ga0068860_100001435 3300005843 Bacteria 25809
107 Ga0068860_100002832 3300005843 Bacteria 18040
108 Ga0068862_100298913 3300005844 Bacteria 1480
109 Ga0068862_100350529 3300005844 Bacteria 1369
110 Ga0081455_10002643 3300005937 Bacteria 21231
111 Ga0081455_10002851 3300005937 Bacteria 20364
112 Ga0081455_10020647 3300005937 Bacteria 6195
113 Ga0081455_10052489 3300005937 Bacteria 3490
114 Ga0081538_10064663 3300005981 Bacteria 2067
115 Ga0081540_1000646 3300005983 Bacteria 33092
116 Ga0081540_1004144 3300005983 Bacteria 11179
117 Ga0081540_1007740 3300005983 Bacteria 7609
118 Ga0081540_1008977 3300005983 Bacteria 6916
119 Ga0081540_1009756 3300005983 Bacteria 6579
120 Ga0081540_1016677 3300005983 Bacteria 4583
121 Ga0081540_1018543 3300005983 Bacteria 4263
122 Ga0081539_10000576 3300005985 Bacteria 75490
123 Ga0081539_10003823 3300005985 Bacteria 17700
124 Ga0081539_10132693 3300005985 Bacteria 1221
125 Ga0070717_10006202 3300006028 Bacteria 8779
126 Ga0070717_10006982 3300006028 Bacteria 8352
127 Ga0075365_10041285 3300006038 Bacteria 3013
128 Ga0075368_10008050 3300006042 Bacteria 3740
129 Ga0075363_100008168 3300006048 Bacteria 4860
130 Ga0075363_100063283 3300006048 Bacteria 1996
131 Ga0070716_100008960 3300006173 Bacteria 4977
132 Ga0070712_100004420 3300006175 Bacteria 8669
133 Ga0070712_100043145 3300006175 Bacteria 3104
134 Ga0070712_100092345 3300006175 Bacteria 2220
135 Ga0075367_10018187 3300006178 Bacteria 3873
136 Ga0075367_10076155 3300006178 Bacteria 2024
137 Ga0075369_10020147 3300006186 Bacteria 2730
138 Ga0075366_10034492 3300006195 Bacteria 2980
139 Ga0075366_10107685 3300006195 Bacteria 1676
140 Ga0097621_100322051 3300006237 Bacteria 1369
141 Ga0075370_10002485 3300006353 Bacteria 8548
142 Ga0075370_10174144 3300006353 Bacteria 1265
143 Ga0075434_100333287 3300006871 Bacteria 1538
144 Ga0068865_100112439 3300006881 Bacteria 2011
145 Ga0068865_100177784 3300006881 Bacteria 1637
146 Ga0097620_100000676 3300006931 Bacteria 34199
147 Ga0097620_100144054 3300006931 Bacteria 2457
148 Ga0097620_100192187 3300006931 Bacteria 2125
149 Ga0099825_1026767 3300006941 Bacteria 3026
150 Ga0099825_1042611 3300006941 Bacteria 1249
151 Ga0099824_1003639 3300006942 Bacteria 22511
152 Ga0099824_1013442 3300006942 Bacteria 8494
153 Ga0099822_1005846 3300006943 Bacteria 16076
154 Ga0099823_1043458 3300006944 Bacteria 3097
155 Ga0105240_10002557 3300009093 Bacteria 29181
156 Ga0105240_10047134 3300009093 Bacteria 5455
157 Ga0105240_10094405 3300009093 Bacteria 3649
158 Ga0105240_10256509 3300009093 Bacteria 2019
159 Ga0105245_10008064 3300009098 Bacteria 9207
160 Ga0105245_10155069 3300009098 Bacteria 2169
161 Ga0105247_10000055 3300009101 Bacteria 134197
162 Ga0105247_10063033 3300009101 Bacteria 2301
163 Ga0105243_10079228 3300009148 Bacteria 2677
164 Ga0105241_10060895 3300009174 Bacteria 2905
165 Ga0105242_10056892 3300009176 Bacteria 3201
166 Ga0105248_10028531 3300009177 Bacteria 6218
167 Ga0105237_10004764 3300009545 Bacteria 15596
168 Ga0105237_10044470 3300009545 Bacteria 4471
169 Ga0105237_10179172 3300009545 Bacteria 2120
170 Ga0105237_10338466 3300009545 Bacteria 1509
171 Ga0105238_10037432 3300009551 Bacteria 4932
172 Ga0105238_10085617 3300009551 Bacteria 3140
173 Ga0105238_10089007 3300009551 Bacteria 3074
174 Ga0105238_10236535 3300009551 Bacteria 1804
175 Ga0105238_10381605 3300009551 Bacteria 1401
176 Ga0105238_10462382 3300009551 Bacteria 1267
177 Ga0105249_10569321 3300009553 Bacteria 1185
178 Ga0105239_10039403 3300010375 Bacteria 5177
179 Ga0105239_10225258 3300010375 Bacteria 2103
180 Ga0105239_10253220 3300010375 Bacteria 1978
181 Ga0105246_10012468 3300011119 Bacteria 5306
182 Ga0157370_10022255 3300013104 Bacteria 6308
183 Ga0157370_10150012 3300013104 Bacteria 2170
184 Ga0157370_10225807 3300013104 Bacteria 1733
185 Ga0157369_10004728 3300013105 Bacteria 16002
186 Ga0157369_10011987 3300013105 Bacteria 9845
187 Ga0157369_10169083 3300013105 Bacteria 2304
188 Ga0157374_10012741 3300013296 Bacteria 7327
189 Ga0157374_10109585 3300013296 Bacteria 2654
190 Ga0157374_10300406 3300013296 Bacteria 1588
191 Ga0157378_10002185 3300013297 Bacteria 17349
192 Ga0163162_10051472 3300013306 Bacteria 4133
193 Ga0163162_10299568 3300013306 Bacteria 1740
194 Ga0157372_10064671 3300013307 Bacteria 4104
195 Ga0157372_10256767 3300013307 Bacteria 2029
196 Ga0157375_10019941 3300013308 Bacteria 6113
197 Ga0157375_10373484 3300013308 Bacteria 1592
198 Ga0163163_10005391 3300014325 Bacteria 11053
199 Ga0163163_10050740 3300014325 Bacteria 4087
200 Ga0163163_10059990 3300014325 Bacteria 3765
201 Ga0163163_10083965 3300014325 Bacteria 3190
202 Ga0157380_10010462 3300014326 Bacteria 6675
203 Ga0157380_10295094 3300014326 Bacteria 1490
204 Ga0157379_10005640 3300014968 Bacteria 10750
205 Ga0157379_10146276 3300014968 Bacteria 2131
206 Ga0157379_10537464 3300014968 Bacteria 1086
207 Ga0157376_10248902 3300014969 Bacteria 1659
208 Ga0163161_10188331 3300017792 Bacteria 1585
209 Ga0214544_1000007 3300021320 Bacteria 379989
210 Ga0214542_1000216 3300021321 Bacteria 92614
211 Ga0214545_1000118 3300021324 Bacteria 92737
212 Ga0214543_1000009 3300021327 Bacteria 384302
213 Ga0213876_10014311 3300021384 Bacteria 4206
214 Ga0213876_10049175 3300021384 Bacteria 2227
215 Ga0213876_10056438 3300021384 Bacteria 2073
216 Ga0213875_10000457 3300021388 Bacteria 35351
217 Ga0213875_10000613 3300021388 Bacteria 28847
218 Ga0213871_10021612 3300021441 Bacteria 1605
219 Ga0209677_100366 3300025253 Bacteria 27688
220 Ga0209677_107225 3300025253 Bacteria 2414
221 Ga0209148_1000469 3300025254 Bacteria 43128
222 Ga0209233_1000950 3300025261 Bacteria 12573
223 Ga0209233_1001192 3300025261 Bacteria 10495
224 Ga0209233_1005688 3300025261 Bacteria 4112
225 Ga0209233_1024362 3300025261 Bacteria 1515
226 Ga0209233_1027503 3300025261 Bacteria 1376
227 Ga0209455_1005585 3300025272 Bacteria 3859
228 Ga0209455_1005599 3300025272 Bacteria 3852
229 Ga0209455_1010645 3300025272 Bacteria 2324
230 Ga0209564_1007728 3300025295 Bacteria 5473
231 Ga0209758_1000030 3300025297 Bacteria 509217
232 Ga0209758_1001206 3300025297 Bacteria 32536
233 Ga0209758_1001554 3300025297 Bacteria 26349
234 Ga0209758_1002805 3300025297 Bacteria 17001
235 Ga0209758_1008529 3300025297 Bacteria 6607
236 Ga0209758_1012174 3300025297 Bacteria 4852
237 Ga0209758_1020626 3300025297 Bacteria 3107
238 Ga0209758_1023996 3300025297 Bacteria 2734
239 Ga0209758_1044361 3300025297 Bacteria 1626
240 Ga0209256_1004511 3300025299 Bacteria 8692
241 Ga0207426_1000347 3300025302 Bacteria 85420
242 Ga0207426_1000974 3300025302 Bacteria 28258
243 Ga0207426_1038325 3300025302 Bacteria 1510
244 Ga0209051_1027300 3300025303 Bacteria 2277
245 Ga0209257_1004181 3300025304 Bacteria 11452
246 Ga0207642_10068074 3300025899 Bacteria 1683
247 Ga0207710_10025614 3300025900 Bacteria 2546
248 Ga0207688_10017848 3300025901 Bacteria 3861
249 Ga0207647_10001188 3300025904 Bacteria 20058
250 Ga0207699_10009181 3300025906 Bacteria 4913
251 Ga0207699_10027819 3300025906 Bacteria 3135
252 Ga0207699_10049850 3300025906 Bacteria 2466
253 Ga0207699_10269321 3300025906 Bacteria 1180
254 Ga0207705_10062355 3300025909 Bacteria 2693
255 Ga0207705_10130441 3300025909 Bacteria 1870
256 Ga0207684_10055845 3300025910 Bacteria 3349
257 Ga0207654_10026029 3300025911 Bacteria 3164
258 Ga0207654_10055014 3300025911 Bacteria 2302
259 Ga0207707_10001124 3300025912 Bacteria 25352
260 Ga0207707_10064060 3300025912 Bacteria 3199
261 Ga0207707_10150549 3300025912 Bacteria 2034
262 Ga0207695_10000006 3300025913 Bacteria 1135309
263 Ga0207695_10013052 3300025913 Bacteria 9920
264 Ga0207695_10390843 3300025913 Bacteria 1276
265 Ga0207671_10004983 3300025914 Bacteria 12436
266 Ga0207693_10007439 3300025915 Bacteria 9006
267 Ga0207693_10054527 3300025915 Bacteria 3135
268 Ga0207693_10068197 3300025915 Bacteria 2784
269 Ga0207693_10127179 3300025915 Bacteria 2003
270 Ga0207663_10009355 3300025916 Bacteria 5172
271 Ga0207663_10025851 3300025916 Bacteria 3401
272 Ga0207663_10028280 3300025916 Bacteria 3280
273 Ga0207663_10288798 3300025916 Bacteria 1221
274 Ga0207660_10128214 3300025917 Bacteria 1929
275 Ga0207660_10172246 3300025917 Bacteria 1676
276 Ga0207662_10283029 3300025918 Bacteria 1098
277 Ga0207657_10004978 3300025919 Bacteria 13980
278 Ga0207657_10113718 3300025919 Bacteria 2233
279 Ga0207657_10143129 3300025919 Bacteria 1952
280 Ga0207649_10139476 3300025920 Bacteria 1657
281 Ga0207652_10029817 3300025921 Bacteria 4565
282 Ga0207652_10090895 3300025921 Bacteria 2683
283 Ga0207646_10186025 3300025922 Bacteria 1876
284 Ga0207694_10102885 3300025924 Bacteria 2265
285 Ga0207694_10161521 3300025924 Bacteria 1810
286 Ga0207650_10179333 3300025925 Bacteria 1687
287 Ga0207687_10017867 3300025927 Bacteria 4680
288 Ga0207687_10024534 3300025927 Bacteria 4030
289 Ga0207700_10069572 3300025928 Bacteria 2702
290 Ga0207700_10144476 3300025928 Bacteria 1959
291 Ga0207664_10098835 3300025929 Bacteria 2407
292 Ga0207690_10113899 3300025932 Bacteria 1952
293 Ga0207706_10052774 3300025933 Bacteria 3589
294 Ga0207706_10125580 3300025933 Bacteria 2257
295 Ga0207709_10012502 3300025935 Bacteria 4675
296 Ga0207709_10139183 3300025935 Bacteria 1666
297 Ga0207670_10148375 3300025936 Bacteria 1737
298 Ga0207669_10026988 3300025937 Bacteria 3134
299 Ga0207704_10109749 3300025938 Bacteria 1862
300 Ga0207665_10089443 3300025939 Bacteria 2133
301 Ga0207665_10118519 3300025939 Bacteria 1868
302 Ga0207691_10049962 3300025940 Bacteria 3830
303 Ga0207691_10055366 3300025940 Bacteria 3615
304 Ga0207711_10059367 3300025941 Bacteria 3293
305 Ga0207711_10352818 3300025941 Bacteria 1362
306 Ga0207689_10202851 3300025942 Bacteria 1637
307 Ga0207661_10001102 3300025944 Bacteria 17966
308 Ga0207661_10120765 3300025944 Bacteria 2230
309 Ga0207661_10429271 3300025944 Bacteria 1201
310 Ga0207667_10017132 3300025949 Bacteria 8168
311 Ga0207667_10315680 3300025949 Bacteria 1596
312 Ga0207667_10323380 3300025949 Bacteria 1575
313 Ga0207712_10057494 3300025961 Bacteria 2744
314 Ga0207668_10029144 3300025972 Bacteria 3615
315 Ga0207658_10231546 3300025986 Bacteria 1560
316 Ga0207677_10019542 3300026023 Bacteria 4093
317 Ga0207703_10009552 3300026035 Bacteria 7615
318 Ga0207703_10082845 3300026035 Bacteria 2678
319 Ga0207703_10093732 3300026035 Bacteria 2529
320 Ga0207639_10203190 3300026041 Bacteria 1701
321 Ga0207678_10004793 3300026067 Bacteria 12144
322 Ga0207678_10057449 3300026067 Bacteria 3348
323 Ga0207678_10111355 3300026067 Bacteria 2335
324 Ga0207678_10270863 3300026067 Bacteria 1456
325 Ga0207708_10154923 3300026075 Bacteria 1806
326 Ga0207702_10002900 3300026078 Bacteria 16046
327 Ga0207702_10059738 3300026078 Bacteria 3248
328 Ga0207702_10110887 3300026078 Bacteria 2439
329 Ga0207702_10161187 3300026078 Bacteria 2048
330 Ga0207702_10221270 3300026078 Bacteria 1764
331 Ga0207641_10011233 3300026088 Bacteria 7347
332 Ga0207641_10401876 3300026088 Bacteria 1315
333 Ga0207676_10315532 3300026095 Bacteria 1433
334 Ga0207674_10139566 3300026116 Bacteria 2384
335 Ga0207675_100055473 3300026118 Bacteria 3696
336 Ga0207683_10007968 3300026121 Bacteria 9062
337 Ga0207683_10056583 3300026121 Bacteria 3441
338 Ga0207683_10398952 3300026121 Bacteria 1265
339 Ga0207698_10071370 3300026142 Bacteria 2755
340 Ga0207698_10084380 3300026142 Bacteria 2575
341 Ga0207698_10125169 3300026142 Bacteria 2184
342 Ga0209389_1000015 3300027296 Bacteria 188311
343 Ga0209389_1000035 3300027296 Bacteria 127089
344 Ga0209589_1000015 3300027357 Bacteria 225913
345 Ga0209589_1000039 3300027357 Bacteria 127084
346 Ga0209489_100015 3300027361 Bacteria 225913
347 Ga0209489_100072 3300027361 Bacteria 138111
348 Ga0209489_100084 3300027361 Bacteria 127094
349 Ga0209700_100025 3300027363 Bacteria 225913
350 Ga0209700_100034 3300027363 Bacteria 197276
351 Ga0209179_1001370 3300027512 Bacteria 2959
352 Ga0209588_1024253 3300027671 Bacteria 1915
353 Ga0268266_10000907 3300028379 Bacteria 38258
354 Ga0268266_10005299 3300028379 Bacteria 12099
355 Ga0268266_10449787 3300028379 Bacteria 1224
356 Ga0268265_10498500 3300028380 Bacteria 1147
357 Ga0268264_10000107 3300028381 Bacteria 209105
358 Ga0268264_10002035 3300028381 Bacteria 18084
359 Ga0265337_1020481 3300028556 Bacteria 2071
360 Ga0265326_10001639 3300028558 Bacteria 7750
361 Ga0265319_1002509 3300028563 Bacteria 9954
362 Ga0265323_10001801 3300028653 Bacteria 10176
363 Ga0265322_10007464 3300028654 Bacteria 3192
364 Ga0265336_10000139 3300028666 Bacteria 51277
365 Ga0307517_10000858 3300028786 Bacteria 51951
366 Ga0265338_10000155 3300028800 Bacteria 125121
367 Ga0265324_10000912 3300029957 Bacteria 18683
368 Ga0265330_10005758 3300031235 Bacteria 6149
369 Ga0265330_10037471 3300031235 Bacteria 2158
370 Ga0265330_10074637 3300031235 Bacteria 1465
371 Ga0265325_10007669 3300031241 Bacteria 6445
372 Ga0265340_10004964 3300031247 Bacteria 7395
373 Ga0265339_10063057 3300031249 Bacteria 1991
374 Ga0265331_10130855 3300031250 Bacteria 1145
375 Ga0265327_10006537 3300031251 Bacteria 9281
376 Ga0307513_10186027 3300031456 Bacteria 1934
377 Ga0307513_10272769 3300031456 Bacteria 1474
378 Ga0307509_10005533 3300031507 Bacteria 17526
379 Ga0307509_10171704 3300031507 Bacteria 2046
380 Ga0307508_10000088 3300031616 Bacteria 107883
381 Ga0307508_10115807 3300031616 Bacteria 2282
382 Ga0265314_10004147 3300031711 Bacteria 13641
383 Ga0265342_10031643 3300031712 Bacteria 3269
384 Ga0265342_10067537 3300031712 Bacteria 2092
385 Ga0307516_10040811 3300031730 Bacteria 4616
386 Ga0307516_10048253 3300031730 Bacteria 4190
387 Ga0307516_10103255 3300031730 Bacteria 2664
388 Ga0307516_10187769 3300031730 Bacteria 1795
389 Ga0307516_10377136 3300031730 Bacteria 1080
390 Ga0307405_10171977 3300031731 Bacteria 1546
391 Ga0307413_10034106 3300031824 Bacteria 2906
392 Ga0307416_100108072 3300032002 Bacteria 2443
393 Ga0307411_10093551 3300032005 Bacteria 2105
394 Ga0307507_10155096 3300033179 Bacteria 1710
395 Ga0307510_10006777 3300033180 Bacteria 13660
396 Ga0307510_10014688 3300033180 Bacteria 9268
397 Ga0307510_10047825 3300033180 Bacteria 4574
398 Ga0307510_10068453 3300033180 Bacteria 3562
399 Ga0307510_10077642 3300033180 Bacteria 3255
400 Ga0307510_10162270 3300033180 Bacteria 1829
401 Ga0307510_10201885 3300033180 Bacteria 1522
402 Ga0315911_1000047 3300033442 Bacteria 41134
403 Ga0316215_1001118 3300033544 Bacteria 2603
404 Ga0373923_0014180 3300035111 Bacteria 2988
405 Ga0373923_0014995 3300035111 Bacteria 2918
406 Ga0373923_0034469 3300035111 Bacteria 2055
407 Ga0373936_0003468 3300035113 Bacteria 5921
408 Ga0373945_0055682 3300035116 Bacteria 1465
409 Ga0373953_0001048 3300035117 Bacteria 7808
410 Ga0373953_0031595 3300035117 Bacteria 2060
411 Ga0373954_0001759 3300035118 Bacteria 8899
412 Ga0373954_0007594 3300035118 Bacteria 4747
413 Ga0373956_0027530 3300035119 Bacteria 2468
414 Ga0373956_0050553 3300035119 Bacteria 1866
415 Ga0373943_0015461 3300035170 Bacteria 3467
416 Ga0373943_0028663 3300035170 Bacteria 2625
417 Ga0373946_0013401 3300035171 Bacteria 3083
418 Ga0373955_0000261 3300035172 Bacteria 21966
419 Ga0373955_0011387 3300035172 Bacteria 4236
420 Ga0373955_0014419 3300035172 Bacteria 3844
421 Ga0373924_0002173 3300035410 Bacteria 6565
422 Ga0373924_0015188 3300035410 Bacteria 2922
423 Ga0373924_0046208 3300035410 Bacteria 1793
424 Ga0373931_0011768 3300035691 Bacteria 4229
425 Ga0373935_0000694 3300035692 Bacteria 17825
426 Ga0373927_0000136 3300035695 Bacteria 56656
427 Ga0373927_0008006 3300035695 Bacteria 7137
428 Ga0373927_0179818 3300035695 Bacteria 1387
429 Ga0373933_0000543 3300035724 Bacteria 23469
430 Ga0373933_0001973 3300035724 Bacteria 11819
431 Ga0373933_0013676 3300035724 Bacteria 4501
432 Ga0373933_0063456 3300035724 Bacteria 2233
433 Ga0373947_0000107 3300035725 Bacteria 41080
434 Ga0373947_0024166 3300035725 Bacteria 3539
435 Ga0373947_0086641 3300035725 Bacteria 1947
436 Ga0373937_0049792 3300036401 Bacteria 3836
437 Ga0373937_0115249 3300036401 Bacteria 2502
438 Ga0373937_0312680 3300036401 Bacteria 1486
439 Ga0373937_0488975 3300036401 Bacteria 1169
440 Ga0372808_010866 3300036459 Bacteria 1285
441 Ga0373925_0014694 3300037068 Bacteria 5656
442 Ga0373925_0064842 3300037068 Bacteria 2750
443 Ga0373925_0118112 3300037068 Bacteria 2056
444 Ga0373925_0188258 3300037068 Bacteria 1637
445 Ga0373925_0218089 3300037068 Bacteria 1522
446 Ga0395900_0000924 3300037418 Bacteria 38604
447 Ga0395900_0007634 3300037418 Bacteria 11167
448 Ga0395898_0014465 3300037466 Bacteria 8105
449 Ga0395898_0051073 3300037466 Bacteria 4044
450 Ga0395898_0419191 3300037466 Bacteria 1276
451 Ga0395905_0015435 3300037471 Bacteria 7262
452 Ga0395905_0019806 3300037471 Bacteria 6378
453 Ga0395905_0062229 3300037471 Bacteria 3491
454 Ga0436364_0355969 3300037853 Bacteria 1351
455 Ga0436364_0577546 3300037853 Bacteria 7563
456 Ga0436364_0668201 3300037853 Bacteria 105492
457 Ga0436364_0685371 3300037853 Bacteria 68284
458 Ga0395901_0013977 3300038443 Bacteria 8170
459 Ga0395901_0134521 3300038443 Bacteria 2598
460 Ga0436365_0205919 3300039437 Bacteria 7541
461 Ga0436365_0229124 3300039437 Bacteria 1220
462 Ga0436365_0611875 3300039437 Bacteria 1246
463 Ga0436365_1440720 3300039437 Bacteria 9021
464 Ga0436365_1722225 3300039437 Bacteria 1546
465 Ga0436365_1831713 3300039437 Bacteria 1828
466 Ga0436360_0157633 3300039438 Bacteria 3418
467 Ga0436360_1018630 3300039438 Bacteria 2211
468 Ga0436361_0763978 3300039447 Bacteria 3271
469 Ga0436363_1581175 3300039450 Bacteria 6123
470 Ga0436362_0921239 3300039453 Bacteria 2441
471 Ga0451800_1027174 3300041459 Bacteria 1035
472 Ga0466969_0004542 3300044656 Bacteria 7388
473 Ga0466972_0000048 3300044658 Bacteria 119165
474 Ga0466965_0011868 3300044683 Bacteria 4090
475 Ga0466966_0031573 3300044684 Bacteria 3434
476 Ga0466961_0000018 3300044693 Bacteria 109837
477 Ga0466957_0186341 3300044842 Bacteria 1357
478 Ga0466960_0017357 3300044901 Bacteria 3137
479 Ga0466960_0072533 3300044901 Bacteria 1716
480 Ga0466959_0005661 3300045049 Bacteria 8597
481 Ga0495592_0006131 3300046454 Bacteria 8940
482 Ga0495592_0013979 3300046454 Bacteria 6097
483 Ga0495592_0086327 3300046454 Bacteria 2260
484 Ga0495592_0181265 3300046454 Bacteria 1434
485 Ga0495603_0000019 3300046455 Bacteria 65316
486 Ga0495603_0022379 3300046455 Bacteria 3828
487 Ga0495603_0100621 3300046455 Bacteria 1687
488 Ga0495629_0000073 3300046459 Bacteria 87538
489 Ga0495629_0006116 3300046459 Bacteria 8939
490 Ga0495629_0006296 3300046459 Bacteria 8809
491 Ga0495629_0065452 3300046459 Bacteria 2537
492 Ga0495638_0002020 3300046460 Bacteria 17306
493 Ga0495638_0042634 3300046460 Bacteria 2865
494 Ga0495641_0027890 3300046461 Bacteria 2738
495 Ga0495651_0005880 3300046462 Bacteria 9357
496 Ga0495651_0017012 3300046462 Bacteria 5632
497 Ga0495651_0029795 3300046462 Bacteria 4255
498 Ga0495651_0043207 3300046462 Bacteria 3497
499 Ga0495653_0021180 3300046463 Bacteria 5268
500 Ga0495653_0063404 3300046463 Bacteria 2789
501 Ga0495650_0086025 3300046471 Bacteria 1204
502 Ga0495580_0000534 3300046472 Bacteria 32210
503 Ga0495580_0017187 3300046472 Bacteria 5414
504 Ga0495582_0000019 3300046473 Bacteria 91143
505 Ga0495582_0089932 3300046473 Bacteria 1711
506 Ga0495582_0120632 3300046473 Bacteria 1477
507 Ga0495605_0056151 3300046474 Bacteria 1900
508 Ga0495605_0098440 3300046474 Bacteria 1347
509 Ga0495639_0000088 3300046475 Bacteria 44334
510 Ga0495639_0027234 3300046475 Bacteria 2529
511 Ga0495662_0004712 3300046476 Bacteria 6831
512 Ga0495662_0062530 3300046476 Bacteria 1798
513 Ga0495664_0134412 3300046477 Bacteria 1498
514 Ga0495585_0064504 3300046492 Bacteria 2008
515 Ga0495585_0083830 3300046492 Bacteria 1724
516 Ga0495585_0124697 3300046492 Bacteria 1360
517 Ga0495594_0000742 3300046499 Bacteria 16762
518 Ga0495583_0096645 3300046506 Bacteria 1265
519 Ga0495606_0000234 3300046507 Bacteria 98166
520 Ga0495606_0077802 3300046507 Bacteria 2070
521 Ga0495608_0023813 3300046511 Bacteria 4190
522 Ga0495608_0056123 3300046511 Bacteria 2602
523 Ga0495610_0032296 3300046512 Bacteria 2721
524 Ga0495616_0016146 3300046513 Bacteria 4138
525 Ga0495618_0165117 3300046514 Bacteria 1410
526 Ga0495628_0013398 3300046516 Bacteria 6899
527 Ga0495628_0102133 3300046516 Bacteria 2212
528 Ga0495628_0123011 3300046516 Bacteria 1989
529 Ga0495630_0000212 3300046517 Bacteria 45914
530 Ga0495630_0130182 3300046517 Bacteria 1911
531 Ga0495632_0058889 3300046519 Bacteria 1870
532 Ga0495643_0008931 3300046522 Bacteria 6298
533 Ga0495643_0043913 3300046522 Bacteria 2430
534 Ga0495643_0106682 3300046522 Bacteria 1429
535 Ga0495648_0068727 3300046524 Bacteria 2065
536 Ga0495666_0030236 3300046526 Bacteria 2660
537 Ga0495652_0029385 3300046529 Bacteria 4829
538 Ga0495652_0033932 3300046529 Bacteria 4450
539 Ga0495652_0068076 3300046529 Bacteria 2983
540 Ga0495652_0169074 3300046529 Bacteria 1689
541 Ga0495652_0172559 3300046529 Bacteria 1667
542 Ga0495652_0200040 3300046529 Bacteria 1517
543 Ga0495665_0001847 3300046531 Bacteria 11443
544 Ga0495665_0044666 3300046531 Bacteria 2354
545 Ga0495665_0131695 3300046531 Bacteria 1309
546 Ga0495587_0002612 3300046536 Bacteria 12038
547 Ga0495587_0010267 3300046536 Bacteria 5968
548 Ga0495597_0009368 3300046542 Bacteria 4844
549 Ga0495645_0013519 3300046543 Bacteria 5774
550 Ga0495645_0015775 3300046543 Bacteria 5378
551 Ga0495645_0048517 3300046543 Bacteria 3092
552 Ga0495622_0081246 3300046557 Bacteria 1491
553 Ga0495633_0061132 3300046558 Bacteria 1764
554 Ga0495667_0002244 3300046559 Bacteria 12922
555 Ga0495667_0051721 3300046559 Bacteria 2709
556 Ga0495656_0027895 3300046615 Bacteria 2259
557 Ga0495656_0042783 3300046615 Bacteria 1898
558 Ga0495668_0140793 3300046616 Bacteria 1320
559 Ga0495634_0000606 3300046642 Bacteria 34706
560 Ga0495634_0017576 3300046642 Bacteria 5101
561 Ga0495634_0026522 3300046642 Bacteria 4042
562 Ga0495634_0031477 3300046642 Bacteria 3654
563 Ga0495625_0058033 3300046660 Bacteria 2750
564 Ga0495635_0006362 3300046663 Bacteria 8227
565 Ga0495635_0009473 3300046663 Bacteria 6804
566 Ga0495635_0037504 3300046663 Bacteria 3355
567 Ga0495635_0083606 3300046663 Bacteria 2184
568 Ga0495659_0033213 3300046664 Bacteria 1810
569 Ga0495588_0003823 3300046674 Bacteria 6597
570 Ga0495588_0008637 3300046674 Bacteria 4681
571 Ga0495588_0057484 3300046674 Bacteria 2009
572 Ga0495657_0006578 3300046675 Bacteria 9081
573 Ga0495657_0026637 3300046675 Bacteria 4092
574 Ga0495599_0043962 3300046678 Bacteria 2802
575 Ga0495599_0070540 3300046678 Bacteria 2181
576 Ga0495599_0178661 3300046678 Bacteria 1309
577 Ga0495623_0006059 3300046679 Bacteria 7860
578 Ga0495623_0008248 3300046679 Bacteria 6775
579 Ga0495623_0011132 3300046679 Bacteria 5821
580 Ga0495646_0007042 3300046680 Bacteria 7144
581 Ga0495646_0022278 3300046680 Bacteria 3997
582 Ga0495646_0031441 3300046680 Bacteria 3307
583 Ga0495646_0049206 3300046680 Bacteria 2559
584 Ga0495647_0000435 3300046681 Bacteria 11974
585 Ga0495647_0093873 3300046681 Bacteria 1234
586 Ga0495658_0000054 3300046683 Bacteria 57414
587 Ga0495613_0002573 3300046689 Bacteria 13649
588 Ga0495613_0020962 3300046689 Bacteria 4872
589 Ga0495624_0000796 3300046690 Bacteria 24913
590 Ga0495624_0006888 3300046690 Bacteria 8019
591 Ga0495670_0064014 3300046691 Bacteria 1852
592 Ga0495671_0069875 3300046692 Bacteria 1726
593 Ga0495649_0058967 3300046694 Bacteria 2067
594 Ga0495649_0108483 3300046694 Bacteria 1473
595 Ga0495600_0017697 3300046809 Bacteria 4535
596 Ga0495600_0018739 3300046809 Bacteria 4414
597 Ga0495600_0022598 3300046809 Bacteria 4039
598 Ga0495581_0001715 3300047315 Bacteria 12217
599 Ga0495581_0079523 3300047315 Bacteria 1897
600 Ga0495604_0000518 3300047317 Bacteria 33955
601 Ga0495604_0007957 3300047317 Bacteria 8398
602 Ga0495604_0030260 3300047317 Bacteria 4301
603 Ga0495604_0034572 3300047317 Bacteria 3997
604 Ga0495604_0101833 3300047317 Bacteria 2109
605 Ga0495674_0001338 3300047319 Bacteria 24025
606 Ga0495674_0017951 3300047319 Bacteria 6587
607 Ga0495674_0040218 3300047319 Bacteria 4183
608 Ga0495674_0046453 3300047319 Bacteria 3854
609 Ga0495674_0136897 3300047319 Bacteria 2060
610 Ga0495674_0153305 3300047319 Bacteria 1931
611 Ga0495676_0147132 3300047321 Bacteria 1681
612 Ga0495676_0174306 3300047321 Bacteria 1511
613 Ga0495680_0004596 3300047322 Bacteria 13159
614 Ga0495680_0021178 3300047322 Bacteria 5447
615 Ga0495680_0035489 3300047322 Bacteria 4016
616 Ga0495687_037415 3300047443 Bacteria 2162
617 Ga0495675_0005612 3300047444 Bacteria 7660
618 Ga0495675_0011843 3300047444 Bacteria 5481
619 Ga0495673_0077164 3300047469 Bacteria 1388
620 Ga0495684_0002876 3300047471 Bacteria 13551
621 Ga0495684_0015613 3300047471 Bacteria 5845
622 Ga0495684_0070253 3300047471 Bacteria 2662
623 Ga0495686_0123757 3300047472 Bacteria 1539
624 Ga0495593_0001244 3300047673 Bacteria 14923
625 Ga0495593_0004525 3300047673 Bacteria 8262
626 Ga0495593_0101008 3300047673 Bacteria 1479
627 Ga0495602_0002591 3300048088 Bacteria 18465
628 Ga0495602_0029185 3300048088 Bacteria 5261
629 Ga0495602_0066246 3300048088 Bacteria 3113
630 Ga0495602_0173927 3300048088 Bacteria 1668
631 Ga0495615_0023954 3300048090 Bacteria 1404
632 Ga0495626_0024808 3300048091 Bacteria 2936
633 Ga0496100_0124552 3300048903 Bacteria 1807
634 Ga0496101_0023781 3300048904 Bacteria 4236
635 Ga0496102_0033536 3300048905 Bacteria 4614
636 Ga0496102_0051772 3300048905 Bacteria 3740
637 Ga0496102_0085694 3300048905 Bacteria 2909
638 Ga0496103_0020084 3300048906 Bacteria 4011
639 Ga0496104_0006999 3300048907 Bacteria 9946
640 Ga0496104_0033682 3300048907 Bacteria 4774
641 Ga0496104_0112464 3300048907 Bacteria 2611
642 Ga0496105_0001000 3300048908 Bacteria 19533
643 Ga0496105_0013379 3300048908 Bacteria 6512
644 Ga0496105_0013779 3300048908 Bacteria 6420
645 Ga0496105_0033888 3300048908 Bacteria 4197
646 Ga0496106_0001189 3300048909 Bacteria 19412
647 Ga0496106_0003360 3300048909 Bacteria 11929
648 Ga0496106_0083915 3300048909 Bacteria 2451
649 Ga0496106_0168221 3300048909 Bacteria 1736
650 Ga0496107_0022933 3300048910 Bacteria 4413
651 Ga0496107_0043826 3300048910 Bacteria 3215
652 Ga0496107_0067250 3300048910 Bacteria 2600
653 Ga0496107_0158965 3300048910 Bacteria 1674
654 Ga0496108_0042296 3300048911 Bacteria 3803
655 Ga0496108_0068113 3300048911 Bacteria 3003
656 Ga0496108_0100324 3300048911 Bacteria 2469
657 Ga0496109_0076084 3300048912 Bacteria 3087
658 Ga0496109_0177099 3300048912 Bacteria 2002
659 Ga0496109_0189147 3300048912 Bacteria 1934
660 Ga0496109_0195441 3300048912 Bacteria 1901
661 Ga0496109_0196422 3300048912 Bacteria 1896
662 Ga0496110_0070821 3300048913 Bacteria 3090
663 Ga0496110_0103467 3300048913 Bacteria 2554
664 Ga0496110_0213539 3300048913 Bacteria 1754
665 Ga0496110_0278339 3300048913 Bacteria 1523
666 Ga0496110_0345340 3300048913 Bacteria 1356
667 Ga0496111_0263331 3300048914 Bacteria 1279
668 Ga0496112_0000051 3300048915 Bacteria 82351
669 Ga0496112_0048577 3300048915 Bacteria 4160
670 Ga0496112_0114501 3300048915 Bacteria 2667
671 Ga0496112_0128435 3300048915 Bacteria 2505
672 Ga0496112_0282910 3300048915 Bacteria 1605
673 Ga0496113_0015164 3300048916 Bacteria 5286
674 Ga0496113_0188378 3300048916 Bacteria 1637
675 Ga0496113_0190874 3300048916 Bacteria 1626
676 Ga0496114_0036038 3300048917 Bacteria 4088
677 Ga0496114_0076820 3300048917 Bacteria 2814
678 Ga0496114_0149347 3300048917 Bacteria 2027
679 Ga0496114_0233425 3300048917 Bacteria 1616
680 Ga0496115_0015706 3300048918 Bacteria 5749
681 Ga0496115_0220675 3300048918 Bacteria 1564
682 Ga0496117_0025696 3300048920 Bacteria 4623
683 Ga0496118_0005559 3300048921 Bacteria 14278
684 Ga0496118_0011676 3300048921 Bacteria 8541
685 Ga0496118_0044416 3300048921 Bacteria 3480
686 Ga0496118_0163369 3300048921 Bacteria 1373
687 Ga0496118_0170287 3300048921 Bacteria 1332
688 Ga0496119_0011296 3300048922 Bacteria 7418
689 Ga0496121_0000091 3300048924 Bacteria 216685
690 Ga0496121_0000191 3300048924 Bacteria 136529
691 Ga0496121_0005586 3300048924 Bacteria 16061
692 Ga0496121_0008326 3300048924 Bacteria 12251
693 Ga0496121_0013393 3300048924 Bacteria 8820
694 Ga0496121_0013944 3300048924 Bacteria 8588
695 Ga0496121_0094949 3300048924 Bacteria 2318
696 Ga0496121_0125434 3300048924 Bacteria 1931
697 Ga0496121_0153546 3300048924 Bacteria 1691
698 Ga0496121_0278161 3300048924 Bacteria 1146
699 Ga0496122_0045106 3300048925 Bacteria 3431
700 Ga0496124_0001506 3300048927 Bacteria 34022
701 Ga0496124_0065348 3300048927 Bacteria 3034
702 Ga0496124_0099882 3300048927 Bacteria 2353
703 Ga0496124_0177883 3300048927 Bacteria 1640
704 Ga0496125_0030389 3300048928 Bacteria 4834
705 Ga0496125_0077726 3300048928 Bacteria 2556
706 Ga0496125_0150968 3300048928 Bacteria 1596
707 Ga0496126_0005194 3300048929 Bacteria 15035
708 Ga0496126_0005651 3300048929 Bacteria 14206
709 Ga0496126_0024203 3300048929 Bacteria 5865
710 Ga0496126_0049321 3300048929 Bacteria 3844
711 Ga0496126_0050367 3300048929 Bacteria 3796
712 Ga0496126_0064494 3300048929 Bacteria 3281
713 Ga0496126_0208362 3300048929 Bacteria 1647
714 Ga0496126_0231297 3300048929 Bacteria 1549
715 Ga0496126_0236588 3300048929 Bacteria 1528
716 Ga0501038_0223473 3300049574 Bacteria 1501
717 Ga0501046_0106490 3300049580 Bacteria 2146
718 Ga0501047_0086376 3300049581 Bacteria 3014
719 Ga0501074_0018445 3300049590 Bacteria 5069
720 Ga0501080_0011301 3300049742 Bacteria 8171
721 nmdc:mga03n38_130_c1 3300050490 Bacteria 16353
722 nmdc:mga00v17_10385_c1 3300050491 Bacteria 5081
723 nmdc:mga0yw44_101209_c1 3300050492 Bacteria 1836
724 nmdc:mga0yw44_62466_c1 3300050492 Bacteria 2288
725 nmdc:mga06z11_2230_c1 3300050494 Bacteria 7372
726 nmdc:mga07m45_11199_c1 3300050496 Bacteria 4708
727 nmdc:mga07m45_9052_c1 3300050496 Bacteria 5144
728 nmdc:mga05p37_26610_c1 3300050507 Bacteria 7034
729 nmdc:mga0n895_219154_c1 3300050512 Bacteria 1932
730 nmdc:mga0sz30_15752_c2 3300050516 Bacteria 2662
731 Ga0495601_0022764 3300053077 Bacteria 3850
732 Ga0495601_0131308 3300053077 Bacteria 1631
733 Ga0495612_0020706 3300053078 Bacteria 2636
734 Ga0495595_0001889 3300053084 Bacteria 8139
735 Ga0495619_0001865 3300053085 Bacteria 14038
736 Ga0500643_000328 3300053087 Bacteria 38149
737 Ga0500647_0007313 3300053091 Bacteria 4736
738 Ga0500566_0000531 3300053094 Bacteria 21399
739 Ga0500566_0033886 3300053094 Bacteria 2973
740 Ga0500566_0055757 3300053094 Bacteria 2249
741 Ga0500641_0029704 3300053096 Bacteria 2143
742 Ga0500650_0028277 3300053098 Bacteria 2530
743 Ga0500554_034680 3300053102 Bacteria 1512
744 Ga0500555_027880 3300053103 Bacteria 1610
745 Ga0500556_0006255 3300053104 Bacteria 3374
746 Ga0500557_000019 3300053105 Bacteria 93216
747 Ga0500569_001790 3300053109 Bacteria 4118
748 Ga0500572_001208 3300053111 Bacteria 7358
749 Ga0500595_000336 3300053119 Bacteria 30876
750 Ga0500595_001036 3300053119 Bacteria 15514
751 Ga0500595_036817 3300053119 Bacteria 1600
752 Ga0500595_044363 3300053119 Bacteria 1409
753 Ga0500642_0000064 3300053130 Bacteria 58285
754 Ga0500559_0001974 3300053136 Bacteria 11058
755 Ga0500559_0018775 3300053136 Bacteria 2920
756 Ga0500559_0112782 3300053136 Bacteria 1260
757 Ga0500568_0007471 3300053139 Bacteria 5358
758 Ga0500568_0079711 3300053139 Bacteria 1244
759 Ga0500573_0026238 3300053140 Bacteria 3348
760 Ga0500589_067930 3300053147 Bacteria 1619
761 Ga0500603_000333 3300053150 Bacteria 12339
762 Ga0500603_014852 3300053150 Bacteria 1824
763 Ga0500622_0131933 3300053156 Bacteria 1200
764 Ga0500627_0096964 3300053158 Bacteria 1322
765 Ga0500630_111368 3300053159 Bacteria 1229
766 Ga0500633_0088927 3300053160 Bacteria 1126
767 Ga0500638_000656 3300053162 Bacteria 9059
768 Ga0500639_076751 3300053163 Bacteria 1690
769 Ga0500636_0000729 3300053177 Bacteria 17739
770 Ga0500636_0102231 3300053177 Bacteria 1628
771 Ga0500637_0000289 3300053178 Bacteria 18843
772 Ga0500625_000083 3300053729 Bacteria 17199
773 Ga0500552_001568 3300053733 Bacteria 2178
774 Ga0500596_016344 3300053735 Bacteria 1115
775 Ga0500601_000198 3300053737 Bacteria 12407
776 Ga0500661_000221 3300055283 Bacteria 10210
777 Ga0466962_0027604 3300061719 Bacteria 2724
778 Ga0466962_0116432 3300061719 Bacteria 1288
779 2507505696 2507262055 Bacteria 8048963
780 2508539588 2508501009 Bacteria 7784016
781 2508695960 2508501042 Bacteria 8719808
782 2509150013 2508501128 Bacteria 8613869
783 2511395002 2511231028 Bacteria 8046582
784 2512032333 2511231221 Bacteria 6846400
785 2513624984 2513237092 Bacteria 8341956
786 2513640780 2513237094 Bacteria 8789602
787 2513651762 2513237095 Bacteria 8976980
788 2513659448 2513237096 Bacteria 8722461
789 2513678319 2513237098 Bacteria 9902361
790 2513693960 2513237101 Bacteria 7952346
791 2513699735 2513237102 Bacteria 7703324
792 2513860609 2513237137 Bacteria 9558895
793 2513879243 2513237139 Bacteria 8737671
794 2513890557 2513237141 Bacteria 8496279
795 2513919017 2513237145 Bacteria 8979722
796 2514010255 2513237161 Bacteria 8871253
797 2515624092 2515154112 Bacteria 8294334
798 2517106540 2517093001 Bacteria 9002274
799 2517888338 2517572143 Bacteria 9484767
800 2524440141 2524023205 Bacteria 8918781
801 2524466409 2524023210 Bacteria 9029266
802 2524539853 2524023228 Bacteria 10118060
803 2528850673 2528768022 Bacteria 10457665
804 2599105547 2597490356 Bacteria 7030811
805 2617350104 2617270735 Bacteria 9163226
806 2617377202 2617270741 Bacteria 8201522
807 2671123316 2667528175 Bacteria 7532676
808 2723849263 2721755755 Bacteria 8322773
809 2728750757 2728368998 Bacteria 8720350
810 2745077750 2744054633 Bacteria 8678936
811 2793065765 2791355196 Bacteria 7323613
812 2793067157 2791355197 Bacteria 8420563
813 2793081638
814 2805920332 2802429603 Bacteria 8777136
815 2818239332 2816332527 Bacteria 8933356
816 2824606310 2824600985 Bacteria 8488197
817 2824616070 2824609381 Bacteria 8672835
818 2824624745 2824617872 Bacteria 8814715
819 2824634051 2824626560 Bacteria 8813858
820 2824641196 2824635225 Bacteria 8785348
821 2824651898 2824644064 Bacteria 8743947
822 2824660967 2824653114 Bacteria 8493680
823 2824669069 2824661429 Bacteria 9877870
824 2824677137 2824671348 Bacteria 8369588
825 2824683636 2824679649 Bacteria 8248951
826 2824693521 2824687955 Bacteria 8360029
827 2824702402 2824696289 Bacteria 8335049
828 2824708003 2824704595 Bacteria 9667483
829 2824723073 2824714736 Bacteria 8717648
830 2824728658 2824723954 Bacteria 8758240
831 2824738799 2824732956 Bacteria 7810675
832 2824753232 2824746037 Bacteria 7911610
833 2824758378 2824753945 Bacteria 9787441
834 2824768920 2824763712 Bacteria 9792355
835 2824780000 2824773399 Bacteria 8360218
836 2838125828 2838122688 Bacteria 8803140
837 2841948420 2841941048 Bacteria 8688029
838 2841952868 2841949485 Bacteria 8680857
839 2841965701 2841957949 Bacteria 8652217
840 2841972867 2841966195 Bacteria 8673214
841 2841977641 2841974524 Bacteria 8931498
842 2841984798 2841983080 Bacteria 8395090
843 2842041481 2842038055 Bacteria 8002051
844 2842049523 2842045827 Bacteria 8006841
845 2844315924 2844315083 Bacteria 8138177
846 2846954767 2846952575 Bacteria 6587527
847 2847939838 2847930680 Bacteria 9342022
848 2847942762 2847939898 Bacteria 8606328
849 2848858964 2848858292 Bacteria 7391279
850 2849076761 2849076700 Bacteria 7039503
851 2857515714 2857509624 Bacteria 7472071
852 2874593185 2874590934 Bacteria 8299676
853 2874608505 2874604998 Bacteria 7834745
854 2874618648 2874612657 Bacteria 8252029
855 2874622076 2874620515 Bacteria 8290088
856 2874629254 2874628541 Bacteria 8630250
857 2874647838 2874645413 Bacteria 8214782
858 2876769806 2876761206 Bacteria 10111113
859 2876773225 2876771140 Bacteria 8287509
860 2876816843 2876808645 Bacteria 8824342
861 2876820532 2876818435 Bacteria 8274608
862 2879076829 2879074833 Bacteria 8279565
863 2879087856 2879083081 Bacteria 8587928
864 2879100656 2879099564 Bacteria 10442239
865 2879112714 2879110137 Bacteria 8907982
866 2879128712 2879127579 Bacteria 8294491
867 2879145499 2879142872 Bacteria 8267021
868 2881367217 2881364244 Bacteria 7710352
869 2881666035 2881665667 Bacteria 8175609
870 2885369011 2885366525 Bacteria 8326213
871 2885377442 2885374607 Bacteria 8927485
872 2885388324 2885383462 Bacteria 9473874
873 2885415449 2885409591 Bacteria 9235467
874 2888379035 2888378607 Bacteria 9652610
875 2888390207 2888388044 Bacteria 7304136
876 2888427346 2888419890 Bacteria 7857137
877 2889035958 2889033259 Bacteria 9099371
878 2897804232 2897803580 Bacteria 7000062
879 2903731873 2903727486 Bacteria 8281579
880 2903754874 2903748898 Bacteria 9972761
881 2903770429 2903768456 Bacteria 9749579
882 2904666551 2904666416 Bacteria 8226587
883 2904692224 2904690495 Bacteria 9412302
884 2904709745
885 2904716083 2904711408 Bacteria 9771557
886 2906603600 2906602504 Bacteria 8295279
887 2906614304
888 2906630211 2906626472 Bacteria 8826946
889 2906641853 2906635258 Bacteria 8601019
890 2906646222 2906643746 Bacteria 8722424
891 2906666765 2906660503 Bacteria 8595048
892 2908746870 2908739725 Bacteria 8628932
893 2908756756 2908756301 Bacteria 8864324
894 2908775719 2908775508 Bacteria 8092255
895 2922364422 2922361189 Bacteria 7436256
896 2922377915
897 2922389115 2922386360 Bacteria 7017218
898 2922400846 2922393267 Bacteria 8285685
899 2922426134
900 2929624155 2929615660 Bacteria 9193770
901 2929631160 2929624759 Bacteria 9339455
902 2932789127 2932784394 Bacteria 9704911
903 2932800142 2932794094 Bacteria 7915132
904 2932808272 2932801729 Bacteria 7987968
905 2932814236 2932809354 Bacteria 9135765
906 2932820362 2932818245 Bacteria 9955613
907 2932834376 2932828146 Bacteria 9745859
908 2933586055 2933577622 Bacteria 9116884
909 2935614750 2935608549 Bacteria 8203142
910 2935620061 2935616580 Bacteria 9032984
911 2935632530 2935630451 Bacteria 8169952
912 2935640380 2935638405 Bacteria 10015038
913 2935649143 2935648319 Bacteria 8801166
914 2935658085 2935656913 Bacteria 8965014
915 2935668573 2935665750 Bacteria 9571747
916 2935683812 2935675223 Bacteria 9928132
917 2935686881 2935684952 Bacteria 9590419
918 2935702080 2935694250 Bacteria 9291695
919 2935710581 2935703347 Bacteria 10242284
920 2935716569 2935713505 Bacteria 9608509
921 2935723306 2935722832 Bacteria 9608746
922 2935734863 2935732158 Bacteria 9706831
923 2935744346 2935741537 Bacteria 9707219
924 2935752847 2935750917 Bacteria 9590372
925 2935769385 2935760218 Bacteria 9817913
926 2935774745 2935769743 Bacteria 7878163
927 2935779638 2935777560 Bacteria 8077691
928 2935789740 2935785616 Bacteria 7962367
929 2935797892 2935793552 Bacteria 8012592
930 2935806278 2935801545 Bacteria 9301974
931 2935818134 2935810662 Bacteria 9401221
932 2935826210 2935819856 Bacteria 8261050
933 2935831886 2935827899 Bacteria 10038562
934 2935841284 2935837841 Bacteria 9454360
935 2935853706 2935847175 Bacteria 8228321
936 2935858947 2935855204 Bacteria 9035059
937 2935864128 2935864058 Bacteria 9784707
938 2935875520 2935873716 Bacteria 9632195
939 2935883379 2935883170 Bacteria 7964738
940 2935910929 2935908558 Bacteria 8568796
941 2935922111 2935916978 Bacteria 9113783
942 2935929752 2935926038 Bacteria 8601059
943 2935937420 2935934488 Bacteria 8602579
944 2935948181 2935942939 Bacteria 8599779
945 2935957598 2935951376 Bacteria 8602333
946 2935964069 2935959822 Bacteria 7869783
947 2935971123 2935967501 Bacteria 8603075
948 2935982285 2935975950 Bacteria 8347125
949 2935985427 2935984226 Bacteria 8302647
950 2935995499 2935992306 Bacteria 9802711
951 2936007922 2936002035 Bacteria 9362176
952 2936012304 2936011229 Bacteria 8801034
953 2936020615 2936019824 Bacteria 8804134
954 2936029597 2936028420 Bacteria 8965941
955 2936044744 2936037263 Bacteria 9446081
956 2936051938 2936046547 Bacteria 8903709
957 2936056805 2936055302 Bacteria 8785755
958 2940558760 2940556831 Bacteria 9590747
959 2941508806 2941507105 Bacteria 8166816
960 2941516636 2941515067 Bacteria 8166720
961 2941524348 2941523033 Bacteria 8169134
962 2941535777 2941531003 Bacteria 7653939
963 2941543511 2941538514 Bacteria 9402094
964 3005483410 3005474847 Bacteria 9259049
965 3005486459 3005483717 Bacteria 7877331
966 3005506380 3005506211 Bacteria 6943378
967 3005588981 3005587118 Bacteria 7794411
968 3005595519 3005594810 Bacteria 8716512
969 3005711506 3005710791 Bacteria 7622528
970 3005718743 3005718088 Bacteria 8283608
971 8006932083 8006926726 Bacteria 6749210
972 8006936841 8006933436 Bacteria 10410654
973 8006967793 8006964411 Bacteria 8966052
974 8006976811 8006973647 Bacteria 10679141
975 8006992532 8006984368 Bacteria 9651211
976 8006998463 8006994254 Bacteria 8309700
977 8016517671 8016511872 Bacteria 9921665
978 8016525731 8016522445 Bacteria 8156687
979 8016543615 8016539877 Bacteria 8155419
980 8016549677 8016548790 Bacteria 8155074
981 8016558094 8016557553 Bacteria 8154380
982 8016569022 8016566248 Bacteria 8158151
983 8016581658 8016575299 Bacteria 8154085
984 8016586961 8016583857 Bacteria 10421953
985 8016596102 8016595262 Bacteria 8149947
986 8016606996 8016603502 Bacteria 8731218
987 8016618901 8016613128 Bacteria 8794220
988 8016622644 8016622563 Bacteria 7999408
989 8016635146 8016630954 Bacteria 9217207
990 8017058955 8017057580 Bacteria 10023680
991 8019530607 8019530166 Bacteria 8155624
992 8019540985 8019538911 Bacteria 7872763
993 8019549636 8019547302 Bacteria 7996444
994 8019561852 8019555841 Bacteria 9642137
995 8019571926 8019565922 Bacteria 9639779
996 8019576690 8019576017 Bacteria 10049540
997 8019594741 8019586578 Bacteria 10212056
998 8019611514 8019608314 Bacteria 10042931
999 8019623446 8019619141 Bacteria 9218857
1000 8019638696 8019629233 Bacteria 8687553
1001 8019641044 8019638758 Bacteria 9062356
1002 8019653061 8019648815 Bacteria 10014479
1003 8019666494 8019659431 Bacteria 8577854
1004 8019676156 8019668869 Bacteria 8791617
1005 8019695712 8019687851 Bacteria 8712826
1006 8054005152 8054002106 Bacteria 7987183
1007 8055742932 8055742211 Bacteria 9226248
1008 8056678514 8056673599 Bacteria 7871253
1009 8056683095 8056681323 Bacteria 8472857
1010 8056692620 8056689827 Bacteria 6712655
1011 8056970769 8056967851 Bacteria 9038162
1012 Ga0068858_100003617
1013 JGI25406J46586_10000548
1014 JGI25406J46586_10003583
1015 JGI25153J46596_10008332
1016 JGI25153J46596_10013566
1017 JGI25160J50197_1001957
1018 JGI25160J50197_1014546
1019 JGI25404J52841_10012584
1020 Ga0055539_1001606
1021 Ga0055542_1004373
1022 Ga0055531_10011060
1023 Ga0055543_1013159
1024 Ga0065165_1001520
1025 Ga0065165_1001837
1026 Ga0065704_10018294
1027 Ga0070658_10092036
1028 Ga0070676_10202550
1029 Ga0070683_100160581
1030 Ga0070680_100103205
1031 Ga0070680_100198741
1032 Ga0070680_100333307
1033 Ga0070682_100075032
1034 Ga0068868_100161319
1035 Ga0068868_100202384
1036 Ga0070689_100174967
1037 Ga0070661_100120056
1038 Ga0070661_100255036
1039 Ga0070669_100181263
1040 Ga0070671_100000510
1041 Ga0070671_100081793
1042 Ga0070674_100077749
1043 Ga0070659_100010343
1044 Ga0070659_100394996
1045 Ga0070667_100004404
1046 Ga0070709_10000581
1047 Ga0070709_10002279
1048 Ga0070709_10252281
1049 Ga0070714_100044686
1050 Ga0070714_100122560
1051 Ga0070713_100054076
1052 Ga0070713_100060562
1053 Ga0070713_100076313
1054 Ga0070713_100126906
1055 Ga0070713_100194139
1056 Ga0070710_10000569
1057 Ga0070710_10041821
1058 Ga0070710_10181296
1059 Ga0070711_100014888
1060 Ga0070711_100017698
1061 Ga0070711_100017955
1062 Ga0070700_100082445
1063 Ga0070663_100009437
1064 Ga0070663_100124336
1065 Ga0070663_100133977
1066 Ga0070678_100085020
1067 Ga0070678_100213781
1068 Ga0070662_100172749
1069 Ga0070681_10009764
1070 Ga0070681_10010624
1071 Ga0070681_10072420
1072 Ga0070681_10194601
1073 Ga0070685_10103007
1074 Ga0070698_100023342
1075 Ga0070698_100257979
1076 Ga0070679_100090365
1077 Ga0070679_100335768
1078 Ga0070679_100488369
1079 Ga0070684_100008775
1080 Ga0070684_100013449
1081 Ga0070684_100077390
1082 Ga0070684_100087323
1083 Ga0070697_100350069
1084 Ga0068853_100377911
1085 Ga0068853_100514941
1086 Ga0070672_100101973
1087 Ga0070665_100004959
1088 Ga0070665_100020484
1089 Ga0070665_100244323
1090 Ga0068855_100038282
1091 Ga0068855_100052781
1092 Ga0068855_100104294
1093 Ga0068855_100172793
1094 Ga0068857_100078760
1095 Ga0068856_100002546
1096 Ga0068856_100159913
1097 Ga0070702_100061453
1098 Ga0070702_100289741
1099 Ga0068852_100043069
1100 Ga0068852_100045537
1101 Ga0068852_100306508
1102 Ga0068852_100373982
1103 Ga0068859_100000676
1104 Ga0068859_100144065
1105 Ga0068859_100192186
1106 Ga0068864_100040896
1107 Ga0068864_100196823
1108 Ga0068864_100343086
1109 Ga0068861_100042845
1110 Ga0068861_100100193
1111 Ga0068851_10045383
1112 Ga0068863_100016729
1113 Ga0068863_100279801
1114 Ga0068858_100089775
1115 Ga0068858_100137112
1116 Ga0068858_100234429
1117 Ga0068860_100001435
1118 Ga0068860_100002832
1119 Ga0068862_100298913
1120 Ga0068862_100350529
1121 Ga0081455_10002643
1122 Ga0081455_10002851
1123 Ga0081455_10020647
1124 Ga0081455_10052489
1125 Ga0081538_10064663
1126 Ga0081540_1000646
1127 Ga0081540_1004144
1128 Ga0081540_1007740
1129 Ga0081540_1008977
1130 Ga0081540_1009756
1131 Ga0081540_1016677
1132 Ga0081540_1018543
1133 Ga0081539_10000576
1134 Ga0081539_10003823
1135 Ga0081539_10132693
1136 Ga0070717_10006202
1137 Ga0070717_10006982
1138 Ga0075365_10041285
1139 Ga0075368_10008050
1140 Ga0075363_100008168
1141 Ga0075363_100063283
1142 Ga0070716_100008960
1143 Ga0070712_100004420
1144 Ga0070712_100043145
1145 Ga0070712_100092345
1146 Ga0075367_10018187
1147 Ga0075367_10076155
1148 Ga0075369_10020147
1149 Ga0075366_10034492
1150 Ga0075366_10107685
1151 Ga0097621_100322051
1152 Ga0075370_10002485
1153 Ga0075370_10174144
1154 Ga0075434_100333287
1155 Ga0068865_100112439
1156 Ga0068865_100177784
1157 Ga0097620_100000676
1158 Ga0097620_100144054
1159 Ga0097620_100192187
1160 Ga0099825_1026767
1161 Ga0099825_1042611
1162 Ga0099824_1003639
1163 Ga0099824_1013442
1164 Ga0099822_1005846
1165 Ga0099823_1043458
1166 Ga0105240_10002557
1167 Ga0105240_10047134
1168 Ga0105240_10094405
1169 Ga0105240_10256509
1170 Ga0105245_10008064
1171 Ga0105245_10155069
1172 Ga0105247_10000055
1173 Ga0105247_10063033
1174 Ga0105243_10079228
1175 Ga0105241_10060895
1176 Ga0105242_10056892
1177 Ga0105248_10028531
1178 Ga0105237_10004764
1179 Ga0105237_10044470
1180 Ga0105237_10179172
1181 Ga0105237_10338466
1182 Ga0105238_10037432
1183 Ga0105238_10085617
1184 Ga0105238_10089007
1185 Ga0105238_10236535
1186 Ga0105238_10381605
1187 Ga0105238_10462382
1188 Ga0105249_10569321
1189 Ga0105239_10039403
1190 Ga0105239_10225258
1191 Ga0105239_10253220
1192 Ga0105246_10012468
1193 Ga0157370_10022255
1194 Ga0157370_10150012
1195 Ga0157370_10225807
1196 Ga0157369_10004728
1197 Ga0157369_10011987
1198 Ga0157369_10169083
1199 Ga0157374_10012741
1200 Ga0157374_10109585
1201 Ga0157374_10300406
1202 Ga0157378_10002185
1203 Ga0163162_10051472
1204 Ga0163162_10299568
1205 Ga0157372_10064671
1206 Ga0157372_10256767
1207 Ga0157375_10019941
1208 Ga0157375_10373484
1209 Ga0163163_10005391
1210 Ga0163163_10050740
1211 Ga0163163_10059990
1212 Ga0163163_10083965
1213 Ga0157380_10010462
1214 Ga0157380_10295094
1215 Ga0157379_10005640
1216 Ga0157379_10146276
1217 Ga0157379_10537464
1218 Ga0157376_10248902
1219 Ga0163161_10188331
1220 Ga0214544_1000007
1221 Ga0214542_1000216
1222 Ga0214545_1000118
1223 Ga0214543_1000009
1224 Ga0213876_10014311
1225 Ga0213876_10049175
1226 Ga0213876_10056438
1227 Ga0213875_10000457
1228 Ga0213875_10000613
1229 Ga0213871_10021612
1230 Ga0209677_100366
1231 Ga0209677_107225
1232 Ga0209148_1000469
1233 Ga0209233_1000950
1234 Ga0209233_1001192
1235 Ga0209233_1005688
1236 Ga0209233_1024362
1237 Ga0209233_1027503
1238 Ga0209455_1005585
1239 Ga0209455_1005599
1240 Ga0209455_1010645
1241 Ga0209564_1007728
1242 Ga0209758_1000030
1243 Ga0209758_1001206
1244 Ga0209758_1001554
1245 Ga0209758_1002805
1246 Ga0209758_1008529
1247 Ga0209758_1012174
1248 Ga0209758_1020626
1249 Ga0209758_1023996
1250 Ga0209758_1044361
1251 Ga0209256_1004511
1252 Ga0207426_1000347
1253 Ga0207426_1000974
1254 Ga0207426_1038325
1255 Ga0209051_1027300
1256 Ga0209257_1004181
1257 Ga0207642_10068074
1258 Ga0207710_10025614
1259 Ga0207688_10017848
1260 Ga0207647_10001188
1261 Ga0207699_10009181
1262 Ga0207699_10027819
1263 Ga0207699_10049850
1264 Ga0207699_10269321
1265 Ga0207705_10062355
1266 Ga0207705_10130441
1267 Ga0207684_10055845
1268 Ga0207654_10026029
1269 Ga0207654_10055014
1270 Ga0207707_10001124
1271 Ga0207707_10064060
1272 Ga0207707_10150549
1273 Ga0207695_10000006
1274 Ga0207695_10013052
1275 Ga0207695_10390843
1276 Ga0207671_10004983
1277 Ga0207693_10007439
1278 Ga0207693_10054527
1279 Ga0207693_10068197
1280 Ga0207693_10127179
1281 Ga0207663_10009355
1282 Ga0207663_10025851
1283 Ga0207663_10028280
1284 Ga0207663_10288798
1285 Ga0207660_10128214
1286 Ga0207660_10172246
1287 Ga0207662_10283029
1288 Ga0207657_10004978
1289 Ga0207657_10113718
1290 Ga0207657_10143129
1291 Ga0207649_10139476
1292 Ga0207652_10029817
1293 Ga0207652_10090895
1294 Ga0207646_10186025
1295 Ga0207694_10102885
1296 Ga0207694_10161521
1297 Ga0207650_10179333
1298 Ga0207687_10017867
1299 Ga0207687_10024534
1300 Ga0207700_10069572
1301 Ga0207700_10144476
1302 Ga0207664_10098835
1303 Ga0207690_10113899
1304 Ga0207706_10052774
1305 Ga0207706_10125580
1306 Ga0207709_10012502
1307 Ga0207709_10139183
1308 Ga0207670_10148375
1309 Ga0207669_10026988
1310 Ga0207704_10109749
1311 Ga0207665_10089443
1312 Ga0207665_10118519
1313 Ga0207691_10049962
1314 Ga0207691_10055366
1315 Ga0207711_10059367
1316 Ga0207711_10352818
1317 Ga0207689_10202851
1318 Ga0207661_10001102
1319 Ga0207661_10120765
1320 Ga0207661_10429271
1321 Ga0207667_10017132
1322 Ga0207667_10315680
1323 Ga0207667_10323380
1324 Ga0207712_10057494
1325 Ga0207668_10029144
1326 Ga0207658_10231546
1327 Ga0207677_10019542
1328 Ga0207703_10009552
1329 Ga0207703_10082845
1330 Ga0207703_10093732
1331 Ga0207639_10203190
1332 Ga0207678_10004793
1333 Ga0207678_10057449
1334 Ga0207678_10111355
1335 Ga0207678_10270863
1336 Ga0207708_10154923
1337 Ga0207702_10002900
1338 Ga0207702_10059738
1339 Ga0207702_10110887
1340 Ga0207702_10161187
1341 Ga0207702_10221270
1342 Ga0207641_10011233
1343 Ga0207641_10401876
1344 Ga0207676_10315532
1345 Ga0207674_10139566
1346 Ga0207675_100055473
1347 Ga0207683_10007968
1348 Ga0207683_10056583
1349 Ga0207683_10398952
1350 Ga0207698_10071370
1351 Ga0207698_10084380
1352 Ga0207698_10125169
1353 Ga0209389_1000015
1354 Ga0209389_1000035
1355 Ga0209589_1000015
1356 Ga0209589_1000039
1357 Ga0209489_100015
1358 Ga0209489_100072
1359 Ga0209489_100084
1360 Ga0209700_100025
1361 Ga0209700_100034
1362 Ga0209179_1001370
1363 Ga0209588_1024253
1364 Ga0268266_10000907
1365 Ga0268266_10005299
1366 Ga0268266_10449787
1367 Ga0268265_10498500
1368 Ga0268264_10000107
1369 Ga0268264_10002035
1370 Ga0265337_1020481
1371 Ga0265326_10001639
1372 Ga0265319_1002509
1373 Ga0265323_10001801
1374 Ga0265322_10007464
1375 Ga0265336_10000139
1376 Ga0307517_10000858
1377 Ga0265338_10000155
1378 Ga0265324_10000912
1379 Ga0265330_10005758
1380 Ga0265330_10037471
1381 Ga0265330_10074637
1382 Ga0265325_10007669
1383 Ga0265340_10004964
1384 Ga0265339_10063057
1385 Ga0265331_10130855
1386 Ga0265327_10006537
1387 Ga0307513_10186027
1388 Ga0307513_10272769
1389 Ga0307509_10005533
1390 Ga0307509_10171704
1391 Ga0307508_10000088
1392 Ga0307508_10115807
1393 Ga0265314_10004147
1394 Ga0265342_10031643
1395 Ga0265342_10067537
1396 Ga0307516_10040811
1397 Ga0307516_10048253
1398 Ga0307516_10103255
1399 Ga0307516_10187769
1400 Ga0307516_10377136
1401 Ga0307405_10171977
1402 Ga0307413_10034106
1403 Ga0307416_100108072
1404 Ga0307411_10093551
1405 Ga0307507_10155096
1406 Ga0307510_10006777
1407 Ga0307510_10014688
1408 Ga0307510_10047825
1409 Ga0307510_10068453
1410 Ga0307510_10077642
1411 Ga0307510_10162270
1412 Ga0307510_10201885
1413 Ga0315911_1000047
1414 Ga0316215_1001118
1415 Ga0373923_0014180
1416 Ga0373923_0014995
1417 Ga0373923_0034469
1418 Ga0373936_0003468
1419 Ga0373945_0055682
1420 Ga0373953_0001048
1421 Ga0373953_0031595
1422 Ga0373954_0001759
1423 Ga0373954_0007594
1424 Ga0373956_0027530
1425 Ga0373956_0050553
1426 Ga0373943_0015461
1427 Ga0373943_0028663
1428 Ga0373946_0013401
1429 Ga0373955_0000261
1430 Ga0373955_0011387
1431 Ga0373955_0014419
1432 Ga0373924_0002173
1433 Ga0373924_0015188
1434 Ga0373924_0046208
1435 Ga0373931_0011768
1436 Ga0373935_0000694
1437 Ga0373927_0000136
1438 Ga0373927_0008006
1439 Ga0373927_0179818
1440 Ga0373933_0000543
1441 Ga0373933_0001973
1442 Ga0373933_0013676
1443 Ga0373933_0063456
1444 Ga0373947_0000107
1445 Ga0373947_0024166
1446 Ga0373947_0086641
1447 Ga0373937_0049792
1448 Ga0373937_0115249
1449 Ga0373937_0312680
1450 Ga0373937_0488975
1451 Ga0372808_010866
1452 Ga0373925_0014694
1453 Ga0373925_0064842
1454 Ga0373925_0118112
1455 Ga0373925_0188258
1456 Ga0373925_0218089
1457 Ga0395900_0000924
1458 Ga0395900_0007634
1459 Ga0395898_0014465
1460 Ga0395898_0051073
1461 Ga0395898_0419191
1462 Ga0395905_0015435
1463 Ga0395905_0019806
1464 Ga0395905_0062229
1465 Ga0436364_0355969
1466 Ga0436364_0577546
1467 Ga0436364_0668201
1468 Ga0436364_0685371
1469 Ga0395901_0013977
1470 Ga0395901_0134521
1471 Ga0436365_0205919
1472 Ga0436365_0229124
1473 Ga0436365_0611875
1474 Ga0436365_1440720
1475 Ga0436365_1722225
1476 Ga0436365_1831713
1477 Ga0436360_0157633
1478 Ga0436360_1018630
1479 Ga0436361_0763978
1480 Ga0436363_1581175
1481 Ga0436362_0921239
1482 Ga0451800_1027174
1483 Ga0466969_0004542
1484 Ga0466972_0000048
1485 Ga0466965_0011868
1486 Ga0466966_0031573
1487 Ga0466961_0000018
1488 Ga0466957_0186341
1489 Ga0466960_0017357
1490 Ga0466960_0072533
1491 Ga0466959_0005661
1492 Ga0495592_0006131
1493 Ga0495592_0013979
1494 Ga0495592_0086327
1495 Ga0495592_0181265
1496 Ga0495603_0000019
1497 Ga0495603_0022379
1498 Ga0495603_0100621
1499 Ga0495629_0000073
1500 Ga0495629_0006116
1501 Ga0495629_0006296
1502 Ga0495629_0065452
1503 Ga0495638_0002020
1504 Ga0495638_0042634
1505 Ga0495641_0027890
1506 Ga0495651_0005880
1507 Ga0495651_0017012
1508 Ga0495651_0029795
1509 Ga0495651_0043207
1510 Ga0495653_0021180
1511 Ga0495653_0063404
1512 Ga0495650_0086025
1513 Ga0495580_0000534
1514 Ga0495580_0017187
1515 Ga0495582_0000019
1516 Ga0495582_0089932
1517 Ga0495582_0120632
1518 Ga0495605_0056151
1519 Ga0495605_0098440
1520 Ga0495639_0000088
1521 Ga0495639_0027234
1522 Ga0495662_0004712
1523 Ga0495662_0062530
1524 Ga0495664_0134412
1525 Ga0495585_0064504
1526 Ga0495585_0083830
1527 Ga0495585_0124697
1528 Ga0495594_0000742
1529 Ga0495583_0096645
1530 Ga0495606_0000234
1531 Ga0495606_0077802
1532 Ga0495608_0023813
1533 Ga0495608_0056123
1534 Ga0495610_0032296
1535 Ga0495616_0016146
1536 Ga0495618_0165117
1537 Ga0495628_0013398
1538 Ga0495628_0102133
1539 Ga0495628_0123011
1540 Ga0495630_0000212
1541 Ga0495630_0130182
1542 Ga0495632_0058889
1543 Ga0495643_0008931
1544 Ga0495643_0043913
1545 Ga0495643_0106682
1546 Ga0495648_0068727
1547 Ga0495666_0030236
1548 Ga0495652_0029385
1549 Ga0495652_0033932
1550 Ga0495652_0068076
1551 Ga0495652_0169074
1552 Ga0495652_0172559
1553 Ga0495652_0200040
1554 Ga0495665_0001847
1555 Ga0495665_0044666
1556 Ga0495665_0131695
1557 Ga0495587_0002612
1558 Ga0495587_0010267
1559 Ga0495597_0009368
1560 Ga0495645_0013519
1561 Ga0495645_0015775
1562 Ga0495645_0048517
1563 Ga0495622_0081246
1564 Ga0495633_0061132
1565 Ga0495667_0002244
1566 Ga0495667_0051721
1567 Ga0495656_0027895
1568 Ga0495656_0042783
1569 Ga0495668_0140793
1570 Ga0495634_0000606
1571 Ga0495634_0017576
1572 Ga0495634_0026522
1573 Ga0495634_0031477
1574 Ga0495625_0058033
1575 Ga0495635_0006362
1576 Ga0495635_0009473
1577 Ga0495635_0037504
1578 Ga0495635_0083606
1579 Ga0495659_0033213
1580 Ga0495588_0003823
1581 Ga0495588_0008637
1582 Ga0495588_0057484
1583 Ga0495657_0006578
1584 Ga0495657_0026637
1585 Ga0495599_0043962
1586 Ga0495599_0070540
1587 Ga0495599_0178661
1588 Ga0495623_0006059
1589 Ga0495623_0008248
1590 Ga0495623_0011132
1591 Ga0495646_0007042
1592 Ga0495646_0022278
1593 Ga0495646_0031441
1594 Ga0495646_0049206
1595 Ga0495647_0000435
1596 Ga0495647_0093873
1597 Ga0495658_0000054
1598 Ga0495613_0002573
1599 Ga0495613_0020962
1600 Ga0495624_0000796
1601 Ga0495624_0006888
1602 Ga0495670_0064014
1603 Ga0495671_0069875
1604 Ga0495649_0058967
1605 Ga0495649_0108483
1606 Ga0495600_0017697
1607 Ga0495600_0018739
1608 Ga0495600_0022598
1609 Ga0495581_0001715
1610 Ga0495581_0079523
1611 Ga0495604_0000518
1612 Ga0495604_0007957
1613 Ga0495604_0030260
1614 Ga0495604_0034572
1615 Ga0495604_0101833
1616 Ga0495674_0001338
1617 Ga0495674_0017951
1618 Ga0495674_0040218
1619 Ga0495674_0046453
1620 Ga0495674_0136897
1621 Ga0495674_0153305
1622 Ga0495676_0147132
1623 Ga0495676_0174306
1624 Ga0495680_0004596
1625 Ga0495680_0021178
1626 Ga0495680_0035489
1627 Ga0495687_037415
1628 Ga0495675_0005612
1629 Ga0495675_0011843
1630 Ga0495673_0077164
1631 Ga0495684_0002876
1632 Ga0495684_0015613
1633 Ga0495684_0070253
1634 Ga0495686_0123757
1635 Ga0495593_0001244
1636 Ga0495593_0004525
1637 Ga0495593_0101008
1638 Ga0495602_0002591
1639 Ga0495602_0029185
1640 Ga0495602_0066246
1641 Ga0495602_0173927
1642 Ga0495615_0023954
1643 Ga0495626_0024808
1644 Ga0496100_0124552
1645 Ga0496101_0023781
1646 Ga0496102_0033536
1647 Ga0496102_0051772
1648 Ga0496102_0085694
1649 Ga0496103_0020084
1650 Ga0496104_0006999
1651 Ga0496104_0033682
1652 Ga0496104_0112464
1653 Ga0496105_0001000
1654 Ga0496105_0013379
1655 Ga0496105_0013779
1656 Ga0496105_0033888
1657 Ga0496106_0001189
1658 Ga0496106_0003360
1659 Ga0496106_0083915
1660 Ga0496106_0168221
1661 Ga0496107_0022933
1662 Ga0496107_0043826
1663 Ga0496107_0067250
1664 Ga0496107_0158965
1665 Ga0496108_0042296
1666 Ga0496108_0068113
1667 Ga0496108_0100324
1668 Ga0496109_0076084
1669 Ga0496109_0177099
1670 Ga0496109_0189147
1671 Ga0496109_0195441
1672 Ga0496109_0196422
1673 Ga0496110_0070821
1674 Ga0496110_0103467
1675 Ga0496110_0213539
1676 Ga0496110_0278339
1677 Ga0496110_0345340
1678 Ga0496111_0263331
1679 Ga0496112_0000051
1680 Ga0496112_0048577
1681 Ga0496112_0114501
1682 Ga0496112_0128435
1683 Ga0496112_0282910
1684 Ga0496113_0015164
1685 Ga0496113_0188378
1686 Ga0496113_0190874
1687 Ga0496114_0036038
1688 Ga0496114_0076820
1689 Ga0496114_0149347
1690 Ga0496114_0233425
1691 Ga0496115_0015706
1692 Ga0496115_0220675
1693 Ga0496117_0025696
1694 Ga0496118_0005559
1695 Ga0496118_0011676
1696 Ga0496118_0044416
1697 Ga0496118_0163369
1698 Ga0496118_0170287
1699 Ga0496119_0011296
1700 Ga0496121_0000091
1701 Ga0496121_0000191
1702 Ga0496121_0005586
1703 Ga0496121_0008326
1704 Ga0496121_0013393
1705 Ga0496121_0013944
1706 Ga0496121_0094949
1707 Ga0496121_0125434
1708 Ga0496121_0153546
1709 Ga0496121_0278161
1710 Ga0496122_0045106
1711 Ga0496124_0001506
1712 Ga0496124_0065348
1713 Ga0496124_0099882
1714 Ga0496124_0177883
1715 Ga0496125_0030389
1716 Ga0496125_0077726
1717 Ga0496125_0150968
1718 Ga0496126_0005194
1719 Ga0496126_0005651
1720 Ga0496126_0024203
1721 Ga0496126_0049321
1722 Ga0496126_0050367
1723 Ga0496126_0064494
1724 Ga0496126_0208362
1725 Ga0496126_0231297
1726 Ga0496126_0236588
1727 Ga0501038_0223473
1728 Ga0501046_0106490
1729 Ga0501047_0086376
1730 Ga0501074_0018445
1731 Ga0501080_0011301
1732 nmdc:mga03n38_130_c1
1733 nmdc:mga00v17_10385_c1
1734 nmdc:mga0yw44_101209_c1
1735 nmdc:mga0yw44_62466_c1
1736 nmdc:mga06z11_2230_c1
1737 nmdc:mga07m45_11199_c1
1738 nmdc:mga07m45_9052_c1
1739 nmdc:mga05p37_26610_c1
1740 nmdc:mga0n895_219154_c1
1741 nmdc:mga0sz30_15752_c2
1742 Ga0495601_0022764
1743 Ga0495601_0131308
1744 Ga0495612_0020706
1745 Ga0495595_0001889
1746 Ga0495619_0001865
1747 Ga0500643_000328
1748 Ga0500647_0007313
1749 Ga0500566_0000531
1750 Ga0500566_0033886
1751 Ga0500566_0055757
1752 Ga0500641_0029704
1753 Ga0500650_0028277
1754 Ga0500554_034680
1755 Ga0500555_027880
1756 Ga0500556_0006255
1757 Ga0500557_000019
1758 Ga0500569_001790
1759 Ga0500572_001208
1760 Ga0500595_000336
1761 Ga0500595_001036
1762 Ga0500595_036817
1763 Ga0500595_044363
1764 Ga0500642_0000064
1765 Ga0500559_0001974
1766 Ga0500559_0018775
1767 Ga0500559_0112782
1768 Ga0500568_0007471
1769 Ga0500568_0079711
1770 Ga0500573_0026238
1771 Ga0500589_067930
1772 Ga0500603_000333
1773 Ga0500603_014852
1774 Ga0500622_0131933
1775 Ga0500627_0096964
1776 Ga0500630_111368
1777 Ga0500633_0088927
1778 Ga0500638_000656
1779 Ga0500639_076751
1780 Ga0500636_0000729
1781 Ga0500636_0102231
1782 Ga0500637_0000289
1783 Ga0500625_000083
1784 Ga0500552_001568
1785 Ga0500596_016344
1786 Ga0500601_000198
1787 Ga0500661_000221
1788 Ga0466962_0027604
1789 Ga0466962_0116432
1790 2507505696
1791 2508539588
1792 2508695960
1793 2509150013
1794 2511395002
1795 2512032333
1796 2513624984
1797 2513640780
1798 2513651762
1799 2513659448
1800 2513678319
1801 2513693960
1802 2513699735
1803 2513860609
1804 2513879243
1805 2513890557
1806 2513919017
1807 2514010255
1808 2515624092
1809 2517106540
1810 2517888338
1811 2524440141
1812 2524466409
1813 2524539853
1814 2528850673
1815 2599105547
1816 2617350104
1817 2617377202
1818 2671123316
1819 2723849263
1820 2728750757
1821 2745077750
1822 2793065765
1823 2793067157
1824 2793081638
1825 2805920332
1826 2818239332
1827 2824606310
1828 2824616070
1829 2824624745
1830 2824634051
1831 2824641196
1832 2824651898
1833 2824660967
1834 2824669069
1835 2824677137
1836 2824683636
1837 2824693521
1838 2824702402
1839 2824708003
1840 2824723073
1841 2824728658
1842 2824738799
1843 2824753232
1844 2824758378
1845 2824768920
1846 2824780000
1847 2838125828
1848 2841948420
1849 2841952868
1850 2841965701
1851 2841972867
1852 2841977641
1853 2841984798
1854 2842041481
1855 2842049523
1856 2844315924
1857 2846954767
1858 2847939838
1859 2847942762
1860 2848858964
1861 2849076761
1862 2857515714
1863 2874593185
1864 2874608505
1865 2874618648
1866 2874622076
1867 2874629254
1868 2874647838
1869 2876769806
1870 2876773225
1871 2876816843
1872 2876820532
1873 2879076829
1874 2879087856
1875 2879100656
1876 2879112714
1877 2879128712
1878 2879145499
1879 2881367217
1880 2881666035
1881 2885369011
1882 2885377442
1883 2885388324
1884 2885415449
1885 2888379035
1886 2888390207
1887 2888427346
1888 2889035958
1889 2897804232
1890 2903731873
1891 2903754874
1892 2903770429
1893 2904666551
1894 2904692224
1895 2904709745
1896 2904716083
1897 2906603600
1898 2906614304
1899 2906630211
1900 2906641853
1901 2906646222
1902 2906666765
1903 2908746870
1904 2908756756
1905 2908775719
1906 2922364422
1907 2922377915
1908 2922389115
1909 2922400846
1910 2922426134
1911 2929624155
1912 2929631160
1913 2932789127
1914 2932800142
1915 2932808272
1916 2932814236
1917 2932820362
1918 2932834376
1919 2933586055
1920 2935614750
1921 2935620061
1922 2935632530
1923 2935640380
1924 2935649143
1925 2935658085
1926 2935668573
1927 2935683812
1928 2935686881
1929 2935702080
1930 2935710581
1931 2935716569
1932 2935723306
1933 2935734863
1934 2935744346
1935 2935752847
1936 2935769385
1937 2935774745
1938 2935779638
1939 2935789740
1940 2935797892
1941 2935806278
1942 2935818134
1943 2935826210
1944 2935831886
1945 2935841284
1946 2935853706
1947 2935858947
1948 2935864128
1949 2935875520
1950 2935883379
1951 2935910929
1952 2935922111
1953 2935929752
1954 2935937420
1955 2935948181
1956 2935957598
1957 2935964069
1958 2935971123
1959 2935982285
1960 2935985427
1961 2935995499
1962 2936007922
1963 2936012304
1964 2936020615
1965 2936029597
1966 2936044744
1967 2936051938
1968 2936056805
1969 2940558760
1970 2941508806
1971 2941516636
1972 2941524348
1973 2941535777
1974 2941543511
1975 3005483410
1976 3005486459
1977 3005506380
1978 3005588981
1979 3005595519
1980 3005711506
1981 3005718743
1982 8006932083
1983 8006936841
1984 8006967793
1985 8006976811
1986 8006992532
1987 8006998463
1988 8016517671
1989 8016525731
1990 8016543615
1991 8016549677
1992 8016558094
1993 8016569022
1994 8016581658
1995 8016586961
1996 8016596102
1997 8016606996
1998 8016618901
1999 8016622644
2000 8016635146
2001 8017058955
2002 8019530607
2003 8019540985
2004 8019549636
2005 8019561852
2006 8019571926
2007 8019576690
2008 8019594741
2009 8019611514
2010 8019623446
2011 8019638696
2012 8019641044
2013 8019653061
2014 8019666494
2015 8019676156
2016 8019695712
2017 8054005152
2018 8055742932
2019 8056678514
2020 8056683095
2021 8056692620
2022 8056970769

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13379

NMT1_2

NMT1-like family

54

295

0.86

PF09084

NMT1

NMT1/THI5 like

69

284

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.8114 30 337
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.8107 31 334
6st1-assembly2.cif.gz_B taurine abc transporter substrate binding protein taua from e. coli in complex with 2-(n-morpholino)ethanesulfonic acid (mes) 0.8058 31 334
3un6-assembly1.cif.gz_A 2.0 angstrom crystal structure of ligand binding component of abc-type import system from staphylococcus aureus with zinc bound 0.8051 30 336
3ksx-assembly1.cif.gz_A the alkanesulfonate-binding protein ssua from xanthomonas axonopodis pv. citri bound to mops 0.7988 30 337
ID Description Score Start End Superfamily
3uifA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8861 116 211 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8823 117 212 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8318 117 211 3.40.190.10
3qslB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8184 117 209 3.40.190.10
3ksxA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8029 117 212 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7Y6T2M8-F1-model_v4 deleted 0.9934 23 337
AF-A0A7C4XT61-F1-model_v4 ABC transporter substrate-binding protein 0.9681 28 333 GO:0042918
AF-A0A7V2RSY2-F1-model_v4 ABC transporter substrate-binding protein 0.9647 23 312 GO:0042918
AF-A0A1W9WA90-F1-model_v4 SsuA/THI5-like domain-containing protein 0.9574 23 330 GO:0042918
AF-A0A7C7DQM7-F1-model_v4 ABC transporter substrate-binding protein 0.9538 23 333 GO:0042918

Map