metagRoot

F488147

General Info

Members	Datasets	Scaffolds	Average Seq Length
1011	615	790	156

Family's Representative Sequence

Representative Sequence	3300037418\|Ga0395900_0044059\|Ga0395900_0044059_2192_2770
Length	184
Sequence	MALPPKSASRQKPDAFTKQPKQSFRIKNMARQPEEKSTGKFSSDDSALIRELALLLDETSLTEIEIERAGLRLRVARNISIATHMPAAVPMTGSAIAPAPIADLSKHPGVVPSPMVGTAYWAPEPGAKPFIEVGSKVSASQTLLIIEAMKTMNQIPSPRAGTVTQILVEDGQPVEFGEPLVIIE

Samples

	Sample ID	Description	Type	Environment
1	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
2	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
3	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
4	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
5	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
6	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
7	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
8	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
9	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
10	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
11	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
12	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
13	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
14	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
15	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
16	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
17	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
18	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
19	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
20	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
21	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
22	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
23	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
24	2667528175	Rhizobium tropici NFR14	Isolate	Rhizoplane
25	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
26	2728368998	Bradyrhizobium macuxiense BR 10303	Isolate	Nodule
27	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
28	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
29	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
30	2791355199
31	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
32	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
33	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
34	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
35	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
36	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
37	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
38	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
39	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
40	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
41	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
42	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
43	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
44	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
45	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
46	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
47	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
48	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
49	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
50	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
51	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
52	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
53	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
54	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
55	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
56	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
57	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
58	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
59	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
60	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
61	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
62	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
63	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
64	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
65	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
66	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
67	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
68	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
69	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
70	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
71	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
72	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
73	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
74	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
75	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
76	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
77	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
78	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
79	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
80	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
81	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
82	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
83	2885374607	Bradyrhizobium sp. NAS96.2	Isolate	Unclassified
84	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
85	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
86	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
87	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
88	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
89	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
90	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
91	2903748898	Bradyrhizobium uaiense UFLA 03-164	Isolate	Nodule
92	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
93	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
94	2904690495	Bradyrhizobium ivorense CI-1B	Isolate	Nodule
95	2904699407
96	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
97	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
98	2906610324
99	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
100	2906635258	Bradyrhizobium sp. USDA 3458	Isolate	Unclassified
101	2906660503	Bradyrhizobium brasilense UFLA 03-321	Isolate	Unclassified
102	2908739725	Bradyrhizobium sp. UFLA03-84	Isolate	Nodule
103	2908756301	Bradyrhizobium ivorense CI-41S	Isolate	Nodule
104	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
105	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
106	2922368715
107	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
108	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
109	2922425934
110	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
111	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
112	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
113	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
114	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
115	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
116	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
117	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
118	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
119	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
120	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
121	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
122	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
123	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
124	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
125	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
126	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
127	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
128	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
129	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
130	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
131	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
132	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
133	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
134	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
135	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
136	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
137	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
138	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
139	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
140	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
141	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
142	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
143	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
144	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
145	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
146	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
147	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
148	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
149	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
150	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
151	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
152	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
153	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
154	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
155	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
156	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
157	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
158	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
159	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
160	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
161	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
162	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
163	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
164	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
165	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
166	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
167	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
168	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
169	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
170	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
171	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
172	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
173	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
174	3005474847	Bradyrhizobium sp. CCBAU 53421	Isolate	Nodule
175	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
176	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
177	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
178	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
179	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
180	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
181	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
182	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
183	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
184	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
185	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
186	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
187	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
188	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
189	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
190	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
191	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
192	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
193	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
194	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
195	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
196	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
197	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
198	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
199	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
200	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
201	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
202	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
203	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
204	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
205	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
206	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
207	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
208	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
209	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
210	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
211	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
212	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
213	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
214	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
215	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
216	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
217	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
218	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
219	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
220	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
221	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
222	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
223	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
224	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
225	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
226	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
227	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
228	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
229	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
230	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
231	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
232	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
233	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
234	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
235	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
236	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
237	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
238	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
239	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
240	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
241	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
242	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
243	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
244	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
245	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
246	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
247	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
248	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
249	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
250	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
251	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
252	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
253	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
254	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
255	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
256	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
257	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
258	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
259	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
260	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
261	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
262	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
263	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
264	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
265	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
266	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
267	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
268	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
269	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
270	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
271	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
272	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
273	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
274	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
275	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
276	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
277	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
278	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
279	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
280	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
281	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
282	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
283	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
284	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
285	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
286	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
287	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
288	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
289	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
290	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
291	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
292	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
293	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
294	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
295	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
296	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
297	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
298	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
299	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
300	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
301	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
358	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
359	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
363	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
364	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
365	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
366	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
367	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
368	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
369	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
370	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
371	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
372	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
373	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
374	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
375	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
376	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
377	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
378	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
379	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
380	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
381	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
382	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
383	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
384	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
385	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
386	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
387	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
388	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
389	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
390	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
391	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
392	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
393	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
394	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
395	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
396	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
397	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
398	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
399	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
400	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
401	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
402	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
403	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
404	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
405	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
406	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
407	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
408	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
409	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
410	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
411	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
412	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
413	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
414	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
415	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
416	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
417	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
418	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
419	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
420	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
421	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
422	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
423	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
424	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
425	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
426	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
427	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
428	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
429	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
430	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
431	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
432	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
433	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
434	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
435	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
436	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
437	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
438	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
439	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
440	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
441	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
442	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
443	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
444	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
445	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
446	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
447	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
448	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
449	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
450	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
451	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
452	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
453	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
454	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
455	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
456	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
457	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
458	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
459	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
460	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
461	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
462	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
463	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
464	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
465	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
466	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
467	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
468	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
469	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
470	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
471	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
472	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
473	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
474	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
475	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
476	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
477	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
478	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
479	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
480	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
481	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
482	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
483	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
484	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
485	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
486	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
487	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
488	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
489	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
490	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
491	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
492	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
493	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
494	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
495	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
496	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
497	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
498	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
499	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
500	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
501	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
502	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
503	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
504	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
505	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
506	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
507	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
508	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
509	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
510	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
511	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
512	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
513	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
514	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
515	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
516	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
517	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
518	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
519	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
520	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
521	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
522	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
523	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
524	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
525	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
526	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
527	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
528	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
529	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
530	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
531	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
532	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
533	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
534	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
535	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
536	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
537	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
538	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
539	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
540	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
541	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
542	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
543	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
544	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
545	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
546	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
547	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
548	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
549	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
550	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
551	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
552	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
553	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
554	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
555	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
556	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
557	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
558	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
559	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
560	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
561	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
562	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
563	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
564	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
565	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
566	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
567	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
568	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
569	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
570	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
571	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
572	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
573	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
574	8001845381	Ancylobacter sonchi VKM B-3145	Isolate	Unclassified
575	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
576	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
577	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
578	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
579	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
580	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
581	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
582	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
583	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
584	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
585	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
586	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
587	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
588	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
589	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
590	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
591	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
592	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
593	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
594	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
595	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
596	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
597	8019547302	Bradyrhizobium sp. LB1.3	Isolate	Nodule
598	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
599	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule
600	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
601	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
602	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
603	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
604	8019619141	Bradyrhizobium sp. GM7.3	Isolate	Nodule
605	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
606	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
607	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
608	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
609	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
610	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
611	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
612	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
613	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
614	8056681323	Bradyrhizobium cenepequi CNPSo 4026	Isolate	Nodule
615	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	78.53
Metatranscriptomes	0
Isolates	21.47

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	6.33
Nodule	16.62
Rhizoplane	9.4
Rhizosphere	58.16
Stem	0
Stem Tuber	0
Unclassified	9.5

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25404J52841_10000074	3300003659	Bacteria	8897
2	JGI25404J52841_10017418	3300003659	Bacteria	1558
3	Ga0065715_10110964	3300005293	Bacteria	2585
4	Ga0070658_10097872	3300005327	Bacteria	2422
5	Ga0070676_10215456	3300005328	Bacteria	1265
6	Ga0070683_100127724	3300005329	Bacteria	2404
7	Ga0070683_100161825	3300005329	Bacteria	2124
8	Ga0070683_100631012	3300005329	Bacteria	1026
9	Ga0070690_100254248	3300005330	Bacteria	1244
10	Ga0070690_100575824	3300005330	Bacteria	852
11	Ga0070670_100502886	3300005331	Bacteria	1078
12	Ga0068869_100353398	3300005334	Bacteria	1198
13	Ga0068869_100488259	3300005334	Bacteria	1026
14	Ga0068869_100650899	3300005334	Bacteria	894
15	Ga0068869_100865143	3300005334	Bacteria	780
16	Ga0070666_10352313	3300005335	Bacteria	1053
17	Ga0070680_100023225	3300005336	Bacteria	4944
18	Ga0070680_100285490	3300005336	Bacteria	1399
19	Ga0070680_100485571	3300005336	Bacteria	1056
20	Ga0070682_100031462	3300005337	Bacteria	3210
21	Ga0070682_100318449	3300005337	Bacteria	1148
22	Ga0070682_100449235	3300005337	Bacteria	987
23	Ga0068868_100015782	3300005338	Bacteria	5595
24	Ga0068868_101047061	3300005338	Bacteria	748
25	Ga0070660_100101024	3300005339	Bacteria	2285
26	Ga0070660_100143997	3300005339	Bacteria	1914
27	Ga0070660_100173799	3300005339	Bacteria	1741
28	Ga0070689_100167031	3300005340	Bacteria	1781
29	Ga0070689_100577311	3300005340	Bacteria	971
30	Ga0070691_10203453	3300005341	Bacteria	1041
31	Ga0070691_10382341	3300005341	Bacteria	789
32	Ga0070661_100089964	3300005344	Bacteria	2273
33	Ga0070668_100040972	3300005347	Bacteria	3547
34	Ga0070668_100056554	3300005347	Bacteria	3030
35	Ga0070668_100386242	3300005347	Bacteria	1192
36	Ga0070668_100505427	3300005347	Bacteria	1047
37	Ga0070669_100425531	3300005353	Bacteria	1090
38	Ga0070675_100178981	3300005354	Bacteria	1832
39	Ga0070671_100130874	3300005355	Bacteria	2113
40	Ga0070674_100007645	3300005356	Bacteria	6383
41	Ga0070674_100050184	3300005356	Bacteria	2872
42	Ga0070673_100759091	3300005364	Bacteria	893
43	Ga0070673_101157450	3300005364	Bacteria	724
44	Ga0070688_100271284	3300005365	Bacteria	1215
45	Ga0070688_100497133	3300005365	Bacteria	919
46	Ga0070659_100145270	3300005366	Bacteria	1932
47	Ga0070659_100612486	3300005366	Bacteria	937
48	Ga0070667_100411748	3300005367	Bacteria	1232
49	Ga0070714_100121097	3300005435	Bacteria	2328
50	Ga0070714_100241367	3300005435	Bacteria	1668
51	Ga0070713_100010275	3300005436	Bacteria	6758
52	Ga0070713_100176956	3300005436	Bacteria	1915
53	Ga0070713_101134942	3300005436	Bacteria	756
54	Ga0070701_10032376	3300005438	Bacteria	2602
55	Ga0070701_10047195	3300005438	Bacteria	2217
56	Ga0070711_100267944	3300005439	Bacteria	1347
57	Ga0070711_100412532	3300005439	Bacteria	1099
58	Ga0070705_100164149	3300005440	Bacteria	1488
59	Ga0070705_100547035	3300005440	Bacteria	887
60	Ga0070700_100207092	3300005441	Bacteria	1381
61	Ga0070700_100487955	3300005441	Bacteria	945
62	Ga0070708_100022040	3300005445	Bacteria	5399
63	Ga0070663_100044064	3300005455	Bacteria	3143
64	Ga0070663_100086097	3300005455	Bacteria	2320
65	Ga0070663_100154382	3300005455	Bacteria	1763
66	Ga0070663_100187216	3300005455	Bacteria	1609
67	Ga0070663_100441891	3300005455	Bacteria	1070
68	Ga0070663_100799809	3300005455	Bacteria	808
69	Ga0070678_100089066	3300005456	Bacteria	2361
70	Ga0070678_100220875	3300005456	Bacteria	1575
71	Ga0070678_100293289	3300005456	Bacteria	1380
72	Ga0070678_100426195	3300005456	Bacteria	1157
73	Ga0070678_100814686	3300005456	Bacteria	848
74	Ga0070662_100222481	3300005457	Bacteria	1506
75	Ga0070681_10010339	3300005458	Bacteria	9211
76	Ga0070681_10146140	3300005458	Bacteria	2293
77	Ga0070681_10782510	3300005458	Bacteria	871
78	Ga0068867_100020024	3300005459	Bacteria	4768
79	Ga0068867_100207822	3300005459	Bacteria	1570
80	Ga0070685_10070010	3300005466	Bacteria	2076
81	Ga0070685_10530809	3300005466	Bacteria	837
82	Ga0070706_100259303	3300005467	Bacteria	1623
83	Ga0070707_100088681	3300005468	Bacteria	2992
84	Ga0070699_100201372	3300005518	Bacteria	1770
85	Ga0070679_100017059	3300005530	Bacteria	7019
86	Ga0070679_100043008	3300005530	Bacteria	4499
87	Ga0070679_100941009	3300005530	Bacteria	808
88	Ga0070684_100007403	3300005535	Bacteria	8533
89	Ga0070684_100065228	3300005535	Bacteria	3196
90	Ga0070684_100773382	3300005535	Bacteria	897
91	Ga0070697_100722321	3300005536	Bacteria	880
92	Ga0068853_100244989	3300005539	Bacteria	1644
93	Ga0068853_100721384	3300005539	Bacteria	952
94	Ga0070672_100060622	3300005543	Bacteria	2979
95	Ga0070672_100206859	3300005543	Bacteria	1643
96	Ga0070696_100145872	3300005546	Bacteria	1733
97	Ga0070696_100471424	3300005546	Bacteria	994
98	Ga0070696_100477014	3300005546	Bacteria	988
99	Ga0070693_100341891	3300005547	Bacteria	1021
100	Ga0070665_100224798	3300005548	Bacteria	1877
101	Ga0070665_100703544	3300005548	Bacteria	1023
102	Ga0068855_100003023	3300005563	Bacteria	20577
103	Ga0068855_100032053	3300005563	Bacteria	6275
104	Ga0068855_100315927	3300005563	Bacteria	1728
105	Ga0070664_100034166	3300005564	Bacteria	4265
106	Ga0070664_100545681	3300005564	Bacteria	1072
107	Ga0070664_100606329	3300005564	Bacteria	1016
108	Ga0068854_100454254	3300005578	Bacteria	1071
109	Ga0068854_101138903	3300005578	Bacteria	697
110	Ga0068856_100072308	3300005614	Bacteria	3415
111	Ga0070702_100035143	3300005615	Bacteria	2767
112	Ga0070702_100042749	3300005615	Bacteria	2549
113	Ga0070702_100135437	3300005615	Bacteria	1562
114	Ga0070702_100437287	3300005615	Bacteria	946
115	Ga0068852_100042910	3300005616	Bacteria	3832
116	Ga0068852_100398894	3300005616	Bacteria	1353
117	Ga0068859_100887809	3300005617	Bacteria	976
118	Ga0068859_100996175	3300005617	Bacteria	920
119	Ga0068864_100243560	3300005618	Bacteria	1667
120	Ga0068866_10064519	3300005718	Bacteria	1912
121	Ga0068861_100438602	3300005719	Bacteria	1167
122	Ga0068870_10035639	3300005840	Bacteria	2555
123	Ga0068863_100082674	3300005841	Bacteria	3044
124	Ga0068863_100283478	3300005841	Bacteria	1606
125	Ga0068863_100313459	3300005841	Bacteria	1523
126	Ga0068863_100583078	3300005841	Bacteria	1106
127	Ga0068858_100031889	3300005842	Bacteria	4897
128	Ga0068858_100692078	3300005842	Bacteria	992
129	Ga0068858_101069730	3300005842	Bacteria	791
130	Ga0068860_100079510	3300005843	Bacteria	3118
131	Ga0068860_101298411	3300005843	Bacteria	748
132	Ga0068862_100040181	3300005844	Bacteria	3976
133	Ga0068862_100066032	3300005844	Bacteria	3117
134	Ga0068862_100226739	3300005844	Bacteria	1693
135	Ga0068862_100272907	3300005844	Bacteria	1547
136	Ga0068862_101672090	3300005844	Bacteria	644
137	Ga0081455_10015473	3300005937	Bacteria	7410
138	Ga0081455_10055763	3300005937	Bacteria	3360
139	Ga0081455_10279684	3300005937	Bacteria	1206
140	Ga0081540_1000136	3300005983	Bacteria	78663
141	Ga0081540_1002694	3300005983	Bacteria	14452
142	Ga0081540_1003284	3300005983	Bacteria	12855
143	Ga0081540_1017176	3300005983	Bacteria	4489
144	Ga0081540_1046754	3300005983	Bacteria	2182
145	Ga0070717_10006942	3300006028	Bacteria	8368
146	Ga0070717_11100359	3300006028	Bacteria	724
147	Ga0075365_10394859	3300006038	Bacteria	976
148	Ga0075365_10550049	3300006038	Bacteria	816
149	Ga0075368_10068569	3300006042	Bacteria	1429
150	Ga0075363_100004820	3300006048	Bacteria	5953
151	Ga0075364_10146771	3300006051	Bacteria	1588
152	Ga0075364_10583538	3300006051	Bacteria	764
153	Ga0070715_10306404	3300006163	Bacteria	852
154	Ga0070716_100030634	3300006173	Bacteria	2921
155	Ga0070716_100055126	3300006173	Bacteria	2274
156	Ga0070716_100132426	3300006173	Bacteria	1578
157	Ga0070712_100235671	3300006175	Bacteria	1456
158	Ga0070712_100250555	3300006175	Bacteria	1415
159	Ga0075362_10123678	3300006177	Bacteria	1226
160	Ga0075367_10377543	3300006178	Bacteria	895
161	Ga0075369_10034195	3300006186	Bacteria	2157
162	Ga0075369_10050214	3300006186	Bacteria	1803
163	Ga0075369_10171134	3300006186	Bacteria	997
164	Ga0075366_10201274	3300006195	Bacteria	1211
165	Ga0097621_100196143	3300006237	Bacteria	1751
166	Ga0075370_10496315	3300006353	Bacteria	736
167	Ga0068871_100127534	3300006358	Bacteria	2155
168	Ga0075428_100065917	3300006844	Bacteria	3966
169	Ga0075428_100114252	3300006844	Bacteria	2941
170	Ga0075433_10693992	3300006852	Bacteria	892
171	Ga0075434_100067371	3300006871	Bacteria	3566
172	Ga0068865_100233609	3300006881	Bacteria	1444
173	Ga0068865_100683196	3300006881	Bacteria	875
174	Ga0097620_100887888	3300006931	Bacteria	976
175	Ga0097620_100996251	3300006931	Bacteria	920
176	Ga0105250_10059349	3300009092	Bacteria	1536
177	Ga0105250_10073381	3300009092	Bacteria	1384
178	Ga0105240_10038716	3300009093	Bacteria	6114
179	Ga0111539_10100424	3300009094	Bacteria	3398
180	Ga0111539_10433427	3300009094	Bacteria	1531
181	Ga0111539_12140220	3300009094	Bacteria	649
182	Ga0105245_10031330	3300009098	Bacteria	4705
183	Ga0105245_10315793	3300009098	Bacteria	1538
184	Ga0105247_10076877	3300009101	Bacteria	2097
185	Ga0105247_10187933	3300009101	Bacteria	1382
186	Ga0105247_10208359	3300009101	Bacteria	1317
187	Ga0114129_10085849	3300009147	Bacteria	4366
188	Ga0105243_10175945	3300009148	Bacteria	1857
189	Ga0105243_10843399	3300009148	Bacteria	907
190	Ga0105243_11053881	3300009148	Bacteria	819
191	Ga0105242_10108112	3300009176	Bacteria	2366
192	Ga0105242_10215584	3300009176	Bacteria	1713
193	Ga0105242_12535964	3300009176	Bacteria	561
194	Ga0105248_10118433	3300009177	Bacteria	2987
195	Ga0105248_10478290	3300009177	Bacteria	1404
196	Ga0105248_10626435	3300009177	Bacteria	1214
197	Ga0105248_11110761	3300009177	Bacteria	894
198	Ga0105248_11598787	3300009177	Bacteria	738
199	Ga0105237_10002239	3300009545	Bacteria	24152
200	Ga0105237_10080273	3300009545	Bacteria	3252
201	Ga0105237_10204224	3300009545	Bacteria	1976
202	Ga0105237_11061428	3300009545	Bacteria	817
203	Ga0105238_10054766	3300009551	Bacteria	4005
204	Ga0105238_10142623	3300009551	Bacteria	2372
205	Ga0105238_10554074	3300009551	Bacteria	1154
206	Ga0105238_10808944	3300009551	Bacteria	953
207	Ga0099796_10070297	3300010159	Bacteria	1262
208	Ga0105239_10015382	3300010375	Bacteria	8477
209	Ga0105239_10053264	3300010375	Bacteria	4438
210	Ga0105239_10070875	3300010375	Bacteria	3829
211	Ga0105239_10095982	3300010375	Bacteria	3275
212	Ga0105239_10717274	3300010375	Bacteria	1144
213	Ga0105239_11389049	3300010375	Bacteria	811
214	Ga0105246_10011321	3300011119	Bacteria	5536
215	Ga0105246_10475482	3300011119	Bacteria	1056
216	Ga0157370_10215983	3300013104	Bacteria	1777
217	Ga0157370_10316608	3300013104	Bacteria	1440
218	Ga0157369_10010134	3300013105	Bacteria	10756
219	Ga0157369_10012483	3300013105	Bacteria	9638
220	Ga0157369_11074110	3300013105	Bacteria	823
221	Ga0157374_10197400	3300013296	Bacteria	1969
222	Ga0157374_10254788	3300013296	Bacteria	1727
223	Ga0157374_10996916	3300013296	Bacteria	857
224	Ga0157374_11257552	3300013296	Bacteria	762
225	Ga0157378_10009924	3300013297	Bacteria	8300
226	Ga0157378_10092354	3300013297	Bacteria	2754
227	Ga0157378_10323074	3300013297	Bacteria	1500
228	Ga0163162_10087246	3300013306	Bacteria	3199
229	Ga0163162_10151024	3300013306	Bacteria	2441
230	Ga0163162_10409890	3300013306	Bacteria	1488
231	Ga0163162_10467021	3300013306	Bacteria	1393
232	Ga0163162_10500398	3300013306	Bacteria	1346
233	Ga0157372_10040112	3300013307	Bacteria	5169
234	Ga0157372_10685633	3300013307	Bacteria	1193
235	Ga0157375_10207380	3300013308	Bacteria	2117
236	Ga0157375_10229597	3300013308	Bacteria	2015
237	Ga0157375_10303746	3300013308	Bacteria	1759
238	Ga0157375_10461069	3300013308	Bacteria	1436
239	Ga0157375_10825504	3300013308	Bacteria	1075
240	Ga0157375_11338128	3300013308	Bacteria	843
241	Ga0163163_10005218	3300014325	Bacteria	11206
242	Ga0163163_10320542	3300014325	Bacteria	1603
243	Ga0163163_10400488	3300014325	Bacteria	1431
244	Ga0163163_10948120	3300014325	Bacteria	924
245	Ga0163163_12290552	3300014325	Bacteria	599
246	Ga0157380_11362017	3300014326	Bacteria	759
247	Ga0157380_11510137	3300014326	Bacteria	725
248	Ga0157379_10482118	3300014968	Bacteria	1148
249	Ga0157379_10713027	3300014968	Bacteria	942
250	Ga0157376_10004919	3300014969	Bacteria	9313
251	Ga0157376_11240303	3300014969	Bacteria	774
252	Ga0182006_1182580	3300015261	Bacteria	699
253	Ga0163161_10061568	3300017792	Bacteria	2732
254	Ga0214544_1000002	3300021320	Bacteria	753857
255	Ga0214542_1000001	3300021321	Bacteria	1018696
256	Ga0214545_1000001	3300021324	Bacteria	1092817
257	Ga0214545_1035778	3300021324	Bacteria	1619
258	Ga0214543_1000001	3300021327	Bacteria	776921
259	Ga0213873_10028727	3300021358	Bacteria	1366
260	Ga0213876_10002470	3300021384	Bacteria	10852
261	Ga0207673_1018247	3300025290	Bacteria	939
262	Ga0209758_1001025	3300025297	Bacteria	36697
263	Ga0207697_10031735	3300025315	Bacteria	2160
264	Ga0207697_10208722	3300025315	Bacteria	860
265	Ga0207682_10131823	3300025893	Bacteria	1116
266	Ga0207642_10051644	3300025899	Bacteria	1861
267	Ga0207710_10324834	3300025900	Bacteria	781
268	Ga0207688_10695000	3300025901	Bacteria	643
269	Ga0207680_10463946	3300025903	Bacteria	900
270	Ga0207645_10121693	3300025907	Bacteria	1694
271	Ga0207645_10202577	3300025907	Bacteria	1306
272	Ga0207645_10284791	3300025907	Bacteria	1098
273	Ga0207643_10137059	3300025908	Bacteria	1460
274	Ga0207643_10533787	3300025908	Bacteria	752
275	Ga0207705_10409394	3300025909	Bacteria	1049
276	Ga0207684_10251257	3300025910	Bacteria	1526
277	Ga0207654_10088179	3300025911	Bacteria	1885
278	Ga0207654_10553657	3300025911	Bacteria	817
279	Ga0207707_10125345	3300025912	Bacteria	2246
280	Ga0207695_10009431	3300025913	Bacteria	12072
281	Ga0207671_10243666	3300025914	Bacteria	1412
282	Ga0207671_10819340	3300025914	Bacteria	738
283	Ga0207693_10089167	3300025915	Bacteria	2417
284	Ga0207693_10195062	3300025915	Bacteria	1593
285	Ga0207693_10570215	3300025915	Bacteria	882
286	Ga0207660_10091846	3300025917	Bacteria	2252
287	Ga0207660_10582441	3300025917	Bacteria	911
288	Ga0207660_10808688	3300025917	Bacteria	765
289	Ga0207660_11413272	3300025917	Bacteria	564
290	Ga0207657_10000784	3300025919	Bacteria	33773
291	Ga0207657_10297522	3300025919	Bacteria	1279
292	Ga0207657_10301990	3300025919	Bacteria	1268
293	Ga0207649_10068978	3300025920	Bacteria	2250
294	Ga0207649_10630891	3300025920	Bacteria	826
295	Ga0207649_10658761	3300025920	Bacteria	809
296	Ga0207652_10026574	3300025921	Bacteria	4824
297	Ga0207652_10608749	3300025921	Bacteria	979
298	Ga0207646_10081518	3300025922	Bacteria	2893
299	Ga0207681_10319895	3300025923	Bacteria	1233
300	Ga0207694_10038951	3300025924	Bacteria	3656
301	Ga0207694_10201996	3300025924	Bacteria	1617
302	Ga0207694_10529359	3300025924	Bacteria	988
303	Ga0207650_10163067	3300025925	Bacteria	1767
304	Ga0207659_10365366	3300025926	Bacteria	1200
305	Ga0207659_11031694	3300025926	Bacteria	708
306	Ga0207687_10025922	3300025927	Bacteria	3924
307	Ga0207687_10760096	3300025927	Bacteria	825
308	Ga0207700_10120677	3300025928	Bacteria	2125
309	Ga0207700_10778581	3300025928	Bacteria	855
310	Ga0207664_10096819	3300025929	Bacteria	2430
311	Ga0207664_10202353	3300025929	Bacteria	1715
312	Ga0207706_10047791	3300025933	Bacteria	3786
313	Ga0207706_10148397	3300025933	Bacteria	2063
314	Ga0207706_10290648	3300025933	Bacteria	1425
315	Ga0207686_10258183	3300025934	Bacteria	1276
316	Ga0207709_10066147	3300025935	Bacteria	2276
317	Ga0207709_10529271	3300025935	Bacteria	924
318	Ga0207670_10344002	3300025936	Bacteria	1179
319	Ga0207670_10382852	3300025936	Bacteria	1121
320	Ga0207670_10758334	3300025936	Bacteria	806
321	Ga0207669_10018683	3300025937	Bacteria	3590
322	Ga0207669_10045638	3300025937	Bacteria	2583
323	Ga0207669_10757738	3300025937	Bacteria	802
324	Ga0207704_11082732	3300025938	Bacteria	680
325	Ga0207665_10078163	3300025939	Bacteria	2272
326	Ga0207665_10227420	3300025939	Bacteria	1370
327	Ga0207665_10236017	3300025939	Bacteria	1346
328	Ga0207665_10402270	3300025939	Bacteria	1043
329	Ga0207691_10048908	3300025940	Bacteria	3875
330	Ga0207691_10198496	3300025940	Bacteria	1747
331	Ga0207711_10019599	3300025941	Bacteria	5631
332	Ga0207689_10055708	3300025942	Bacteria	3254
333	Ga0207689_10460497	3300025942	Bacteria	1063
334	Ga0207689_10811391	3300025942	Bacteria	790
335	Ga0207661_10542790	3300025944	Bacteria	1065
336	Ga0207661_10871750	3300025944	Bacteria	829
337	Ga0207679_10028273	3300025945	Bacteria	3888
338	Ga0207679_10090770	3300025945	Bacteria	2362
339	Ga0207679_10760842	3300025945	Bacteria	881
340	Ga0207667_10039055	3300025949	Bacteria	5061
341	Ga0207667_10789181	3300025949	Bacteria	947
342	Ga0207667_11177075	3300025949	Bacteria	747
343	Ga0207712_10360816	3300025961	Bacteria	1211
344	Ga0207712_11570297	3300025961	Bacteria	590
345	Ga0207668_10115858	3300025972	Bacteria	2019
346	Ga0207668_10187657	3300025972	Bacteria	1636
347	Ga0207668_10313965	3300025972	Bacteria	1298
348	Ga0207668_10853379	3300025972	Bacteria	808
349	Ga0207668_11552542	3300025972	Bacteria	597
350	Ga0207640_10406556	3300025981	Bacteria	1110
351	Ga0207640_10865050	3300025981	Bacteria	787
352	Ga0207658_11249175	3300025986	Bacteria	679
353	Ga0207677_10076948	3300026023	Bacteria	2377
354	Ga0207677_10136957	3300026023	Bacteria	1868
355	Ga0207677_10187195	3300026023	Bacteria	1634
356	Ga0207677_10235816	3300026023	Bacteria	1477
357	Ga0207677_10719309	3300026023	Bacteria	887
358	Ga0207677_11880770	3300026023	Bacteria	556
359	Ga0207703_10131454	3300026035	Bacteria	2162
360	Ga0207703_10179271	3300026035	Bacteria	1869
361	Ga0207703_10317296	3300026035	Bacteria	1426
362	Ga0207639_10605090	3300026041	Bacteria	1011
363	Ga0207639_10781981	3300026041	Bacteria	889
364	Ga0207678_10037212	3300026067	Bacteria	4234
365	Ga0207678_10153356	3300026067	Bacteria	1967
366	Ga0207678_10220356	3300026067	Bacteria	1624
367	Ga0207678_10274850	3300026067	Bacteria	1445
368	Ga0207678_10280298	3300026067	Bacteria	1430
369	Ga0207678_10433812	3300026067	Bacteria	1140
370	Ga0207708_10488576	3300026075	Bacteria	1030
371	Ga0207708_10581060	3300026075	Bacteria	947
372	Ga0207641_10018331	3300026088	Bacteria	5738
373	Ga0207641_10098286	3300026088	Bacteria	2574
374	Ga0207641_10225237	3300026088	Bacteria	1741
375	Ga0207641_11301072	3300026088	Bacteria	727
376	Ga0207648_10025820	3300026089	Bacteria	5227
377	Ga0207648_10477439	3300026089	Bacteria	1138
378	Ga0207676_10094773	3300026095	Bacteria	2460
379	Ga0207676_10545106	3300026095	Bacteria	1107
380	Ga0207676_11888177	3300026095	Bacteria	596
381	Ga0207674_10215991	3300026116	Bacteria	1866
382	Ga0207675_100035028	3300026118	Bacteria	4681
383	Ga0207675_100041238	3300026118	Bacteria	4311
384	Ga0207675_100264237	3300026118	Bacteria	1668
385	Ga0207675_101924525	3300026118	Bacteria	610
386	Ga0207683_10050062	3300026121	Bacteria	3659
387	Ga0207683_10087234	3300026121	Bacteria	2775
388	Ga0207683_10420463	3300026121	Bacteria	1231
389	Ga0207683_10426560	3300026121	Bacteria	1222
390	Ga0207683_10573586	3300026121	Bacteria	1044
391	Ga0207698_10331680	3300026142	Bacteria	1429
392	Ga0207698_10371445	3300026142	Bacteria	1358
393	Ga0209813_10176274	3300027866	Bacteria	779
394	Ga0207428_10321642	3300027907	Bacteria	1142
395	Ga0268266_10001919	3300028379	Bacteria	23365
396	Ga0268266_10002779	3300028379	Bacteria	18266
397	Ga0268266_10104118	3300028379	Bacteria	2505
398	Ga0268266_10702727	3300028379	Bacteria	974
399	Ga0268266_10725901	3300028379	Bacteria	958
400	Ga0268265_10317916	3300028380	Bacteria	1408
401	Ga0268265_10624867	3300028380	Bacteria	1032
402	Ga0268265_11561698	3300028380	Bacteria	664
403	Ga0268264_10000043	3300028381	Bacteria	371761
404	Ga0268264_10033691	3300028381	Bacteria	4211
405	Ga0268264_10154443	3300028381	Bacteria	2061
406	Ga0265336_10035778	3300028666	Bacteria	1531
407	Ga0307517_10000063	3300028786	Bacteria	144304
408	Ga0307515_10534978	3300028794	Bacteria	781
409	Ga0265338_10061068	3300028800	Bacteria	3305
410	Ga0307511_10209660	3300030521	Bacteria	997
411	Ga0265330_10009689	3300031235	Bacteria	4566
412	Ga0265325_10011986	3300031241	Bacteria	4967
413	Ga0265340_10003402	3300031247	Bacteria	8987
414	Ga0265340_10125666	3300031247	Bacteria	1178
415	Ga0265339_10067376	3300031249	Bacteria	1914
416	Ga0307408_101280852	3300031548	Bacteria	686
417	Ga0307508_10000010	3300031616	Bacteria	255747
418	Ga0307508_10014670	3300031616	Bacteria	7147
419	Ga0307508_10414776	3300031616	Bacteria	938
420	Ga0307508_10457603	3300031616	Bacteria	869
421	Ga0307508_10525031	3300031616	Bacteria	780
422	Ga0265342_10056727	3300031712	Bacteria	2320
423	Ga0265342_10119181	3300031712	Bacteria	1487
424	Ga0307516_10222002	3300031730	Bacteria	1598
425	Ga0307405_11746251	3300031731	Bacteria	552
426	Ga0307413_10100977	3300031824	Bacteria	1906
427	Ga0307413_10111460	3300031824	Bacteria	1832
428	Ga0307410_10251121	3300031852	Bacteria	1375
429	Ga0307407_10255048	3300031903	Bacteria	1204
430	Ga0307412_10471370	3300031911	Bacteria	1039
431	Ga0307416_100397663	3300032002	Bacteria	1414
432	Ga0307416_100595776	3300032002	Bacteria	1184
433	Ga0307414_10778866	3300032004	Bacteria	871
434	Ga0307411_10116011	3300032005	Bacteria	1927
435	Ga0307510_10229266	3300033180	Bacteria	1361
436	Ga0373930_0092602	3300034816	Bacteria	710
437	Ga0373959_0044885	3300034820	Bacteria	939
438	Ga0373929_0010642	3300035085	Bacteria	1723
439	Ga0373934_0041894	3300035086	Bacteria	1808
440	Ga0373940_0030764	3300035088	Bacteria	1430
441	Ga0373944_0223338	3300035089	Bacteria	688
442	Ga0373949_0139366	3300035090	Bacteria	694
443	Ga0373952_0004283	3300035092	Bacteria	2583
444	Ga0373923_0022342	3300035111	Bacteria	2480
445	Ga0373932_0346984	3300035112	Bacteria	564
446	Ga0373936_0097700	3300035113	Bacteria	1237
447	Ga0373941_0086059	3300035115	Bacteria	1070
448	Ga0373941_0338866	3300035115	Bacteria	609
449	Ga0373943_0037733	3300035170	Bacteria	2320
450	Ga0373943_0382959	3300035170	Bacteria	810
451	Ga0373955_0060689	3300035172	Bacteria	2086
452	Ga0373924_0020261	3300035410	Bacteria	2583
453	Ga0373931_0009393	3300035691	Bacteria	4675
454	Ga0373935_0004357	3300035692	Bacteria	8307
455	Ga0373935_0008594	3300035692	Bacteria	6110
456	Ga0373935_0115339	3300035692	Bacteria	1788
457	Ga0373927_0002258	3300035695	Bacteria	14120
458	Ga0373927_0060753	3300035695	Bacteria	2445
459	Ga0373927_0116167	3300035695	Bacteria	1745
460	Ga0373927_0140502	3300035695	Bacteria	1579
461	Ga0373933_0189809	3300035724	Bacteria	1312
462	Ga0373947_0002634	3300035725	Bacteria	10777
463	Ga0373947_0023496	3300035725	Bacteria	3587
464	Ga0373947_0068387	3300035725	Bacteria	2172
465	Ga0373947_0244070	3300035725	Bacteria	1186
466	Ga0373937_0122685	3300036401	Bacteria	2422
467	Ga0373937_0155295	3300036401	Bacteria	2144
468	Ga0373937_0619546	3300036401	Bacteria	1027
469	Ga0373925_0008340	3300037068	Bacteria	7544
470	Ga0373925_0548134	3300037068	Bacteria	951
471	Ga0373925_0548920	3300037068	Bacteria	950
472	Ga0395899_0139395	3300037312	Bacteria	1727
473	Ga0395900_0044059	3300037418	Bacteria	4599
474	Ga0395898_0051661	3300037466	Bacteria	4019
475	Ga0436364_0975533	3300037853	Bacteria	2416
476	Ga0395901_0837210	3300038443	Bacteria	906
477	Ga0436365_0163014	3300039437	Bacteria	2402
478	Ga0436365_0508090	3300039437	Bacteria	5532
479	Ga0436365_0589211	3300039437	Bacteria	844
480	Ga0436365_1190006	3300039437	Bacteria	14387
481	Ga0436360_0226663	3300039438	Bacteria	590
482	Ga0436360_1352026	3300039438	Bacteria	609
483	Ga0436363_0850716	3300039450	Bacteria	1137
484	Ga0436362_1192450	3300039453	Bacteria	7407
485	Ga0451797_1020677	3300041453	Bacteria	847
486	Ga0451795_0541422	3300041456	Bacteria	978
487	Ga0451807_2622904	3300041486	Bacteria	1312
488	Ga0451839_1163861	3300041496	Bacteria	766
489	Ga0451845_0217232	3300041501	Bacteria	869
490	Ga0451853_1762699	3300041512	Bacteria	1174
491	Ga0451853_2570889	3300041512	Bacteria	671
492	Ga0439431_0050249	3300041997	Bacteria	1080
493	Ga0439434_0210318	3300042435	Bacteria	658
494	Ga0466971_0012320	3300044719	Bacteria	3746
495	Ga0466970_0123467	3300044765	Bacteria	1419
496	Ga0466957_0207749	3300044842	Bacteria	1288
497	Ga0466959_0064221	3300045049	Bacteria	2665
498	Ga0466958_0111995	3300045836	Bacteria	1704
499	Ga0466958_0164205	3300045836	Bacteria	1404
500	Ga0495592_0157706	3300046454	Bacteria	1564
501	Ga0495592_0159799	3300046454	Bacteria	1551
502	Ga0495592_0834286	3300046454	Bacteria	546
503	Ga0495603_0000676	3300046455	Bacteria	19328
504	Ga0495603_0265566	3300046455	Bacteria	987
505	Ga0495591_069584	3300046458	Bacteria	917
506	Ga0495629_0231277	3300046459	Bacteria	1274
507	Ga0495629_0231914	3300046459	Bacteria	1272
508	Ga0495629_0327051	3300046459	Bacteria	1047
509	Ga0495629_0707476	3300046459	Bacteria	669
510	Ga0495641_0005779	3300046461	Bacteria	8216
511	Ga0495641_0059296	3300046461	Bacteria	1730
512	Ga0495651_0114580	3300046462	Bacteria	1989
513	Ga0495580_0951641	3300046472	Bacteria	550
514	Ga0495582_0000177	3300046473	Bacteria	34588
515	Ga0495582_0064536	3300046473	Bacteria	2022
516	Ga0495639_0156346	3300046475	Bacteria	1102
517	Ga0495639_0171384	3300046475	Bacteria	1053
518	Ga0495662_0000028	3300046476	Bacteria	51556
519	Ga0495664_0013279	3300046477	Bacteria	4671
520	Ga0495664_0406649	3300046477	Bacteria	817
521	Ga0495584_0032145	3300046491	Bacteria	2657
522	Ga0495585_0140898	3300046492	Bacteria	1263
523	Ga0495585_0170754	3300046492	Bacteria	1123
524	Ga0495594_0000020	3300046499	Bacteria	80534
525	Ga0495606_0004986	3300046507	Bacteria	12946
526	Ga0495606_0564624	3300046507	Bacteria	564
527	Ga0495608_0220879	3300046511	Bacteria	1189
528	Ga0495610_0048384	3300046512	Bacteria	2087
529	Ga0495616_0189004	3300046513	Bacteria	911
530	Ga0495618_0731070	3300046514	Bacteria	580
531	Ga0495630_0003026	3300046517	Bacteria	11659
532	Ga0495630_0028188	3300046517	Bacteria	4172
533	Ga0495630_0455892	3300046517	Bacteria	980
534	Ga0495637_0197147	3300046520	Bacteria	741
535	Ga0495637_0235144	3300046520	Bacteria	663
536	Ga0495644_0049011	3300046523	Bacteria	1586
537	Ga0495644_0247130	3300046523	Bacteria	692
538	Ga0495648_0095800	3300046524	Bacteria	1650
539	Ga0495666_0081834	3300046526	Bacteria	1527
540	Ga0495652_0036711	3300046529	Bacteria	4258
541	Ga0495652_0906265	3300046529	Bacteria	581
542	Ga0495665_0000057	3300046531	Bacteria	44876
543	Ga0495665_0495319	3300046531	Bacteria	616
544	Ga0495640_0009965	3300046533	Bacteria	7367
545	Ga0495640_0022817	3300046533	Bacteria	4570
546	Ga0495640_0072851	3300046533	Bacteria	2300
547	Ga0495587_0584005	3300046536	Bacteria	616
548	Ga0495621_0198836	3300046539	Bacteria	806
549	Ga0495597_0145441	3300046542	Bacteria	975
550	Ga0495597_0221203	3300046542	Bacteria	752
551	Ga0495622_0003396	3300046557	Bacteria	7510
552	Ga0495622_0146398	3300046557	Bacteria	1070
553	Ga0495667_0219763	3300046559	Bacteria	1213
554	Ga0495656_0100701	3300046615	Bacteria	1336
555	Ga0495668_0320896	3300046616	Bacteria	849
556	Ga0495634_0000324	3300046642	Bacteria	46211
557	Ga0495634_0014597	3300046642	Bacteria	5660
558	Ga0495634_0239917	3300046642	Bacteria	1112
559	Ga0495611_0109511	3300046648	Bacteria	1285
560	Ga0495625_0059002	3300046660	Bacteria	2724
561	Ga0495635_0000496	3300046663	Bacteria	24850
562	Ga0495635_0838383	3300046663	Bacteria	591
563	Ga0495588_0003434	3300046674	Bacteria	6887
564	Ga0495646_0103828	3300046680	Bacteria	1626
565	Ga0495646_0159192	3300046680	Bacteria	1251
566	Ga0495647_0183690	3300046681	Bacteria	911
567	Ga0495658_0007012	3300046683	Bacteria	5558
568	Ga0495658_0277471	3300046683	Bacteria	1057
569	Ga0495669_0010274	3300046684	Bacteria	3955
570	Ga0495613_0004688	3300046689	Bacteria	10257
571	Ga0495624_0252414	3300046690	Bacteria	1067
572	Ga0495671_0108683	3300046692	Bacteria	1354
573	Ga0495649_0106711	3300046694	Bacteria	1486
574	Ga0495589_0137655	3300046794	Bacteria	1170
575	Ga0495581_0006881	3300047315	Bacteria	6593
576	Ga0495604_0333125	3300047317	Bacteria	1012
577	Ga0495604_0479750	3300047317	Bacteria	809
578	Ga0495674_0024210	3300047319	Bacteria	5583
579	Ga0495674_0145108	3300047319	Bacteria	1993
580	Ga0495672_0009800	3300047320	Bacteria	6895
581	Ga0495676_0063040	3300047321	Bacteria	2891
582	Ga0495676_0137424	3300047321	Bacteria	1756
583	Ga0495675_0446468	3300047444	Bacteria	749
584	Ga0495677_0029189	3300047445	Bacteria	2005
585	Ga0495685_034944	3300047447	Bacteria	1727
586	Ga0495673_0164432	3300047469	Bacteria	850
587	Ga0495673_0183702	3300047469	Bacteria	790
588	Ga0495684_0020958	3300047471	Bacteria	5035
589	Ga0495686_0063144	3300047472	Bacteria	2296
590	Ga0495686_0068038	3300047472	Bacteria	2197
591	Ga0495593_0067263	3300047673	Bacteria	1865
592	Ga0495615_0020027	3300048090	Bacteria	1494
593	Ga0496100_0006178	3300048903	Bacteria	6514
594	Ga0496100_0035526	3300048903	Bacteria	3135
595	Ga0496100_0048766	3300048903	Bacteria	2735
596	Ga0496100_0132185	3300048903	Bacteria	1759
597	Ga0496100_1302928	3300048903	Bacteria	573
598	Ga0496101_0007887	3300048904	Bacteria	6930
599	Ga0496101_0014276	3300048904	Bacteria	5335
600	Ga0496101_0106766	3300048904	Bacteria	2103
601	Ga0496101_0180558	3300048904	Bacteria	1625
602	Ga0496101_0187689	3300048904	Bacteria	1594
603	Ga0496101_0222186	3300048904	Bacteria	1466
604	Ga0496101_0549085	3300048904	Bacteria	913
605	Ga0496102_0005734	3300048905	Bacteria	10553
606	Ga0496102_0048507	3300048905	Bacteria	3861
607	Ga0496102_0064455	3300048905	Bacteria	3356
608	Ga0496102_0068279	3300048905	Bacteria	3261
609	Ga0496102_0114709	3300048905	Bacteria	2513
610	Ga0496102_0186056	3300048905	Bacteria	1957
611	Ga0496102_0261712	3300048905	Bacteria	1631
612	Ga0496102_0316218	3300048905	Bacteria	1471
613	Ga0496102_0357950	3300048905	Bacteria	1374
614	Ga0496102_1051141	3300048905	Bacteria	734
615	Ga0496102_1341029	3300048905	Bacteria	634
616	Ga0496103_0023313	3300048906	Bacteria	3732
617	Ga0496103_0035178	3300048906	Bacteria	3066
618	Ga0496103_0058756	3300048906	Bacteria	2389
619	Ga0496103_0188693	3300048906	Bacteria	1325
620	Ga0496104_0007944	3300048907	Bacteria	9407
621	Ga0496104_0017208	3300048907	Bacteria	6577
622	Ga0496104_0138922	3300048907	Bacteria	2335
623	Ga0496104_0150175	3300048907	Bacteria	2237
624	Ga0496104_0634850	3300048907	Bacteria	977
625	Ga0496105_0045859	3300048908	Bacteria	3606
626	Ga0496105_0190761	3300048908	Bacteria	1675
627	Ga0496105_0330913	3300048908	Bacteria	1219
628	Ga0496105_0418700	3300048908	Bacteria	1061
629	Ga0496106_0001783	3300048909	Bacteria	16071
630	Ga0496106_0007982	3300048909	Bacteria	7822
631	Ga0496106_0070834	3300048909	Bacteria	2663
632	Ga0496106_0098878	3300048909	Bacteria	2261
633	Ga0496106_0153155	3300048909	Bacteria	1819
634	Ga0496106_0341996	3300048909	Bacteria	1202
635	Ga0496106_0474117	3300048909	Bacteria	1005
636	Ga0496107_0001739	3300048910	Bacteria	13695
637	Ga0496107_0048126	3300048910	Bacteria	3071
638	Ga0496107_0053497	3300048910	Bacteria	2912
639	Ga0496107_0053815	3300048910	Bacteria	2903
640	Ga0496107_0155167	3300048910	Bacteria	1695
641	Ga0496107_0786694	3300048910	Bacteria	697
642	Ga0496108_0052299	3300048911	Bacteria	3422
643	Ga0496108_0119792	3300048911	Bacteria	2256
644	Ga0496108_0245547	3300048911	Bacteria	1557
645	Ga0496108_0318428	3300048911	Bacteria	1356
646	Ga0496108_0526989	3300048911	Bacteria	1031
647	Ga0496108_0616597	3300048911	Bacteria	945
648	Ga0496108_1397905	3300048911	Bacteria	585
649	Ga0496109_0007958	3300048912	Bacteria	8985
650	Ga0496109_0011937	3300048912	Bacteria	7481
651	Ga0496109_0110862	3300048912	Bacteria	2551
652	Ga0496109_0157225	3300048912	Bacteria	2129
653	Ga0496109_0566321	3300048912	Bacteria	1071
654	Ga0496110_0004242	3300048913	Bacteria	11090
655	Ga0496110_0023887	3300048913	Bacteria	5204
656	Ga0496110_0046547	3300048913	Bacteria	3795
657	Ga0496110_0754565	3300048913	Bacteria	876
658	Ga0496111_0012624	3300048914	Bacteria	5723
659	Ga0496111_0036020	3300048914	Bacteria	3538
660	Ga0496111_0158281	3300048914	Bacteria	1681
661	Ga0496111_0999666	3300048914	Bacteria	599
662	Ga0496112_0000031	3300048915	Bacteria	120022
663	Ga0496112_0056939	3300048915	Bacteria	3848
664	Ga0496112_0238744	3300048915	Bacteria	1771
665	Ga0496113_0007392	3300048916	Bacteria	7064
666	Ga0496113_0022172	3300048916	Bacteria	4487
667	Ga0496113_0507440	3300048916	Bacteria	968
668	Ga0496113_0591531	3300048916	Bacteria	889
669	Ga0496114_0005673	3300048917	Bacteria	9791
670	Ga0496114_0022987	3300048917	Bacteria	5082
671	Ga0496114_0030943	3300048917	Bacteria	4403
672	Ga0496114_0076768	3300048917	Bacteria	2815
673	Ga0496114_0198371	3300048917	Bacteria	1757
674	Ga0496114_0281477	3300048917	Bacteria	1466
675	Ga0496114_1420093	3300048917	Bacteria	581
676	Ga0496115_0002452	3300048918	Bacteria	13321
677	Ga0496115_0023593	3300048918	Bacteria	4775
678	Ga0496115_0035163	3300048918	Bacteria	3963
679	Ga0496115_0040280	3300048918	Bacteria	3713
680	Ga0496115_0120774	3300048918	Bacteria	2156
681	Ga0496115_0444004	3300048918	Bacteria	1049
682	Ga0496115_0620904	3300048918	Bacteria	857
683	Ga0496115_0784234	3300048918	Bacteria	743
684	Ga0496117_0057783	3300048920	Bacteria	2691
685	Ga0496118_0001507	3300048921	Bacteria	34698
686	Ga0496119_0057524	3300048922	Bacteria	2349
687	Ga0496120_0136792	3300048923	Bacteria	1248
688	Ga0496121_0000183	3300048924	Bacteria	139168
689	Ga0496121_0000407	3300048924	Bacteria	85728
690	Ga0496121_0065910	3300048924	Bacteria	2943
691	Ga0496121_0082002	3300048924	Bacteria	2551
692	Ga0496121_0104964	3300048924	Bacteria	2169
693	Ga0496121_0272041	3300048924	Bacteria	1164
694	Ga0496124_0003899	3300048927	Bacteria	17843
695	Ga0496124_0365264	3300048927	Bacteria	1015
696	Ga0496125_0037479	3300048928	Bacteria	4215
697	Ga0496125_0091046	3300048928	Bacteria	2286
698	Ga0496126_0016402	3300048929	Bacteria	7409
699	Ga0496126_0026742	3300048929	Bacteria	5525
700	Ga0496126_0354945	3300048929	Bacteria	1198
701	Ga0496126_0453923	3300048929	Bacteria	1031
702	Ga0501034_0275584	3300049571	Bacteria	1622
703	Ga0501037_0145545	3300049573	Bacteria	1695
704	Ga0501042_0045953	3300049578	Bacteria	3112
705	Ga0501042_0288253	3300049578	Bacteria	1186
706	Ga0501046_0333426	3300049580	Bacteria	1104
707	Ga0501047_0115889	3300049581	Bacteria	2561
708	Ga0501047_0191056	3300049581	Bacteria	1911
709	Ga0501047_0247540	3300049581	Bacteria	1632
710	Ga0501069_0038412	3300049585	Bacteria	2643
711	Ga0501069_0058291	3300049585	Bacteria	2153
712	Ga0501070_0002951	3300049586	Bacteria	14812
713	Ga0501070_0244522	3300049586	Bacteria	1468
714	Ga0501071_0206781	3300049587	Bacteria	1475
715	Ga0501074_0180529	3300049590	Bacteria	1506
716	Ga0501079_0779087	3300049741	Bacteria	753
717	Ga0501080_0101140	3300049742	Bacteria	2674
718	Ga0501080_0448605	3300049742	Bacteria	1157
719	Ga0501083_0021975	3300049744	Bacteria	4430
720	Ga0501035_0055687	3300049822	Bacteria	3530
721	Ga0501035_0215511	3300049822	Bacteria	1641
722	Ga0501044_0189635	3300049823	Bacteria	2019
723	Ga0501044_0196804	3300049823	Bacteria	1975
724	Ga0501044_0557344	3300049823	Bacteria	1043
725	nmdc:mga03683_146506_c1	3300050489	Bacteria	1064
726	nmdc:mga03n38_518827_c1	3300050490	Bacteria	671
727	nmdc:mga00v17_251907_c1	3300050491	Bacteria	1145
728	nmdc:mga0yw44_363671_c1	3300050492	Bacteria	975
729	nmdc:mga0yw44_55241_c1	3300050492	Bacteria	2416
730	nmdc:mga0yw44_612562_c1	3300050492	Bacteria	740
731	nmdc:mga06z11_359328_c1	3300050494	Bacteria	873
732	nmdc:mga04h51_132514_c1	3300050495	Bacteria	939
733	nmdc:mga04h51_139952_c1	3300050495	Bacteria	917
734	nmdc:mga04h51_20146_c1	3300050495	Bacteria	1987
735	nmdc:mga07m45_119977_c1	3300050496	Bacteria	1519
736	nmdc:mga07m45_2740_c2	3300050496	Bacteria	5767
737	nmdc:mga07m45_348724_c1	3300050496	Bacteria	860
738	nmdc:mga05p37_307378_c1	3300050507	Bacteria	1881
739	nmdc:mga0qj67_41_c1	3300050509	Bacteria	89688
740	nmdc:mga08y16_187301_c1	3300050511	Bacteria	2147
741	nmdc:mga08y16_383261_c1	3300050511	Bacteria	1441
742	nmdc:mga08y16_423734_c1	3300050511	Bacteria	1360
743	nmdc:mga0sz30_119450_c1	3300050516	Bacteria	1158
744	nmdc:mga0sz30_246287_c1	3300050516	Bacteria	796
745	Ga0495601_0073827	3300053077	Bacteria	2182
746	Ga0495601_0139795	3300053077	Bacteria	1579
747	Ga0495601_0468704	3300053077	Bacteria	814
748	Ga0495612_0304302	3300053078	Bacteria	715
749	Ga0495655_0120443	3300053083	Bacteria	798
750	Ga0495655_0143383	3300053083	Bacteria	745
751	Ga0495595_0143097	3300053084	Bacteria	1174
752	Ga0495595_0173613	3300053084	Bacteria	1067
753	Ga0495619_0262235	3300053085	Bacteria	1197
754	Ga0500643_063404	3300053087	Bacteria	1034
755	Ga0500644_0063885	3300053088	Bacteria	1306
756	Ga0500581_158916	3300053089	Bacteria	1052
757	Ga0500646_0176548	3300053090	Bacteria	721
758	Ga0500646_0178462	3300053090	Bacteria	718
759	Ga0500651_0225852	3300053093	Bacteria	1096
760	Ga0500651_0487626	3300053093	Bacteria	681
761	Ga0500566_0281515	3300053094	Bacteria	792
762	Ga0500641_0022271	3300053096	Bacteria	2424
763	Ga0500641_0073066	3300053096	Bacteria	1446
764	Ga0500554_005156	3300053102	Bacteria	2824
765	Ga0500569_060966	3300053109	Bacteria	1164
766	Ga0500595_000844	3300053119	Bacteria	17484
767	Ga0500595_003905	3300053119	Bacteria	6839
768	Ga0500597_144648	3300053120	Bacteria	1023
769	Ga0500642_0145471	3300053130	Bacteria	1112
770	Ga0500652_000042	3300053131	Bacteria	67099
771	Ga0500568_0025777	3300053139	Bacteria	2475
772	Ga0500579_128041	3300053143	Bacteria	1200
773	Ga0500588_0083825	3300053146	Bacteria	1071
774	Ga0500589_039873	3300053147	Bacteria	2192
775	Ga0500589_251038	3300053147	Bacteria	649
776	Ga0500603_106980	3300053150	Bacteria	836
777	Ga0500604_0234711	3300053151	Bacteria	634
778	Ga0500616_0086832	3300053153	Bacteria	1559
779	Ga0500622_0051434	3300053156	Bacteria	2120
780	Ga0500633_0187699	3300053160	Bacteria	774
781	Ga0500638_000727	3300053162	Bacteria	8868
782	Ga0500638_081771	3300053162	Bacteria	1533
783	Ga0500636_0174238	3300053177	Bacteria	1161
784	Ga0500637_0000104	3300053178	Bacteria	30138
785	Ga0500609_012671	3300053731	Bacteria	1140
786	Ga0500552_009830	3300053733	Bacteria	1163
787	Ga0501084_0563430	3300054114	Bacteria	963
788	Ga0500661_001650	3300055283	Bacteria	4197
789	Ga0501082_0742905	3300060353	Bacteria	859
790	Ga0466962_0064772	3300061719	Bacteria	1745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300013308	Ga0157375_10229597	Ga0157375_102295974	124
2	3300048911	Ga0496108_0318428	Ga0496108_0318428_175_696	124
3	3300048914	Ga0496111_0158281	Ga0496111_0158281_932_1453	124
4	3300005339	Ga0070660_100101024	Ga0070660_1001010243	126
5	3300009094	Ga0111539_10100424	Ga0111539_101004244	126
6	3300025919	Ga0207657_10000784	Ga0207657_1000078416	126
7	3300049822	Ga0501035_0055687	Ga0501035_0055687_2921_3343	126
8	3300050511	nmdc:mga08y16_383261_c1	nmdc:mga08y16_383261_c1_824_1255	126
9	3300047321	Ga0495676_0137424	Ga0495676_0137424_810_1310	129
10	3300009545	Ga0105237_10002239	Ga0105237_100022395	130
11	3300025919	Ga0207657_10297522	Ga0207657_102975222	130
12	3300046507	Ga0495606_0564624	Ga0495606_0564624_32_523	130
13	3300005467	Ga0070706_100259303	Ga0070706_1002593031	131
14	3300025901	Ga0207688_10695000	Ga0207688_106950001	131
15	3300049585	Ga0501069_0038412	Ga0501069_0038412_1115_1600	131
16	3300049586	Ga0501070_0002951	Ga0501070_0002951_3458_3943	131
17	3300049590	Ga0501074_0180529	Ga0501074_0180529_216_701	131
18	3300049742	Ga0501080_0101140	Ga0501080_0101140_70_555	131
19	3300005367	Ga0070667_100411748	Ga0070667_1004117482	132
20	3300006186	Ga0075369_10034195	Ga0075369_100341953	132
21	3300026121	Ga0207683_10426560	Ga0207683_104265602	132
22	3300028786	Ga0307517_10000063	Ga0307517_10000063111	132
23	3300039438	Ga0436360_0226663	Ga0436360_0226663_73_564	132
24	3300046459	Ga0495629_0707476	Ga0495629_0707476_135_626	132
25	3300047320	Ga0495672_0009800	Ga0495672_0009800_5642_6133	132
26	3300047469	Ga0495673_0164432	Ga0495673_0164432_27_518	132
27	3300048929	Ga0496126_0453923	Ga0496126_0453923_63_554	132
28	3300053151	Ga0500604_0234711	Ga0500604_0234711_109_600	132
29	3300005983	Ga0081540_1002694	Ga0081540_100269410	133
30	3300005341	Ga0070691_10382341	Ga0070691_103823411	134
31	3300005347	Ga0070668_100040972	Ga0070668_1000409722	134
32	3300005356	Ga0070674_100050184	Ga0070674_1000501843	134
33	3300005365	Ga0070688_100497133	Ga0070688_1004971332	134
34	3300005438	Ga0070701_10047195	Ga0070701_100471952	134
35	3300005546	Ga0070696_100471424	Ga0070696_1004714241	134
36	3300005615	Ga0070702_100035143	Ga0070702_1000351432	134
37	3300005617	Ga0068859_100996175	Ga0068859_1009961752	134
38	3300005840	Ga0068870_10035639	Ga0068870_100356393	134
39	3300005843	Ga0068860_100079510	Ga0068860_1000795103	134
40	3300005844	Ga0068862_100040181	Ga0068862_1000401814	134
41	3300006881	Ga0068865_100233609	Ga0068865_1002336092	134
42	3300006931	Ga0097620_100996251	Ga0097620_1009962512	134
43	3300009148	Ga0105243_10175945	Ga0105243_101759453	134
44	3300010375	Ga0105239_10717274	Ga0105239_107172742	134
45	3300014968	Ga0157379_10713027	Ga0157379_107130271	134
46	3300017792	Ga0163161_10061568	Ga0163161_100615683	134
47	3300025935	Ga0207709_10529271	Ga0207709_105292712	134
48	3300025937	Ga0207669_10045638	Ga0207669_100456382	134
49	3300025972	Ga0207668_10187657	Ga0207668_101876572	134
50	3300026067	Ga0207678_10153356	Ga0207678_101533562	134
51	3300026118	Ga0207675_100035028	Ga0207675_1000350283	134
52	3300028381	Ga0268264_10033691	Ga0268264_100336913	134
53	3300047472	Ga0495686_0068038	Ga0495686_0068038_887_1396	134
54	3300048904	Ga0496101_0187689	Ga0496101_0187689_480_974	134
55	3300048905	Ga0496102_1051141	Ga0496102_1051141_130_624	134
56	3300048906	Ga0496103_0058756	Ga0496103_0058756_1799_2293	134
57	3300048907	Ga0496104_0150175	Ga0496104_0150175_1450_1944	134
58	3300048908	Ga0496105_0330913	Ga0496105_0330913_446_940	134
59	3300048909	Ga0496106_0070834	Ga0496106_0070834_130_624	134
60	3300048910	Ga0496107_0001739	Ga0496107_0001739_6584_7078	134
61	3300048912	Ga0496109_0011937	Ga0496109_0011937_3919_4413	134
62	3300048917	Ga0496114_0005673	Ga0496114_0005673_3611_4105	134
63	3300048918	Ga0496115_0023593	Ga0496115_0023593_1246_1740	134
64	3300009177	Ga0105248_10626435	Ga0105248_106264351	135
65	3300009551	Ga0105238_10054766	Ga0105238_100547663	135
66	3300010375	Ga0105239_10015382	Ga0105239_100153822	135
67	3300025924	Ga0207694_10038951	Ga0207694_100389513	135
68	3300031824	Ga0307413_10111460	Ga0307413_101114603	135
69	3300032005	Ga0307411_10116011	Ga0307411_101160112	135
70	3300046473	Ga0495582_0064536	Ga0495582_0064536_369_863	135
71	3300046681	Ga0495647_0183690	Ga0495647_0183690_153_647	135
72	3300048927	Ga0496124_0365264	Ga0496124_0365264_179_655	135
73	3300050496	nmdc:mga07m45_2740_c2	nmdc:mga07m45_2740_c2_3318_3809	135
74	3300053094	Ga0500566_0281515	Ga0500566_0281515_239_733	135
75	iso_pu_bacteria	8001845381	8001849777	135
76	3300005329	Ga0070683_100127724	Ga0070683_1001277242	136
77	3300005336	Ga0070680_100023225	Ga0070680_1000232254	136
78	3300005458	Ga0070681_10010339	Ga0070681_100103394	136
79	3300005530	Ga0070679_100017059	Ga0070679_1000170597	136
80	3300005535	Ga0070684_100007403	Ga0070684_1000074037	136
81	3300005547	Ga0070693_100341891	Ga0070693_1003418911	136
82	3300005548	Ga0070665_100703544	Ga0070665_1007035442	136
83	3300009551	Ga0105238_10808944	Ga0105238_108089441	136
84	3300025912	Ga0207707_10125345	Ga0207707_101253452	136
85	3300025917	Ga0207660_10091846	Ga0207660_100918462	136
86	3300025921	Ga0207652_10026574	Ga0207652_100265741	136
87	3300028379	Ga0268266_10702727	Ga0268266_107027271	136
88	3300044719	Ga0466971_0012320	Ga0466971_0012320_2305_2802	136
89	3300044765	Ga0466970_0123467	Ga0466970_0123467_505_1002	136
90	3300044842	Ga0466957_0207749	Ga0466957_0207749_172_669	136
91	3300045049	Ga0466959_0064221	Ga0466959_0064221_1432_1929	136
92	3300045836	Ga0466958_0111995	Ga0466958_0111995_180_677	136
93	3300049571	Ga0501034_0275584	Ga0501034_0275584_982_1446	136
94	3300049581	Ga0501047_0247540	Ga0501047_0247540_140_604	136
95	3300049585	Ga0501069_0058291	Ga0501069_0058291_1001_1465	136
96	3300049586	Ga0501070_0244522	Ga0501070_0244522_747_1211	136
97	3300049587	Ga0501071_0206781	Ga0501071_0206781_123_587	136
98	3300049822	Ga0501035_0215511	Ga0501035_0215511_1048_1512	136
99	3300049823	Ga0501044_0189635	Ga0501044_0189635_374_838	136
100	3300061719	Ga0466962_0064772	Ga0466962_0064772_859_1356	136
101	3300049578	Ga0501042_0045953	Ga0501042_0045953_1032_1517	137
102	3300053139	Ga0500568_0025777	Ga0500568_0025777_1274_1753	137
103	3300053153	Ga0500616_0086832	Ga0500616_0086832_703_1182	137
104	3300009101	Ga0105247_10076877	Ga0105247_100768772	138
105	3300009551	Ga0105238_10142623	Ga0105238_101426232	138
106	3300013105	Ga0157369_10010134	Ga0157369_100101347	138
107	3300013307	Ga0157372_10685633	Ga0157372_106856332	138
108	3300025914	Ga0207671_10819340	Ga0207671_108193401	138
109	3300025915	Ga0207693_10195062	Ga0207693_101950622	138
110	3300025924	Ga0207694_10201996	Ga0207694_102019962	138
111	3300035725	Ga0373947_0023496	Ga0373947_0023496_358_819	138
112	3300037068	Ga0373925_0548920	Ga0373925_0548920_332_793	138
113	3300039437	Ga0436365_0163014	Ga0436365_0163014_510_1112	138
114	3300046454	Ga0495592_0157706	Ga0495592_0157706_203_664	138
115	3300046514	Ga0495618_0731070	Ga0495618_0731070_20_481	138
116	3300046517	Ga0495630_0455892	Ga0495630_0455892_184_645	138
117	3300046531	Ga0495665_0495319	Ga0495665_0495319_77_538	138
118	3300046533	Ga0495640_0022817	Ga0495640_0022817_3726_4187	138
119	3300046642	Ga0495634_0239917	Ga0495634_0239917_100_561	138
120	3300046690	Ga0495624_0252414	Ga0495624_0252414_447_908	138
121	3300047319	Ga0495674_0145108	Ga0495674_0145108_622_1083	138
122	3300010159	Ga0099796_10070297	Ga0099796_100702973	139
123	3300046491	Ga0495584_0032145	Ga0495584_0032145_138_584	139
124	3300046492	Ga0495585_0140898	Ga0495585_0140898_345_791	139
125	3300005293	Ga0065715_10110964	Ga0065715_101109643	140
126	3300005336	Ga0070680_100485571	Ga0070680_1004855712	140
127	3300005338	Ga0068868_101047061	Ga0068868_1010470611	140
128	3300005347	Ga0070668_100505427	Ga0070668_1005054272	140
129	3300005439	Ga0070711_100267944	Ga0070711_1002679442	140
130	3300005445	Ga0070708_100022040	Ga0070708_1000220404	140
131	3300005456	Ga0070678_100220875	Ga0070678_1002208752	140
132	3300005458	Ga0070681_10782510	Ga0070681_107825102	140
133	3300005468	Ga0070707_100088681	Ga0070707_1000886814	140
134	3300005535	Ga0070684_100773382	Ga0070684_1007733821	140
135	3300005841	Ga0068863_100583078	Ga0068863_1005830782	140
136	3300005842	Ga0068858_100692078	Ga0068858_1006920782	140
137	3300005844	Ga0068862_100066032	Ga0068862_1000660324	140
138	3300006163	Ga0070715_10306404	Ga0070715_103064042	140
139	3300006173	Ga0070716_100055126	Ga0070716_1000551264	140
140	3300006173	Ga0070716_100132426	Ga0070716_1001324263	140
141	3300006237	Ga0097621_100196143	Ga0097621_1001961432	140
142	3300009101	Ga0105247_10187933	Ga0105247_101879332	140
143	3300009176	Ga0105242_10215584	Ga0105242_102155842	140
144	3300009177	Ga0105248_10118433	Ga0105248_101184332	140
145	3300009545	Ga0105237_10080273	Ga0105237_100802734	140
146	3300010375	Ga0105239_10070875	Ga0105239_100708754	140
147	3300013306	Ga0163162_10409890	Ga0163162_104098902	140
148	3300013308	Ga0157375_10461069	Ga0157375_104610692	140
149	3300014325	Ga0163163_10320542	Ga0163163_103205422	140
150	3300014325	Ga0163163_10948120	Ga0163163_109481202	140
151	3300014326	Ga0157380_11510137	Ga0157380_115101372	140
152	3300025297	Ga0209758_1001025	Ga0209758_100102518	140
153	3300025917	Ga0207660_10582441	Ga0207660_105824411	140
154	3300025922	Ga0207646_10081518	Ga0207646_100815182	140
155	3300025938	Ga0207704_11082732	Ga0207704_110827321	140
156	3300025939	Ga0207665_10227420	Ga0207665_102274202	140
157	3300025939	Ga0207665_10402270	Ga0207665_104022701	140
158	3300025941	Ga0207711_10019599	Ga0207711_100195993	140
159	3300025972	Ga0207668_10313965	Ga0207668_103139652	140
160	3300026023	Ga0207677_10187195	Ga0207677_101871953	140
161	3300026035	Ga0207703_10131454	Ga0207703_101314543	140
162	3300026041	Ga0207639_10781981	Ga0207639_107819812	140
163	3300026088	Ga0207641_10225237	Ga0207641_102252372	140
164	3300026121	Ga0207683_10420463	Ga0207683_104204632	140
165	3300026142	Ga0207698_10331680	Ga0207698_103316802	140
166	3300028380	Ga0268265_11561698	Ga0268265_115616981	140
167	3300031616	Ga0307508_10000010	Ga0307508_1000001020	140
168	3300034816	Ga0373930_0092602	Ga0373930_0092602_188_679	140
169	3300035085	Ga0373929_0010642	Ga0373929_0010642_213_704	140
170	3300035089	Ga0373944_0223338	Ga0373944_0223338_42_533	140
171	3300035092	Ga0373952_0004283	Ga0373952_0004283_1360_1851	140
172	3300035115	Ga0373941_0086059	Ga0373941_0086059_547_1038	140
173	3300035691	Ga0373931_0009393	Ga0373931_0009393_1141_1632	140
174	3300035692	Ga0373935_0115339	Ga0373935_0115339_1197_1688	140
175	3300037853	Ga0436364_0975533	Ga0436364_0975533_223_825	140
176	3300046615	Ga0495656_0100701	Ga0495656_0100701_152_643	140
177	3300046663	Ga0495635_0838383	Ga0495635_0838383_46_537	140
178	3300048903	Ga0496100_0035526	Ga0496100_0035526_1502_1993	140
179	3300048904	Ga0496101_0007887	Ga0496101_0007887_2786_3277	140
180	3300048905	Ga0496102_0005734	Ga0496102_0005734_5908_6399	140
181	3300048906	Ga0496103_0035178	Ga0496103_0035178_2213_2704	140
182	3300048908	Ga0496105_0045859	Ga0496105_0045859_1392_1883	140
183	3300048910	Ga0496107_0053815	Ga0496107_0053815_419_910	140
184	3300048911	Ga0496108_0052299	Ga0496108_0052299_1268_1759	140
185	3300048912	Ga0496109_0157225	Ga0496109_0157225_631_1122	140
186	3300048913	Ga0496110_0023887	Ga0496110_0023887_4393_4884	140
187	3300048913	Ga0496110_0754565	Ga0496110_0754565_126_638	140
188	3300048914	Ga0496111_0036020	Ga0496111_0036020_644_1135	140
189	3300048915	Ga0496112_0056939	Ga0496112_0056939_1944_2435	140
190	3300048916	Ga0496113_0022172	Ga0496113_0022172_1396_1887	140
191	3300048916	Ga0496113_0591531	Ga0496113_0591531_178_690	140
192	3300048917	Ga0496114_0022987	Ga0496114_0022987_2933_3424	140
193	3300048918	Ga0496115_0040280	Ga0496115_0040280_1891_2382	140
194	3300049581	Ga0501047_0191056	Ga0501047_0191056_873_1361	140
195	3300049823	Ga0501044_0557344	Ga0501044_0557344_200_688	140
196	3300053078	Ga0495612_0304302	Ga0495612_0304302_12_503	140
197	iso_pu_bacteria	2524023228	2524541147	140
198	3300005329	Ga0070683_100631012	Ga0070683_1006310121	141
199	3300005563	Ga0068855_100315927	Ga0068855_1003159271	141
200	3300005615	Ga0070702_100135437	Ga0070702_1001354372	141
201	3300013297	Ga0157378_10092354	Ga0157378_100923542	141
202	3300025944	Ga0207661_10871750	Ga0207661_108717502	141
203	3300026067	Ga0207678_10037212	Ga0207678_100372122	141
204	3300026089	Ga0207648_10477439	Ga0207648_104774392	141
205	3300039437	Ga0436365_0589211	Ga0436365_0589211_131_592	141
206	iso_pu_bacteria	2513237098	2513673878	141
207	iso_pu_bacteria	2513237104	2513719519	141
208	iso_pu_bacteria	2517093001	2517108329	141
209	iso_pu_bacteria	2524023210	2524469609	141
210	iso_pu_bacteria	2885383462	2885390534	141
211	iso_pu_bacteria	2903768456	2903776000	141
212	iso_pu_bacteria	2904699407	2904703370	141
213	iso_pu_bacteria	8006933436	8006940731	141
214	iso_pu_bacteria	8006973647	8006980421	141
215	iso_pu_bacteria	8056681323	8056686628	141
216	3300005436	Ga0070713_101134942	Ga0070713_1011349422	142
217	3300005440	Ga0070705_100164149	Ga0070705_1001641491	142
218	3300005441	Ga0070700_100487955	Ga0070700_1004879552	142
219	3300005455	Ga0070663_100187216	Ga0070663_1001872162	142
220	3300005466	Ga0070685_10530809	Ga0070685_105308092	142
221	3300005937	Ga0081455_10015473	Ga0081455_100154737	142
222	3300009177	Ga0105248_11110761	Ga0105248_111107612	142
223	3300013306	Ga0163162_10087246	Ga0163162_100872464	142
224	3300013308	Ga0157375_10207380	Ga0157375_102073803	142
225	3300014325	Ga0163163_10005218	Ga0163163_100052187	142
226	3300021358	Ga0213873_10028727	Ga0213873_100287272	142
227	3300021384	Ga0213876_10002470	Ga0213876_100024705	142
228	3300026023	Ga0207677_11880770	Ga0207677_118807701	142
229	3300026067	Ga0207678_10280298	Ga0207678_102802982	142
230	3300026075	Ga0207708_10581060	Ga0207708_105810601	142
231	3300026088	Ga0207641_10098286	Ga0207641_100982862	142
232	3300027907	Ga0207428_10321642	Ga0207428_103216421	142
233	3300039437	Ga0436365_1190006	Ga0436365_1190006_5742_6227	142
234	3300039453	Ga0436362_1192450	Ga0436362_1192450_3138_3623	142
235	3300048905	Ga0496102_0114709	Ga0496102_0114709_805_1281	142
236	3300048906	Ga0496103_0188693	Ga0496103_0188693_749_1225	142
237	3300048907	Ga0496104_0017208	Ga0496104_0017208_2855_3331	142
238	3300048908	Ga0496105_0190761	Ga0496105_0190761_493_969	142
239	3300048909	Ga0496106_0153155	Ga0496106_0153155_557_1033	142
240	3300048910	Ga0496107_0048126	Ga0496107_0048126_546_1022	142
241	3300048911	Ga0496108_0119792	Ga0496108_0119792_1112_1588	142
242	3300048912	Ga0496109_0110862	Ga0496109_0110862_1715_2191	142
243	3300048913	Ga0496110_0046547	Ga0496110_0046547_1574_2050	142
244	3300048915	Ga0496112_0238744	Ga0496112_0238744_1080_1556	142
245	3300048918	Ga0496115_0120774	Ga0496115_0120774_493_969	142
246	3300050492	nmdc:mga0yw44_363671_c1	nmdc:mga0yw44_363671_c1_203_697	142
247	3300053131	Ga0500652_000042	Ga0500652_000042_40428_40952	142
248	iso_pu_bacteria	2508501009	2508542753	142
249	iso_pu_bacteria	2508501042	2508691488	142
250	iso_pu_bacteria	2513237092	2513623110	142
251	iso_pu_bacteria	2513237094	2513639039	142
252	iso_pu_bacteria	2513237095	2513645913	142
253	iso_pu_bacteria	2513237102	2513700133	142
254	iso_pu_bacteria	2513237139	2513872698	142
255	iso_pu_bacteria	2513237161	2514011924	142
256	iso_pu_bacteria	2515154112	2515628290	142
257	iso_pu_bacteria	2524023205	2524440501	142
258	iso_pu_bacteria	2528768022	2528851166	142
259	iso_pu_bacteria	2617270735	2617348944	142
260	iso_pu_bacteria	2617270741	2617375839	142
261	iso_pu_bacteria	2728368998	2728751492	142
262	iso_pu_bacteria	2744054633	2745075229	142
263	iso_pu_bacteria	2791355196	2793062467	142
264	iso_pu_bacteria	2802429603	2805915404	142
265	iso_pu_bacteria	2816332527	2818238981	142
266	iso_pu_bacteria	2824600985	2824609142	142
267	iso_pu_bacteria	2824609381	2824617649	142
268	iso_pu_bacteria	2824617872	2824625725	142
269	iso_pu_bacteria	2824626560	2824634503	142
270	iso_pu_bacteria	2824635225	2824642567	142
271	iso_pu_bacteria	2824644064	2824650321	142
272	iso_pu_bacteria	2824661429	2824670349	142
273	iso_pu_bacteria	2824671348	2824678235	142
274	iso_pu_bacteria	2824679649	2824686011	142
275	iso_pu_bacteria	2824687955	2824694662	142
276	iso_pu_bacteria	2824696289	2824703597	142
277	iso_pu_bacteria	2824714736	2824720838	142
278	iso_pu_bacteria	2824723954	2824730616	142
279	iso_pu_bacteria	2824732956	2824739021	142
280	iso_pu_bacteria	2824746037	2824753266	142
281	iso_pu_bacteria	2824763712	2824772785	142
282	iso_pu_bacteria	2824773399	2824781165	142
283	iso_pu_bacteria	2838122688	2838123824	142
284	iso_pu_bacteria	2841941048	2841944047	142
285	iso_pu_bacteria	2841949485	2841949924	142
286	iso_pu_bacteria	2841957949	2841958598	142
287	iso_pu_bacteria	2841966195	2841966342	142
288	iso_pu_bacteria	2841974524	2841975076	142
289	iso_pu_bacteria	2841983080	2841983352	142
290	iso_pu_bacteria	2842038055	2842039136	142
291	iso_pu_bacteria	2842045827	2842047917	142
292	iso_pu_bacteria	2844315083	2844319023	142
293	iso_pu_bacteria	2847930680	2847936143	142
294	iso_pu_bacteria	2847939898	2847946493	142
295	iso_pu_bacteria	2849076700	2849079384	142
296	iso_pu_bacteria	2857509624	2857514383	142
297	iso_pu_bacteria	2874590934	2874591536	142
298	iso_pu_bacteria	2874612657	2874615236	142
299	iso_pu_bacteria	2874620515	2874627170	142
300	iso_pu_bacteria	2874628541	2874631780	142
301	iso_pu_bacteria	2874645413	2874648946	142
302	iso_pu_bacteria	2876761206	2876767028	142
303	iso_pu_bacteria	2876771140	2876771973	142
304	iso_pu_bacteria	2876818435	2876822082	142
305	iso_pu_bacteria	2879074833	2879075595	142
306	iso_pu_bacteria	2879083081	2879085337	142
307	iso_pu_bacteria	2879099564	2879103289	142
308	iso_pu_bacteria	2879127579	2879135497	142
309	iso_pu_bacteria	2879142872	2879143106	142
310	iso_pu_bacteria	2881364244	2881367010	142
311	iso_pu_bacteria	2881665667	2881671106	142
312	iso_pu_bacteria	2885366525	2885370539	142
313	iso_pu_bacteria	2885409591	2885412211	142
314	iso_pu_bacteria	2888378607	2888383992	142
315	iso_pu_bacteria	2888388044	2888393866	142
316	iso_pu_bacteria	2888419890	2888424400	142
317	iso_pu_bacteria	2903727486	2903729052	142
318	iso_pu_bacteria	2904666416	2904671311	142
319	iso_pu_bacteria	2904711408	2904714544	142
320	iso_pu_bacteria	2906602504	2906610098	142
321	iso_pu_bacteria	2906626472	2906628601	142
322	iso_pu_bacteria	2908775508	2908780105	142
323	iso_pu_bacteria	2922368715	2922374313	142
324	iso_pu_bacteria	2922393267	2922396379	142
325	iso_pu_bacteria	2929615660	2929617987	142
326	iso_pu_bacteria	2929624759	2929627668	142
327	iso_pu_bacteria	2932784394	2932788231	142
328	iso_pu_bacteria	2932794094	2932797541	142
329	iso_pu_bacteria	2932801729	2932802855	142
330	iso_pu_bacteria	2932809354	2932810619	142
331	iso_pu_bacteria	2932818245	2932821235	142
332	iso_pu_bacteria	2932828146	2932831228	142
333	iso_pu_bacteria	2933577622	2933579915	142
334	iso_pu_bacteria	2935608549	2935608812	142
335	iso_pu_bacteria	2935616580	2935622976	142
336	iso_pu_bacteria	2935638405	2935642336	142
337	iso_pu_bacteria	2935648319	2935649972	142
338	iso_pu_bacteria	2935656913	2935661876	142
339	iso_pu_bacteria	2935665750	2935668361	142
340	iso_pu_bacteria	2935675223	2935680494	142
341	iso_pu_bacteria	2935684952	2935692836	142
342	iso_pu_bacteria	2935694250	2935701005	142
343	iso_pu_bacteria	2935703347	2935706216	142
344	iso_pu_bacteria	2935713505	2935721439	142
345	iso_pu_bacteria	2935722832	2935730357	142
346	iso_pu_bacteria	2935732158	2935740370	142
347	iso_pu_bacteria	2935741537	2935749634	142
348	iso_pu_bacteria	2935750917	2935759053	142
349	iso_pu_bacteria	2935760218	2935762617	142
350	iso_pu_bacteria	2935769743	2935773226	142
351	iso_pu_bacteria	2935777560	2935778472	142
352	iso_pu_bacteria	2935785616	2935790409	142
353	iso_pu_bacteria	2935793552	2935798138	142
354	iso_pu_bacteria	2935801545	2935803216	142
355	iso_pu_bacteria	2935810662	2935814536	142
356	iso_pu_bacteria	2935819856	2935821972	142
357	iso_pu_bacteria	2935827899	2935831674	142
358	iso_pu_bacteria	2935837841	2935838542	142
359	iso_pu_bacteria	2935847175	2935847554	142
360	iso_pu_bacteria	2935855204	2935861224	142
361	iso_pu_bacteria	2935864058	2935865762	142
362	iso_pu_bacteria	2935873716	2935878263	142
363	iso_pu_bacteria	2935883170	2935885197	142
364	iso_pu_bacteria	2935908558	2935909179	142
365	iso_pu_bacteria	2935916978	2935919900	142
366	iso_pu_bacteria	2935926038	2935926247	142
367	iso_pu_bacteria	2935934488	2935934697	142
368	iso_pu_bacteria	2935942939	2935943147	142
369	iso_pu_bacteria	2935951376	2935951585	142
370	iso_pu_bacteria	2935959822	2935966417	142
371	iso_pu_bacteria	2935967501	2935967710	142
372	iso_pu_bacteria	2935975950	2935977090	142
373	iso_pu_bacteria	2935984226	2935988244	142
374	iso_pu_bacteria	2935992306	2935994576	142
375	iso_pu_bacteria	2936002035	2936007624	142
376	iso_pu_bacteria	2936011229	2936012545	142
377	iso_pu_bacteria	2936019824	2936021109	142
378	iso_pu_bacteria	2936028420	2936029838	142
379	iso_pu_bacteria	2936037263	2936040093	142
380	iso_pu_bacteria	2936046547	2936047303	142
381	iso_pu_bacteria	2936055302	2936057539	142
382	iso_pu_bacteria	2940556831	2940564942	142
383	iso_pu_bacteria	2941531003	2941532687	142
384	iso_pu_bacteria	2941538514	2941538790	142
385	iso_pu_bacteria	3005483717	3005487273	142
386	iso_pu_bacteria	3005506211	3005510266	142
387	iso_pu_bacteria	3005587118	3005591062	142
388	iso_pu_bacteria	3005594810	3005599167	142
389	iso_pu_bacteria	3005718088	3005722263	142
390	iso_pu_bacteria	8006926726	8006929964	142
391	iso_pu_bacteria	8016511872	8016522416	142
392	iso_pu_bacteria	8016522445	8016529681	142
393	iso_pu_bacteria	8016530956	8016534900	142
394	iso_pu_bacteria	8016539877	8016548110	142
395	iso_pu_bacteria	8016548790	8016554015	142
396	iso_pu_bacteria	8016557553	8016562390	142
397	iso_pu_bacteria	8016566248	8016573245	142
398	iso_pu_bacteria	8016575299	8016577388	142
399	iso_pu_bacteria	8016583857	8016591860	142
400	iso_pu_bacteria	8016595262	8016600191	142
401	iso_pu_bacteria	8016603502	8016610562	142
402	iso_pu_bacteria	8016622563	8016626618	142
403	iso_pu_bacteria	8016630954	8016640425	142
404	iso_pu_bacteria	8017057580	8017063145	142
405	iso_pu_bacteria	8019530166	8019534660	142
406	iso_pu_bacteria	8019538911	8019544810	142
407	iso_pu_bacteria	8019547302	8019553727	142
408	iso_pu_bacteria	8019576017	8019582579	142
409	iso_pu_bacteria	8019586578	8019590370	142
410	iso_pu_bacteria	8019597564	8019600984	142
411	iso_pu_bacteria	8019608314	8019617569	142
412	iso_pu_bacteria	8019619141	8019628065	142
413	iso_pu_bacteria	8019629233	8019634542	142
414	iso_pu_bacteria	8019638758	8019645183	142
415	iso_pu_bacteria	8019648815	8019658318	142
416	iso_pu_bacteria	8019659431	8019662435	142
417	iso_pu_bacteria	8019668869	8019671934	142
418	iso_pu_bacteria	8019678201	8019684159	142
419	iso_pu_bacteria	8019687851	8019689997	142
420	iso_pu_bacteria	8055742211	8055746424	142
421	iso_pu_bacteria	8056967851	8056967966	142
422	3300003659	JGI25404J52841_10017418	JGI25404J52841_100174182	143
423	3300005435	Ga0070714_100241367	Ga0070714_1002413672	143
424	3300005436	Ga0070713_100010275	Ga0070713_1000102756	143
425	3300005436	Ga0070713_100176956	Ga0070713_1001769562	143
426	3300005439	Ga0070711_100412532	Ga0070711_1004125322	143
427	3300005441	Ga0070700_100207092	Ga0070700_1002070922	143
428	3300005536	Ga0070697_100722321	Ga0070697_1007223211	143
429	3300005983	Ga0081540_1017176	Ga0081540_10171765	143
430	3300006028	Ga0070717_10006942	Ga0070717_100069423	143
431	3300006038	Ga0075365_10550049	Ga0075365_105500492	143
432	3300006051	Ga0075364_10146771	Ga0075364_101467712	143
433	3300006175	Ga0070712_100235671	Ga0070712_1002356712	143
434	3300006177	Ga0075362_10123678	Ga0075362_101236782	143
435	3300006186	Ga0075369_10171134	Ga0075369_101711342	143
436	3300006844	Ga0075428_100114252	Ga0075428_1001142523	143
437	3300021324	Ga0214545_1035778	Ga0214545_10357781	143
438	3300025915	Ga0207693_10570215	Ga0207693_105702152	143
439	3300025928	Ga0207700_10120677	Ga0207700_101206771	143
440	3300025928	Ga0207700_10778581	Ga0207700_107785812	143
441	3300025929	Ga0207664_10202353	Ga0207664_102023532	143
442	3300025939	Ga0207665_10236017	Ga0207665_102360172	143
443	3300026035	Ga0207703_10179271	Ga0207703_101792712	143
444	3300028381	Ga0268264_10000043	Ga0268264_1000004365	143
445	3300028666	Ga0265336_10035778	Ga0265336_100357782	143
446	3300028800	Ga0265338_10061068	Ga0265338_100610683	143
447	3300031235	Ga0265330_10009689	Ga0265330_100096892	143
448	3300031241	Ga0265325_10011986	Ga0265325_100119863	143
449	3300031247	Ga0265340_10125666	Ga0265340_101256662	143
450	3300031249	Ga0265339_10067376	Ga0265339_100673762	143
451	3300031616	Ga0307508_10525031	Ga0307508_105250312	143
452	3300031712	Ga0265342_10056727	Ga0265342_100567272	143
453	3300031911	Ga0307412_10471370	Ga0307412_104713701	143
454	3300035086	Ga0373934_0041894	Ga0373934_0041894_142_627	143
455	3300035172	Ga0373955_0060689	Ga0373955_0060689_305_790	143
456	3300035692	Ga0373935_0004357	Ga0373935_0004357_1589_2074	143
457	3300036401	Ga0373937_0122685	Ga0373937_0122685_1297_1782	143
458	3300045836	Ga0466958_0164205	Ga0466958_0164205_292_762	143
459	3300046454	Ga0495592_0159799	Ga0495592_0159799_556_1041	143
460	3300046477	Ga0495664_0013279	Ga0495664_0013279_3588_4073	143
461	3300046517	Ga0495630_0028188	Ga0495630_0028188_507_992	143
462	3300046529	Ga0495652_0036711	Ga0495652_0036711_3122_3607	143
463	3300046533	Ga0495640_0009965	Ga0495640_0009965_1324_1809	143
464	3300046642	Ga0495634_0014597	Ga0495634_0014597_3545_4030	143
465	3300046680	Ga0495646_0103828	Ga0495646_0103828_659_1144	143
466	3300047471	Ga0495684_0020958	Ga0495684_0020958_3384_3869	143
467	3300048903	Ga0496100_0132185	Ga0496100_0132185_289_741	143
468	3300048904	Ga0496101_0106766	Ga0496101_0106766_639_1091	143
469	3300048905	Ga0496102_0261712	Ga0496102_0261712_641_1093	143
470	3300048909	Ga0496106_0341996	Ga0496106_0341996_203_655	143
471	3300048917	Ga0496114_0198371	Ga0496114_0198371_570_1022	143
472	3300049573	Ga0501037_0145545	Ga0501037_0145545_1212_1682	143
473	3300049580	Ga0501046_0333426	Ga0501046_0333426_556_1026	143
474	3300049581	Ga0501047_0115889	Ga0501047_0115889_1439_1909	143
475	3300049742	Ga0501080_0448605	Ga0501080_0448605_631_1101	143
476	3300049744	Ga0501083_0021975	Ga0501083_0021975_810_1280	143
477	3300050489	nmdc:mga03683_146506_c1	nmdc:mga03683_146506_c1_296_787	143
478	3300050491	nmdc:mga00v17_251907_c1	nmdc:mga00v17_251907_c1_329_820	143
479	3300050492	nmdc:mga0yw44_55241_c1	nmdc:mga0yw44_55241_c1_1458_1949	143
480	3300050507	nmdc:mga05p37_307378_c1	nmdc:mga05p37_307378_c1_1173_1664	143
481	3300050516	nmdc:mga0sz30_119450_c1	nmdc:mga0sz30_119450_c1_240_731	143
482	3300053077	Ga0495601_0073827	Ga0495601_0073827_264_749	143
483	3300053077	Ga0495601_0468704	Ga0495601_0468704_18_470	143
484	3300053084	Ga0495595_0143097	Ga0495595_0143097_79_531	143
485	3300054114	Ga0501084_0563430	Ga0501084_0563430_180_650	143
486	iso_pu_bacteria	2922386360	2922390908	143
487	3300005334	Ga0068869_100353398	Ga0068869_1003533982	144
488	3300005563	Ga0068855_100032053	Ga0068855_1000320536	144
489	3300005841	Ga0068863_100082674	Ga0068863_1000826742	144
490	3300005841	Ga0068863_100283478	Ga0068863_1002834782	144
491	3300006028	Ga0070717_11100359	Ga0070717_111003592	144
492	3300006038	Ga0075365_10394859	Ga0075365_103948592	144
493	3300009148	Ga0105243_10843399	Ga0105243_108433992	144
494	3300025910	Ga0207684_10251257	Ga0207684_102512572	144
495	3300025917	Ga0207660_11413272	Ga0207660_114132721	144
496	3300025936	Ga0207670_10758334	Ga0207670_107583341	144
497	3300025949	Ga0207667_11177075	Ga0207667_111770751	144
498	3300026075	Ga0207708_10488576	Ga0207708_104885761	144
499	3300026088	Ga0207641_10018331	Ga0207641_100183313	144
500	3300026095	Ga0207676_11888177	Ga0207676_118881771	144
501	3300031616	Ga0307508_10014670	Ga0307508_100146704	144
502	3300031730	Ga0307516_10222002	Ga0307516_102220022	144
503	3300035695	Ga0373927_0140502	Ga0373927_0140502_701_1192	144
504	3300036401	Ga0373937_0619546	Ga0373937_0619546_54_545	144
505	3300039438	Ga0436360_1352026	Ga0436360_1352026_31_534	144
506	3300046462	Ga0495651_0114580	Ga0495651_0114580_608_1093	144
507	3300046472	Ga0495580_0951641	Ga0495580_0951641_18_509	144
508	3300046477	Ga0495664_0406649	Ga0495664_0406649_56_547	144
509	3300046539	Ga0495621_0198836	Ga0495621_0198836_267_758	144
510	3300047444	Ga0495675_0446468	Ga0495675_0446468_153_644	144
511	3300048922	Ga0496119_0057524	Ga0496119_0057524_284_775	144
512	3300048924	Ga0496121_0104964	Ga0496121_0104964_448_939	144
513	3300050492	nmdc:mga0yw44_612562_c1	nmdc:mga0yw44_612562_c1_186_728	144
514	3300053077	Ga0495601_0139795	Ga0495601_0139795_551_1042	144
515	3300053084	Ga0495595_0173613	Ga0495595_0173613_490_981	144
516	3300053085	Ga0495619_0262235	Ga0495619_0262235_212_703	144
517	iso_pu_bacteria	2513237137	2513855921	144
518	iso_pu_bacteria	2904690495	2904698404	144
519	iso_pu_bacteria	2908756301	2908761064	144
520	iso_pu_bacteria	2922361189	2922365286	144
521	3300005341	Ga0070691_10203453	Ga0070691_102034532	145
522	3300005344	Ga0070661_100089964	Ga0070661_1000899642	145
523	3300005364	Ga0070673_101157450	Ga0070673_1011574501	145
524	3300005435	Ga0070714_100121097	Ga0070714_1001210971	145
525	3300005539	Ga0068853_100721384	Ga0068853_1007213842	145
526	3300005578	Ga0068854_100454254	Ga0068854_1004542542	145
527	3300005614	Ga0068856_100072308	Ga0068856_1000723082	145
528	3300005616	Ga0068852_100398894	Ga0068852_1003988942	145
529	3300005937	Ga0081455_10279684	Ga0081455_102796841	145
530	3300005983	Ga0081540_1046754	Ga0081540_10467542	145
531	3300006051	Ga0075364_10583538	Ga0075364_105835381	145
532	3300006173	Ga0070716_100030634	Ga0070716_1000306344	145
533	3300006175	Ga0070712_100250555	Ga0070712_1002505552	145
534	3300009093	Ga0105240_10038716	Ga0105240_100387163	145
535	3300009177	Ga0105248_10478290	Ga0105248_104782902	145
536	3300009545	Ga0105237_10204224	Ga0105237_102042242	145
537	3300013104	Ga0157370_10215983	Ga0157370_102159832	145
538	3300013105	Ga0157369_10012483	Ga0157369_100124838	145
539	3300013296	Ga0157374_10996916	Ga0157374_109969162	145
540	3300013297	Ga0157378_10009924	Ga0157378_100099243	145
541	3300013307	Ga0157372_10040112	Ga0157372_100401124	145
542	3300025315	Ga0207697_10031735	Ga0207697_100317352	145
543	3300025913	Ga0207695_10009431	Ga0207695_100094317	145
544	3300025914	Ga0207671_10243666	Ga0207671_102436662	145
545	3300025915	Ga0207693_10089167	Ga0207693_100891673	145
546	3300025920	Ga0207649_10658761	Ga0207649_106587612	145
547	3300025929	Ga0207664_10096819	Ga0207664_100968192	145
548	3300025939	Ga0207665_10078163	Ga0207665_100781633	145
549	3300025981	Ga0207640_10406556	Ga0207640_104065562	145
550	3300026041	Ga0207639_10605090	Ga0207639_106050902	145
551	3300026142	Ga0207698_10371445	Ga0207698_103714452	145
552	3300035111	Ga0373923_0022342	Ga0373923_0022342_1785_2267	145
553	3300035170	Ga0373943_0037733	Ga0373943_0037733_79_561	145
554	3300035410	Ga0373924_0020261	Ga0373924_0020261_277_759	145
555	3300035692	Ga0373935_0008594	Ga0373935_0008594_1088_1570	145
556	3300035695	Ga0373927_0002258	Ga0373927_0002258_6824_7306	145
557	3300035695	Ga0373927_0060753	Ga0373927_0060753_1776_2258	145
558	3300035695	Ga0373927_0116167	Ga0373927_0116167_352_846	145
559	3300035724	Ga0373933_0189809	Ga0373933_0189809_654_1136	145
560	3300035725	Ga0373947_0002634	Ga0373947_0002634_8124_8606	145
561	3300035725	Ga0373947_0068387	Ga0373947_0068387_516_998	145
562	3300035725	Ga0373947_0244070	Ga0373947_0244070_204_698	145
563	3300036401	Ga0373937_0155295	Ga0373937_0155295_1475_1957	145
564	3300037068	Ga0373925_0008340	Ga0373925_0008340_5232_5714	145
565	3300037068	Ga0373925_0548134	Ga0373925_0548134_435_929	145
566	3300037312	Ga0395899_0139395	Ga0395899_0139395_527_1021	145
567	3300037418	Ga0395900_0044059	Ga0395900_0044059_2192_2770	145
568	3300037466	Ga0395898_0051661	Ga0395898_0051661_1464_2042	145
569	3300038443	Ga0395901_0837210	Ga0395901_0837210_261_755	145
570	3300039437	Ga0436365_0508090	Ga0436365_0508090_2097_2588	145
571	3300039450	Ga0436363_0850716	Ga0436363_0850716_328_819	145
572	3300041486	Ga0451807_2622904	Ga0451807_2622904_737_1225	145
573	3300041501	Ga0451845_0217232	Ga0451845_0217232_325_813	145
574	3300046454	Ga0495592_0834286	Ga0495592_0834286_36_518	145
575	3300046455	Ga0495603_0000676	Ga0495603_0000676_18151_18633	145
576	3300046459	Ga0495629_0327051	Ga0495629_0327051_520_1002	145
577	3300046461	Ga0495641_0005779	Ga0495641_0005779_2005_2487	145
578	3300046473	Ga0495582_0000177	Ga0495582_0000177_16938_17420	145
579	3300046475	Ga0495639_0156346	Ga0495639_0156346_73_555	145
580	3300046475	Ga0495639_0171384	Ga0495639_0171384_353_835	145
581	3300046476	Ga0495662_0000028	Ga0495662_0000028_45257_45739	145
582	3300046499	Ga0495594_0000020	Ga0495594_0000020_13309_13791	145
583	3300046517	Ga0495630_0003026	Ga0495630_0003026_10224_10706	145
584	3300046526	Ga0495666_0081834	Ga0495666_0081834_755_1237	145
585	3300046529	Ga0495652_0906265	Ga0495652_0906265_74_556	145
586	3300046531	Ga0495665_0000057	Ga0495665_0000057_1579_2061	145
587	3300046533	Ga0495640_0072851	Ga0495640_0072851_60_542	145
588	3300046557	Ga0495622_0003396	Ga0495622_0003396_3743_4225	145
589	3300046559	Ga0495667_0219763	Ga0495667_0219763_385_867	145
590	3300046642	Ga0495634_0000324	Ga0495634_0000324_15592_16074	145
591	3300046663	Ga0495635_0000496	Ga0495635_0000496_8399_8881	145
592	3300046674	Ga0495588_0003434	Ga0495588_0003434_471_953	145
593	3300046680	Ga0495646_0159192	Ga0495646_0159192_190_672	145
594	3300046683	Ga0495658_0007012	Ga0495658_0007012_3247_3729	145
595	3300046689	Ga0495613_0004688	Ga0495613_0004688_4788_5270	145
596	3300047315	Ga0495581_0006881	Ga0495581_0006881_5631_6113	145
597	3300047317	Ga0495604_0479750	Ga0495604_0479750_296_778	145
598	3300047319	Ga0495674_0024210	Ga0495674_0024210_4547_5029	145
599	3300047321	Ga0495676_0063040	Ga0495676_0063040_701_1183	145
600	3300047673	Ga0495593_0067263	Ga0495593_0067263_339_821	145
601	3300048904	Ga0496101_0180558	Ga0496101_0180558_167_661	145
602	3300048911	Ga0496108_0526989	Ga0496108_0526989_510_1004	145
603	3300048917	Ga0496114_0281477	Ga0496114_0281477_780_1274	145
604	3300048918	Ga0496115_0784234	Ga0496115_0784234_89_583	145
605	3300048924	Ga0496121_0000407	Ga0496121_0000407_37246_37725	145
606	3300048924	Ga0496121_0272041	Ga0496121_0272041_459_950	145
607	3300049578	Ga0501042_0288253	Ga0501042_0288253_445_942	145
608	3300049741	Ga0501079_0779087	Ga0501079_0779087_16_510	145
609	3300053090	Ga0500646_0178462	Ga0500646_0178462_14_496	145
610	iso_pu_bacteria	2513237101	2513692452	145
611	iso_pu_bacteria	2517572143	2517892447	145
612	iso_pu_bacteria	2667528175	2671122444	145
613	iso_pu_bacteria	2721755755	2723845165	145
614	iso_pu_bacteria	2791355197	2793072071	145
615	iso_pu_bacteria	2791355199	2793080914	145
616	iso_pu_bacteria	2874604998	2874605120	145
617	iso_pu_bacteria	2876808645	2876813278	145
618	iso_pu_bacteria	2879110137	2879113624	145
619	iso_pu_bacteria	2885374607	2885375050	145
620	iso_pu_bacteria	2889033259	2889039909	145
621	iso_pu_bacteria	2903748898	2903751745	145
622	iso_pu_bacteria	2906610324	2906618567	145
623	iso_pu_bacteria	2906635258	2906636115	145
624	iso_pu_bacteria	2906660503	2906666434	145
625	iso_pu_bacteria	2908739725	2908742753	145
626	iso_pu_bacteria	2922425934	2922430224	145
627	iso_pu_bacteria	2935630451	2935631715	145
628	iso_pu_bacteria	2941507105	2941511509	145
629	iso_pu_bacteria	2941515067	2941519210	145
630	iso_pu_bacteria	2941523033	2941526210	145
631	iso_pu_bacteria	8006964411	8006965665	145
632	iso_pu_bacteria	8006984368	8006987124	145
633	iso_pu_bacteria	8006994254	8006998801	145
634	iso_pu_bacteria	8019555841	8019556812	145
635	iso_pu_bacteria	8019565922	8019568495	145
636	3300005327	Ga0070658_10097872	Ga0070658_100978723	146
637	3300005336	Ga0070680_100285490	Ga0070680_1002854902	146
638	3300005366	Ga0070659_100145270	Ga0070659_1001452702	146
639	3300005440	Ga0070705_100547035	Ga0070705_1005470351	146
640	3300005458	Ga0070681_10146140	Ga0070681_101461403	146
641	3300005530	Ga0070679_100043008	Ga0070679_1000430085	146
642	3300005563	Ga0068855_100003023	Ga0068855_1000030237	146
643	3300005841	Ga0068863_100313459	Ga0068863_1003134592	146
644	3300009092	Ga0105250_10073381	Ga0105250_100733812	146
645	3300010375	Ga0105239_11389049	Ga0105239_113890491	146
646	3300013104	Ga0157370_10316608	Ga0157370_103166082	146
647	3300013105	Ga0157369_11074110	Ga0157369_110741101	146
648	3300021320	Ga0214544_1000002	Ga0214544_1000002501	146
649	3300021321	Ga0214542_1000001	Ga0214542_1000001851	146
650	3300021324	Ga0214545_1000001	Ga0214545_1000001917	146
651	3300021327	Ga0214543_1000001	Ga0214543_1000001277	146
652	3300025917	Ga0207660_10808688	Ga0207660_108086882	146
653	3300025921	Ga0207652_10608749	Ga0207652_106087492	146
654	3300025949	Ga0207667_10039055	Ga0207667_100390552	146
655	3300048905	Ga0496102_0357950	Ga0496102_0357950_291_776	146
656	3300048909	Ga0496106_0001783	Ga0496106_0001783_313_798	146
657	3300048920	Ga0496117_0057783	Ga0496117_0057783_103_588	146
658	3300048921	Ga0496118_0001507	Ga0496118_0001507_22679_23164	146
659	3300048924	Ga0496121_0000183	Ga0496121_0000183_101431_101916	146
660	3300048927	Ga0496124_0003899	Ga0496124_0003899_11592_12077	146
661	3300048928	Ga0496125_0037479	Ga0496125_0037479_2775_3260	146
662	3300048929	Ga0496126_0016402	Ga0496126_0016402_2685_3170	146
663	3300060353	Ga0501082_0742905	Ga0501082_0742905_353_826	146
664	iso_pu_bacteria	2513237096	2513654668	146
665	iso_pu_bacteria	2513237145	2513915152	146
666	iso_pu_bacteria	3005474847	3005480157	146
667	iso_pu_bacteria	8056673599	8056673937	146
668	3300013296	Ga0157374_11257552	Ga0157374_112575522	147
669	3300031247	Ga0265340_10003402	Ga0265340_100034024	147
670	3300031712	Ga0265342_10119181	Ga0265342_101191812	147
671	3300046507	Ga0495606_0004986	Ga0495606_0004986_3926_4405	147
672	3300048915	Ga0496112_0000031	Ga0496112_0000031_7283_7768	147
673	3300049823	Ga0501044_0196804	Ga0501044_0196804_1130_1600	147
674	3300005334	Ga0068869_100488259	Ga0068869_1004882591	148
675	3300005337	Ga0070682_100031462	Ga0070682_1000314623	148
676	3300005353	Ga0070669_100425531	Ga0070669_1004255311	148
677	3300005455	Ga0070663_100044064	Ga0070663_1000440642	148
678	3300005518	Ga0070699_100201372	Ga0070699_1002013721	148
679	3300005530	Ga0070679_100941009	Ga0070679_1009410091	148
680	3300005546	Ga0070696_100477014	Ga0070696_1004770142	148
681	3300005564	Ga0070664_100545681	Ga0070664_1005456812	148
682	3300005564	Ga0070664_100606329	Ga0070664_1006063292	148
683	3300005843	Ga0068860_101298411	Ga0068860_1012984112	148
684	3300006048	Ga0075363_100004820	Ga0075363_1000048202	148
685	3300009148	Ga0105243_11053881	Ga0105243_110538811	148
686	3300025907	Ga0207645_10202577	Ga0207645_102025772	148
687	3300025920	Ga0207649_10068978	Ga0207649_100689783	148
688	3300025924	Ga0207694_10529359	Ga0207694_105293591	148
689	3300025942	Ga0207689_10460497	Ga0207689_104604972	148
690	3300025944	Ga0207661_10542790	Ga0207661_105427901	148
691	3300025945	Ga0207679_10760842	Ga0207679_107608422	148
692	3300025961	Ga0207712_10360816	Ga0207712_103608162	148
693	3300026023	Ga0207677_10235816	Ga0207677_102358161	148
694	3300026023	Ga0207677_10719309	Ga0207677_107193092	148
695	3300026118	Ga0207675_100041238	Ga0207675_1000412381	148
696	3300028379	Ga0268266_10002779	Ga0268266_100027794	148
697	3300035088	Ga0373940_0030764	Ga0373940_0030764_687_1181	148
698	3300035113	Ga0373936_0097700	Ga0373936_0097700_342_836	148
699	3300046536	Ga0495587_0584005	Ga0495587_0584005_46_540	148
700	3300048904	Ga0496101_0549085	Ga0496101_0549085_388_879	148
701	3300048905	Ga0496102_0064455	Ga0496102_0064455_999_1490	148
702	3300048907	Ga0496104_0138922	Ga0496104_0138922_768_1259	148
703	3300048909	Ga0496106_0474117	Ga0496106_0474117_402_893	148
704	3300048910	Ga0496107_0155167	Ga0496107_0155167_747_1238	148
705	3300048912	Ga0496109_0566321	Ga0496109_0566321_475_966	148
706	3300048918	Ga0496115_0444004	Ga0496115_0444004_491_982	148
707	3300050490	nmdc:mga03n38_518827_c1	nmdc:mga03n38_518827_c1_71_562	148
708	3300050494	nmdc:mga06z11_359328_c1	nmdc:mga06z11_359328_c1_358_849	148
709	3300050495	nmdc:mga04h51_20146_c1	nmdc:mga04h51_20146_c1_316_807	148
710	3300053093	Ga0500651_0487626	Ga0500651_0487626_133_627	148
711	3300053102	Ga0500554_005156	Ga0500554_005156_450_944	148
712	3300053119	Ga0500595_000844	Ga0500595_000844_5763_6257	148
713	3300053150	Ga0500603_106980	Ga0500603_106980_230_724	148
714	3300053162	Ga0500638_000727	Ga0500638_000727_6795_7289	148
715	3300053177	Ga0500636_0174238	Ga0500636_0174238_173_667	148
716	3300053178	Ga0500637_0000104	Ga0500637_0000104_25253_25747	148
717	3300055283	Ga0500661_001650	Ga0500661_001650_3562_4056	148
718	3300005328	Ga0070676_10215456	Ga0070676_102154562	149
719	3300005329	Ga0070683_100161825	Ga0070683_1001618252	149
720	3300005330	Ga0070690_100575824	Ga0070690_1005758241	149
721	3300005331	Ga0070670_100502886	Ga0070670_1005028862	149
722	3300005334	Ga0068869_100650899	Ga0068869_1006508991	149
723	3300005334	Ga0068869_100865143	Ga0068869_1008651431	149
724	3300005335	Ga0070666_10352313	Ga0070666_103523132	149
725	3300005337	Ga0070682_100318449	Ga0070682_1003184491	149
726	3300005337	Ga0070682_100449235	Ga0070682_1004492351	149
727	3300005338	Ga0068868_100015782	Ga0068868_1000157823	149
728	3300005339	Ga0070660_100143997	Ga0070660_1001439972	149
729	3300005339	Ga0070660_100173799	Ga0070660_1001737992	149
730	3300005340	Ga0070689_100167031	Ga0070689_1001670312	149
731	3300005340	Ga0070689_100577311	Ga0070689_1005773112	149
732	3300005347	Ga0070668_100056554	Ga0070668_1000565541	149
733	3300005347	Ga0070668_100386242	Ga0070668_1003862421	149
734	3300005354	Ga0070675_100178981	Ga0070675_1001789812	149
735	3300005355	Ga0070671_100130874	Ga0070671_1001308742	149
736	3300005356	Ga0070674_100007645	Ga0070674_1000076452	149
737	3300005364	Ga0070673_100759091	Ga0070673_1007590912	149
738	3300005365	Ga0070688_100271284	Ga0070688_1002712842	149
739	3300005366	Ga0070659_100612486	Ga0070659_1006124862	149
740	3300005438	Ga0070701_10032376	Ga0070701_100323763	149
741	3300005455	Ga0070663_100086097	Ga0070663_1000860973	149
742	3300005455	Ga0070663_100154382	Ga0070663_1001543822	149
743	3300005455	Ga0070663_100441891	Ga0070663_1004418912	149
744	3300005455	Ga0070663_100799809	Ga0070663_1007998091	149
745	3300005456	Ga0070678_100089066	Ga0070678_1000890663	149
746	3300005456	Ga0070678_100293289	Ga0070678_1002932892	149
747	3300005456	Ga0070678_100426195	Ga0070678_1004261952	149
748	3300005456	Ga0070678_100814686	Ga0070678_1008146861	149
749	3300005457	Ga0070662_100222481	Ga0070662_1002224812	149
750	3300005459	Ga0068867_100020024	Ga0068867_1000200243	149
751	3300005459	Ga0068867_100207822	Ga0068867_1002078221	149
752	3300005466	Ga0070685_10070010	Ga0070685_100700102	149
753	3300005535	Ga0070684_100065228	Ga0070684_1000652284	149
754	3300005539	Ga0068853_100244989	Ga0068853_1002449893	149
755	3300005543	Ga0070672_100060622	Ga0070672_1000606223	149
756	3300005543	Ga0070672_100206859	Ga0070672_1002068592	149
757	3300005546	Ga0070696_100145872	Ga0070696_1001458722	149
758	3300005548	Ga0070665_100224798	Ga0070665_1002247982	149
759	3300005564	Ga0070664_100034166	Ga0070664_1000341665	149
760	3300005578	Ga0068854_101138903	Ga0068854_1011389032	149
761	3300005615	Ga0070702_100042749	Ga0070702_1000427493	149
762	3300005615	Ga0070702_100437287	Ga0070702_1004372872	149
763	3300005616	Ga0068852_100042910	Ga0068852_1000429104	149
764	3300005617	Ga0068859_100887809	Ga0068859_1008878092	149
765	3300005618	Ga0068864_100243560	Ga0068864_1002435602	149
766	3300005718	Ga0068866_10064519	Ga0068866_100645193	149
767	3300005719	Ga0068861_100438602	Ga0068861_1004386022	149
768	3300005842	Ga0068858_100031889	Ga0068858_1000318895	149
769	3300005842	Ga0068858_101069730	Ga0068858_1010697301	149
770	3300005844	Ga0068862_100226739	Ga0068862_1002267392	149
771	3300005844	Ga0068862_100272907	Ga0068862_1002729072	149
772	3300005844	Ga0068862_101672090	Ga0068862_1016720901	149
773	3300005937	Ga0081455_10055763	Ga0081455_100557632	149
774	3300005983	Ga0081540_1003284	Ga0081540_10032846	149
775	3300006042	Ga0075368_10068569	Ga0075368_100685692	149
776	3300006178	Ga0075367_10377543	Ga0075367_103775432	149
777	3300006186	Ga0075369_10050214	Ga0075369_100502143	149
778	3300006195	Ga0075366_10201274	Ga0075366_102012742	149
779	3300006353	Ga0075370_10496315	Ga0075370_104963152	149
780	3300006358	Ga0068871_100127534	Ga0068871_1001275343	149
781	3300006852	Ga0075433_10693992	Ga0075433_106939922	149
782	3300006871	Ga0075434_100067371	Ga0075434_1000673715	149
783	3300006881	Ga0068865_100683196	Ga0068865_1006831962	149
784	3300006931	Ga0097620_100887888	Ga0097620_1008878882	149
785	3300009092	Ga0105250_10059349	Ga0105250_100593492	149
786	3300009094	Ga0111539_10433427	Ga0111539_104334272	149
787	3300009094	Ga0111539_12140220	Ga0111539_121402201	149
788	3300009098	Ga0105245_10031330	Ga0105245_100313302	149
789	3300009098	Ga0105245_10315793	Ga0105245_103157932	149
790	3300009101	Ga0105247_10208359	Ga0105247_102083592	149
791	3300009176	Ga0105242_10108112	Ga0105242_101081122	149
792	3300009176	Ga0105242_12535964	Ga0105242_125359641	149
793	3300009177	Ga0105248_11598787	Ga0105248_115987872	149
794	3300009545	Ga0105237_11061428	Ga0105237_110614282	149
795	3300009551	Ga0105238_10554074	Ga0105238_105540742	149
796	3300010375	Ga0105239_10053264	Ga0105239_100532642	149
797	3300010375	Ga0105239_10095982	Ga0105239_100959822	149
798	3300011119	Ga0105246_10011321	Ga0105246_100113216	149
799	3300011119	Ga0105246_10475482	Ga0105246_104754822	149
800	3300013296	Ga0157374_10197400	Ga0157374_101974002	149
801	3300013296	Ga0157374_10254788	Ga0157374_102547881	149
802	3300013297	Ga0157378_10323074	Ga0157378_103230742	149
803	3300013306	Ga0163162_10151024	Ga0163162_101510241	149
804	3300013306	Ga0163162_10467021	Ga0163162_104670213	149
805	3300013306	Ga0163162_10500398	Ga0163162_105003981	149
806	3300013308	Ga0157375_10303746	Ga0157375_103037463	149
807	3300013308	Ga0157375_10825504	Ga0157375_108255041	149
808	3300013308	Ga0157375_11338128	Ga0157375_113381281	149
809	3300014325	Ga0163163_10400488	Ga0163163_104004882	149
810	3300014325	Ga0163163_12290552	Ga0163163_122905521	149
811	3300014326	Ga0157380_11362017	Ga0157380_113620172	149
812	3300014968	Ga0157379_10482118	Ga0157379_104821182	149
813	3300014969	Ga0157376_10004919	Ga0157376_100049195	149
814	3300014969	Ga0157376_11240303	Ga0157376_112403031	149
815	3300015261	Ga0182006_1182580	Ga0182006_11825801	149
816	3300025290	Ga0207673_1018247	Ga0207673_10182471	149
817	3300025315	Ga0207697_10208722	Ga0207697_102087222	149
818	3300025893	Ga0207682_10131823	Ga0207682_101318231	149
819	3300025899	Ga0207642_10051644	Ga0207642_100516442	149
820	3300025900	Ga0207710_10324834	Ga0207710_103248342	149
821	3300025903	Ga0207680_10463946	Ga0207680_104639461	149
822	3300025907	Ga0207645_10121693	Ga0207645_101216932	149
823	3300025907	Ga0207645_10284791	Ga0207645_102847911	149
824	3300025908	Ga0207643_10137059	Ga0207643_101370592	149
825	3300025908	Ga0207643_10533787	Ga0207643_105337872	149
826	3300025909	Ga0207705_10409394	Ga0207705_104093941	149
827	3300025911	Ga0207654_10088179	Ga0207654_100881791	149
828	3300025911	Ga0207654_10553657	Ga0207654_105536572	149
829	3300025919	Ga0207657_10301990	Ga0207657_103019902	149
830	3300025920	Ga0207649_10630891	Ga0207649_106308911	149
831	3300025923	Ga0207681_10319895	Ga0207681_103198952	149
832	3300025925	Ga0207650_10163067	Ga0207650_101630673	149
833	3300025926	Ga0207659_10365366	Ga0207659_103653662	149
834	3300025926	Ga0207659_11031694	Ga0207659_110316942	149
835	3300025927	Ga0207687_10025922	Ga0207687_100259224	149
836	3300025927	Ga0207687_10760096	Ga0207687_107600962	149
837	3300025933	Ga0207706_10047791	Ga0207706_100477914	149
838	3300025933	Ga0207706_10148397	Ga0207706_101483973	149
839	3300025933	Ga0207706_10290648	Ga0207706_102906482	149
840	3300025934	Ga0207686_10258183	Ga0207686_102581832	149
841	3300025935	Ga0207709_10066147	Ga0207709_100661472	149
842	3300025936	Ga0207670_10344002	Ga0207670_103440022	149
843	3300025936	Ga0207670_10382852	Ga0207670_103828522	149
844	3300025937	Ga0207669_10018683	Ga0207669_100186833	149
845	3300025937	Ga0207669_10757738	Ga0207669_107577382	149
846	3300025940	Ga0207691_10048908	Ga0207691_100489082	149
847	3300025940	Ga0207691_10198496	Ga0207691_101984962	149
848	3300025942	Ga0207689_10055708	Ga0207689_100557084	149
849	3300025942	Ga0207689_10811391	Ga0207689_108113911	149
850	3300025945	Ga0207679_10028273	Ga0207679_100282733	149
851	3300025945	Ga0207679_10090770	Ga0207679_100907703	149
852	3300025949	Ga0207667_10789181	Ga0207667_107891812	149
853	3300025961	Ga0207712_11570297	Ga0207712_115702971	149
854	3300025972	Ga0207668_10115858	Ga0207668_101158583	149
855	3300025972	Ga0207668_10853379	Ga0207668_108533792	149
856	3300025972	Ga0207668_11552542	Ga0207668_115525421	149
857	3300025981	Ga0207640_10865050	Ga0207640_108650501	149
858	3300025986	Ga0207658_11249175	Ga0207658_112491752	149
859	3300026023	Ga0207677_10076948	Ga0207677_100769483	149
860	3300026023	Ga0207677_10136957	Ga0207677_101369572	149
861	3300026035	Ga0207703_10317296	Ga0207703_103172962	149
862	3300026067	Ga0207678_10220356	Ga0207678_102203562	149
863	3300026067	Ga0207678_10274850	Ga0207678_102748503	149
864	3300026067	Ga0207678_10433812	Ga0207678_104338122	149
865	3300026088	Ga0207641_11301072	Ga0207641_113010721	149
866	3300026089	Ga0207648_10025820	Ga0207648_100258202	149
867	3300026095	Ga0207676_10094773	Ga0207676_100947733	149
868	3300026095	Ga0207676_10545106	Ga0207676_105451062	149
869	3300026116	Ga0207674_10215991	Ga0207674_102159912	149
870	3300026118	Ga0207675_100264237	Ga0207675_1002642372	149
871	3300026118	Ga0207675_101924525	Ga0207675_1019245251	149
872	3300026121	Ga0207683_10050062	Ga0207683_100500621	149
873	3300026121	Ga0207683_10087234	Ga0207683_100872342	149
874	3300026121	Ga0207683_10573586	Ga0207683_105735862	149
875	3300027866	Ga0209813_10176274	Ga0209813_101762742	149
876	3300028379	Ga0268266_10001919	Ga0268266_100019199	149
877	3300028379	Ga0268266_10104118	Ga0268266_101041182	149
878	3300028379	Ga0268266_10725901	Ga0268266_107259012	149
879	3300028380	Ga0268265_10317916	Ga0268265_103179162	149
880	3300028380	Ga0268265_10624867	Ga0268265_106248672	149
881	3300028381	Ga0268264_10154443	Ga0268264_101544432	149
882	3300028794	Ga0307515_10534978	Ga0307515_105349781	149
883	3300030521	Ga0307511_10209660	Ga0307511_102096602	149
884	3300031548	Ga0307408_101280852	Ga0307408_1012808521	149
885	3300031616	Ga0307508_10414776	Ga0307508_104147762	149
886	3300031616	Ga0307508_10457603	Ga0307508_104576032	149
887	3300031731	Ga0307405_11746251	Ga0307405_117462511	149
888	3300031824	Ga0307413_10100977	Ga0307413_101009772	149
889	3300031852	Ga0307410_10251121	Ga0307410_102511212	149
890	3300031903	Ga0307407_10255048	Ga0307407_102550482	149
891	3300032002	Ga0307416_100397663	Ga0307416_1003976632	149
892	3300032002	Ga0307416_100595776	Ga0307416_1005957762	149
893	3300032004	Ga0307414_10778866	Ga0307414_107788661	149
894	3300033180	Ga0307510_10229266	Ga0307510_102292662	149
895	3300034820	Ga0373959_0044885	Ga0373959_0044885_192_683	149
896	3300035090	Ga0373949_0139366	Ga0373949_0139366_116_607	149
897	3300035112	Ga0373932_0346984	Ga0373932_0346984_28_516	149
898	3300035115	Ga0373941_0338866	Ga0373941_0338866_40_534	149
899	3300035170	Ga0373943_0382959	Ga0373943_0382959_272_757	149
900	3300041453	Ga0451797_1020677	Ga0451797_1020677_289_777	149
901	3300041456	Ga0451795_0541422	Ga0451795_0541422_333_836	149
902	3300041496	Ga0451839_1163861	Ga0451839_1163861_179_667	149
903	3300041512	Ga0451853_1762699	Ga0451853_1762699_507_1022	149
904	3300041512	Ga0451853_2570889	Ga0451853_2570889_157_660	149
905	3300041997	Ga0439431_0050249	Ga0439431_0050249_259_753	149
906	3300042435	Ga0439434_0210318	Ga0439434_0210318_83_577	149
907	3300046455	Ga0495603_0265566	Ga0495603_0265566_429_917	149
908	3300046458	Ga0495591_069584	Ga0495591_069584_225_716	149
909	3300046459	Ga0495629_0231277	Ga0495629_0231277_443_934	149
910	3300046459	Ga0495629_0231914	Ga0495629_0231914_137_628	149
911	3300046461	Ga0495641_0059296	Ga0495641_0059296_561_1049	149
912	3300046492	Ga0495585_0170754	Ga0495585_0170754_553_1041	149
913	3300046511	Ga0495608_0220879	Ga0495608_0220879_200_691	149
914	3300046512	Ga0495610_0048384	Ga0495610_0048384_721_1209	149
915	3300046513	Ga0495616_0189004	Ga0495616_0189004_372_866	149
916	3300046520	Ga0495637_0197147	Ga0495637_0197147_95_583	149
917	3300046520	Ga0495637_0235144	Ga0495637_0235144_70_561	149
918	3300046523	Ga0495644_0049011	Ga0495644_0049011_30_524	149
919	3300046523	Ga0495644_0247130	Ga0495644_0247130_100_588	149
920	3300046524	Ga0495648_0095800	Ga0495648_0095800_594_1082	149
921	3300046542	Ga0495597_0145441	Ga0495597_0145441_200_691	149
922	3300046542	Ga0495597_0221203	Ga0495597_0221203_53_541	149
923	3300046557	Ga0495622_0146398	Ga0495622_0146398_189_677	149
924	3300046616	Ga0495668_0320896	Ga0495668_0320896_258_746	149
925	3300046648	Ga0495611_0109511	Ga0495611_0109511_695_1183	149
926	3300046660	Ga0495625_0059002	Ga0495625_0059002_1965_2453	149
927	3300046683	Ga0495658_0277471	Ga0495658_0277471_370_861	149
928	3300046684	Ga0495669_0010274	Ga0495669_0010274_2306_2800	149
929	3300046692	Ga0495671_0108683	Ga0495671_0108683_748_1236	149
930	3300046694	Ga0495649_0106711	Ga0495649_0106711_779_1267	149
931	3300046794	Ga0495589_0137655	Ga0495589_0137655_560_1048	149
932	3300047317	Ga0495604_0333125	Ga0495604_0333125_155_652	149
933	3300047445	Ga0495677_0029189	Ga0495677_0029189_271_765	149
934	3300047447	Ga0495685_034944	Ga0495685_034944_461_952	149
935	3300047469	Ga0495673_0183702	Ga0495673_0183702_76_564	149
936	3300047472	Ga0495686_0063144	Ga0495686_0063144_1063_1554	149
937	3300048090	Ga0495615_0020027	Ga0495615_0020027_345_836	149
938	3300048903	Ga0496100_0006178	Ga0496100_0006178_3434_3937	149
939	3300048903	Ga0496100_0048766	Ga0496100_0048766_1588_2082	149
940	3300048903	Ga0496100_1302928	Ga0496100_1302928_31_522	149
941	3300048904	Ga0496101_0014276	Ga0496101_0014276_4415_4918	149
942	3300048904	Ga0496101_0222186	Ga0496101_0222186_116_610	149
943	3300048905	Ga0496102_0048507	Ga0496102_0048507_927_1421	149
944	3300048905	Ga0496102_0068279	Ga0496102_0068279_443_946	149
945	3300048905	Ga0496102_0186056	Ga0496102_0186056_751_1245	149
946	3300048905	Ga0496102_0316218	Ga0496102_0316218_56_547	149
947	3300048905	Ga0496102_1341029	Ga0496102_1341029_93_581	149
948	3300048906	Ga0496103_0023313	Ga0496103_0023313_2618_3121	149
949	3300048907	Ga0496104_0007944	Ga0496104_0007944_8212_8715	149
950	3300048907	Ga0496104_0634850	Ga0496104_0634850_109_600	149
951	3300048908	Ga0496105_0418700	Ga0496105_0418700_325_816	149
952	3300048909	Ga0496106_0007982	Ga0496106_0007982_4976_5479	149
953	3300048909	Ga0496106_0098878	Ga0496106_0098878_638_1132	149
954	3300048910	Ga0496107_0053497	Ga0496107_0053497_2303_2806	149
955	3300048910	Ga0496107_0786694	Ga0496107_0786694_162_653	149
956	3300048911	Ga0496108_0245547	Ga0496108_0245547_1026_1517	149
957	3300048911	Ga0496108_0616597	Ga0496108_0616597_69_560	149
958	3300048911	Ga0496108_1397905	Ga0496108_1397905_59_550	149
959	3300048912	Ga0496109_0007958	Ga0496109_0007958_443_946	149
960	3300048913	Ga0496110_0004242	Ga0496110_0004242_8601_9104	149
961	3300048914	Ga0496111_0012624	Ga0496111_0012624_1744_2247	149
962	3300048914	Ga0496111_0999666	Ga0496111_0999666_34_522	149
963	3300048916	Ga0496113_0007392	Ga0496113_0007392_5076_5579	149
964	3300048916	Ga0496113_0507440	Ga0496113_0507440_197_688	149
965	3300048917	Ga0496114_0030943	Ga0496114_0030943_2675_3169	149
966	3300048917	Ga0496114_0076768	Ga0496114_0076768_627_1130	149
967	3300048917	Ga0496114_1420093	Ga0496114_1420093_80_571	149
968	3300048918	Ga0496115_0002452	Ga0496115_0002452_1168_1671	149
969	3300048918	Ga0496115_0035163	Ga0496115_0035163_710_1201	149
970	3300048918	Ga0496115_0620904	Ga0496115_0620904_60_551	149
971	3300048923	Ga0496120_0136792	Ga0496120_0136792_501_989	149
972	3300048924	Ga0496121_0065910	Ga0496121_0065910_149_640	149
973	3300048924	Ga0496121_0082002	Ga0496121_0082002_141_629	149
974	3300048928	Ga0496125_0091046	Ga0496125_0091046_1530_2021	149
975	3300048929	Ga0496126_0026742	Ga0496126_0026742_4978_5466	149
976	3300048929	Ga0496126_0354945	Ga0496126_0354945_663_1154	149
977	3300050495	nmdc:mga04h51_132514_c1	nmdc:mga04h51_132514_c1_51_542	149
978	3300050495	nmdc:mga04h51_139952_c1	nmdc:mga04h51_139952_c1_328_819	149
979	3300050496	nmdc:mga07m45_119977_c1	nmdc:mga07m45_119977_c1_945_1436	149
980	3300050496	nmdc:mga07m45_348724_c1	nmdc:mga07m45_348724_c1_72_563	149
981	3300050511	nmdc:mga08y16_187301_c1	nmdc:mga08y16_187301_c1_285_779	149
982	3300050511	nmdc:mga08y16_423734_c1	nmdc:mga08y16_423734_c1_264_752	149
983	3300050516	nmdc:mga0sz30_246287_c1	nmdc:mga0sz30_246287_c1_218_709	149
984	3300053083	Ga0495655_0120443	Ga0495655_0120443_283_786	149
985	3300053083	Ga0495655_0143383	Ga0495655_0143383_12_497	149
986	3300053087	Ga0500643_063404	Ga0500643_063404_19_510	149
987	3300053088	Ga0500644_0063885	Ga0500644_0063885_96_584	149
988	3300053089	Ga0500581_158916	Ga0500581_158916_384_869	149
989	3300053090	Ga0500646_0176548	Ga0500646_0176548_139_630	149
990	3300053093	Ga0500651_0225852	Ga0500651_0225852_151_639	149
991	3300053096	Ga0500641_0022271	Ga0500641_0022271_1056_1547	149
992	3300053096	Ga0500641_0073066	Ga0500641_0073066_901_1392	149
993	3300053109	Ga0500569_060966	Ga0500569_060966_621_1109	149
994	3300053119	Ga0500595_003905	Ga0500595_003905_4455_4940	149
995	3300053120	Ga0500597_144648	Ga0500597_144648_125_610	149
996	3300053130	Ga0500642_0145471	Ga0500642_0145471_69_560	149
997	3300053143	Ga0500579_128041	Ga0500579_128041_265_753	149
998	3300053146	Ga0500588_0083825	Ga0500588_0083825_20_511	149
999	3300053147	Ga0500589_039873	Ga0500589_039873_10_501	149
1000	3300053147	Ga0500589_251038	Ga0500589_251038_24_512	149
1001	3300053156	Ga0500622_0051434	Ga0500622_0051434_246_734	149
1002	3300053160	Ga0500633_0187699	Ga0500633_0187699_231_722	149
1003	3300053162	Ga0500638_081771	Ga0500638_081771_220_711	149
1004	3300053731	Ga0500609_012671	Ga0500609_012671_264_752	149
1005	3300053733	Ga0500552_009830	Ga0500552_009830_466_954	149
1006	3300009147	Ga0114129_10085849	Ga0114129_100858491	150
1007	3300005330	Ga0070690_100254248	Ga0070690_1002542482	151
1008	3300006844	Ga0075428_100065917	Ga0075428_1000659173	151
1009	3300050509	nmdc:mga0qj67_41_c1	nmdc:mga0qj67_41_c1_41262_41753	153
1010	3300003659	JGI25404J52841_10000074	JGI25404J52841_100000744	155
1011	3300005983	Ga0081540_1000136	Ga0081540_100013671	155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

109

183

0.97 Feature Viewer

pLDDT	pTM	Quality
75.17	0.48	Low

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F488147

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

109

183

0.97

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map