F488158

General Info

Members Datasets Scaffolds Average Seq Length
1012 271 2024 206

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10360617|Ga0065715_103606171
Length 224
Sequence VGVIDKTAAYRTLESELIAMNKLVILVFALLLSPMVARAQGGHEYSPLVEKTVNYKNWALPNLKTDKPDDLRALVAGKKLVMIVYFAPWCGNWRNEAPIAAKLYEKYKDQGFQVIGVSEYGSRDDVKAYFGEAGAPYPVVTESESRDDKQKTAHYGYRQLTGDGRNWGSPWNIFLEPSKLTATGDVLTEKAWVVNGELVEDEVDKFIASKVSLKTASVIEPCKN

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
202 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
203 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
204 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
205 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
229 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
230 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
231 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
232 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
237 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
238 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
239 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
240 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
241 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
242 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
243 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
244 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
245 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
246 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
247 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
248 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
249 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
250 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
251 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
252 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
253 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
257 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
258 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
259 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
260 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.48
Rhizosphere 98.32
Stem 0
Stem Tuber 0
Unclassified 25.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10360617 3300005293 Bacteria 884
2 MBSR1b_contig_11831596 2162886012 Bacteria 875
3 CNBas_1001844 3300000531 Unclassified 1142
4 JGI24751J29686_10000044 3300002459 Bacteria 77576
5 JGI25406J46586_10002885 3300003203 Bacteria 8106
6 Ga0065704_10087916 3300005289 Bacteria 2983
7 Ga0065704_10100713 3300005289 Unclassified 2264
8 Ga0065704_10119347 3300005289 Unclassified 1801
9 Ga0065704_10141261 3300005289 Bacteria 1513
10 Ga0065704_10158725 3300005289 Bacteria 1371
11 Ga0065712_10000123 3300005290 Bacteria 89338
12 Ga0065712_10010968 3300005290 Bacteria 2359
13 Ga0065712_10048272 3300005290 Unclassified 739
14 Ga0065712_10109847 3300005290 Bacteria 1848
15 Ga0065712_10146274 3300005290 Bacteria 1406
16 Ga0065715_10017239 3300005293 Bacteria 1615
17 Ga0065715_10068422 3300005293 Unclassified 721
18 Ga0065715_10089361 3300005293 Bacteria 10882
19 Ga0065715_10094370 3300005293 Bacteria 4350
20 Ga0065715_10147747 3300005293 Bacteria 1767
21 Ga0065715_10214062 3300005293 Bacteria 1301
22 Ga0065715_10586200 3300005293 Bacteria 717
23 Ga0065707_10003187 3300005295 Bacteria 4287
24 Ga0065707_10099533 3300005295 Bacteria 2989
25 Ga0065707_10106281 3300005295 Bacteria 2603
26 Ga0065707_10107559 3300005295 Unclassified 2549
27 Ga0065707_10271768 3300005295 Unclassified 1070
28 Ga0065707_10286549 3300005295 Unclassified 1034
29 Ga0065707_10294977 3300005295 Unclassified 1016
30 Ga0070676_10259573 3300005328 Bacteria 1163
31 Ga0070676_10267149 3300005328 Unclassified 1148
32 Ga0070676_10776551 3300005328 Unclassified 705
33 Ga0070683_100539584 3300005329 Unclassified 1115
34 Ga0070690_100085278 3300005330 Bacteria 2072
35 Ga0070690_100119691 3300005330 Bacteria 1766
36 Ga0070690_100128731 3300005330 Bacteria 1707
37 Ga0070690_100142793 3300005330 Unclassified 1626
38 Ga0070690_100241144 3300005330 Unclassified 1275
39 Ga0070690_100431157 3300005330 Bacteria 974
40 Ga0070670_100000144 3300005331 Bacteria 66583
41 Ga0070670_100016819 3300005331 Bacteria 6277
42 Ga0070670_100046457 3300005331 Bacteria 3734
43 Ga0070670_100132631 3300005331 Unclassified 2152
44 Ga0070670_100253954 3300005331 Bacteria 1532
45 Ga0070670_100292051 3300005331 Unclassified 1425
46 Ga0070670_100872126 3300005331 Bacteria 815
47 Ga0070677_10077455 3300005333 Bacteria 1414
48 Ga0068869_100026023 3300005334 Bacteria 4069
49 Ga0068869_100053422 3300005334 Bacteria 2937
50 Ga0068869_100108174 3300005334 Bacteria 2112
51 Ga0068869_100556540 3300005334 Unclassified 964
52 Ga0068869_100720234 3300005334 Unclassified 852
53 Ga0068869_100744021 3300005334 Unclassified 839
54 Ga0068869_100762964 3300005334 Bacteria 829
55 Ga0068869_101067821 3300005334 Unclassified 705
56 Ga0070666_10058851 3300005335 Bacteria 2599
57 Ga0070666_10077869 3300005335 Bacteria 2263
58 Ga0070680_100000624 3300005336 Bacteria 24592
59 Ga0070682_100000405 3300005337 Bacteria 28330
60 Ga0070682_100003448 3300005337 Bacteria 8754
61 Ga0070682_100011524 3300005337 Bacteria 5055
62 Ga0070682_100702342 3300005337 Bacteria 811
63 Ga0068868_100012130 3300005338 Bacteria 6293
64 Ga0068868_100022784 3300005338 Bacteria 4733
65 Ga0068868_100087038 3300005338 Bacteria 2512
66 Ga0068868_100346800 3300005338 Bacteria 1271
67 Ga0068868_100349530 3300005338 Bacteria 1266
68 Ga0068868_100432309 3300005338 Bacteria 1142
69 Ga0070660_100185064 3300005339 Unclassified 1686
70 Ga0070689_100001209 3300005340 Bacteria 16353
71 Ga0070689_100137948 3300005340 Unclassified 1959
72 Ga0070689_100205479 3300005340 Bacteria 1610
73 Ga0070691_10469824 3300005341 Bacteria 722
74 Ga0070687_100012833 3300005343 Unclassified 3714
75 Ga0070687_100012923 3300005343 Bacteria 3704
76 Ga0070687_100181944 3300005343 Bacteria 1260
77 Ga0070687_100232675 3300005343 Unclassified 1135
78 Ga0070687_100281004 3300005343 Bacteria 1048
79 Ga0070687_100629167 3300005343 Bacteria 741
80 Ga0070687_100759905 3300005343 Bacteria 683
81 Ga0070661_100177215 3300005344 Bacteria 1621
82 Ga0070661_100846179 3300005344 Bacteria 753
83 Ga0070692_10001749 3300005345 Bacteria 8102
84 Ga0070692_10009660 3300005345 Bacteria 4361
85 Ga0070692_10063808 3300005345 Bacteria 1947
86 Ga0070692_10229614 3300005345 Bacteria 1101
87 Ga0070692_10279775 3300005345 Unclassified 1011
88 Ga0070668_100001433 3300005347 Bacteria 17215
89 Ga0070668_101151423 3300005347 Unclassified 701
90 Ga0070669_100001869 3300005353 Bacteria 15165
91 Ga0070669_100036875 3300005353 Bacteria 3544
92 Ga0070669_100064092 3300005353 Bacteria 2706
93 Ga0070669_100186423 3300005353 Bacteria 1626
94 Ga0070669_100308450 3300005353 Bacteria 1275
95 Ga0070669_100389284 3300005353 Unclassified 1138
96 Ga0070675_100159298 3300005354 Bacteria 1940
97 Ga0070671_100003832 3300005355 Bacteria 11813
98 Ga0070671_100085327 3300005355 Bacteria 2641
99 Ga0070671_100225165 3300005355 Bacteria 1591
100 Ga0070671_100339530 3300005355 Bacteria 1281
101 Ga0070674_100792502 3300005356 Bacteria 818
102 Ga0070673_100081375 3300005364 Unclassified 2626
103 Ga0070673_100130152 3300005364 Bacteria 2110
104 Ga0070673_100236121 3300005364 Bacteria 1588
105 Ga0070673_100245695 3300005364 Unclassified 1558
106 Ga0070673_100448507 3300005364 Bacteria 1160
107 Ga0070673_100527543 3300005364 Bacteria 1071
108 Ga0070673_100691062 3300005364 Unclassified 936
109 Ga0070673_101107574 3300005364 Unclassified 740
110 Ga0070688_100327451 3300005365 Unclassified 1115
111 Ga0070688_100790993 3300005365 Unclassified 741
112 Ga0070659_100016910 3300005366 Bacteria 5482
113 Ga0070659_100167007 3300005366 Bacteria 1801
114 Ga0070667_100550020 3300005367 Bacteria 1061
115 Ga0070667_100677013 3300005367 Unclassified 953
116 Ga0070667_100808510 3300005367 Bacteria 870
117 Ga0070703_10000117 3300005406 Bacteria 41424
118 Ga0070703_10021983 3300005406 Bacteria 1868
119 Ga0070703_10036845 3300005406 Bacteria 1505
120 Ga0070703_10047071 3300005406 Unclassified 1365
121 Ga0070701_10036020 3300005438 Bacteria 2490
122 Ga0070701_10040733 3300005438 Bacteria 2363
123 Ga0070701_10200044 3300005438 Unclassified 1180
124 Ga0070705_100007202 3300005440 Bacteria 5472
125 Ga0070705_100056427 3300005440 Bacteria 2313
126 Ga0070705_100067535 3300005440 Bacteria 2148
127 Ga0070705_100117059 3300005440 Bacteria 1714
128 Ga0070705_100119594 3300005440 Bacteria 1698
129 Ga0070700_100000062 3300005441 Bacteria 79866
130 Ga0070700_100007690 3300005441 Bacteria 5834
131 Ga0070700_100010600 3300005441 Bacteria 5091
132 Ga0070700_100122307 3300005441 Unclassified 1746
133 Ga0070700_100166334 3300005441 Unclassified 1523
134 Ga0070700_100426070 3300005441 Bacteria 1004
135 Ga0070694_100002065 3300005444 Bacteria 11915
136 Ga0070694_100004696 3300005444 Bacteria 8221
137 Ga0070694_100007085 3300005444 Bacteria 6824
138 Ga0070694_100009483 3300005444 Bacteria 5971
139 Ga0070694_100026789 3300005444 Unclassified 3739
140 Ga0070694_100056456 3300005444 Unclassified 2667
141 Ga0070694_100116800 3300005444 Bacteria 1909
142 Ga0070694_100127480 3300005444 Bacteria 1834
143 Ga0070694_100162633 3300005444 Bacteria 1639
144 Ga0070694_100206996 3300005444 Bacteria 1465
145 Ga0070694_100340587 3300005444 Bacteria 1159
146 Ga0070694_100341338 3300005444 Unclassified 1158
147 Ga0070694_100540898 3300005444 Unclassified 932
148 Ga0070694_100561943 3300005444 Unclassified 915
149 Ga0070694_100764636 3300005444 Bacteria 790
150 Ga0070694_100863718 3300005444 Bacteria 745
151 Ga0070708_100001183 3300005445 Bacteria 20061
152 Ga0070708_100016622 3300005445 Bacteria 6111
153 Ga0070708_100045673 3300005445 Bacteria 3861
154 Ga0070708_100077547 3300005445 Bacteria 3003
155 Ga0070708_100188259 3300005445 Unclassified 1930
156 Ga0070708_100682779 3300005445 Unclassified 967
157 Ga0070708_101367246 3300005445 Unclassified 661
158 Ga0070663_100440258 3300005455 Bacteria 1072
159 Ga0070663_100449565 3300005455 Unclassified 1062
160 Ga0070678_100159223 3300005456 Bacteria 1827
161 Ga0070662_100021490 3300005457 Bacteria 4407
162 Ga0070662_100280603 3300005457 Bacteria 1348
163 Ga0070662_100386373 3300005457 Bacteria 1153
164 Ga0070662_100389585 3300005457 Bacteria 1148
165 Ga0070662_100537709 3300005457 Unclassified 978
166 Ga0070681_10007691 3300005458 Bacteria 10538
167 Ga0070681_10020025 3300005458 Bacteria 6703
168 Ga0070681_10025119 3300005458 Bacteria 5995
169 Ga0070681_10072851 3300005458 Bacteria 3397
170 Ga0068867_100012727 3300005459 Bacteria 5953
171 Ga0068867_100072287 3300005459 Bacteria 2581
172 Ga0068867_100160907 3300005459 Bacteria 1770
173 Ga0070685_10133495 3300005466 Bacteria 1555
174 Ga0070685_10807272 3300005466 Bacteria 692
175 Ga0070706_100014834 3300005467 Bacteria 7201
176 Ga0070706_100043332 3300005467 Bacteria 4158
177 Ga0070706_100044179 3300005467 Bacteria 4116
178 Ga0070706_100199596 3300005467 Bacteria 1869
179 Ga0070706_100274933 3300005467 Bacteria 1572
180 Ga0070706_100377280 3300005467 Bacteria 1321
181 Ga0070707_100000349 3300005468 Bacteria 45434
182 Ga0070707_100011592 3300005468 Bacteria 8224
183 Ga0070707_100018277 3300005468 Bacteria 6597
184 Ga0070707_100049224 3300005468 Bacteria 4039
185 Ga0070707_100262783 3300005468 Bacteria 1679
186 Ga0070707_100324760 3300005468 Bacteria 1495
187 Ga0070707_100355400 3300005468 Bacteria 1423
188 Ga0070707_100661499 3300005468 Bacteria 1007
189 Ga0070707_100961995 3300005468 Bacteria 819
190 Ga0070707_100995040 3300005468 Unclassified 804
191 Ga0070698_100000126 3300005471 Bacteria 66495
192 Ga0070698_100000214 3300005471 Bacteria 56486
193 Ga0070698_100010112 3300005471 Bacteria 10078
194 Ga0070698_100016175 3300005471 Bacteria 7877
195 Ga0070698_100066657 3300005471 Unclassified 3622
196 Ga0070698_100073161 3300005471 Bacteria 3434
197 Ga0070698_100441906 3300005471 Unclassified 1236
198 Ga0070698_100527919 3300005471 Unclassified 1119
199 Ga0070698_100550075 3300005471 Bacteria 1094
200 Ga0070699_100002296 3300005518 Bacteria 17204
201 Ga0070699_100005850 3300005518 Bacteria 10747
202 Ga0070699_100006980 3300005518 Bacteria 9815
203 Ga0070699_100047578 3300005518 Unclassified 3711
204 Ga0070699_100065301 3300005518 Bacteria 3158
205 Ga0070699_100272927 3300005518 Bacteria 1514
206 Ga0070699_100556037 3300005518 Bacteria 1045
207 Ga0070699_100957260 3300005518 Unclassified 785
208 Ga0070679_100000047 3300005530 Bacteria 90654
209 Ga0070679_100912282 3300005530 Unclassified 822
210 Ga0070684_100776426 3300005535 Unclassified 895
211 Ga0070697_100000217 3300005536 Bacteria 47346
212 Ga0070697_100000380 3300005536 Bacteria 34660
213 Ga0070697_100044313 3300005536 Unclassified 3603
214 Ga0070697_100167892 3300005536 Bacteria 1856
215 Ga0070697_100297976 3300005536 Unclassified 1386
216 Ga0070697_100379832 3300005536 Bacteria 1224
217 Ga0070697_100392709 3300005536 Bacteria 1203
218 Ga0068853_100150415 3300005539 Bacteria 2095
219 Ga0068853_100405778 3300005539 Bacteria 1276
220 Ga0068853_100453121 3300005539 Bacteria 1207
221 Ga0068853_100488941 3300005539 Bacteria 1161
222 Ga0068853_100706419 3300005539 Bacteria 962
223 Ga0068853_100946251 3300005539 Unclassified 828
224 Ga0070672_100270755 3300005543 Bacteria 1434
225 Ga0070672_100809191 3300005543 Unclassified 825
226 Ga0070672_100832642 3300005543 Unclassified 813
227 Ga0070686_100000648 3300005544 Bacteria 20371
228 Ga0070686_100009242 3300005544 Bacteria 5534
229 Ga0070686_100020844 3300005544 Bacteria 3885
230 Ga0070686_100095756 3300005544 Bacteria 1995
231 Ga0070686_100833525 3300005544 Bacteria 746
232 Ga0070686_100914422 3300005544 Unclassified 715
233 Ga0070695_100039878 3300005545 Bacteria 2970
234 Ga0070695_100045540 3300005545 Unclassified 2797
235 Ga0070695_100103748 3300005545 Bacteria 1919
236 Ga0070695_100275601 3300005545 Bacteria 1234
237 Ga0070695_100396149 3300005545 Bacteria 1046
238 Ga0070695_100435736 3300005545 Bacteria 1001
239 Ga0070695_100465171 3300005545 Bacteria 972
240 Ga0070695_100474366 3300005545 Unclassified 963
241 Ga0070695_100723643 3300005545 Unclassified 792
242 Ga0070696_100031651 3300005546 Unclassified 3627
243 Ga0070696_100037727 3300005546 Unclassified 3333
244 Ga0070696_100156761 3300005546 Bacteria 1675
245 Ga0070696_100164135 3300005546 Bacteria 1638
246 Ga0070696_100171861 3300005546 Bacteria 1602
247 Ga0070696_100293413 3300005546 Unclassified 1243
248 Ga0070696_100320826 3300005546 Bacteria 1192
249 Ga0070696_100405273 3300005546 Unclassified 1068
250 Ga0070696_100557848 3300005546 Bacteria 918
251 Ga0070696_100587500 3300005546 Unclassified 896
252 Ga0070693_100001695 3300005547 Bacteria 10006
253 Ga0070693_100004426 3300005547 Bacteria 6641
254 Ga0070693_100031014 3300005547 Bacteria 2927
255 Ga0070665_100622772 3300005548 Bacteria 1092
256 Ga0070665_100883143 3300005548 Bacteria 907
257 Ga0070704_100003232 3300005549 Bacteria 9315
258 Ga0070704_100050571 3300005549 Bacteria 2922
259 Ga0070704_100102529 3300005549 Bacteria 2159
260 Ga0070704_100126943 3300005549 Bacteria 1970
261 Ga0070704_100282862 3300005549 Bacteria 1375
262 Ga0070704_100316789 3300005549 Bacteria 1305
263 Ga0070704_100347020 3300005549 Unclassified 1252
264 Ga0070704_100442306 3300005549 Unclassified 1118
265 Ga0070704_100612336 3300005549 Unclassified 958
266 Ga0070704_100751961 3300005549 Unclassified 868
267 Ga0070704_100817063 3300005549 Unclassified 834
268 Ga0070664_100014957 3300005564 Bacteria 6332
269 Ga0070664_100456518 3300005564 Bacteria 1174
270 Ga0068857_100064025 3300005577 Unclassified 3269
271 Ga0068857_100138045 3300005577 Bacteria 2202
272 Ga0068857_100600591 3300005577 Bacteria 1040
273 Ga0068857_100615014 3300005577 Unclassified 1028
274 Ga0068857_100951970 3300005577 Bacteria 825
275 Ga0068857_101149657 3300005577 Bacteria 751
276 Ga0068854_100082457 3300005578 Unclassified 2377
277 Ga0068854_100121292 3300005578 Bacteria 1985
278 Ga0068854_100129147 3300005578 Bacteria 1928
279 Ga0068854_100181278 3300005578 Bacteria 1645
280 Ga0068854_100378895 3300005578 Unclassified 1165
281 Ga0068856_100006841 3300005614 Bacteria 11155
282 Ga0070702_100013605 3300005615 Bacteria 4112
283 Ga0070702_100063061 3300005615 Bacteria 2162
284 Ga0070702_100095456 3300005615 Bacteria 1813
285 Ga0070702_100217094 3300005615 Bacteria 1276
286 Ga0070702_100473090 3300005615 Bacteria 914
287 Ga0068852_100131637 3300005616 Bacteria 2304
288 Ga0068852_100331812 3300005616 Bacteria 1480
289 Ga0068852_100707377 3300005616 Bacteria 1018
290 Ga0068852_100912548 3300005616 Bacteria 896
291 Ga0068859_100020309 3300005617 Bacteria 6668
292 Ga0068859_100022806 3300005617 Bacteria 6276
293 Ga0068859_100029886 3300005617 Bacteria 5467
294 Ga0068859_100040540 3300005617 Unclassified 4674
295 Ga0068859_100045155 3300005617 Bacteria 4427
296 Ga0068859_100049851 3300005617 Bacteria 4205
297 Ga0068859_100056736 3300005617 Bacteria 3943
298 Ga0068859_100114087 3300005617 Unclassified 2765
299 Ga0068859_100126246 3300005617 Bacteria 2628
300 Ga0068859_100150795 3300005617 Bacteria 2400
301 Ga0068859_100178192 3300005617 Bacteria 2208
302 Ga0068859_100280931 3300005617 Bacteria 1757
303 Ga0068859_100315592 3300005617 Unclassified 1657
304 Ga0068859_100466912 3300005617 Unclassified 1358
305 Ga0068859_101190759 3300005617 Unclassified 839
306 Ga0068864_100064981 3300005618 Bacteria 3165
307 Ga0068864_100098969 3300005618 Bacteria 2583
308 Ga0068864_100122297 3300005618 Bacteria 2329
309 Ga0068864_100124782 3300005618 Bacteria 2306
310 Ga0068864_100151645 3300005618 Bacteria 2100
311 Ga0068864_100167807 3300005618 Bacteria 1999
312 Ga0068864_100239213 3300005618 Unclassified 1682
313 Ga0068864_100264650 3300005618 Unclassified 1600
314 Ga0068864_100322629 3300005618 Bacteria 1451
315 Ga0068864_100443012 3300005618 Bacteria 1241
316 Ga0068864_100482718 3300005618 Bacteria 1190
317 Ga0068864_100483302 3300005618 Unclassified 1189
318 Ga0068864_100610628 3300005618 Unclassified 1059
319 Ga0068866_10031530 3300005718 Bacteria 2554
320 Ga0068866_10076173 3300005718 Bacteria 1788
321 Ga0068861_100006125 3300005719 Bacteria 8185
322 Ga0068861_100023899 3300005719 Bacteria 4413
323 Ga0068861_100034946 3300005719 Bacteria 3720
324 Ga0068861_100089492 3300005719 Bacteria 2426
325 Ga0068861_100130256 3300005719 Unclassified 2041
326 Ga0068861_100223068 3300005719 Unclassified 1594
327 Ga0068861_100312448 3300005719 Bacteria 1366
328 Ga0068861_100698675 3300005719 Unclassified 942
329 Ga0068851_10362742 3300005834 Unclassified 845
330 Ga0068870_10017039 3300005840 Bacteria 3486
331 Ga0068870_10051005 3300005840 Bacteria 2189
332 Ga0068870_10150257 3300005840 Bacteria 1371
333 Ga0068870_10245124 3300005840 Unclassified 1108
334 Ga0068863_100026639 3300005841 Bacteria 5513
335 Ga0068863_100091832 3300005841 Unclassified 2879
336 Ga0068863_100133871 3300005841 Bacteria 2367
337 Ga0068863_100163148 3300005841 Unclassified 2136
338 Ga0068863_100276594 3300005841 Unclassified 1626
339 Ga0068863_100499072 3300005841 Bacteria 1198
340 Ga0068863_100592415 3300005841 Bacteria 1097
341 Ga0068863_100595866 3300005841 Bacteria 1094
342 Ga0068863_100750732 3300005841 Bacteria 972
343 Ga0068858_100014545 3300005842 Bacteria 7415
344 Ga0068858_100033321 3300005842 Bacteria 4782
345 Ga0068858_100115266 3300005842 Unclassified 2510
346 Ga0068858_100146758 3300005842 Unclassified 2216
347 Ga0068858_100161681 3300005842 Bacteria 2108
348 Ga0068858_100176608 3300005842 Bacteria 2015
349 Ga0068858_100355061 3300005842 Unclassified 1404
350 Ga0068858_100377009 3300005842 Bacteria 1361
351 Ga0068858_100726763 3300005842 Bacteria 967
352 Ga0068860_100022110 3300005843 Bacteria 6156
353 Ga0068860_100035879 3300005843 Unclassified 4754
354 Ga0068860_100055864 3300005843 Bacteria 3753
355 Ga0068860_100153124 3300005843 Unclassified 2221
356 Ga0068860_100226580 3300005843 Bacteria 1816
357 Ga0068860_100340565 3300005843 Bacteria 1474
358 Ga0068860_100710189 3300005843 Bacteria 1015
359 Ga0068862_100063414 3300005844 Bacteria 3180
360 Ga0068862_100070844 3300005844 Unclassified 3010
361 Ga0068862_100076839 3300005844 Bacteria 2890
362 Ga0068862_100102217 3300005844 Bacteria 2509
363 Ga0068862_100535118 3300005844 Bacteria 1117
364 Ga0068862_100615184 3300005844 Bacteria 1044
365 Ga0068862_100721625 3300005844 Unclassified 967
366 Ga0081455_10463840 3300005937 Bacteria 862
367 Ga0081540_1063214 3300005983 Unclassified 1753
368 Ga0081539_10000422 3300005985 Bacteria 90043
369 Ga0081539_10007568 3300005985 Bacteria 9824
370 Ga0075432_10071248 3300006058 Unclassified 1249
371 Ga0070715_10000002 3300006163 Bacteria 389554
372 Ga0070716_100000001 3300006173 Bacteria 400668
373 Ga0070716_100142786 3300006173 Unclassified 1529
374 Ga0070716_100166330 3300006173 Bacteria 1434
375 Ga0070716_100591540 3300006173 Bacteria 833
376 Ga0070716_100815578 3300006173 Unclassified 724
377 Ga0097621_100010916 3300006237 Bacteria 6668
378 Ga0097621_100218321 3300006237 Bacteria 1661
379 Ga0068871_100106369 3300006358 Bacteria 2355
380 Ga0068871_100133507 3300006358 Bacteria 2106
381 Ga0068871_100919660 3300006358 Bacteria 811
382 Ga0075428_100052364 3300006844 Bacteria 4474
383 Ga0075428_100140028 3300006844 Bacteria 2631
384 Ga0075428_100294946 3300006844 Bacteria 1744
385 Ga0075428_100354918 3300006844 Bacteria 1573
386 Ga0075430_100101202 3300006846 Bacteria 2406
387 Ga0075431_100093711 3300006847 Bacteria 3099
388 Ga0075431_100789153 3300006847 Bacteria 923
389 Ga0075433_10042512 3300006852 Bacteria 3943
390 Ga0075433_10066356 3300006852 Bacteria 3166
391 Ga0075433_10073659 3300006852 Unclassified 3004
392 Ga0075433_10111034 3300006852 Bacteria 2432
393 Ga0075433_10119161 3300006852 Unclassified 2343
394 Ga0075433_10592137 3300006852 Bacteria 974
395 Ga0075433_10673275 3300006852 Bacteria 907
396 Ga0075434_100105261 3300006871 Bacteria 2832
397 Ga0075434_100106497 3300006871 Unclassified 2813
398 Ga0075434_100179512 3300006871 Bacteria 2137
399 Ga0075434_100208089 3300006871 Bacteria 1977
400 Ga0075434_100252352 3300006871 Bacteria 1783
401 Ga0075434_100603563 3300006871 Bacteria 1117
402 Ga0075429_100108511 3300006880 Bacteria 2426
403 Ga0075429_100333883 3300006880 Bacteria 1327
404 Ga0075429_100547152 3300006880 Bacteria 1014
405 Ga0075436_100000028 3300006914 Bacteria 97815
406 Ga0075436_100022320 3300006914 Bacteria 4347
407 Ga0097620_100020310 3300006931 Bacteria 6668
408 Ga0097620_100022804 3300006931 Bacteria 6276
409 Ga0097620_100029886 3300006931 Bacteria 5467
410 Ga0097620_100040539 3300006931 Unclassified 4674
411 Ga0097620_100045156 3300006931 Bacteria 4427
412 Ga0097620_100049850 3300006931 Bacteria 4205
413 Ga0097620_100056736 3300006931 Bacteria 3943
414 Ga0097620_100114088 3300006931 Unclassified 2765
415 Ga0097620_100126241 3300006931 Bacteria 2628
416 Ga0097620_100150795 3300006931 Bacteria 2400
417 Ga0097620_100178175 3300006931 Bacteria 2208
418 Ga0097620_100280938 3300006931 Bacteria 1757
419 Ga0097620_100315570 3300006931 Unclassified 1657
420 Ga0097620_100466931 3300006931 Unclassified 1358
421 Ga0097620_101191116 3300006931 Unclassified 839
422 Ga0075435_100021741 3300007076 Unclassified 4940
423 Ga0075435_100426004 3300007076 Bacteria 1143
424 Ga0099794_10004171 3300007265 Bacteria 5636
425 Ga0099795_10058360 3300007788 Bacteria 1425
426 Ga0105251_10167242 3300009011 Unclassified 991
427 Ga0105240_10176724 3300009093 Bacteria 2523
428 Ga0111539_10001877 3300009094 Bacteria 27899
429 Ga0111539_10005687 3300009094 Bacteria 16134
430 Ga0111539_10006549 3300009094 Bacteria 15010
431 Ga0111539_10125960 3300009094 Bacteria 3001
432 Ga0111539_10150037 3300009094 Bacteria 2729
433 Ga0111539_10389665 3300009094 Unclassified 1622
434 Ga0111539_10723326 3300009094 Unclassified 1159
435 Ga0111539_11179587 3300009094 Unclassified 889
436 Ga0105245_10427013 3300009098 Unclassified 1329
437 Ga0105245_10724165 3300009098 Unclassified 1029
438 Ga0105245_10868491 3300009098 Bacteria 943
439 Ga0105245_10985689 3300009098 Bacteria 887
440 Ga0105245_11261122 3300009098 Bacteria 788
441 Ga0105247_10003373 3300009101 Bacteria 10451
442 Ga0105247_10102872 3300009101 Bacteria 1828
443 Ga0105247_10117094 3300009101 Bacteria 1722
444 Ga0105247_10130714 3300009101 Bacteria 1636
445 Ga0105247_10165925 3300009101 Bacteria 1465
446 Ga0105247_10472538 3300009101 Unclassified 908
447 Ga0114129_10010658 3300009147 Bacteria 13107
448 Ga0114129_10049988 3300009147 Bacteria 5873
449 Ga0114129_10071582 3300009147 Unclassified 4835
450 Ga0114129_10149045 3300009147 Bacteria 3202
451 Ga0114129_10200232 3300009147 Bacteria 2705
452 Ga0114129_10210011 3300009147 Bacteria 2632
453 Ga0114129_10240502 3300009147 Bacteria 2434
454 Ga0114129_10279643 3300009147 Bacteria 2230
455 Ga0114129_10589249 3300009147 Bacteria 1442
456 Ga0114129_10873829 3300009147 Unclassified 1141
457 Ga0114129_10876941 3300009147 Unclassified 1139
458 Ga0105243_10000015 3300009148 Bacteria 251115
459 Ga0105243_10012901 3300009148 Bacteria 6314
460 Ga0105243_10014515 3300009148 Bacteria 5959
461 Ga0105243_10055616 3300009148 Unclassified 3144
462 Ga0105243_10066347 3300009148 Bacteria 2902
463 Ga0105243_10092878 3300009148 Bacteria 2489
464 Ga0105243_10197930 3300009148 Unclassified 1760
465 Ga0105243_10267282 3300009148 Bacteria 1534
466 Ga0105243_10422313 3300009148 Bacteria 1244
467 Ga0105243_10434797 3300009148 Unclassified 1227
468 Ga0105243_10735466 3300009148 Bacteria 966
469 Ga0105243_11115138 3300009148 Unclassified 798
470 Ga0105243_11257944 3300009148 Unclassified 755
471 Ga0105241_10045407 3300009174 Bacteria 3333
472 Ga0105241_10105290 3300009174 Bacteria 2249
473 Ga0105241_10503279 3300009174 Unclassified 1080
474 Ga0105241_10513392 3300009174 Bacteria 1070
475 Ga0105241_10592148 3300009174 Unclassified 1001
476 Ga0105241_10921539 3300009174 Unclassified 813
477 Ga0105241_11443259 3300009174 Bacteria 660
478 Ga0105242_10000028 3300009176 Bacteria 106293
479 Ga0105242_10008738 3300009176 Bacteria 7773
480 Ga0105242_10032609 3300009176 Bacteria 4166
481 Ga0105242_10040362 3300009176 Bacteria 3761
482 Ga0105242_10150891 3300009176 Bacteria 2026
483 Ga0105242_10293396 3300009176 Bacteria 1481
484 Ga0105242_10390455 3300009176 Bacteria 1296
485 Ga0105242_10391601 3300009176 Bacteria 1294
486 Ga0105242_10408433 3300009176 Bacteria 1269
487 Ga0105242_10527510 3300009176 Bacteria 1128
488 Ga0105248_10009861 3300009177 Bacteria 10521
489 Ga0105248_10025944 3300009177 Bacteria 6517
490 Ga0105248_10059640 3300009177 Bacteria 4286
491 Ga0105248_10117472 3300009177 Bacteria 3000
492 Ga0105248_10129580 3300009177 Bacteria 2846
493 Ga0105248_10205134 3300009177 Bacteria 2221
494 Ga0105248_10466434 3300009177 Bacteria 1423
495 Ga0105248_10489232 3300009177 Bacteria 1387
496 Ga0105248_10804707 3300009177 Unclassified 1061
497 Ga0105248_10870785 3300009177 Bacteria 1017
498 Ga0105248_11424512 3300009177 Bacteria 784
499 Ga0105237_10000903 3300009545 Bacteria 39910
500 Ga0105237_10101023 3300009545 Bacteria 2876
501 Ga0105237_10490011 3300009545 Bacteria 1236
502 Ga0105238_10005940 3300009551 Bacteria 12097
503 Ga0105238_10013120 3300009551 Bacteria 8362
504 Ga0105249_10000136 3300009553 Bacteria 96659
505 Ga0105249_10011401 3300009553 Bacteria 7806
506 Ga0105249_10043269 3300009553 Bacteria 4096
507 Ga0105249_10066800 3300009553 Bacteria 3311
508 Ga0105249_10234405 3300009553 Bacteria 1811
509 Ga0105249_10324364 3300009553 Bacteria 1552
510 Ga0105249_10406408 3300009553 Unclassified 1393
511 Ga0105249_10624820 3300009553 Bacteria 1133
512 Ga0105249_10783920 3300009553 Bacteria 1016
513 Ga0105239_10095554 3300010375 Bacteria 3283
514 Ga0105239_10109014 3300010375 Bacteria 3068
515 Ga0105239_10334780 3300010375 Bacteria 1708
516 Ga0105239_10542069 3300010375 Unclassified 1325
517 Ga0105239_10669845 3300010375 Bacteria 1185
518 Ga0105239_11401104 3300010375 Bacteria 807
519 Ga0105246_10020265 3300011119 Unclassified 4263
520 Ga0105246_10057398 3300011119 Bacteria 2693
521 Ga0105246_10102185 3300011119 Bacteria 2090
522 Ga0105246_10364491 3300011119 Bacteria 1188
523 Ga0105246_10766682 3300011119 Unclassified 852
524 Ga0157373_10010134 3300013100 Bacteria 6945
525 Ga0157373_10418838 3300013100 Bacteria 961
526 Ga0157371_10511310 3300013102 Unclassified 888
527 Ga0157374_10022394 3300013296 Bacteria 5637
528 Ga0157374_10052804 3300013296 Bacteria 3787
529 Ga0157378_10003478 3300013297 Bacteria 13980
530 Ga0157378_10009116 3300013297 Bacteria 8636
531 Ga0157378_10014880 3300013297 Bacteria 6807
532 Ga0157378_10017810 3300013297 Bacteria 6237
533 Ga0157378_10029842 3300013297 Unclassified 4816
534 Ga0157378_10067110 3300013297 Bacteria 3214
535 Ga0157378_10088050 3300013297 Bacteria 2817
536 Ga0157378_10099596 3300013297 Bacteria 2652
537 Ga0157378_10127387 3300013297 Bacteria 2353
538 Ga0157378_10127853 3300013297 Bacteria 2349
539 Ga0157378_10225211 3300013297 Unclassified 1784
540 Ga0157378_10240225 3300013297 Bacteria 1730
541 Ga0157378_10529931 3300013297 Bacteria 1180
542 Ga0157378_11115083 3300013297 Unclassified 826
543 Ga0163162_10000001 3300013306 Bacteria 751833
544 Ga0163162_10020922 3300013306 Bacteria 6435
545 Ga0163162_10022132 3300013306 Bacteria 6265
546 Ga0163162_10094875 3300013306 Bacteria 3070
547 Ga0163162_10119313 3300013306 Bacteria 2740
548 Ga0163162_10137921 3300013306 Unclassified 2550
549 Ga0163162_10221403 3300013306 Bacteria 2022
550 Ga0163162_10323460 3300013306 Bacteria 1675
551 Ga0163162_10335240 3300013306 Bacteria 1645
552 Ga0163162_10374622 3300013306 Unclassified 1557
553 Ga0163162_10803230 3300013306 Bacteria 1058
554 Ga0157372_10010237 3300013307 Bacteria 9957
555 Ga0157372_10176650 3300013307 Bacteria 2472
556 Ga0157372_10429643 3300013307 Bacteria 1539
557 Ga0157375_10010051 3300013308 Bacteria 8320
558 Ga0157375_10035989 3300013308 Bacteria 4731
559 Ga0157375_10035990 3300013308 Bacteria 4731
560 Ga0157375_10125642 3300013308 Bacteria 2679
561 Ga0157375_10625156 3300013308 Bacteria 1235
562 Ga0157375_11467363 3300013308 Bacteria 804
563 Ga0157375_11841562 3300013308 Unclassified 718
564 Ga0163163_10001208 3300014325 Bacteria 21839
565 Ga0163163_10005816 3300014325 Bacteria 10718
566 Ga0163163_10009856 3300014325 Bacteria 8562
567 Ga0163163_10040627 3300014325 Unclassified 4543
568 Ga0163163_10044834 3300014325 Bacteria 4339
569 Ga0163163_10050659 3300014325 Unclassified 4089
570 Ga0163163_10060630 3300014325 Bacteria 3747
571 Ga0163163_10125892 3300014325 Bacteria 2600
572 Ga0163163_10199147 3300014325 Bacteria 2051
573 Ga0163163_10271820 3300014325 Bacteria 1746
574 Ga0163163_10612970 3300014325 Unclassified 1152
575 Ga0163163_10870422 3300014325 Unclassified 964
576 Ga0157380_10000283 3300014326 Bacteria 30521
577 Ga0157380_10005686 3300014326 Bacteria 8720
578 Ga0157380_10006247 3300014326 Bacteria 8366
579 Ga0157380_10012283 3300014326 Bacteria 6208
580 Ga0157380_10023647 3300014326 Bacteria 4638
581 Ga0157380_10133196 3300014326 Bacteria 2124
582 Ga0157380_10146960 3300014326 Bacteria 2032
583 Ga0157380_10174950 3300014326 Bacteria 1880
584 Ga0157380_10944655 3300014326 Unclassified 892
585 Ga0157380_11117106 3300014326 Unclassified 828
586 Ga0157377_10070675 3300014745 Bacteria 2017
587 Ga0157377_10122821 3300014745 Unclassified 1576
588 Ga0157379_10151703 3300014968 Unclassified 2090
589 Ga0157379_10201694 3300014968 Bacteria 1799
590 Ga0157379_10326075 3300014968 Bacteria 1402
591 Ga0157379_11081104 3300014968 Bacteria 768
592 Ga0157376_10072525 3300014969 Bacteria 2929
593 Ga0157376_10084445 3300014969 Bacteria 2734
594 Ga0163161_10011523 3300017792 Bacteria 6135
595 Ga0163161_10317381 3300017792 Bacteria 1231
596 Ga0163161_10353702 3300017792 Unclassified 1168
597 Ga0213875_10292036 3300021388 Unclassified 771
598 Ga0207697_10008507 3300025315 Unclassified 4484
599 Ga0207697_10047072 3300025315 Bacteria 1778
600 Ga0207653_10000342 3300025885 Bacteria 24007
601 Ga0207653_10047542 3300025885 Unclassified 1421
602 Ga0207653_10140400 3300025885 Bacteria 883
603 Ga0207682_10058435 3300025893 Bacteria 1610
604 Ga0207642_10013304 3300025899 Bacteria 3000
605 Ga0207710_10000927 3300025900 Bacteria 15620
606 Ga0207710_10185716 3300025900 Bacteria 1022
607 Ga0207647_10007102 3300025904 Bacteria 8121
608 Ga0207647_10240161 3300025904 Bacteria 1040
609 Ga0207685_10000002 3300025905 Bacteria 438088
610 Ga0207645_10091469 3300025907 Unclassified 1956
611 Ga0207643_10000595 3300025908 Bacteria 22930
612 Ga0207643_10029946 3300025908 Bacteria 3028
613 Ga0207643_10338456 3300025908 Unclassified 943
614 Ga0207684_10000314 3300025910 Bacteria 68706
615 Ga0207684_10007903 3300025910 Bacteria 9510
616 Ga0207684_10008012 3300025910 Bacteria 9437
617 Ga0207684_10174676 3300025910 Bacteria 1852
618 Ga0207684_10197959 3300025910 Bacteria 1733
619 Ga0207654_10030444 3300025911 Bacteria 2962
620 Ga0207654_10065174 3300025911 Unclassified 2144
621 Ga0207654_10113646 3300025911 Unclassified 1689
622 Ga0207654_10122934 3300025911 Bacteria 1632
623 Ga0207654_10225858 3300025911 Bacteria 1244
624 Ga0207654_10455917 3300025911 Bacteria 897
625 Ga0207707_10000006 3300025912 Bacteria 374131
626 Ga0207707_10032652 3300025912 Unclassified 4557
627 Ga0207707_10285501 3300025912 Bacteria 1428
628 Ga0207695_10066767 3300025913 Bacteria 3692
629 Ga0207671_10160785 3300025914 Unclassified 1739
630 Ga0207671_10438007 3300025914 Bacteria 1040
631 Ga0207671_10796205 3300025914 Unclassified 750
632 Ga0207660_10002802 3300025917 Bacteria 11428
633 Ga0207660_10818039 3300025917 Unclassified 760
634 Ga0207662_10002563 3300025918 Bacteria 9154
635 Ga0207662_10072803 3300025918 Bacteria 2083
636 Ga0207662_10094642 3300025918 Unclassified 1843
637 Ga0207662_10118564 3300025918 Unclassified 1657
638 Ga0207662_10135164 3300025918 Bacteria 1558
639 Ga0207652_10001029 3300025921 Bacteria 25565
640 Ga0207646_10000199 3300025922 Bacteria 81584
641 Ga0207646_10012482 3300025922 Bacteria 8162
642 Ga0207646_10072002 3300025922 Bacteria 3087
643 Ga0207646_10076563 3300025922 Bacteria 2990
644 Ga0207646_10237233 3300025922 Bacteria 1648
645 Ga0207646_10914361 3300025922 Unclassified 778
646 Ga0207681_10000407 3300025923 Bacteria 29960
647 Ga0207681_10009399 3300025923 Bacteria 5973
648 Ga0207681_10046565 3300025923 Bacteria 2917
649 Ga0207681_10144120 3300025923 Bacteria 1778
650 Ga0207681_10261458 3300025923 Unclassified 1355
651 Ga0207681_10350999 3300025923 Unclassified 1181
652 Ga0207681_10788517 3300025923 Unclassified 793
653 Ga0207694_10000938 3300025924 Bacteria 25703
654 Ga0207694_10026046 3300025924 Bacteria 4447
655 Ga0207650_10000047 3300025925 Bacteria 175675
656 Ga0207650_10000517 3300025925 Bacteria 31837
657 Ga0207650_10143185 3300025925 Bacteria 1881
658 Ga0207650_10146613 3300025925 Bacteria 1859
659 Ga0207650_10238573 3300025925 Bacteria 1469
660 Ga0207650_10960879 3300025925 Bacteria 726
661 Ga0207659_10063331 3300025926 Bacteria 2673
662 Ga0207659_10855579 3300025926 Unclassified 782
663 Ga0207687_10325776 3300025927 Bacteria 1245
664 Ga0207687_10493327 3300025927 Bacteria 1021
665 Ga0207687_10913768 3300025927 Unclassified 751
666 Ga0207644_10011207 3300025931 Bacteria 5926
667 Ga0207644_10021315 3300025931 Bacteria 4413
668 Ga0207644_10320690 3300025931 Bacteria 1253
669 Ga0207644_10526847 3300025931 Bacteria 977
670 Ga0207690_10013277 3300025932 Bacteria 4946
671 Ga0207690_10808606 3300025932 Unclassified 775
672 Ga0207706_10123297 3300025933 Bacteria 2280
673 Ga0207706_10141782 3300025933 Bacteria 2114
674 Ga0207706_10242791 3300025933 Bacteria 1574
675 Ga0207706_10423200 3300025933 Bacteria 1154
676 Ga0207686_10000031 3300025934 Bacteria 158735
677 Ga0207686_10000381 3300025934 Bacteria 30953
678 Ga0207686_10069084 3300025934 Bacteria 2265
679 Ga0207686_10367006 3300025934 Bacteria 1088
680 Ga0207709_10000009 3300025935 Bacteria 619238
681 Ga0207709_10008224 3300025935 Bacteria 5778
682 Ga0207709_10074255 3300025935 Bacteria 2169
683 Ga0207709_10090719 3300025935 Bacteria 1997
684 Ga0207709_10102046 3300025935 Bacteria 1898
685 Ga0207709_10271435 3300025935 Bacteria 1248
686 Ga0207709_10366874 3300025935 Bacteria 1092
687 Ga0207709_10488021 3300025935 Bacteria 959
688 Ga0207709_10609559 3300025935 Unclassified 865
689 Ga0207670_10000162 3300025936 Bacteria 44279
690 Ga0207670_10036079 3300025936 Bacteria 3212
691 Ga0207670_10308976 3300025936 Unclassified 1240
692 Ga0207670_10415949 3300025936 Bacteria 1078
693 Ga0207670_10734591 3300025936 Unclassified 819
694 Ga0207669_10051011 3300025937 Bacteria 2477
695 Ga0207665_10000016 3300025939 Bacteria 132853
696 Ga0207665_10071790 3300025939 Bacteria 2363
697 Ga0207665_10186956 3300025939 Unclassified 1503
698 Ga0207665_10201259 3300025939 Bacteria 1451
699 Ga0207691_10007252 3300025940 Unclassified 10692
700 Ga0207691_10300598 3300025940 Unclassified 1379
701 Ga0207711_10013606 3300025941 Bacteria 6759
702 Ga0207711_10023587 3300025941 Bacteria 5151
703 Ga0207711_10062117 3300025941 Unclassified 3222
704 Ga0207711_10103335 3300025941 Bacteria 2523
705 Ga0207711_10266561 3300025941 Bacteria 1575
706 Ga0207711_10331757 3300025941 Bacteria 1407
707 Ga0207711_10366906 3300025941 Bacteria 1335
708 Ga0207711_10732150 3300025941 Bacteria 922
709 Ga0207711_10771806 3300025941 Bacteria 896
710 Ga0207711_10846212 3300025941 Bacteria 851
711 Ga0207689_10001827 3300025942 Bacteria 20116
712 Ga0207689_10002806 3300025942 Bacteria 16095
713 Ga0207689_10071917 3300025942 Bacteria 2841
714 Ga0207689_10083245 3300025942 Bacteria 2631
715 Ga0207689_10090588 3300025942 Bacteria 2513
716 Ga0207689_10104862 3300025942 Bacteria 2323
717 Ga0207689_10120891 3300025942 Bacteria 2154
718 Ga0207689_10163621 3300025942 Bacteria 1833
719 Ga0207689_10173036 3300025942 Bacteria 1780
720 Ga0207689_10255676 3300025942 Unclassified 1449
721 Ga0207689_10326790 3300025942 Bacteria 1273
722 Ga0207689_10519742 3300025942 Unclassified 998
723 Ga0207679_10032627 3300025945 Bacteria 3658
724 Ga0207679_10165235 3300025945 Unclassified 1816
725 Ga0207679_10495974 3300025945 Unclassified 1089
726 Ga0207667_10279566 3300025949 Bacteria 1706
727 Ga0207667_10312336 3300025949 Bacteria 1605
728 Ga0207651_10096351 3300025960 Bacteria 2182
729 Ga0207651_10119147 3300025960 Bacteria 1998
730 Ga0207651_10134655 3300025960 Bacteria 1898
731 Ga0207651_10192477 3300025960 Unclassified 1628
732 Ga0207651_10276718 3300025960 Bacteria 1385
733 Ga0207651_10661408 3300025960 Unclassified 918
734 Ga0207651_10821546 3300025960 Viruses 825
735 Ga0207712_10000092 3300025961 Bacteria 103502
736 Ga0207712_10005073 3300025961 Bacteria 8330
737 Ga0207712_10016894 3300025961 Unclassified 4732
738 Ga0207712_10037262 3300025961 Bacteria 3316
739 Ga0207712_10105243 3300025961 Unclassified 2105
740 Ga0207712_10195886 3300025961 Bacteria 1598
741 Ga0207712_10352094 3300025961 Bacteria 1225
742 Ga0207712_10723660 3300025961 Bacteria 870
743 Ga0207668_10002111 3300025972 Bacteria 11601
744 Ga0207640_10014816 3300025981 Bacteria 4497
745 Ga0207640_10035631 3300025981 Bacteria 3116
746 Ga0207640_10100247 3300025981 Bacteria 2029
747 Ga0207640_10137699 3300025981 Bacteria 1775
748 Ga0207640_10389470 3300025981 Unclassified 1132
749 Ga0207658_10234953 3300025986 Bacteria 1549
750 Ga0207677_10674697 3300026023 Bacteria 914
751 Ga0207677_11103331 3300026023 Bacteria 723
752 Ga0207703_10015611 3300026035 Bacteria 5925
753 Ga0207703_10042431 3300026035 Bacteria 3649
754 Ga0207703_10045746 3300026035 Bacteria 3522
755 Ga0207703_10081772 3300026035 Bacteria 2693
756 Ga0207703_10125571 3300026035 Bacteria 2208
757 Ga0207703_10129429 3300026035 Unclassified 2178
758 Ga0207703_10165919 3300026035 Unclassified 1938
759 Ga0207703_10374853 3300026035 Bacteria 1315
760 Ga0207703_10401040 3300026035 Bacteria 1272
761 Ga0207639_10440794 3300026041 Bacteria 1181
762 Ga0207639_10614019 3300026041 Bacteria 1004
763 Ga0207708_10000246 3300026075 Bacteria 42577
764 Ga0207708_10007047 3300026075 Bacteria 8307
765 Ga0207708_10008389 3300026075 Bacteria 7648
766 Ga0207708_10024106 3300026075 Bacteria 4601
767 Ga0207708_10041981 3300026075 Bacteria 3487
768 Ga0207708_10069713 3300026075 Bacteria 2692
769 Ga0207708_10092804 3300026075 Bacteria 2330
770 Ga0207708_10096882 3300026075 Bacteria 2280
771 Ga0207708_10219950 3300026075 Bacteria 1521
772 Ga0207708_10883393 3300026075 Bacteria 773
773 Ga0207708_11022617 3300026075 Unclassified 719
774 Ga0207641_10022808 3300026088 Bacteria 5154
775 Ga0207641_10075438 3300026088 Bacteria 2912
776 Ga0207641_10173552 3300026088 Unclassified 1970
777 Ga0207641_10242088 3300026088 Bacteria 1681
778 Ga0207641_10437633 3300026088 Bacteria 1262
779 Ga0207641_10530339 3300026088 Bacteria 1146
780 Ga0207648_10009860 3300026089 Bacteria 9108
781 Ga0207648_10029342 3300026089 Bacteria 4878
782 Ga0207648_10072970 3300026089 Unclassified 2991
783 Ga0207648_10270326 3300026089 Bacteria 1518
784 Ga0207648_10406731 3300026089 Bacteria 1234
785 Ga0207648_10647435 3300026089 Unclassified 976
786 Ga0207648_11157929 3300026089 Unclassified 726
787 Ga0207676_10003037 3300026095 Bacteria 11982
788 Ga0207676_10008551 3300026095 Bacteria 7275
789 Ga0207676_10029779 3300026095 Bacteria 4090
790 Ga0207676_10120854 3300026095 Unclassified 2209
791 Ga0207676_10246216 3300026095 Bacteria 1607
792 Ga0207676_10275852 3300026095 Unclassified 1524
793 Ga0207676_10300850 3300026095 Bacteria 1465
794 Ga0207676_10312591 3300026095 Bacteria 1439
795 Ga0207676_10528675 3300026095 Bacteria 1124
796 Ga0207676_10787841 3300026095 Unclassified 927
797 Ga0207674_10019731 3300026116 Bacteria 7296
798 Ga0207674_10100220 3300026116 Unclassified 2878
799 Ga0207674_10110002 3300026116 Bacteria 2731
800 Ga0207674_10124154 3300026116 Bacteria 2547
801 Ga0207674_10182682 3300026116 Unclassified 2048
802 Ga0207674_10222075 3300026116 Unclassified 1838
803 Ga0207674_10328590 3300026116 Unclassified 1479
804 Ga0207674_10582220 3300026116 Bacteria 1081
805 Ga0207674_10605508 3300026116 Bacteria 1058
806 Ga0207675_100009521 3300026118 Bacteria 9088
807 Ga0207675_100037618 3300026118 Bacteria 4513
808 Ga0207675_100038139 3300026118 Bacteria 4484
809 Ga0207675_100097066 3300026118 Bacteria 2775
810 Ga0207675_100113146 3300026118 Bacteria 2562
811 Ga0207675_100184169 3300026118 Bacteria 2001
812 Ga0207675_100229512 3300026118 Bacteria 1791
813 Ga0207675_100254800 3300026118 Bacteria 1699
814 Ga0207675_100258880 3300026118 Bacteria 1686
815 Ga0207675_100269991 3300026118 Bacteria 1651
816 Ga0207675_100959419 3300026118 Unclassified 873
817 Ga0207683_10080211 3300026121 Bacteria 2895
818 Ga0207683_10206396 3300026121 Unclassified 1787
819 Ga0207683_10418297 3300026121 Bacteria 1234
820 Ga0207683_10433747 3300026121 Bacteria 1211
821 Ga0207698_10356844 3300026142 Bacteria 1383
822 Ga0207698_10607455 3300026142 Unclassified 1079
823 Ga0207698_10767282 3300026142 Unclassified 964
824 Ga0207428_10002219 3300027907 Bacteria 19493
825 Ga0207428_10013301 3300027907 Bacteria 7194
826 Ga0207428_10069112 3300027907 Bacteria 2777
827 Ga0207428_10296088 3300027907 Unclassified 1198
828 Ga0268266_10765376 3300028379 Bacteria 932
829 Ga0268265_10122619 3300028380 Bacteria 2144
830 Ga0268265_10199819 3300028380 Bacteria 1733
831 Ga0268265_10218442 3300028380 Bacteria 1666
832 Ga0268265_10295444 3300028380 Unclassified 1456
833 Ga0268265_10481059 3300028380 Bacteria 1166
834 Ga0268265_10508919 3300028380 Bacteria 1136
835 Ga0268264_10110750 3300028381 Bacteria 2404
836 Ga0268264_10110935 3300028381 Bacteria 2402
837 Ga0268264_10117790 3300028381 Bacteria 2336
838 Ga0268264_10129367 3300028381 Unclassified 2236
839 Ga0268264_10158615 3300028381 Bacteria 2036
840 Ga0268264_10171380 3300028381 Bacteria 1963
841 Ga0268264_10196724 3300028381 Bacteria 1841
842 Ga0268264_10389432 3300028381 Bacteria 1337
843 Ga0268264_10560060 3300028381 Bacteria 1122
844 Ga0307513_10453815 3300031456 Unclassified 1006
845 Ga0307408_100112541 3300031548 Unclassified 2093
846 Ga0307408_100509753 3300031548 Bacteria 1055
847 Ga0307405_10016049 3300031731 Unclassified 4074
848 Ga0307413_10711986 3300031824 Bacteria 835
849 Ga0307410_10031517 3300031852 Unclassified 3403
850 Ga0307410_10206176 3300031852 Bacteria 1504
851 Ga0307410_10873844 3300031852 Unclassified 769
852 Ga0307406_10098864 3300031901 Unclassified 1982
853 Ga0307406_10871705 3300031901 Bacteria 765
854 Ga0307407_10042041 3300031903 Bacteria 2560
855 Ga0307412_10021603 3300031911 Unclassified 3935
856 Ga0307412_10101083 3300031911 Unclassified 2039
857 Ga0307412_10277657 3300031911 Bacteria 1314
858 Ga0307409_100295642 3300031995 Unclassified 1504
859 Ga0307416_100035493 3300032002 Unclassified 3809
860 Ga0307416_100100284 3300032002 Bacteria 2518
861 Ga0307416_100165479 3300032002 Bacteria 2050
862 Ga0307414_10039672 3300032004 Unclassified 3173
863 Ga0307414_10186038 3300032004 Bacteria 1676
864 Ga0307415_100025864 3300032126 Bacteria 3693
865 Ga0307415_100074212 3300032126 Bacteria 2403
866 Ga0373949_0077918 3300035090 Bacteria 879
867 Ga0373951_0000456 3300035091 Bacteria 11829
868 Ga0373941_0005444 3300035115 Bacteria 2997
869 Ga0373931_0013124 3300035691 Bacteria 4029
870 Ga0373931_0103930 3300035691 Bacteria 1602
871 Ga0395900_0345971 3300037418 Bacteria 1461
872 Ga0395898_0084385 3300037466 Bacteria 3062
873 Ga0395905_0998662 3300037471 Bacteria 740
874 Ga0395901_0371842 3300038443 Bacteria 1472
875 Ga0242422_01462 3300038699 Unclassified 1632
876 Ga0242420_014220 3300038996 Unclassified 1364
877 Ga0439439_0097744 3300041406 Bacteria 806
878 Ga0439431_0084883 3300041997 Bacteria 857
879 Ga0439455_0011346 3300042012 Bacteria 1977
880 Ga0439458_0010133 3300042157 Bacteria 2098
881 Ga0439434_0013509 3300042435 Unclassified 2425
882 Ga0439464_0056276 3300042439 Bacteria 1145
883 Ga0453683_0117074 3300044673 Bacteria 1677
884 Ga0451576_0565285 3300045051 Unclassified 1195
885 Ga0451576_1074163 3300045051 Bacteria 843
886 Ga0451576_1169985 3300045051 Unclassified 804
887 Ga0451576_1215512 3300045051 Bacteria 787
888 Ga0495639_0097569 3300046475 Bacteria 1385
889 Ga0495586_0194213 3300046535 Bacteria 1150
890 Ga0495621_0000007 3300046539 Bacteria 43743
891 Ga0495621_0005112 3300046539 Bacteria 3747
892 Ga0495659_0019215 3300046664 Bacteria 2285
893 Ga0495613_0018185 3300046689 Bacteria 5240
894 Ga0495674_0438464 3300047319 Bacteria 1051
895 Ga0495672_0008903 3300047320 Bacteria 7335
896 Ga0495680_0050097 3300047322 Bacteria 3267
897 Ga0495677_0063226 3300047445 Bacteria 1375
898 Ga0496100_1083949 3300048903 Bacteria 631
899 Ga0496102_0010003 3300048905 Bacteria 8156
900 Ga0496106_0612599 3300048909 Bacteria 872
901 Ga0496107_0063454 3300048910 Bacteria 2677
902 Ga0496108_0082717 3300048911 Bacteria 2723
903 Ga0496108_0445103 3300048911 Bacteria 1132
904 Ga0496110_0208063 3300048913 Bacteria 1778
905 Ga0496110_0458932 3300048913 Unclassified 1161
906 Ga0496110_0544706 3300048913 Bacteria 1055
907 Ga0496112_0113304 3300048915 Bacteria 2683
908 Ga0496112_0353446 3300048915 Bacteria 1412
909 Ga0496112_0686872 3300048915 Bacteria 952
910 Ga0496113_0064526 3300048916 Unclassified 2769
911 Ga0496113_0134251 3300048916 Bacteria 1944
912 Ga0496113_0317784 3300048916 Bacteria 1248
913 Ga0501291_021658 3300049514 Bacteria 1026
914 Ga0501292_011788 3300049515 Bacteria 1327
915 Ga0501293_008273 3300049516 Bacteria 872
916 Ga0501298_022136 3300049521 Bacteria 1195
917 Ga0501299_002870 3300049522 Bacteria 2437
918 Ga0501299_010131 3300049522 Unclassified 1569
919 Ga0501299_050322 3300049522 Bacteria 859
920 Ga0501038_0007240 3300049574 Bacteria 10248
921 Ga0501039_0382406 3300049575 Bacteria 1106
922 Ga0501072_0235266 3300049588 Bacteria 1459
923 Ga0501072_0857907 3300049588 Unclassified 710
924 Ga0501202_003380 3300049652 Bacteria 2730
925 Ga0501202_011961 3300049652 Bacteria 1632
926 Ga0501206_024900 3300049653 Bacteria 869
927 Ga0501207_003570 3300049654 Unclassified 2078
928 Ga0501216_001897 3300049660 Unclassified 2898
929 Ga0501216_002824 3300049660 Bacteria 2494
930 Ga0501217_000772 3300049661 Bacteria 5565
931 Ga0501217_003056 3300049661 Unclassified 3352
932 Ga0501217_091789 3300049661 Bacteria 853
933 Ga0501223_005173 3300049663 Bacteria 2752
934 Ga0501223_005210 3300049663 Bacteria 2742
935 Ga0501223_011979 3300049663 Unclassified 1739
936 Ga0501224_001375 3300049664 Unclassified 3220
937 Ga0501227_084161 3300049665 Bacteria 836
938 Ga0501230_000985 3300049667 Bacteria 3229
939 Ga0501230_066605 3300049667 Bacteria 736
940 Ga0501233_003750 3300049668 Bacteria 2748
941 Ga0501233_007716 3300049668 Bacteria 2055
942 Ga0501233_008092 3300049668 Bacteria 2019
943 Ga0501233_043158 3300049668 Bacteria 1067
944 Ga0501235_003719 3300049669 Unclassified 3294
945 Ga0501235_004036 3300049669 Unclassified 3177
946 Ga0501235_009688 3300049669 Bacteria 2106
947 Ga0501235_018171 3300049669 Bacteria 1557
948 Ga0501235_033090 3300049669 Bacteria 1170
949 Ga0501243_004127 3300049675 Unclassified 2171
950 Ga0501243_007641 3300049675 Bacteria 1655
951 Ga0501249_013306 3300049679 Bacteria 1748
952 Ga0501249_014692 3300049679 Unclassified 1669
953 Ga0501249_035677 3300049679 Bacteria 1119
954 Ga0501249_089058 3300049679 Unclassified 730
955 Ga0501257_011404 3300049686 Unclassified 2029
956 Ga0501257_011905 3300049686 Bacteria 1988
957 Ga0501259_013009 3300049688 Unclassified 1394
958 Ga0501225_0004958 3300049705 Unclassified 3933
959 Ga0501225_0007957 3300049705 Bacteria 3055
960 Ga0501225_0093622 3300049705 Unclassified 872
961 Ga0501234_007226 3300049707 Unclassified 1739
962 Ga0501234_010505 3300049707 Unclassified 1443
963 Ga0501245_020593 3300049708 Bacteria 1030
964 Ga0501079_0917730 3300049741 Bacteria 690
965 Ga0501081_0215047 3300049743 Bacteria 1397
966 Ga0501081_0497792 3300049743 Bacteria 908
967 Ga0501267_009689 3300049764 Unclassified 965
968 Ga0501268_024751 3300049765 Bacteria 1051
969 Ga0501283_001080 3300049779 Bacteria 3591
970 Ga0501212_024371 3300049851 Bacteria 952
971 Ga0501212_024512 3300049851 Bacteria 949
972 Ga0501212_043988 3300049851 Bacteria 744
973 Ga0501226_000589 3300049853 Bacteria 5006
974 nmdc:mga05p37_136097_c1 3300050507 Bacteria 3012
975 nmdc:mga05p37_192430_c1 3300050507 Bacteria 2475
976 nmdc:mga05p37_205646_c1 3300050507 Bacteria 2381
977 nmdc:mga05p37_213946_c1 3300050507 Bacteria 2329
978 nmdc:mga05p37_507149_c1 3300050507 Unclassified 1383
979 nmdc:mga05p37_621407_c1 3300050507 Unclassified 1216
980 nmdc:mga05p37_97921_c1 3300050507 Bacteria 3613
981 nmdc:mga09592_206209_c1 3300050508 Unclassified 1703
982 nmdc:mga09592_26548_c1 3300050508 Unclassified 4799
983 nmdc:mga09592_324285_c1 3300050508 Unclassified 1334
984 nmdc:mga09592_95776_c1 3300050508 Bacteria 2539
985 nmdc:mga0qj67_115701_c1 3300050509 Bacteria 2167
986 nmdc:mga0qj67_204259_c1 3300050509 Bacteria 1605
987 nmdc:mga08y16_100599_c1 3300050511 Bacteria 3010
988 nmdc:mga08y16_233036_c1 3300050511 Bacteria 1904
989 nmdc:mga08y16_697458_c1 3300050511 Unclassified 1015
990 nmdc:mga08y16_8582_c1 3300050511 Bacteria 10707
991 nmdc:mga0n895_253264_c1 3300050512 Bacteria 1787
992 nmdc:mga0n895_264806_c1 3300050512 Bacteria 1744
993 nmdc:mga0n895_266812_c1 3300050512 Bacteria 1737
994 nmdc:mga0n895_434117_c1 3300050512 Bacteria 1327
995 nmdc:mga0n895_76060_c1 3300050512 Unclassified 3338
996 nmdc:mga0rr50_115016_c1 3300050513 Bacteria 2134
997 nmdc:mga0rr50_1432_c1 3300050513 Bacteria 13118
998 nmdc:mga0rr50_153545_c1 3300050513 Bacteria 1863
999 nmdc:mga0rr50_188637_c1 3300050513 Bacteria 1688
1000 nmdc:mga0rr50_545386_c1 3300050513 Unclassified 987
1001 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
1002 nmdc:mga08x19_4099_c1 3300050514 Bacteria 8644
1003 nmdc:mga0a205_284960_c1 3300050515 Bacteria 1527
1004 nmdc:mga0a205_333661_c1 3300050515 Bacteria 1386
1005 nmdc:mga0a205_418409_c1 3300050515 Bacteria 1202
1006 nmdc:mga0a205_42897_c1 3300050515 Bacteria 4360
1007 nmdc:mga0a205_44029_c1 3300050515 Bacteria 4302
1008 nmdc:mga0a205_44167_c1 3300050515 Bacteria 3958
1009 nmdc:mga0a205_81896_c1 3300050515 Bacteria 3118
1010 Ga0495655_0004099 3300053083 Unclassified 2467
1011 Ga0501084_0167175 3300054114 Bacteria 1856
1012 Ga0530510_0435040 3300061734 Bacteria 991
1013 Ga0065715_10360617
1014 MBSR1b_contig_11831596
1015 CNBas_1001844
1016 JGI24751J29686_10000044
1017 JGI25406J46586_10002885
1018 Ga0065704_10087916
1019 Ga0065704_10100713
1020 Ga0065704_10119347
1021 Ga0065704_10141261
1022 Ga0065704_10158725
1023 Ga0065712_10000123
1024 Ga0065712_10010968
1025 Ga0065712_10048272
1026 Ga0065712_10109847
1027 Ga0065712_10146274
1028 Ga0065715_10017239
1029 Ga0065715_10068422
1030 Ga0065715_10089361
1031 Ga0065715_10094370
1032 Ga0065715_10147747
1033 Ga0065715_10214062
1034 Ga0065715_10586200
1035 Ga0065707_10003187
1036 Ga0065707_10099533
1037 Ga0065707_10106281
1038 Ga0065707_10107559
1039 Ga0065707_10271768
1040 Ga0065707_10286549
1041 Ga0065707_10294977
1042 Ga0070676_10259573
1043 Ga0070676_10267149
1044 Ga0070676_10776551
1045 Ga0070683_100539584
1046 Ga0070690_100085278
1047 Ga0070690_100119691
1048 Ga0070690_100128731
1049 Ga0070690_100142793
1050 Ga0070690_100241144
1051 Ga0070690_100431157
1052 Ga0070670_100000144
1053 Ga0070670_100016819
1054 Ga0070670_100046457
1055 Ga0070670_100132631
1056 Ga0070670_100253954
1057 Ga0070670_100292051
1058 Ga0070670_100872126
1059 Ga0070677_10077455
1060 Ga0068869_100026023
1061 Ga0068869_100053422
1062 Ga0068869_100108174
1063 Ga0068869_100556540
1064 Ga0068869_100720234
1065 Ga0068869_100744021
1066 Ga0068869_100762964
1067 Ga0068869_101067821
1068 Ga0070666_10058851
1069 Ga0070666_10077869
1070 Ga0070680_100000624
1071 Ga0070682_100000405
1072 Ga0070682_100003448
1073 Ga0070682_100011524
1074 Ga0070682_100702342
1075 Ga0068868_100012130
1076 Ga0068868_100022784
1077 Ga0068868_100087038
1078 Ga0068868_100346800
1079 Ga0068868_100349530
1080 Ga0068868_100432309
1081 Ga0070660_100185064
1082 Ga0070689_100001209
1083 Ga0070689_100137948
1084 Ga0070689_100205479
1085 Ga0070691_10469824
1086 Ga0070687_100012833
1087 Ga0070687_100012923
1088 Ga0070687_100181944
1089 Ga0070687_100232675
1090 Ga0070687_100281004
1091 Ga0070687_100629167
1092 Ga0070687_100759905
1093 Ga0070661_100177215
1094 Ga0070661_100846179
1095 Ga0070692_10001749
1096 Ga0070692_10009660
1097 Ga0070692_10063808
1098 Ga0070692_10229614
1099 Ga0070692_10279775
1100 Ga0070668_100001433
1101 Ga0070668_101151423
1102 Ga0070669_100001869
1103 Ga0070669_100036875
1104 Ga0070669_100064092
1105 Ga0070669_100186423
1106 Ga0070669_100308450
1107 Ga0070669_100389284
1108 Ga0070675_100159298
1109 Ga0070671_100003832
1110 Ga0070671_100085327
1111 Ga0070671_100225165
1112 Ga0070671_100339530
1113 Ga0070674_100792502
1114 Ga0070673_100081375
1115 Ga0070673_100130152
1116 Ga0070673_100236121
1117 Ga0070673_100245695
1118 Ga0070673_100448507
1119 Ga0070673_100527543
1120 Ga0070673_100691062
1121 Ga0070673_101107574
1122 Ga0070688_100327451
1123 Ga0070688_100790993
1124 Ga0070659_100016910
1125 Ga0070659_100167007
1126 Ga0070667_100550020
1127 Ga0070667_100677013
1128 Ga0070667_100808510
1129 Ga0070703_10000117
1130 Ga0070703_10021983
1131 Ga0070703_10036845
1132 Ga0070703_10047071
1133 Ga0070701_10036020
1134 Ga0070701_10040733
1135 Ga0070701_10200044
1136 Ga0070705_100007202
1137 Ga0070705_100056427
1138 Ga0070705_100067535
1139 Ga0070705_100117059
1140 Ga0070705_100119594
1141 Ga0070700_100000062
1142 Ga0070700_100007690
1143 Ga0070700_100010600
1144 Ga0070700_100122307
1145 Ga0070700_100166334
1146 Ga0070700_100426070
1147 Ga0070694_100002065
1148 Ga0070694_100004696
1149 Ga0070694_100007085
1150 Ga0070694_100009483
1151 Ga0070694_100026789
1152 Ga0070694_100056456
1153 Ga0070694_100116800
1154 Ga0070694_100127480
1155 Ga0070694_100162633
1156 Ga0070694_100206996
1157 Ga0070694_100340587
1158 Ga0070694_100341338
1159 Ga0070694_100540898
1160 Ga0070694_100561943
1161 Ga0070694_100764636
1162 Ga0070694_100863718
1163 Ga0070708_100001183
1164 Ga0070708_100016622
1165 Ga0070708_100045673
1166 Ga0070708_100077547
1167 Ga0070708_100188259
1168 Ga0070708_100682779
1169 Ga0070708_101367246
1170 Ga0070663_100440258
1171 Ga0070663_100449565
1172 Ga0070678_100159223
1173 Ga0070662_100021490
1174 Ga0070662_100280603
1175 Ga0070662_100386373
1176 Ga0070662_100389585
1177 Ga0070662_100537709
1178 Ga0070681_10007691
1179 Ga0070681_10020025
1180 Ga0070681_10025119
1181 Ga0070681_10072851
1182 Ga0068867_100012727
1183 Ga0068867_100072287
1184 Ga0068867_100160907
1185 Ga0070685_10133495
1186 Ga0070685_10807272
1187 Ga0070706_100014834
1188 Ga0070706_100043332
1189 Ga0070706_100044179
1190 Ga0070706_100199596
1191 Ga0070706_100274933
1192 Ga0070706_100377280
1193 Ga0070707_100000349
1194 Ga0070707_100011592
1195 Ga0070707_100018277
1196 Ga0070707_100049224
1197 Ga0070707_100262783
1198 Ga0070707_100324760
1199 Ga0070707_100355400
1200 Ga0070707_100661499
1201 Ga0070707_100961995
1202 Ga0070707_100995040
1203 Ga0070698_100000126
1204 Ga0070698_100000214
1205 Ga0070698_100010112
1206 Ga0070698_100016175
1207 Ga0070698_100066657
1208 Ga0070698_100073161
1209 Ga0070698_100441906
1210 Ga0070698_100527919
1211 Ga0070698_100550075
1212 Ga0070699_100002296
1213 Ga0070699_100005850
1214 Ga0070699_100006980
1215 Ga0070699_100047578
1216 Ga0070699_100065301
1217 Ga0070699_100272927
1218 Ga0070699_100556037
1219 Ga0070699_100957260
1220 Ga0070679_100000047
1221 Ga0070679_100912282
1222 Ga0070684_100776426
1223 Ga0070697_100000217
1224 Ga0070697_100000380
1225 Ga0070697_100044313
1226 Ga0070697_100167892
1227 Ga0070697_100297976
1228 Ga0070697_100379832
1229 Ga0070697_100392709
1230 Ga0068853_100150415
1231 Ga0068853_100405778
1232 Ga0068853_100453121
1233 Ga0068853_100488941
1234 Ga0068853_100706419
1235 Ga0068853_100946251
1236 Ga0070672_100270755
1237 Ga0070672_100809191
1238 Ga0070672_100832642
1239 Ga0070686_100000648
1240 Ga0070686_100009242
1241 Ga0070686_100020844
1242 Ga0070686_100095756
1243 Ga0070686_100833525
1244 Ga0070686_100914422
1245 Ga0070695_100039878
1246 Ga0070695_100045540
1247 Ga0070695_100103748
1248 Ga0070695_100275601
1249 Ga0070695_100396149
1250 Ga0070695_100435736
1251 Ga0070695_100465171
1252 Ga0070695_100474366
1253 Ga0070695_100723643
1254 Ga0070696_100031651
1255 Ga0070696_100037727
1256 Ga0070696_100156761
1257 Ga0070696_100164135
1258 Ga0070696_100171861
1259 Ga0070696_100293413
1260 Ga0070696_100320826
1261 Ga0070696_100405273
1262 Ga0070696_100557848
1263 Ga0070696_100587500
1264 Ga0070693_100001695
1265 Ga0070693_100004426
1266 Ga0070693_100031014
1267 Ga0070665_100622772
1268 Ga0070665_100883143
1269 Ga0070704_100003232
1270 Ga0070704_100050571
1271 Ga0070704_100102529
1272 Ga0070704_100126943
1273 Ga0070704_100282862
1274 Ga0070704_100316789
1275 Ga0070704_100347020
1276 Ga0070704_100442306
1277 Ga0070704_100612336
1278 Ga0070704_100751961
1279 Ga0070704_100817063
1280 Ga0070664_100014957
1281 Ga0070664_100456518
1282 Ga0068857_100064025
1283 Ga0068857_100138045
1284 Ga0068857_100600591
1285 Ga0068857_100615014
1286 Ga0068857_100951970
1287 Ga0068857_101149657
1288 Ga0068854_100082457
1289 Ga0068854_100121292
1290 Ga0068854_100129147
1291 Ga0068854_100181278
1292 Ga0068854_100378895
1293 Ga0068856_100006841
1294 Ga0070702_100013605
1295 Ga0070702_100063061
1296 Ga0070702_100095456
1297 Ga0070702_100217094
1298 Ga0070702_100473090
1299 Ga0068852_100131637
1300 Ga0068852_100331812
1301 Ga0068852_100707377
1302 Ga0068852_100912548
1303 Ga0068859_100020309
1304 Ga0068859_100022806
1305 Ga0068859_100029886
1306 Ga0068859_100040540
1307 Ga0068859_100045155
1308 Ga0068859_100049851
1309 Ga0068859_100056736
1310 Ga0068859_100114087
1311 Ga0068859_100126246
1312 Ga0068859_100150795
1313 Ga0068859_100178192
1314 Ga0068859_100280931
1315 Ga0068859_100315592
1316 Ga0068859_100466912
1317 Ga0068859_101190759
1318 Ga0068864_100064981
1319 Ga0068864_100098969
1320 Ga0068864_100122297
1321 Ga0068864_100124782
1322 Ga0068864_100151645
1323 Ga0068864_100167807
1324 Ga0068864_100239213
1325 Ga0068864_100264650
1326 Ga0068864_100322629
1327 Ga0068864_100443012
1328 Ga0068864_100482718
1329 Ga0068864_100483302
1330 Ga0068864_100610628
1331 Ga0068866_10031530
1332 Ga0068866_10076173
1333 Ga0068861_100006125
1334 Ga0068861_100023899
1335 Ga0068861_100034946
1336 Ga0068861_100089492
1337 Ga0068861_100130256
1338 Ga0068861_100223068
1339 Ga0068861_100312448
1340 Ga0068861_100698675
1341 Ga0068851_10362742
1342 Ga0068870_10017039
1343 Ga0068870_10051005
1344 Ga0068870_10150257
1345 Ga0068870_10245124
1346 Ga0068863_100026639
1347 Ga0068863_100091832
1348 Ga0068863_100133871
1349 Ga0068863_100163148
1350 Ga0068863_100276594
1351 Ga0068863_100499072
1352 Ga0068863_100592415
1353 Ga0068863_100595866
1354 Ga0068863_100750732
1355 Ga0068858_100014545
1356 Ga0068858_100033321
1357 Ga0068858_100115266
1358 Ga0068858_100146758
1359 Ga0068858_100161681
1360 Ga0068858_100176608
1361 Ga0068858_100355061
1362 Ga0068858_100377009
1363 Ga0068858_100726763
1364 Ga0068860_100022110
1365 Ga0068860_100035879
1366 Ga0068860_100055864
1367 Ga0068860_100153124
1368 Ga0068860_100226580
1369 Ga0068860_100340565
1370 Ga0068860_100710189
1371 Ga0068862_100063414
1372 Ga0068862_100070844
1373 Ga0068862_100076839
1374 Ga0068862_100102217
1375 Ga0068862_100535118
1376 Ga0068862_100615184
1377 Ga0068862_100721625
1378 Ga0081455_10463840
1379 Ga0081540_1063214
1380 Ga0081539_10000422
1381 Ga0081539_10007568
1382 Ga0075432_10071248
1383 Ga0070715_10000002
1384 Ga0070716_100000001
1385 Ga0070716_100142786
1386 Ga0070716_100166330
1387 Ga0070716_100591540
1388 Ga0070716_100815578
1389 Ga0097621_100010916
1390 Ga0097621_100218321
1391 Ga0068871_100106369
1392 Ga0068871_100133507
1393 Ga0068871_100919660
1394 Ga0075428_100052364
1395 Ga0075428_100140028
1396 Ga0075428_100294946
1397 Ga0075428_100354918
1398 Ga0075430_100101202
1399 Ga0075431_100093711
1400 Ga0075431_100789153
1401 Ga0075433_10042512
1402 Ga0075433_10066356
1403 Ga0075433_10073659
1404 Ga0075433_10111034
1405 Ga0075433_10119161
1406 Ga0075433_10592137
1407 Ga0075433_10673275
1408 Ga0075434_100105261
1409 Ga0075434_100106497
1410 Ga0075434_100179512
1411 Ga0075434_100208089
1412 Ga0075434_100252352
1413 Ga0075434_100603563
1414 Ga0075429_100108511
1415 Ga0075429_100333883
1416 Ga0075429_100547152
1417 Ga0075436_100000028
1418 Ga0075436_100022320
1419 Ga0097620_100020310
1420 Ga0097620_100022804
1421 Ga0097620_100029886
1422 Ga0097620_100040539
1423 Ga0097620_100045156
1424 Ga0097620_100049850
1425 Ga0097620_100056736
1426 Ga0097620_100114088
1427 Ga0097620_100126241
1428 Ga0097620_100150795
1429 Ga0097620_100178175
1430 Ga0097620_100280938
1431 Ga0097620_100315570
1432 Ga0097620_100466931
1433 Ga0097620_101191116
1434 Ga0075435_100021741
1435 Ga0075435_100426004
1436 Ga0099794_10004171
1437 Ga0099795_10058360
1438 Ga0105251_10167242
1439 Ga0105240_10176724
1440 Ga0111539_10001877
1441 Ga0111539_10005687
1442 Ga0111539_10006549
1443 Ga0111539_10125960
1444 Ga0111539_10150037
1445 Ga0111539_10389665
1446 Ga0111539_10723326
1447 Ga0111539_11179587
1448 Ga0105245_10427013
1449 Ga0105245_10724165
1450 Ga0105245_10868491
1451 Ga0105245_10985689
1452 Ga0105245_11261122
1453 Ga0105247_10003373
1454 Ga0105247_10102872
1455 Ga0105247_10117094
1456 Ga0105247_10130714
1457 Ga0105247_10165925
1458 Ga0105247_10472538
1459 Ga0114129_10010658
1460 Ga0114129_10049988
1461 Ga0114129_10071582
1462 Ga0114129_10149045
1463 Ga0114129_10200232
1464 Ga0114129_10210011
1465 Ga0114129_10240502
1466 Ga0114129_10279643
1467 Ga0114129_10589249
1468 Ga0114129_10873829
1469 Ga0114129_10876941
1470 Ga0105243_10000015
1471 Ga0105243_10012901
1472 Ga0105243_10014515
1473 Ga0105243_10055616
1474 Ga0105243_10066347
1475 Ga0105243_10092878
1476 Ga0105243_10197930
1477 Ga0105243_10267282
1478 Ga0105243_10422313
1479 Ga0105243_10434797
1480 Ga0105243_10735466
1481 Ga0105243_11115138
1482 Ga0105243_11257944
1483 Ga0105241_10045407
1484 Ga0105241_10105290
1485 Ga0105241_10503279
1486 Ga0105241_10513392
1487 Ga0105241_10592148
1488 Ga0105241_10921539
1489 Ga0105241_11443259
1490 Ga0105242_10000028
1491 Ga0105242_10008738
1492 Ga0105242_10032609
1493 Ga0105242_10040362
1494 Ga0105242_10150891
1495 Ga0105242_10293396
1496 Ga0105242_10390455
1497 Ga0105242_10391601
1498 Ga0105242_10408433
1499 Ga0105242_10527510
1500 Ga0105248_10009861
1501 Ga0105248_10025944
1502 Ga0105248_10059640
1503 Ga0105248_10117472
1504 Ga0105248_10129580
1505 Ga0105248_10205134
1506 Ga0105248_10466434
1507 Ga0105248_10489232
1508 Ga0105248_10804707
1509 Ga0105248_10870785
1510 Ga0105248_11424512
1511 Ga0105237_10000903
1512 Ga0105237_10101023
1513 Ga0105237_10490011
1514 Ga0105238_10005940
1515 Ga0105238_10013120
1516 Ga0105249_10000136
1517 Ga0105249_10011401
1518 Ga0105249_10043269
1519 Ga0105249_10066800
1520 Ga0105249_10234405
1521 Ga0105249_10324364
1522 Ga0105249_10406408
1523 Ga0105249_10624820
1524 Ga0105249_10783920
1525 Ga0105239_10095554
1526 Ga0105239_10109014
1527 Ga0105239_10334780
1528 Ga0105239_10542069
1529 Ga0105239_10669845
1530 Ga0105239_11401104
1531 Ga0105246_10020265
1532 Ga0105246_10057398
1533 Ga0105246_10102185
1534 Ga0105246_10364491
1535 Ga0105246_10766682
1536 Ga0157373_10010134
1537 Ga0157373_10418838
1538 Ga0157371_10511310
1539 Ga0157374_10022394
1540 Ga0157374_10052804
1541 Ga0157378_10003478
1542 Ga0157378_10009116
1543 Ga0157378_10014880
1544 Ga0157378_10017810
1545 Ga0157378_10029842
1546 Ga0157378_10067110
1547 Ga0157378_10088050
1548 Ga0157378_10099596
1549 Ga0157378_10127387
1550 Ga0157378_10127853
1551 Ga0157378_10225211
1552 Ga0157378_10240225
1553 Ga0157378_10529931
1554 Ga0157378_11115083
1555 Ga0163162_10000001
1556 Ga0163162_10020922
1557 Ga0163162_10022132
1558 Ga0163162_10094875
1559 Ga0163162_10119313
1560 Ga0163162_10137921
1561 Ga0163162_10221403
1562 Ga0163162_10323460
1563 Ga0163162_10335240
1564 Ga0163162_10374622
1565 Ga0163162_10803230
1566 Ga0157372_10010237
1567 Ga0157372_10176650
1568 Ga0157372_10429643
1569 Ga0157375_10010051
1570 Ga0157375_10035989
1571 Ga0157375_10035990
1572 Ga0157375_10125642
1573 Ga0157375_10625156
1574 Ga0157375_11467363
1575 Ga0157375_11841562
1576 Ga0163163_10001208
1577 Ga0163163_10005816
1578 Ga0163163_10009856
1579 Ga0163163_10040627
1580 Ga0163163_10044834
1581 Ga0163163_10050659
1582 Ga0163163_10060630
1583 Ga0163163_10125892
1584 Ga0163163_10199147
1585 Ga0163163_10271820
1586 Ga0163163_10612970
1587 Ga0163163_10870422
1588 Ga0157380_10000283
1589 Ga0157380_10005686
1590 Ga0157380_10006247
1591 Ga0157380_10012283
1592 Ga0157380_10023647
1593 Ga0157380_10133196
1594 Ga0157380_10146960
1595 Ga0157380_10174950
1596 Ga0157380_10944655
1597 Ga0157380_11117106
1598 Ga0157377_10070675
1599 Ga0157377_10122821
1600 Ga0157379_10151703
1601 Ga0157379_10201694
1602 Ga0157379_10326075
1603 Ga0157379_11081104
1604 Ga0157376_10072525
1605 Ga0157376_10084445
1606 Ga0163161_10011523
1607 Ga0163161_10317381
1608 Ga0163161_10353702
1609 Ga0213875_10292036
1610 Ga0207697_10008507
1611 Ga0207697_10047072
1612 Ga0207653_10000342
1613 Ga0207653_10047542
1614 Ga0207653_10140400
1615 Ga0207682_10058435
1616 Ga0207642_10013304
1617 Ga0207710_10000927
1618 Ga0207710_10185716
1619 Ga0207647_10007102
1620 Ga0207647_10240161
1621 Ga0207685_10000002
1622 Ga0207645_10091469
1623 Ga0207643_10000595
1624 Ga0207643_10029946
1625 Ga0207643_10338456
1626 Ga0207684_10000314
1627 Ga0207684_10007903
1628 Ga0207684_10008012
1629 Ga0207684_10174676
1630 Ga0207684_10197959
1631 Ga0207654_10030444
1632 Ga0207654_10065174
1633 Ga0207654_10113646
1634 Ga0207654_10122934
1635 Ga0207654_10225858
1636 Ga0207654_10455917
1637 Ga0207707_10000006
1638 Ga0207707_10032652
1639 Ga0207707_10285501
1640 Ga0207695_10066767
1641 Ga0207671_10160785
1642 Ga0207671_10438007
1643 Ga0207671_10796205
1644 Ga0207660_10002802
1645 Ga0207660_10818039
1646 Ga0207662_10002563
1647 Ga0207662_10072803
1648 Ga0207662_10094642
1649 Ga0207662_10118564
1650 Ga0207662_10135164
1651 Ga0207652_10001029
1652 Ga0207646_10000199
1653 Ga0207646_10012482
1654 Ga0207646_10072002
1655 Ga0207646_10076563
1656 Ga0207646_10237233
1657 Ga0207646_10914361
1658 Ga0207681_10000407
1659 Ga0207681_10009399
1660 Ga0207681_10046565
1661 Ga0207681_10144120
1662 Ga0207681_10261458
1663 Ga0207681_10350999
1664 Ga0207681_10788517
1665 Ga0207694_10000938
1666 Ga0207694_10026046
1667 Ga0207650_10000047
1668 Ga0207650_10000517
1669 Ga0207650_10143185
1670 Ga0207650_10146613
1671 Ga0207650_10238573
1672 Ga0207650_10960879
1673 Ga0207659_10063331
1674 Ga0207659_10855579
1675 Ga0207687_10325776
1676 Ga0207687_10493327
1677 Ga0207687_10913768
1678 Ga0207644_10011207
1679 Ga0207644_10021315
1680 Ga0207644_10320690
1681 Ga0207644_10526847
1682 Ga0207690_10013277
1683 Ga0207690_10808606
1684 Ga0207706_10123297
1685 Ga0207706_10141782
1686 Ga0207706_10242791
1687 Ga0207706_10423200
1688 Ga0207686_10000031
1689 Ga0207686_10000381
1690 Ga0207686_10069084
1691 Ga0207686_10367006
1692 Ga0207709_10000009
1693 Ga0207709_10008224
1694 Ga0207709_10074255
1695 Ga0207709_10090719
1696 Ga0207709_10102046
1697 Ga0207709_10271435
1698 Ga0207709_10366874
1699 Ga0207709_10488021
1700 Ga0207709_10609559
1701 Ga0207670_10000162
1702 Ga0207670_10036079
1703 Ga0207670_10308976
1704 Ga0207670_10415949
1705 Ga0207670_10734591
1706 Ga0207669_10051011
1707 Ga0207665_10000016
1708 Ga0207665_10071790
1709 Ga0207665_10186956
1710 Ga0207665_10201259
1711 Ga0207691_10007252
1712 Ga0207691_10300598
1713 Ga0207711_10013606
1714 Ga0207711_10023587
1715 Ga0207711_10062117
1716 Ga0207711_10103335
1717 Ga0207711_10266561
1718 Ga0207711_10331757
1719 Ga0207711_10366906
1720 Ga0207711_10732150
1721 Ga0207711_10771806
1722 Ga0207711_10846212
1723 Ga0207689_10001827
1724 Ga0207689_10002806
1725 Ga0207689_10071917
1726 Ga0207689_10083245
1727 Ga0207689_10090588
1728 Ga0207689_10104862
1729 Ga0207689_10120891
1730 Ga0207689_10163621
1731 Ga0207689_10173036
1732 Ga0207689_10255676
1733 Ga0207689_10326790
1734 Ga0207689_10519742
1735 Ga0207679_10032627
1736 Ga0207679_10165235
1737 Ga0207679_10495974
1738 Ga0207667_10279566
1739 Ga0207667_10312336
1740 Ga0207651_10096351
1741 Ga0207651_10119147
1742 Ga0207651_10134655
1743 Ga0207651_10192477
1744 Ga0207651_10276718
1745 Ga0207651_10661408
1746 Ga0207651_10821546
1747 Ga0207712_10000092
1748 Ga0207712_10005073
1749 Ga0207712_10016894
1750 Ga0207712_10037262
1751 Ga0207712_10105243
1752 Ga0207712_10195886
1753 Ga0207712_10352094
1754 Ga0207712_10723660
1755 Ga0207668_10002111
1756 Ga0207640_10014816
1757 Ga0207640_10035631
1758 Ga0207640_10100247
1759 Ga0207640_10137699
1760 Ga0207640_10389470
1761 Ga0207658_10234953
1762 Ga0207677_10674697
1763 Ga0207677_11103331
1764 Ga0207703_10015611
1765 Ga0207703_10042431
1766 Ga0207703_10045746
1767 Ga0207703_10081772
1768 Ga0207703_10125571
1769 Ga0207703_10129429
1770 Ga0207703_10165919
1771 Ga0207703_10374853
1772 Ga0207703_10401040
1773 Ga0207639_10440794
1774 Ga0207639_10614019
1775 Ga0207708_10000246
1776 Ga0207708_10007047
1777 Ga0207708_10008389
1778 Ga0207708_10024106
1779 Ga0207708_10041981
1780 Ga0207708_10069713
1781 Ga0207708_10092804
1782 Ga0207708_10096882
1783 Ga0207708_10219950
1784 Ga0207708_10883393
1785 Ga0207708_11022617
1786 Ga0207641_10022808
1787 Ga0207641_10075438
1788 Ga0207641_10173552
1789 Ga0207641_10242088
1790 Ga0207641_10437633
1791 Ga0207641_10530339
1792 Ga0207648_10009860
1793 Ga0207648_10029342
1794 Ga0207648_10072970
1795 Ga0207648_10270326
1796 Ga0207648_10406731
1797 Ga0207648_10647435
1798 Ga0207648_11157929
1799 Ga0207676_10003037
1800 Ga0207676_10008551
1801 Ga0207676_10029779
1802 Ga0207676_10120854
1803 Ga0207676_10246216
1804 Ga0207676_10275852
1805 Ga0207676_10300850
1806 Ga0207676_10312591
1807 Ga0207676_10528675
1808 Ga0207676_10787841
1809 Ga0207674_10019731
1810 Ga0207674_10100220
1811 Ga0207674_10110002
1812 Ga0207674_10124154
1813 Ga0207674_10182682
1814 Ga0207674_10222075
1815 Ga0207674_10328590
1816 Ga0207674_10582220
1817 Ga0207674_10605508
1818 Ga0207675_100009521
1819 Ga0207675_100037618
1820 Ga0207675_100038139
1821 Ga0207675_100097066
1822 Ga0207675_100113146
1823 Ga0207675_100184169
1824 Ga0207675_100229512
1825 Ga0207675_100254800
1826 Ga0207675_100258880
1827 Ga0207675_100269991
1828 Ga0207675_100959419
1829 Ga0207683_10080211
1830 Ga0207683_10206396
1831 Ga0207683_10418297
1832 Ga0207683_10433747
1833 Ga0207698_10356844
1834 Ga0207698_10607455
1835 Ga0207698_10767282
1836 Ga0207428_10002219
1837 Ga0207428_10013301
1838 Ga0207428_10069112
1839 Ga0207428_10296088
1840 Ga0268266_10765376
1841 Ga0268265_10122619
1842 Ga0268265_10199819
1843 Ga0268265_10218442
1844 Ga0268265_10295444
1845 Ga0268265_10481059
1846 Ga0268265_10508919
1847 Ga0268264_10110750
1848 Ga0268264_10110935
1849 Ga0268264_10117790
1850 Ga0268264_10129367
1851 Ga0268264_10158615
1852 Ga0268264_10171380
1853 Ga0268264_10196724
1854 Ga0268264_10389432
1855 Ga0268264_10560060
1856 Ga0307513_10453815
1857 Ga0307408_100112541
1858 Ga0307408_100509753
1859 Ga0307405_10016049
1860 Ga0307413_10711986
1861 Ga0307410_10031517
1862 Ga0307410_10206176
1863 Ga0307410_10873844
1864 Ga0307406_10098864
1865 Ga0307406_10871705
1866 Ga0307407_10042041
1867 Ga0307412_10021603
1868 Ga0307412_10101083
1869 Ga0307412_10277657
1870 Ga0307409_100295642
1871 Ga0307416_100035493
1872 Ga0307416_100100284
1873 Ga0307416_100165479
1874 Ga0307414_10039672
1875 Ga0307414_10186038
1876 Ga0307415_100025864
1877 Ga0307415_100074212
1878 Ga0373949_0077918
1879 Ga0373951_0000456
1880 Ga0373941_0005444
1881 Ga0373931_0013124
1882 Ga0373931_0103930
1883 Ga0395900_0345971
1884 Ga0395898_0084385
1885 Ga0395905_0998662
1886 Ga0395901_0371842
1887 Ga0242422_01462
1888 Ga0242420_014220
1889 Ga0439439_0097744
1890 Ga0439431_0084883
1891 Ga0439455_0011346
1892 Ga0439458_0010133
1893 Ga0439434_0013509
1894 Ga0439464_0056276
1895 Ga0453683_0117074
1896 Ga0451576_0565285
1897 Ga0451576_1074163
1898 Ga0451576_1169985
1899 Ga0451576_1215512
1900 Ga0495639_0097569
1901 Ga0495586_0194213
1902 Ga0495621_0000007
1903 Ga0495621_0005112
1904 Ga0495659_0019215
1905 Ga0495613_0018185
1906 Ga0495674_0438464
1907 Ga0495672_0008903
1908 Ga0495680_0050097
1909 Ga0495677_0063226
1910 Ga0496100_1083949
1911 Ga0496102_0010003
1912 Ga0496106_0612599
1913 Ga0496107_0063454
1914 Ga0496108_0082717
1915 Ga0496108_0445103
1916 Ga0496110_0208063
1917 Ga0496110_0458932
1918 Ga0496110_0544706
1919 Ga0496112_0113304
1920 Ga0496112_0353446
1921 Ga0496112_0686872
1922 Ga0496113_0064526
1923 Ga0496113_0134251
1924 Ga0496113_0317784
1925 Ga0501291_021658
1926 Ga0501292_011788
1927 Ga0501293_008273
1928 Ga0501298_022136
1929 Ga0501299_002870
1930 Ga0501299_010131
1931 Ga0501299_050322
1932 Ga0501038_0007240
1933 Ga0501039_0382406
1934 Ga0501072_0235266
1935 Ga0501072_0857907
1936 Ga0501202_003380
1937 Ga0501202_011961
1938 Ga0501206_024900
1939 Ga0501207_003570
1940 Ga0501216_001897
1941 Ga0501216_002824
1942 Ga0501217_000772
1943 Ga0501217_003056
1944 Ga0501217_091789
1945 Ga0501223_005173
1946 Ga0501223_005210
1947 Ga0501223_011979
1948 Ga0501224_001375
1949 Ga0501227_084161
1950 Ga0501230_000985
1951 Ga0501230_066605
1952 Ga0501233_003750
1953 Ga0501233_007716
1954 Ga0501233_008092
1955 Ga0501233_043158
1956 Ga0501235_003719
1957 Ga0501235_004036
1958 Ga0501235_009688
1959 Ga0501235_018171
1960 Ga0501235_033090
1961 Ga0501243_004127
1962 Ga0501243_007641
1963 Ga0501249_013306
1964 Ga0501249_014692
1965 Ga0501249_035677
1966 Ga0501249_089058
1967 Ga0501257_011404
1968 Ga0501257_011905
1969 Ga0501259_013009
1970 Ga0501225_0004958
1971 Ga0501225_0007957
1972 Ga0501225_0093622
1973 Ga0501234_007226
1974 Ga0501234_010505
1975 Ga0501245_020593
1976 Ga0501079_0917730
1977 Ga0501081_0215047
1978 Ga0501081_0497792
1979 Ga0501267_009689
1980 Ga0501268_024751
1981 Ga0501283_001080
1982 Ga0501212_024371
1983 Ga0501212_024512
1984 Ga0501212_043988
1985 Ga0501226_000589
1986 nmdc:mga05p37_136097_c1
1987 nmdc:mga05p37_192430_c1
1988 nmdc:mga05p37_205646_c1
1989 nmdc:mga05p37_213946_c1
1990 nmdc:mga05p37_507149_c1
1991 nmdc:mga05p37_621407_c1
1992 nmdc:mga05p37_97921_c1
1993 nmdc:mga09592_206209_c1
1994 nmdc:mga09592_26548_c1
1995 nmdc:mga09592_324285_c1
1996 nmdc:mga09592_95776_c1
1997 nmdc:mga0qj67_115701_c1
1998 nmdc:mga0qj67_204259_c1
1999 nmdc:mga08y16_100599_c1
2000 nmdc:mga08y16_233036_c1
2001 nmdc:mga08y16_697458_c1
2002 nmdc:mga08y16_8582_c1
2003 nmdc:mga0n895_253264_c1
2004 nmdc:mga0n895_264806_c1
2005 nmdc:mga0n895_266812_c1
2006 nmdc:mga0n895_434117_c1
2007 nmdc:mga0n895_76060_c1
2008 nmdc:mga0rr50_115016_c1
2009 nmdc:mga0rr50_1432_c1
2010 nmdc:mga0rr50_153545_c1
2011 nmdc:mga0rr50_188637_c1
2012 nmdc:mga0rr50_545386_c1
2013 nmdc:mga08x19_3_c1
2014 nmdc:mga08x19_4099_c1
2015 nmdc:mga0a205_284960_c1
2016 nmdc:mga0a205_333661_c1
2017 nmdc:mga0a205_418409_c1
2018 nmdc:mga0a205_42897_c1
2019 nmdc:mga0a205_44029_c1
2020 nmdc:mga0a205_44167_c1
2021 nmdc:mga0a205_81896_c1
2022 Ga0495655_0004099
2023 Ga0501084_0167175
2024 Ga0530510_0435040

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

54

175

0.85

PF00578

AhpC-TSA

AhpC/TSA family

54

160

0.83

PF00085

Thioredoxin

Thioredoxin

62

153

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7luj-assembly3.cif.gz_C burkholderia pseudomallei disulfide bond forming protein a (dsba) liganded with fragment 4-methoxy-n-phenylbenzenesulfonamide 0.8855 59 100
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.8181 39 195
2h1b-assembly2.cif.gz_B resa e80q 0.8056 33 195
2h1g-assembly1.cif.gz_A resa c74a/c77a 0.8053 39 195
2h1a-assembly1.cif.gz_A resa c74a variant 0.8045 39 195
ID Description Score Start End Superfamily
5vyoC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8684 58 100 3.40.30.10
3apoA02 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8133 55 100 3.40.30.10
3iosA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8015 40 196 3.40.30.10
af_O06392_67_205_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8006 41 194 3.40.30.10
af_B2RYB1_652_773_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7968 58 100 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V8P7L8-F1-model_v4 Thioredoxin domain-containing protein 0.9584 41 205 GO:0016209
GO:0016491
AF-A0A2V8P7L8-F1-model_v4 Thioredoxin domain-containing protein 0.947 41 205 GO:0016209
GO:0016491
AF-A0A7V9SMR1-F1-model_v4 TlpA family protein disulfide reductase 0.8884 18 207 GO:0016209
GO:0016491
AF-A0A2W4S4J2-F1-model_v4 Thiol:disulfide interchange protein 0.8682 39 194 GO:0016020
GO:0016491
GO:0017004
AF-A0A5B3GEP1-F1-model_v4 AhpC/TSA family protein 0.8675 39 160 GO:0016491
GO:0017004

Map