F488159

General Info

Members Datasets Scaffolds Average Seq Length
1012 353 2024 106

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10682833|Ga0065707_106828332
Length 110
Sequence MTDLMARVVVNVPAEAKKGEVIEIRTLAGHPMETGFRRTQLGELVPRDIIRSLVCAYNGVEVFRAELHPAIAANPLLTFTTVATESGTLEFRWTGDNGFSVTEKAVIKVV

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
187 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
204 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
222 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
223 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
224 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
225 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
228 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
229 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
230 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
241 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
255 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
278 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
320 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
321 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
339 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
340 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
341 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
342 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
343 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
344 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
345 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
346 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
347 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
348 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
349 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
353 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.1
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 1.48
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 9.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10682833 3300005295 Bacteria 648
2 JGI24750J21931_1012062 3300002070 Bacteria 1141
3 JGI25406J46586_10112665 3300003203 Bacteria 804
4 Ga0058859_10482534 3300004798 Bacteria 645
5 Ga0065707_10002472 3300005295 Bacteria 4857
6 Ga0065707_10008939 3300005295 Bacteria 2752
7 Ga0065707_10032199 3300005295 Bacteria 1093
8 Ga0065707_10142379 3300005295 Bacteria 1756
9 Ga0065707_10421713 3300005295 Bacteria 830
10 Ga0065707_10742311 3300005295 Bacteria 622
11 Ga0065707_10843318 3300005295 Bacteria 572
12 Ga0065707_10863893 3300005295 Unclassified 578
13 Ga0070676_10267672 3300005328 Bacteria 1146
14 Ga0070676_10289081 3300005328 Bacteria 1107
15 Ga0070676_10302924 3300005328 Bacteria 1084
16 Ga0070683_100164724 3300005329 Bacteria 2103
17 Ga0070690_100000131 3300005330 Bacteria 38893
18 Ga0070690_100009883 3300005330 Bacteria 5536
19 Ga0070690_100123222 3300005330 Bacteria 1742
20 Ga0070690_101040930 3300005330 Bacteria 647
21 Ga0068869_100000392 3300005334 Bacteria 23853
22 Ga0068869_100032305 3300005334 Bacteria 3688
23 Ga0068869_101253262 3300005334 Bacteria 653
24 Ga0070666_10295857 3300005335 Bacteria 1152
25 Ga0070680_100052279 3300005336 Bacteria 3335
26 Ga0070680_100055201 3300005336 Bacteria 3246
27 Ga0070680_100130316 3300005336 Bacteria 2104
28 Ga0070680_100168751 3300005336 Bacteria 1841
29 Ga0070680_100644785 3300005336 Bacteria 910
30 Ga0070680_100903533 3300005336 Bacteria 762
31 Ga0070680_101717628 3300005336 Bacteria 544
32 Ga0070682_100024737 3300005337 Bacteria 3577
33 Ga0068868_100000656 3300005338 Bacteria 23322
34 Ga0068868_101081600 3300005338 Bacteria 737
35 Ga0070689_100006489 3300005340 Bacteria 8103
36 Ga0070689_100098199 3300005340 Bacteria 2316
37 Ga0070689_100441349 3300005340 Bacteria 1106
38 Ga0070689_100614528 3300005340 Bacteria 942
39 Ga0070691_10000200 3300005341 Bacteria 20142
40 Ga0070691_10034787 3300005341 Bacteria 2372
41 Ga0070691_10094607 3300005341 Bacteria 1477
42 Ga0070687_100000175 3300005343 Bacteria 22196
43 Ga0070687_100127683 3300005343 Bacteria 1464
44 Ga0070687_100318442 3300005343 Bacteria 993
45 Ga0070692_10001132 3300005345 Bacteria 9346
46 Ga0070692_10018032 3300005345 Bacteria 3387
47 Ga0070692_11059412 3300005345 Unclassified 570
48 Ga0070668_100055705 3300005347 Bacteria 3053
49 Ga0070668_100226763 3300005347 Bacteria 1543
50 Ga0070668_101331689 3300005347 Unclassified 653
51 Ga0070669_100190392 3300005353 Bacteria 1609
52 Ga0070669_101272375 3300005353 Unclassified 636
53 Ga0070669_101835745 3300005353 Unclassified 529
54 Ga0070675_100050024 3300005354 Bacteria 3431
55 Ga0070675_100076173 3300005354 Bacteria 2790
56 Ga0070671_101381184 3300005355 Bacteria 622
57 Ga0070674_100069371 3300005356 Bacteria 2487
58 Ga0070674_100688142 3300005356 Bacteria 873
59 Ga0070673_100078130 3300005364 Bacteria 2676
60 Ga0070688_100216458 3300005365 Bacteria 1348
61 Ga0070688_100702707 3300005365 Bacteria 783
62 Ga0070688_100734921 3300005365 Unclassified 767
63 Ga0070688_101069554 3300005365 Bacteria 644
64 Ga0070703_10140112 3300005406 Archaea 898
65 Ga0070709_10978484 3300005434 Bacteria 672
66 Ga0070710_10193938 3300005437 Bacteria 1279
67 Ga0070701_10000676 3300005438 Bacteria 12013
68 Ga0070701_10181614 3300005438 Bacteria 1232
69 Ga0070701_10337596 3300005438 Bacteria 937
70 Ga0070701_10356053 3300005438 Bacteria 916
71 Ga0070701_10667612 3300005438 Archaea 696
72 Ga0070711_100267315 3300005439 Bacteria 1348
73 Ga0070711_100562676 3300005439 Bacteria 947
74 Ga0070705_100003918 3300005440 Bacteria 7277
75 Ga0070705_100144122 3300005440 Bacteria 1572
76 Ga0070705_100250177 3300005440 Bacteria 1244
77 Ga0070705_100719174 3300005440 Bacteria 786
78 Ga0070705_100849852 3300005440 Bacteria 730
79 Ga0070705_101056823 3300005440 Bacteria 662
80 Ga0070700_100000587 3300005441 Bacteria 18243
81 Ga0070700_100044406 3300005441 Bacteria 2737
82 Ga0070700_100530306 3300005441 Bacteria 911
83 Ga0070700_101148093 3300005441 Bacteria 646
84 Ga0070700_101215337 3300005441 Unclassified 630
85 Ga0070694_100000136 3300005444 Bacteria 36787
86 Ga0070694_100367479 3300005444 Bacteria 1119
87 Ga0070694_100474031 3300005444 Bacteria 992
88 Ga0070694_100680372 3300005444 Bacteria 835
89 Ga0070694_100740679 3300005444 Bacteria 802
90 Ga0070694_100842465 3300005444 Bacteria 754
91 Ga0070694_100890541 3300005444 Bacteria 734
92 Ga0070694_101103691 3300005444 Unclassified 662
93 Ga0070708_100045853 3300005445 Bacteria 3854
94 Ga0070708_100493268 3300005445 Bacteria 1155
95 Ga0070708_100503739 3300005445 Bacteria 1142
96 Ga0070663_100431865 3300005455 Bacteria 1082
97 Ga0070678_100988831 3300005456 Bacteria 773
98 Ga0070662_100832722 3300005457 Archaea 785
99 Ga0070662_101650347 3300005457 Bacteria 553
100 Ga0070681_10007592 3300005458 Bacteria 10603
101 Ga0068867_100001154 3300005459 Bacteria 18064
102 Ga0068867_100002412 3300005459 Bacteria 13146
103 Ga0068867_100251805 3300005459 Bacteria 1436
104 Ga0068867_100559475 3300005459 Bacteria 992
105 Ga0068867_100837729 3300005459 Bacteria 823
106 Ga0070706_100078100 3300005467 Bacteria 3065
107 Ga0070706_100119580 3300005467 Bacteria 2455
108 Ga0070707_100047466 3300005468 Bacteria 4111
109 Ga0070707_100753661 3300005468 Bacteria 937
110 Ga0070707_100808756 3300005468 Bacteria 901
111 Ga0070698_100009043 3300005471 Bacteria 10708
112 Ga0070698_100013803 3300005471 Bacteria 8546
113 Ga0070698_100094448 3300005471 Bacteria 2969
114 Ga0070698_100402494 3300005471 Bacteria 1302
115 Ga0070699_100305144 3300005518 Bacteria 1428
116 Ga0070699_100343313 3300005518 Bacteria 1344
117 Ga0070699_100352759 3300005518 Bacteria 1325
118 Ga0070699_100438873 3300005518 Bacteria 1183
119 Ga0070679_100110038 3300005530 Bacteria 2741
120 Ga0070684_100080859 3300005535 Bacteria 2875
121 Ga0070697_100028284 3300005536 Bacteria 4488
122 Ga0070697_100038912 3300005536 Bacteria 3843
123 Ga0070697_100183529 3300005536 Bacteria 1774
124 Ga0070672_100571404 3300005543 Archaea 983
125 Ga0070686_100000285 3300005544 Bacteria 34108
126 Ga0070686_100034464 3300005544 Bacteria 3120
127 Ga0070686_100382979 3300005544 Bacteria 1065
128 Ga0070686_100729425 3300005544 Bacteria 793
129 Ga0070686_101062558 3300005544 Bacteria 667
130 Ga0070686_101738496 3300005544 Unclassified 530
131 Ga0070695_100000705 3300005545 Bacteria 17853
132 Ga0070695_100494244 3300005545 Bacteria 945
133 Ga0070695_100576905 3300005545 Bacteria 880
134 Ga0070695_101335010 3300005545 Unclassified 593
135 Ga0070696_100002015 3300005546 Bacteria 13322
136 Ga0070696_100015035 3300005546 Bacteria 5195
137 Ga0070696_100025633 3300005546 Bacteria 4009
138 Ga0070696_100173263 3300005546 Bacteria 1596
139 Ga0070696_100276734 3300005546 Bacteria 1278
140 Ga0070696_100981981 3300005546 Bacteria 704
141 Ga0070693_100000278 3300005547 Bacteria 24050
142 Ga0070693_100480465 3300005547 Bacteria 878
143 Ga0070693_100931771 3300005547 Bacteria 653
144 Ga0070704_100000103 3300005549 Bacteria 29844
145 Ga0070704_100001347 3300005549 Bacteria 13021
146 Ga0070704_100102412 3300005549 Bacteria 2160
147 Ga0070704_100213775 3300005549 Bacteria 1564
148 Ga0070704_100488248 3300005549 Bacteria 1067
149 Ga0070704_101264158 3300005549 Unclassified 675
150 Ga0070704_101907159 3300005549 Unclassified 551
151 Ga0068857_100410209 3300005577 Bacteria 1262
152 Ga0068854_100001266 3300005578 Bacteria 15179
153 Ga0068856_100025824 3300005614 Bacteria 5728
154 Ga0070702_100000039 3300005615 Bacteria 35203
155 Ga0070702_100011795 3300005615 Bacteria 4358
156 Ga0070702_100263693 3300005615 Bacteria 1174
157 Ga0068852_101909030 3300005616 Bacteria 616
158 Ga0068859_100000420 3300005617 Bacteria 42401
159 Ga0068859_100181226 3300005617 Bacteria 2189
160 Ga0068859_100332394 3300005617 Bacteria 1614
161 Ga0068859_100509781 3300005617 Bacteria 1298
162 Ga0068859_100894356 3300005617 Bacteria 973
163 Ga0068866_10001352 3300005718 Bacteria 10601
164 Ga0068861_100000399 3300005719 Bacteria 25138
165 Ga0068861_100121308 3300005719 Bacteria 2109
166 Ga0068861_100452508 3300005719 Bacteria 1151
167 Ga0068861_100715111 3300005719 Bacteria 932
168 Ga0068861_101178810 3300005719 Bacteria 740
169 Ga0068870_10036599 3300005840 Bacteria 2526
170 Ga0068870_10066418 3300005840 Bacteria 1953
171 Ga0068863_102666131 3300005841 Unclassified 509
172 Ga0068858_100005769 3300005842 Bacteria 12097
173 Ga0068858_100112559 3300005842 Bacteria 2542
174 Ga0068858_100520779 3300005842 Bacteria 1150
175 Ga0068858_101170622 3300005842 Unclassified 755
176 Ga0068860_100002528 3300005843 Bacteria 19155
177 Ga0068860_100099481 3300005843 Bacteria 2774
178 Ga0068860_100533700 3300005843 Bacteria 1174
179 Ga0068860_100602500 3300005843 Bacteria 1104
180 Ga0068860_101460699 3300005843 Bacteria 705
181 Ga0068862_100005981 3300005844 Bacteria 10130
182 Ga0068862_100048027 3300005844 Bacteria 3643
183 Ga0068862_100166396 3300005844 Bacteria 1971
184 Ga0068862_100553678 3300005844 Bacteria 1098
185 Ga0068862_101458131 3300005844 Unclassified 689
186 Ga0068862_102493692 3300005844 Unclassified 529
187 Ga0081455_10003176 3300005937 Bacteria 19071
188 Ga0081455_10450024 3300005937 Bacteria 880
189 Ga0081455_10614601 3300005937 Bacteria 706
190 Ga0081538_10337381 3300005981 Unclassified 547
191 Ga0081540_1000841 3300005983 Bacteria 28015
192 Ga0081540_1023446 3300005983 Bacteria 3609
193 Ga0081539_10000468 3300005985 Bacteria 85386
194 Ga0081539_10029471 3300005985 Bacteria 3427
195 Ga0075368_10106793 3300006042 Bacteria 1152
196 Ga0075432_10105557 3300006058 Bacteria 1045
197 Ga0070716_100481606 3300006173 Bacteria 911
198 Ga0070712_100001185 3300006175 Bacteria 15747
199 Ga0097621_100000754 3300006237 Bacteria 22721
200 Ga0097621_100028703 3300006237 Bacteria 4387
201 Ga0097621_101106566 3300006237 Bacteria 744
202 Ga0068871_100003878 3300006358 Bacteria 10311
203 Ga0068871_100009731 3300006358 Bacteria 6978
204 Ga0068871_100367069 3300006358 Unclassified 1276
205 Ga0068871_101363878 3300006358 Bacteria 668
206 Ga0075428_100001502 3300006844 Bacteria 24964
207 Ga0075428_100016740 3300006844 Bacteria 8096
208 Ga0075428_100101531 3300006844 Bacteria 3136
209 Ga0075428_100169137 3300006844 Bacteria 2370
210 Ga0075428_100185437 3300006844 Bacteria 2251
211 Ga0075428_100209874 3300006844 Bacteria 2104
212 Ga0075428_100277743 3300006844 Bacteria 1802
213 Ga0075428_100370279 3300006844 Bacteria 1536
214 Ga0075428_100400711 3300006844 Bacteria 1471
215 Ga0075428_100533781 3300006844 Unclassified 1254
216 Ga0075428_100583307 3300006844 Bacteria 1194
217 Ga0075428_100846073 3300006844 Bacteria 971
218 Ga0075428_100970926 3300006844 Bacteria 900
219 Ga0075428_101384707 3300006844 Bacteria 738
220 Ga0075428_101511895 3300006844 Bacteria 703
221 Ga0075428_101908210 3300006844 Bacteria 617
222 Ga0075428_102122220 3300006844 Bacteria 581
223 Ga0075428_102475135 3300006844 Bacteria 532
224 Ga0075430_100001098 3300006846 Bacteria 21488
225 Ga0075430_100002189 3300006846 Bacteria 16184
226 Ga0075430_100004241 3300006846 Bacteria 12110
227 Ga0075430_100011150 3300006846 Bacteria 7618
228 Ga0075430_100044526 3300006846 Bacteria 3751
229 Ga0075430_100243501 3300006846 Bacteria 1490
230 Ga0075430_100251596 3300006846 Bacteria 1464
231 Ga0075430_100351842 3300006846 Bacteria 1216
232 Ga0075430_100736214 3300006846 Bacteria 813
233 Ga0075430_101346514 3300006846 Bacteria 587
234 Ga0075430_101660051 3300006846 Unclassified 524
235 Ga0075431_100012939 3300006847 Bacteria 8423
236 Ga0075431_100021216 3300006847 Bacteria 6638
237 Ga0075431_100059320 3300006847 Bacteria 3949
238 Ga0075431_100115679 3300006847 Bacteria 2769
239 Ga0075431_100145224 3300006847 Bacteria 2445
240 Ga0075431_100150292 3300006847 Bacteria 2399
241 Ga0075431_100276979 3300006847 Bacteria 1699
242 Ga0075431_100317579 3300006847 Bacteria 1571
243 Ga0075431_100355586 3300006847 Unclassified 1472
244 Ga0075431_100729205 3300006847 Bacteria 967
245 Ga0075431_101512254 3300006847 Bacteria 630
246 Ga0075431_101849872 3300006847 Unclassified 560
247 Ga0075433_10011246 3300006852 Bacteria 7205
248 Ga0075433_10033804 3300006852 Bacteria 4386
249 Ga0075433_10060852 3300006852 Bacteria 3307
250 Ga0075433_10131534 3300006852 Bacteria 2223
251 Ga0075433_10131656 3300006852 Bacteria 2222
252 Ga0075433_10154480 3300006852 Bacteria 2042
253 Ga0075433_11540808 3300006852 Bacteria 574
254 Ga0075434_100006963 3300006871 Bacteria 10421
255 Ga0075434_100043103 3300006871 Bacteria 4474
256 Ga0075434_100064939 3300006871 Bacteria 3635
257 Ga0075434_100083230 3300006871 Bacteria 3197
258 Ga0075434_100156612 3300006871 Bacteria 2297
259 Ga0075434_100379461 3300006871 Bacteria 1434
260 Ga0075434_100389302 3300006871 Bacteria 1415
261 Ga0075434_101351586 3300006871 Bacteria 723
262 Ga0075434_101359723 3300006871 Bacteria 720
263 Ga0075434_101777379 3300006871 Bacteria 623
264 Ga0075434_101787199 3300006871 Bacteria 622
265 Ga0075434_101958202 3300006871 Bacteria 591
266 Ga0075429_100000055 3300006880 Bacteria 55152
267 Ga0075429_100000432 3300006880 Bacteria 31238
268 Ga0075429_100001365 3300006880 Bacteria 19968
269 Ga0075429_100028891 3300006880 Bacteria 4816
270 Ga0075429_100044996 3300006880 Bacteria 3840
271 Ga0075429_100098316 3300006880 Bacteria 2554
272 Ga0075429_100184447 3300006880 Bacteria 1828
273 Ga0075429_100473842 3300006880 Bacteria 1097
274 Ga0075429_101677911 3300006880 Bacteria 552
275 Ga0075429_101964715 3300006880 Unclassified 507
276 Ga0068865_100001524 3300006881 Bacteria 13518
277 Ga0068865_100040545 3300006881 Bacteria 3165
278 Ga0068865_100252665 3300006881 Bacteria 1392
279 Ga0075436_100007888 3300006914 Bacteria 7286
280 Ga0075436_100114402 3300006914 Bacteria 1884
281 Ga0097620_100000420 3300006931 Bacteria 42401
282 Ga0097620_100181248 3300006931 Bacteria 2189
283 Ga0097620_100332394 3300006931 Bacteria 1614
284 Ga0097620_100509803 3300006931 Bacteria 1298
285 Ga0097620_100894455 3300006931 Bacteria 973
286 Ga0075435_100007468 3300007076 Bacteria 7793
287 Ga0075435_100024358 3300007076 Bacteria 4696
288 Ga0075435_100048103 3300007076 Bacteria 3425
289 Ga0075435_100200586 3300007076 Bacteria 1690
290 Ga0075435_100201259 3300007076 Bacteria 1688
291 Ga0075435_100351769 3300007076 Bacteria 1263
292 Ga0075435_101268334 3300007076 Bacteria 645
293 Ga0099794_10064805 3300007265 Bacteria 1781
294 Ga0099794_10295389 3300007265 Bacteria 839
295 Ga0099794_10494406 3300007265 Bacteria 643
296 Ga0099795_10335698 3300007788 Bacteria 673
297 Ga0099795_10425416 3300007788 Unclassified 607
298 Ga0105240_12017022 3300009093 Bacteria 599
299 Ga0111539_10006184 3300009094 Bacteria 15445
300 Ga0111539_10026623 3300009094 Bacteria 7069
301 Ga0111539_10088217 3300009094 Bacteria 3645
302 Ga0111539_10102104 3300009094 Bacteria 3366
303 Ga0111539_10131305 3300009094 Bacteria 2933
304 Ga0111539_10184796 3300009094 Bacteria 2434
305 Ga0111539_10237023 3300009094 Bacteria 2124
306 Ga0111539_10240452 3300009094 Bacteria 2108
307 Ga0111539_10251855 3300009094 Bacteria 2056
308 Ga0111539_10402779 3300009094 Bacteria 1594
309 Ga0111539_10782009 3300009094 Bacteria 1111
310 Ga0111539_11135043 3300009094 Bacteria 908
311 Ga0111539_11245919 3300009094 Bacteria 864
312 Ga0111539_11980314 3300009094 Bacteria 676
313 Ga0105245_10012764 3300009098 Bacteria 7317
314 Ga0114129_10002987 3300009147 Bacteria 23703
315 Ga0114129_10006327 3300009147 Bacteria 16791
316 Ga0114129_10012532 3300009147 Bacteria 12074
317 Ga0114129_10030430 3300009147 Bacteria 7639
318 Ga0114129_10060555 3300009147 Bacteria 5293
319 Ga0114129_10067680 3300009147 Bacteria 4981
320 Ga0114129_10073085 3300009147 Bacteria 4778
321 Ga0114129_10124456 3300009147 Bacteria 3546
322 Ga0114129_10224122 3300009147 Bacteria 2535
323 Ga0114129_10237706 3300009147 Bacteria 2450
324 Ga0114129_10281729 3300009147 Bacteria 2221
325 Ga0114129_10299009 3300009147 Bacteria 2146
326 Ga0114129_10301114 3300009147 Bacteria 2137
327 Ga0114129_10308584 3300009147 Bacteria 2107
328 Ga0114129_10356472 3300009147 Bacteria 1936
329 Ga0114129_10365692 3300009147 Bacteria 1908
330 Ga0114129_10768525 3300009147 Unclassified 1232
331 Ga0114129_11628529 3300009147 Unclassified 789
332 Ga0114129_12639983 3300009147 Bacteria 599
333 Ga0105243_10002912 3300009148 Bacteria 14169
334 Ga0105243_10035086 3300009148 Bacteria 3888
335 Ga0105241_10044445 3300009174 Bacteria 3366
336 Ga0105241_11425235 3300009174 Bacteria 664
337 Ga0105242_10000248 3300009176 Bacteria 42523
338 Ga0105242_10227045 3300009176 Bacteria 1671
339 Ga0105248_10631497 3300009177 Bacteria 1208
340 Ga0105248_12160258 3300009177 Unclassified 633
341 Ga0105248_12161144 3300009177 Bacteria 633
342 Ga0105237_11902219 3300009545 Archaea 603
343 Ga0105237_12111053 3300009545 Bacteria 572
344 Ga0105249_10054817 3300009553 Bacteria 3646
345 Ga0105249_10066654 3300009553 Bacteria 3315
346 Ga0105249_10287100 3300009553 Bacteria 1645
347 Ga0105249_10539275 3300009553 Bacteria 1216
348 Ga0105249_11122045 3300009553 Bacteria 857
349 Ga0105249_12037070 3300009553 Bacteria 647
350 Ga0105239_10199942 3300010375 Bacteria 2239
351 Ga0157374_11997332 3300013296 Bacteria 606
352 Ga0157378_10000387 3300013297 Bacteria 43542
353 Ga0157378_10108512 3300013297 Bacteria 2542
354 Ga0157378_10721705 3300013297 Bacteria 1017
355 Ga0157378_11255069 3300013297 Bacteria 781
356 Ga0163162_10633774 3300013306 Bacteria 1193
357 Ga0163162_11634273 3300013306 Bacteria 735
358 Ga0163162_11694773 3300013306 Bacteria 722
359 Ga0163162_11740112 3300013306 Bacteria 712
360 Ga0163162_12447749 3300013306 Bacteria 600
361 Ga0157372_11314907 3300013307 Bacteria 834
362 Ga0157375_12124567 3300013308 Unclassified 668
363 Ga0157380_10011921 3300014326 Bacteria 6289
364 Ga0157380_10025684 3300014326 Bacteria 4469
365 Ga0157380_11671134 3300014326 Bacteria 694
366 Ga0157380_13121355 3300014326 Unclassified 528
367 Ga0157377_10603151 3300014745 Unclassified 783
368 Ga0157376_10012006 3300014969 Bacteria 6410
369 Ga0157376_11450566 3300014969 Unclassified 719
370 Ga0163161_10365627 3300017792 Unclassified 1150
371 Ga0163161_11353484 3300017792 Bacteria 620
372 Ga0213875_10072124 3300021388 Bacteria 1612
373 Ga0207666_1045861 3300025271 Unclassified 688
374 Ga0207653_10004764 3300025885 Bacteria 4242
375 Ga0207682_10363490 3300025893 Unclassified 682
376 Ga0207692_10180675 3300025898 Bacteria 1229
377 Ga0207642_10005011 3300025899 Bacteria 4300
378 Ga0207642_10053835 3300025899 Bacteria 1832
379 Ga0207688_10057485 3300025901 Bacteria 2187
380 Ga0207688_10617023 3300025901 Bacteria 684
381 Ga0207680_10055662 3300025903 Bacteria 2385
382 Ga0207645_10049224 3300025907 Bacteria 2691
383 Ga0207645_10472831 3300025907 Bacteria 847
384 Ga0207645_11018987 3300025907 Unclassified 560
385 Ga0207643_10064864 3300025908 Bacteria 2091
386 Ga0207643_10077561 3300025908 Bacteria 1921
387 Ga0207684_10019497 3300025910 Bacteria 5800
388 Ga0207684_10399399 3300025910 Bacteria 1182
389 Ga0207654_10252025 3300025911 Bacteria 1184
390 Ga0207707_10011165 3300025912 Bacteria 7813
391 Ga0207663_10302475 3300025916 Bacteria 1196
392 Ga0207660_10041586 3300025917 Bacteria 3222
393 Ga0207660_10043670 3300025917 Bacteria 3150
394 Ga0207660_10067317 3300025917 Bacteria 2594
395 Ga0207660_10160542 3300025917 Bacteria 1734
396 Ga0207660_10562741 3300025917 Bacteria 928
397 Ga0207660_11075085 3300025917 Bacteria 656
398 Ga0207662_10000095 3300025918 Bacteria 41923
399 Ga0207662_10268917 3300025918 Bacteria 1124
400 Ga0207652_10026429 3300025921 Bacteria 4835
401 Ga0207646_10003246 3300025922 Bacteria 18533
402 Ga0207646_10858213 3300025922 Bacteria 807
403 Ga0207681_10194022 3300025923 Bacteria 1556
404 Ga0207681_10208421 3300025923 Bacteria 1505
405 Ga0207681_10311137 3300025923 Bacteria 1249
406 Ga0207681_11610792 3300025923 Unclassified 543
407 Ga0207659_10024348 3300025926 Bacteria 4055
408 Ga0207659_10159000 3300025926 Bacteria 1772
409 Ga0207659_11863080 3300025926 Unclassified 510
410 Ga0207687_10003242 3300025927 Bacteria 11024
411 Ga0207687_11727265 3300025927 Bacteria 536
412 Ga0207644_10408267 3300025931 Bacteria 1111
413 Ga0207644_10933887 3300025931 Bacteria 727
414 Ga0207690_10673940 3300025932 Bacteria 849
415 Ga0207706_11152731 3300025933 Bacteria 646
416 Ga0207686_10001874 3300025934 Bacteria 11669
417 Ga0207709_10001439 3300025935 Bacteria 16614
418 Ga0207709_10040568 3300025935 Bacteria 2788
419 Ga0207670_10002023 3300025936 Bacteria 10646
420 Ga0207670_10115149 3300025936 Bacteria 1944
421 Ga0207669_10016254 3300025937 Bacteria 3776
422 Ga0207704_10000623 3300025938 Bacteria 15673
423 Ga0207704_10040114 3300025938 Bacteria 2733
424 Ga0207704_10467020 3300025938 Bacteria 1010
425 Ga0207665_10129051 3300025939 Bacteria 1793
426 Ga0207665_10374736 3300025939 Bacteria 1079
427 Ga0207691_10396080 3300025940 Bacteria 1178
428 Ga0207711_11247717 3300025941 Bacteria 685
429 Ga0207689_10000977 3300025942 Bacteria 27402
430 Ga0207689_10048172 3300025942 Bacteria 3515
431 Ga0207689_10284782 3300025942 Bacteria 1368
432 Ga0207689_10986962 3300025942 Bacteria 710
433 Ga0207661_10561417 3300025944 Bacteria 1046
434 Ga0207712_10013536 3300025961 Bacteria 5231
435 Ga0207712_10108426 3300025961 Bacteria 2078
436 Ga0207712_10587580 3300025961 Bacteria 962
437 Ga0207712_10665316 3300025961 Bacteria 906
438 Ga0207712_11313584 3300025961 Bacteria 646
439 Ga0207668_10083070 3300025972 Bacteria 2330
440 Ga0207668_10163260 3300025972 Bacteria 1738
441 Ga0207640_10019295 3300025981 Bacteria 4026
442 Ga0207640_10627586 3300025981 Bacteria 913
443 Ga0207677_10017944 3300026023 Bacteria 4236
444 Ga0207677_11316375 3300026023 Bacteria 664
445 Ga0207677_11911674 3300026023 Unclassified 551
446 Ga0207703_10012439 3300026035 Bacteria 6635
447 Ga0207703_10018478 3300026035 Bacteria 5444
448 Ga0207678_10460086 3300026067 Bacteria 1106
449 Ga0207708_10000551 3300026075 Bacteria 28958
450 Ga0207708_10005521 3300026075 Bacteria 9333
451 Ga0207708_11361306 3300026075 Archaea 622
452 Ga0207702_10064024 3300026078 Bacteria 3146
453 Ga0207648_10000513 3300026089 Bacteria 43298
454 Ga0207648_10002477 3300026089 Bacteria 19838
455 Ga0207648_10076446 3300026089 Bacteria 2919
456 Ga0207648_10233922 3300026089 Bacteria 1635
457 Ga0207676_10760790 3300026095 Unclassified 943
458 Ga0207674_10810244 3300026116 Unclassified 903
459 Ga0207674_11950776 3300026116 Bacteria 553
460 Ga0207675_100001063 3300026118 Bacteria 27254
461 Ga0207675_100104513 3300026118 Bacteria 2669
462 Ga0207675_100796735 3300026118 Bacteria 958
463 Ga0207675_101912505 3300026118 Unclassified 612
464 Ga0207683_10080122 3300026121 Bacteria 2896
465 Ga0207698_10742700 3300026142 Bacteria 980
466 Ga0209969_1018790 3300027360 Bacteria 1023
467 Ga0209967_1015009 3300027364 Bacteria 1107
468 Ga0209981_1010132 3300027378 Bacteria 1291
469 Ga0210000_1015710 3300027462 Bacteria 1141
470 Ga0209968_1047314 3300027526 Bacteria 742
471 Ga0209970_1003183 3300027614 Bacteria 2774
472 Ga0209588_1027778 3300027671 Bacteria 1801
473 Ga0209971_1003253 3300027682 Bacteria 3870
474 Ga0209966_1002671 3300027695 Bacteria 2984
475 Ga0209998_10009892 3300027717 Unclassified 1977
476 Ga0209813_10243775 3300027866 Bacteria 680
477 Ga0209974_10148155 3300027876 Bacteria 846
478 Ga0207428_10000288 3300027907 Bacteria 67876
479 Ga0207428_10011126 3300027907 Bacteria 7987
480 Ga0207428_10081245 3300027907 Bacteria 2531
481 Ga0207428_10129247 3300027907 Bacteria 1934
482 Ga0207428_10212262 3300027907 Bacteria 1454
483 Ga0207428_10872034 3300027907 Bacteria 637
484 Ga0268265_10009410 3300028380 Bacteria 6598
485 Ga0268265_10043725 3300028380 Bacteria 3331
486 Ga0268265_10409679 3300028380 Bacteria 1256
487 Ga0268265_10714535 3300028380 Unclassified 969
488 Ga0268264_10005879 3300028381 Bacteria 10384
489 Ga0268264_10087084 3300028381 Bacteria 2685
490 Ga0307408_100108002 3300031548 Unclassified 2132
491 Ga0307408_101546949 3300031548 Bacteria 628
492 Ga0307408_102465983 3300031548 Unclassified 505
493 Ga0307408_102508862 3300031548 Unclassified 501
494 Ga0307405_10323688 3300031731 Bacteria 1179
495 Ga0307410_10524901 3300031852 Unclassified 978
496 Ga0307410_11031064 3300031852 Bacteria 711
497 Ga0307410_11889599 3300031852 Unclassified 531
498 Ga0307407_10112275 3300031903 Bacteria 1713
499 Ga0307407_11375041 3300031903 Bacteria 556
500 Ga0307412_10283588 3300031911 Bacteria 1302
501 Ga0307412_11074838 3300031911 Bacteria 715
502 Ga0307409_100094044 3300031995 Bacteria 2465
503 Ga0307416_100218413 3300032002 Bacteria 1826
504 Ga0307416_100480818 3300032002 Unclassified 1302
505 Ga0307416_101129270 3300032002 Bacteria 889
506 Ga0307416_101873284 3300032002 Bacteria 703
507 Ga0307416_102076379 3300032002 Unclassified 670
508 Ga0307416_102708381 3300032002 Bacteria 592
509 Ga0307416_102808169 3300032002 Unclassified 582
510 Ga0307416_103143362 3300032002 Bacteria 552
511 Ga0307416_103284057 3300032002 Bacteria 541
512 Ga0307411_10210161 3300032005 Bacteria 1502
513 Ga0307411_10318321 3300032005 Bacteria 1255
514 Ga0307411_10569643 3300032005 Bacteria 969
515 Ga0307415_101071647 3300032126 Bacteria 753
516 Ga0373930_0054789 3300034816 Bacteria 878
517 Ga0373930_0078431 3300034816 Bacteria 760
518 Ga0373948_0011845 3300034817 Bacteria 1550
519 Ga0373958_0194446 3300034819 Bacteria 528
520 Ga0373959_0026875 3300034820 Bacteria 1140
521 Ga0373938_0238554 3300034957 Unclassified 516
522 Ga0373926_0002148 3300035083 Bacteria 6207
523 Ga0373928_0005303 3300035084 Unclassified 2461
524 Ga0373928_0010322 3300035084 Bacteria 1834
525 Ga0373928_0072121 3300035084 Bacteria 856
526 Ga0373934_0100950 3300035086 Unclassified 1167
527 Ga0373940_0002387 3300035088 Bacteria 3642
528 Ga0373940_0065041 3300035088 Bacteria 1051
529 Ga0373940_0087889 3300035088 Bacteria 927
530 Ga0373944_0005437 3300035089 Bacteria 3354
531 Ga0373949_0127897 3300035090 Bacteria 719
532 Ga0373951_0026089 3300035091 Bacteria 1360
533 Ga0373951_0048705 3300035091 Bacteria 1038
534 Ga0373951_0208294 3300035091 Bacteria 572
535 Ga0373952_0004949 3300035092 Bacteria 2424
536 Ga0373952_0261350 3300035092 Bacteria 527
537 Ga0373923_0062044 3300035111 Bacteria 1590
538 Ga0373932_0002691 3300035112 Bacteria 4422
539 Ga0373932_0024935 3300035112 Bacteria 1614
540 Ga0373932_0051987 3300035112 Bacteria 1219
541 Ga0373932_0076916 3300035112 Bacteria 1047
542 Ga0373932_0224809 3300035112 Unclassified 676
543 Ga0373932_0254490 3300035112 Bacteria 642
544 Ga0373932_0340476 3300035112 Unclassified 568
545 Ga0373936_0040361 3300035113 Bacteria 1869
546 Ga0373939_0007089 3300035114 Bacteria 2714
547 Ga0373939_0044303 3300035114 Bacteria 1354
548 Ga0373939_0052296 3300035114 Bacteria 1273
549 Ga0373939_0068016 3300035114 Unclassified 1152
550 Ga0373939_0076110 3300035114 Bacteria 1104
551 Ga0373939_0110226 3300035114 Bacteria 957
552 Ga0373941_0005268 3300035115 Bacteria 3033
553 Ga0373941_0017198 3300035115 Bacteria 1977
554 Ga0373941_0019880 3300035115 Bacteria 1876
555 Ga0373941_0143279 3300035115 Bacteria 871
556 Ga0373941_0376150 3300035115 Bacteria 583
557 Ga0373945_0048244 3300035116 Bacteria 1559
558 Ga0373954_0000030 3300035118 Bacteria 55716
559 Ga0373954_0259205 3300035118 Bacteria 856
560 Ga0373957_0056107 3300035120 Bacteria 1516
561 Ga0373960_0022032 3300035121 Bacteria 1701
562 Ga0373960_0028430 3300035121 Bacteria 1543
563 Ga0373960_0037436 3300035121 Bacteria 1386
564 Ga0373943_0068348 3300035170 Bacteria 1793
565 Ga0373946_0047609 3300035171 Bacteria 1781
566 Ga0373955_0084477 3300035172 Bacteria 1800
567 Ga0373955_0353705 3300035172 Unclassified 890
568 Ga0373942_0019869 3300035207 Bacteria 1681
569 Ga0373942_0058599 3300035207 Unclassified 1098
570 Ga0373942_0063190 3300035207 Bacteria 1065
571 Ga0373942_0131809 3300035207 Bacteria 789
572 Ga0373961_0021631 3300035241 Unclassified 1713
573 Ga0373961_0038197 3300035241 Bacteria 1375
574 Ga0373961_0073549 3300035241 Bacteria 1061
575 Ga0373961_0105621 3300035241 Bacteria 917
576 Ga0373961_0448189 3300035241 Bacteria 503
577 Ga0373962_0008702 3300035242 Bacteria 2504
578 Ga0373962_0012184 3300035242 Bacteria 2164
579 Ga0373962_0013605 3300035242 Bacteria 2064
580 Ga0373962_0100443 3300035242 Bacteria 902
581 Ga0373962_0171366 3300035242 Bacteria 721
582 Ga0373962_0357490 3300035242 Unclassified 529
583 Ga0373924_0016098 3300035410 Bacteria 2852
584 Ga0373931_0001918 3300035691 Bacteria 9111
585 Ga0373931_0002342 3300035691 Bacteria 8366
586 Ga0373931_0006328 3300035691 Bacteria 5524
587 Ga0373931_0010421 3300035691 Bacteria 4467
588 Ga0373931_0025771 3300035691 Bacteria 2987
589 Ga0373931_0029473 3300035691 Bacteria 2818
590 Ga0373931_0033364 3300035691 Bacteria 2668
591 Ga0373931_0073169 3300035691 Bacteria 1875
592 Ga0373931_0213618 3300035691 Bacteria 1158
593 Ga0373931_0250445 3300035691 Unclassified 1077
594 Ga0373931_1260027 3300035691 Bacteria 508
595 Ga0373935_0125433 3300035692 Bacteria 1719
596 Ga0373927_0008733 3300035695 Bacteria 6806
597 Ga0373927_1012096 3300035695 Bacteria 548
598 Ga0373933_0022210 3300035724 Bacteria 3611
599 Ga0373947_0048561 3300035725 Bacteria 2546
600 Ga0373937_0025516 3300036401 Bacteria 5335
601 Ga0373937_0604372 3300036401 Bacteria 1041
602 Ga0373937_0622877 3300036401 Bacteria 1024
603 Ga0373925_0012851 3300037068 Bacteria 6065
604 Ga0395900_0003092 3300037418 Bacteria 18074
605 Ga0395898_0011090 3300037466 Bacteria 9384
606 Ga0395905_0252699 3300037471 Bacteria 1647
607 Ga0436364_1195800 3300037853 Bacteria 2751
608 Ga0395901_0001902 3300038443 Bacteria 21558
609 Ga0436365_1664112 3300039437 Bacteria 1359
610 Ga0436365_1801159 3300039437 Bacteria 2440
611 Ga0451807_2725195 3300041486 Bacteria 2599
612 Ga0451839_0304386 3300041496 Bacteria 757
613 Ga0439441_087449 3300042001 Unclassified 685
614 Ga0439441_185385 3300042001 Bacteria 502
615 Ga0439456_117078 3300042013 Unclassified 609
616 Ga0439435_0001468 3300042436 Bacteria 4378
617 Ga0439460_0002117 3300042461 Bacteria 4757
618 Ga0439460_0132936 3300042461 Bacteria 821
619 Ga0439460_0175014 3300042461 Bacteria 724
620 Ga0451577_0034679 3300042876 Bacteria 4547
621 Ga0451577_0063848 3300042876 Bacteria 3284
622 Ga0451577_0402867 3300042876 Unclassified 1242
623 Ga0451577_0463491 3300042876 Bacteria 1151
624 Ga0451577_0548330 3300042876 Bacteria 1050
625 Ga0451577_0849017 3300042876 Bacteria 824
626 Ga0439440_0147678 3300042993 Bacteria 671
627 Ga0466972_0418143 3300044658 Bacteria 629
628 Ga0453683_0191599 3300044673 Bacteria 1297
629 Ga0466965_0060429 3300044683 Bacteria 1893
630 Ga0466960_0450872 3300044901 Bacteria 748
631 Ga0451576_0018030 3300045051 Bacteria 7745
632 Ga0451576_0020308 3300045051 Bacteria 7235
633 Ga0451576_0023304 3300045051 Bacteria 6703
634 Ga0451576_0286661 3300045051 Bacteria 1721
635 Ga0451576_0424788 3300045051 Unclassified 1394
636 Ga0451576_0498059 3300045051 Bacteria 1280
637 Ga0451576_1243971 3300045051 Bacteria 777
638 Ga0466967_1536089 3300045976 Bacteria 663
639 Ga0495592_0001475 3300046454 Bacteria 16364
640 Ga0495603_0036255 3300046455 Bacteria 2961
641 Ga0495629_0892549 3300046459 Unclassified 583
642 Ga0495653_0012697 3300046463 Bacteria 6881
643 Ga0495580_0002475 3300046472 Bacteria 16114
644 Ga0495580_0190977 3300046472 Bacteria 1412
645 Ga0495582_0036167 3300046473 Bacteria 2716
646 Ga0495582_0129869 3300046473 Bacteria 1423
647 Ga0495639_0331543 3300046475 Bacteria 762
648 Ga0495662_0005331 3300046476 Bacteria 6441
649 Ga0495662_0038196 3300046476 Bacteria 2320
650 Ga0495584_0137983 3300046491 Bacteria 1238
651 Ga0495608_0014819 3300046511 Bacteria 5408
652 Ga0495608_0611753 3300046511 Unclassified 653
653 Ga0495618_0097543 3300046514 Bacteria 1880
654 Ga0495628_0091825 3300046516 Bacteria 2349
655 Ga0495630_0016927 3300046517 Bacteria 5334
656 Ga0495630_0066008 3300046517 Bacteria 2720
657 Ga0495630_0141363 3300046517 Bacteria 1830
658 Ga0495630_1115995 3300046517 Unclassified 598
659 Ga0495666_0013108 3300046526 Bacteria 4130
660 Ga0495666_0023766 3300046526 Bacteria 3031
661 Ga0495642_0017372 3300046528 Bacteria 2811
662 Ga0495642_0024669 3300046528 Bacteria 2380
663 Ga0495642_0102755 3300046528 Bacteria 1217
664 Ga0495652_0264328 3300046529 Bacteria 1268
665 Ga0495652_0797629 3300046529 Unclassified 629
666 Ga0495665_0062602 3300046531 Bacteria 1964
667 Ga0495665_0348724 3300046531 Unclassified 754
668 Ga0495640_0005456 3300046533 Bacteria 10118
669 Ga0495640_0030921 3300046533 Bacteria 3828
670 Ga0495586_0002272 3300046535 Bacteria 10454
671 Ga0495586_0009170 3300046535 Bacteria 5265
672 Ga0495587_0020738 3300046536 Bacteria 4054
673 Ga0495587_0238668 3300046536 Bacteria 1023
674 Ga0495598_0219483 3300046537 Bacteria 693
675 Ga0495621_0164081 3300046539 Bacteria 880
676 Ga0495621_0202782 3300046539 Bacteria 798
677 Ga0495621_0318220 3300046539 Bacteria 648
678 Ga0495645_0196269 3300046543 Bacteria 1372
679 Ga0495667_0002694 3300046559 Bacteria 11880
680 Ga0495667_0302105 3300046559 Bacteria 1014
681 Ga0495656_0026757 3300046615 Bacteria 2299
682 Ga0495656_0118188 3300046615 Bacteria 1248
683 Ga0495656_0326102 3300046615 Bacteria 792
684 Ga0495634_0003551 3300046642 Bacteria 12479
685 Ga0495635_0109075 3300046663 Bacteria 1891
686 Ga0495659_0059792 3300046664 Bacteria 1405
687 Ga0495659_0061294 3300046664 Bacteria 1390
688 Ga0495659_0095715 3300046664 Bacteria 1145
689 Ga0495661_0390800 3300046665 Bacteria 678
690 Ga0495588_0171347 3300046674 Bacteria 1147
691 Ga0495599_0002703 3300046678 Bacteria 10357
692 Ga0495599_0098574 3300046678 Bacteria 1822
693 Ga0495646_0601941 3300046680 Unclassified 558
694 Ga0495647_0001740 3300046681 Bacteria 6749
695 Ga0495647_0154543 3300046681 Bacteria 985
696 Ga0495647_0245078 3300046681 Bacteria 796
697 Ga0495658_0013614 3300046683 Bacteria 4143
698 Ga0495658_0024614 3300046683 Bacteria 3208
699 Ga0495669_0016289 3300046684 Bacteria 3182
700 Ga0495669_0050743 3300046684 Bacteria 1861
701 Ga0495669_0307721 3300046684 Bacteria 764
702 Ga0495669_0531461 3300046684 Bacteria 572
703 Ga0495613_0003446 3300046689 Bacteria 11822
704 Ga0495624_0194193 3300046690 Bacteria 1234
705 Ga0495600_0077653 3300046809 Bacteria 2168
706 Ga0495600_0136839 3300046809 Bacteria 1591
707 Ga0495581_0131514 3300047315 Bacteria 1458
708 Ga0495604_0002697 3300047317 Bacteria 14233
709 Ga0495604_0538134 3300047317 Unclassified 754
710 Ga0495636_0038176 3300047318 Bacteria 1986
711 Ga0495636_0054880 3300047318 Bacteria 1675
712 Ga0495636_0522371 3300047318 Unclassified 575
713 Ga0495636_0651902 3300047318 Unclassified 517
714 Ga0495674_0526202 3300047319 Bacteria 943
715 Ga0495674_0860094 3300047319 Unclassified 702
716 Ga0495680_0004055 3300047322 Bacteria 14117
717 Ga0495680_0696338 3300047322 Unclassified 671
718 Ga0495675_0215029 3300047444 Bacteria 1165
719 Ga0495677_0158614 3300047445 Bacteria 873
720 Ga0495684_0114616 3300047471 Bacteria 2032
721 Ga0495684_0369720 3300047471 Unclassified 1014
722 Ga0496100_0119819 3300048903 Bacteria 1839
723 Ga0496101_0173194 3300048904 Bacteria 1659
724 Ga0496102_0677997 3300048905 Bacteria 954
725 Ga0496103_0092576 3300048906 Bacteria 1908
726 Ga0496104_0047284 3300048907 Bacteria 4055
727 Ga0496105_0160233 3300048908 Bacteria 1847
728 Ga0496106_0023172 3300048909 Bacteria 4612
729 Ga0496107_0013207 3300048910 Bacteria 5771
730 Ga0496109_0003297 3300048912 Bacteria 13474
731 Ga0496110_0016127 3300048913 Bacteria 6231
732 Ga0496111_0384820 3300048914 Bacteria 1037
733 Ga0496112_0048142 3300048915 Bacteria 4180
734 Ga0496113_1003104 3300048916 Bacteria 657
735 Ga0496115_0198577 3300048918 Bacteria 1657
736 Ga0501299_101000 3300049522 Bacteria 670
737 Ga0501299_119268 3300049522 Bacteria 634
738 Ga0501031_0042679 3300049568 Bacteria 2960
739 Ga0501032_0862865 3300049569 Bacteria 571
740 Ga0501033_0006002 3300049570 Bacteria 9528
741 Ga0501033_0066352 3300049570 Bacteria 2654
742 Ga0501034_0199915 3300049571 Bacteria 1957
743 Ga0501036_0002811 3300049572 Bacteria 13791
744 Ga0501036_0186397 3300049572 Bacteria 1746
745 Ga0501036_0373424 3300049572 Bacteria 1190
746 Ga0501036_0555224 3300049572 Bacteria 954
747 Ga0501036_1027854 3300049572 Bacteria 674
748 Ga0501036_1029896 3300049572 Bacteria 673
749 Ga0501036_1244350 3300049572 Bacteria 606
750 Ga0501037_0016719 3300049573 Bacteria 5398
751 Ga0501037_0536499 3300049573 Bacteria 791
752 Ga0501037_0601433 3300049573 Unclassified 738
753 Ga0501037_1120708 3300049573 Bacteria 509
754 Ga0501038_0008069 3300049574 Bacteria 9687
755 Ga0501038_0090474 3300049574 Bacteria 2565
756 Ga0501038_0337775 3300049574 Bacteria 1175
757 Ga0501039_0014392 3300049575 Bacteria 6058
758 Ga0501039_0040879 3300049575 Bacteria 3579
759 Ga0501039_0044419 3300049575 Bacteria 3432
760 Ga0501039_0050433 3300049575 Bacteria 3220
761 Ga0501039_0137551 3300049575 Bacteria 1918
762 Ga0501039_0257536 3300049575 Unclassified 1372
763 Ga0501039_0361291 3300049575 Bacteria 1141
764 Ga0501039_1329603 3300049575 Unclassified 554
765 Ga0501040_0000376 3300049576 Bacteria 26256
766 Ga0501040_0020631 3300049576 Bacteria 4393
767 Ga0501040_0021173 3300049576 Bacteria 4338
768 Ga0501040_0055396 3300049576 Bacteria 2719
769 Ga0501040_0118826 3300049576 Bacteria 1854
770 Ga0501040_0967783 3300049576 Bacteria 617
771 Ga0501041_0000609 3300049577 Bacteria 18677
772 Ga0501041_0044711 3300049577 Bacteria 2691
773 Ga0501041_0230173 3300049577 Bacteria 1164
774 Ga0501041_0233771 3300049577 Bacteria 1154
775 Ga0501041_0253432 3300049577 Bacteria 1106
776 Ga0501041_0259263 3300049577 Bacteria 1093
777 Ga0501041_0534239 3300049577 Unclassified 747
778 Ga0501042_0000217 3300049578 Bacteria 27323
779 Ga0501042_0029750 3300049578 Bacteria 3853
780 Ga0501042_0298264 3300049578 Bacteria 1164
781 Ga0501042_0728428 3300049578 Bacteria 721
782 Ga0501042_0879999 3300049578 Bacteria 652
783 Ga0501042_1233331 3300049578 Bacteria 545
784 Ga0501043_0343407 3300049579 Unclassified 1135
785 Ga0501043_0746534 3300049579 Bacteria 712
786 Ga0501046_0003851 3300049580 Bacteria 13731
787 Ga0501046_0036615 3300049580 Bacteria 3948
788 Ga0501046_1113013 3300049580 Unclassified 545
789 Ga0501046_1223563 3300049580 Bacteria 515
790 Ga0501048_0001002 3300049582 Bacteria 21063
791 Ga0501048_0193203 3300049582 Bacteria 1442
792 Ga0501048_0217621 3300049582 Bacteria 1354
793 Ga0501048_0635887 3300049582 Bacteria 766
794 Ga0501048_0981891 3300049582 Bacteria 607
795 Ga0501048_1149143 3300049582 Bacteria 558
796 Ga0501067_0059070 3300049583 Bacteria 2123
797 Ga0501067_0120572 3300049583 Bacteria 1459
798 Ga0501067_0427476 3300049583 Unclassified 739
799 Ga0501068_0072013 3300049584 Bacteria 2110
800 Ga0501068_0414487 3300049584 Bacteria 869
801 Ga0501068_0677900 3300049584 Bacteria 674
802 Ga0501068_0816443 3300049584 Bacteria 612
803 Ga0501068_0908294 3300049584 Bacteria 579
804 Ga0501068_1208693 3300049584 Unclassified 501
805 Ga0501069_0184637 3300049585 Bacteria 1206
806 Ga0501070_0115292 3300049586 Bacteria 2219
807 Ga0501071_0011096 3300049587 Bacteria 6056
808 Ga0501071_0073797 3300049587 Bacteria 2489
809 Ga0501071_0078746 3300049587 Bacteria 2409
810 Ga0501071_0217319 3300049587 Bacteria 1438
811 Ga0501071_0432788 3300049587 Bacteria 1006
812 Ga0501071_0638314 3300049587 Bacteria 819
813 Ga0501072_0008373 3300049588 Bacteria 7852
814 Ga0501072_0023786 3300049588 Bacteria 4759
815 Ga0501072_0062249 3300049588 Bacteria 2944
816 Ga0501072_0108474 3300049588 Bacteria 2209
817 Ga0501072_0350928 3300049588 Bacteria 1171
818 Ga0501072_1101838 3300049588 Bacteria 618
819 Ga0501072_1105660 3300049588 Bacteria 617
820 Ga0501072_1240763 3300049588 Unclassified 578
821 Ga0501073_0327130 3300049589 Bacteria 1058
822 Ga0501073_0844070 3300049589 Bacteria 631
823 Ga0501074_0054650 3300049590 Bacteria 2879
824 Ga0501074_0280235 3300049590 Bacteria 1185
825 Ga0501074_1300868 3300049590 Unclassified 509
826 Ga0501075_0004474 3300049591 Bacteria 9463
827 Ga0501075_0015921 3300049591 Bacteria 5408
828 Ga0501075_0035366 3300049591 Bacteria 3725
829 Ga0501075_0053786 3300049591 Bacteria 3028
830 Ga0501075_0064978 3300049591 Bacteria 2752
831 Ga0501075_0082723 3300049591 Bacteria 2431
832 Ga0501075_0599301 3300049591 Bacteria 840
833 Ga0501075_0604425 3300049591 Bacteria 836
834 Ga0501076_0000526 3300049592 Bacteria 24329
835 Ga0501076_0000778 3300049592 Bacteria 20562
836 Ga0501076_0010510 3300049592 Bacteria 6869
837 Ga0501076_0011445 3300049592 Bacteria 6609
838 Ga0501076_0142561 3300049592 Bacteria 1947
839 Ga0501076_0163537 3300049592 Bacteria 1814
840 Ga0501076_0612339 3300049592 Bacteria 898
841 Ga0501076_1366318 3300049592 Bacteria 582
842 Ga0501077_0001082 3300049593 Bacteria 16418
843 Ga0501077_0026200 3300049593 Bacteria 3700
844 Ga0501077_0441809 3300049593 Bacteria 833
845 Ga0501199_024935 3300049650 Bacteria 712
846 Ga0501209_262894 3300049656 Bacteria 540
847 Ga0501079_0000010 3300049741 Bacteria 73916
848 Ga0501079_0017301 3300049741 Bacteria 5505
849 Ga0501079_0023005 3300049741 Bacteria 4786
850 Ga0501079_0053522 3300049741 Bacteria 3114
851 Ga0501079_0098297 3300049741 Bacteria 2269
852 Ga0501079_0176662 3300049741 Bacteria 1665
853 Ga0501079_0351802 3300049741 Unclassified 1154
854 Ga0501079_0363463 3300049741 Bacteria 1134
855 Ga0501079_0429811 3300049741 Bacteria 1037
856 Ga0501079_0474012 3300049741 Bacteria 983
857 Ga0501080_0026635 3300049742 Bacteria 5372
858 Ga0501080_0397483 3300049742 Bacteria 1240
859 Ga0501080_0507160 3300049742 Bacteria 1078
860 Ga0501080_0669886 3300049742 Bacteria 917
861 Ga0501080_0750522 3300049742 Bacteria 858
862 Ga0501081_0000811 3300049743 Bacteria 18451
863 Ga0501081_0001107 3300049743 Bacteria 16185
864 Ga0501081_0007636 3300049743 Bacteria 7015
865 Ga0501081_0038926 3300049743 Bacteria 3252
866 Ga0501081_0119593 3300049743 Bacteria 1875
867 Ga0501081_1501706 3300049743 Bacteria 512
868 Ga0501035_0041997 3300049822 Bacteria 4126
869 Ga0501035_0116958 3300049822 Bacteria 2333
870 Ga0501035_0246262 3300049822 Bacteria 1519
871 Ga0501035_0620111 3300049822 Bacteria 880
872 Ga0501044_0059444 3300049823 Bacteria 3916
873 Ga0501045_0000946 3300049824 Bacteria 18981
874 Ga0501045_0130617 3300049824 Bacteria 1867
875 Ga0501045_0579165 3300049824 Bacteria 832
876 Ga0501045_1082688 3300049824 Bacteria 586
877 nmdc:mga04h51_275502_c1 3300050495 Bacteria 680
878 nmdc:mga05p37_1169323_c1 3300050507 Bacteria 798
879 nmdc:mga05p37_129800_c1 3300050507 Bacteria 3093
880 nmdc:mga05p37_1935_c1 3300050507 Bacteria 24113
881 nmdc:mga05p37_24531_c1 3300050507 Bacteria 7331
882 nmdc:mga05p37_24611_c1 3300050507 Bacteria 7319
883 nmdc:mga05p37_290444_c1 3300050507 Bacteria 1946
884 nmdc:mga05p37_29685_c1 3300050507 Bacteria 6672
885 nmdc:mga05p37_31849_c1 3300050507 Bacteria 6445
886 nmdc:mga05p37_391130_c1 3300050507 Bacteria 1626
887 nmdc:mga05p37_413587_c1 3300050507 Bacteria 1571
888 nmdc:mga05p37_432823_c1 3300050507 Bacteria 1528
889 nmdc:mga05p37_437652_c1 3300050507 Bacteria 1517
890 nmdc:mga05p37_54085_c1 3300050507 Bacteria 4939
891 nmdc:mga05p37_66268_c1 3300050507 Bacteria 4442
892 nmdc:mga05p37_92690_c1 3300050507 Bacteria 3722
893 nmdc:mga05p37_98208_c1 3300050507 Bacteria 3607
894 nmdc:mga09592_1304195_c1 3300050508 Bacteria 597
895 nmdc:mga09592_1441079_c1 3300050508 Unclassified 562
896 nmdc:mga09592_15247_c1 3300050508 Bacteria 6279
897 nmdc:mga09592_15522_c1 3300050508 Bacteria 6226
898 nmdc:mga09592_1903_c1 3300050508 Bacteria 16783
899 nmdc:mga09592_258426_c1 3300050508 Bacteria 1510
900 nmdc:mga09592_28339_c1 3300050508 Bacteria 4652
901 nmdc:mga09592_378224_c1 3300050508 Bacteria 1225
902 nmdc:mga09592_400650_c1 3300050508 Bacteria 1186
903 nmdc:mga09592_50783_c1 3300050508 Bacteria 3498
904 nmdc:mga09592_622737_c1 3300050508 Bacteria 923
905 nmdc:mga09592_996446_c1 3300050508 Bacteria 700
906 nmdc:mga0qj67_129_c1 3300050509 Bacteria 50064
907 nmdc:mga0qj67_1355991_c1 3300050509 Bacteria 550
908 nmdc:mga0qj67_263467_c1 3300050509 Bacteria 1398
909 nmdc:mga0qj67_345846_c1 3300050509 Bacteria 1202
910 nmdc:mga0qj67_523130_c1 3300050509 Bacteria 953
911 nmdc:mga0qj67_63996_c1 3300050509 Bacteria 2925
912 nmdc:mga0qj67_733_c1 3300050509 Bacteria 22325
913 nmdc:mga0qj67_831191_c1 3300050509 Bacteria 730
914 nmdc:mga0qj67_885_c1 3300050509 Bacteria 20530
915 nmdc:mga06r32_10855_c1 3300050510 Bacteria 8202
916 nmdc:mga06r32_118889_c1 3300050510 Bacteria 2606
917 nmdc:mga06r32_1205052_c1 3300050510 Bacteria 703
918 nmdc:mga06r32_1301599_c1 3300050510 Bacteria 671
919 nmdc:mga06r32_1580981_c1 3300050510 Bacteria 595
920 nmdc:mga06r32_172098_c1 3300050510 Bacteria 2149
921 nmdc:mga06r32_182123_c1 3300050510 Bacteria 2087
922 nmdc:mga06r32_299792_c1 3300050510 Bacteria 1593
923 nmdc:mga06r32_485259_c1 3300050510 Bacteria 1214
924 nmdc:mga06r32_572428_c1 3300050510 Bacteria 1102
925 nmdc:mga06r32_57445_c1 3300050510 Bacteria 3738
926 nmdc:mga06r32_62963_c1 3300050510 Bacteria 3574
927 nmdc:mga06r32_82372_c1 3300050510 Bacteria 3134
928 nmdc:mga06r32_825828_c1 3300050510 Unclassified 886
929 nmdc:mga08y16_10187_c1 3300050511 Bacteria 9872
930 nmdc:mga08y16_112369_c1 3300050511 Bacteria 2836
931 nmdc:mga08y16_1325940_c1 3300050511 Bacteria 685
932 nmdc:mga08y16_152687_c1 3300050511 Bacteria 2400
933 nmdc:mga08y16_181142_c1 3300050511 Bacteria 2188
934 nmdc:mga08y16_2033_c1 3300050511 Bacteria 20720
935 nmdc:mga08y16_2044345_c1 3300050511 Unclassified 521
936 nmdc:mga08y16_2110138_c1 3300050511 Unclassified 511
937 nmdc:mga08y16_254680_c1 3300050511 Bacteria 1814
938 nmdc:mga08y16_279555_c1 3300050511 Bacteria 1722
939 nmdc:mga08y16_299184_c1 3300050511 Bacteria 1659
940 nmdc:mga08y16_39632_c1 3300050511 Bacteria 4942
941 nmdc:mga08y16_397400_c1 3300050511 Bacteria 1411
942 nmdc:mga08y16_44681_c2 3300050511 Bacteria 1895
943 nmdc:mga08y16_894136_c1 3300050511 Unclassified 875
944 nmdc:mga0n895_13013_c1 3300050512 Bacteria 7485
945 nmdc:mga0n895_1586586_c1 3300050512 Bacteria 619
946 nmdc:mga0n895_207855_c1 3300050512 Bacteria 1988
947 nmdc:mga0n895_244277_c1 3300050512 Bacteria 1822
948 nmdc:mga0n895_363814_c1 3300050512 Bacteria 1465
949 nmdc:mga0n895_515275_c1 3300050512 Bacteria 1204
950 nmdc:mga0n895_63738_c1 3300050512 Bacteria 3645
951 nmdc:mga0n895_67283_c1 3300050512 Bacteria 3548
952 nmdc:mga0n895_831915_c1 3300050512 Bacteria 912
953 nmdc:mga0n895_911213_c1 3300050512 Bacteria 864
954 nmdc:mga0n895_914440_c1 3300050512 Bacteria 862
955 nmdc:mga0rr50_1053066_c1 3300050513 Unclassified 692
956 nmdc:mga0rr50_32319_c1 3300050513 Bacteria 3728
957 nmdc:mga0rr50_3348_c1 3300050513 Bacteria 9209
958 nmdc:mga0rr50_35454_c1 3300050513 Bacteria 3583
959 nmdc:mga0rr50_367426_c1 3300050513 Bacteria 1212
960 nmdc:mga0rr50_373569_c1 3300050513 Bacteria 1201
961 nmdc:mga0rr50_532655_c1 3300050513 Bacteria 1000
962 nmdc:mga0rr50_659677_c1 3300050513 Bacteria 893
963 nmdc:mga0rr50_78197_c1 3300050513 Bacteria 2545
964 nmdc:mga08x19_4462_c1 3300050514 Bacteria 8292
965 nmdc:mga08x19_988589_c1 3300050514 Unclassified 598
966 nmdc:mga0a205_14700_c1 3300050515 Bacteria 7303
967 nmdc:mga0a205_155193_c1 3300050515 Bacteria 2188
968 nmdc:mga0a205_182067_c1 3300050515 Bacteria 1995
969 nmdc:mga0a205_328091_c1 3300050515 Bacteria 1400
970 nmdc:mga0a205_3699_c1 3300050515 Bacteria 13683
971 nmdc:mga0a205_48854_c1 3300050515 Bacteria 4083
972 nmdc:mga0a205_49050_c1 3300050515 Bacteria 4074
973 nmdc:mga0a205_67799_c1 3300050515 Bacteria 3446
974 Ga0495601_0057527 3300053077 Unclassified 2463
975 Ga0495601_0269669 3300053077 Bacteria 1110
976 Ga0495601_0315265 3300053077 Unclassified 1018
977 Ga0495595_0353378 3300053084 Bacteria 742
978 Ga0495619_0162293 3300053085 Bacteria 1544
979 Ga0500643_002271 3300053087 Bacteria 10082
980 Ga0500651_0031020 3300053093 Bacteria 3365
981 Ga0500651_0088309 3300053093 Bacteria 1912
982 Ga0500566_0034058 3300053094 Bacteria 2965
983 Ga0500595_000003 3300053119 Bacteria 419332
984 Ga0500642_0412553 3300053130 Bacteria 587
985 Ga0500652_005161 3300053131 Bacteria 4091
986 Ga0500577_0185485 3300053142 Bacteria 894
987 Ga0500616_0000002 3300053153 Bacteria 1611257
988 Ga0500645_000226 3300053730 Bacteria 42982
989 Ga0500645_201682 3300053730 Bacteria 536
990 Ga0501084_0001073 3300054114 Bacteria 21259
991 Ga0501084_0084857 3300054114 Bacteria 2659
992 Ga0501084_0214935 3300054114 Bacteria 1622
993 Ga0501084_0413873 3300054114 Bacteria 1139
994 Ga0501084_0427176 3300054114 Bacteria 1120
995 Ga0501084_0841933 3300054114 Bacteria 772
996 Ga0501084_0989198 3300054114 Unclassified 707
997 Ga0501082_0000809 3300060353 Bacteria 27479
998 Ga0501082_0002254 3300060353 Bacteria 16885
999 Ga0501082_0016215 3300060353 Bacteria 6414
1000 Ga0501082_0059202 3300060353 Bacteria 3301
1001 Ga0501082_0633352 3300060353 Bacteria 936
1002 Ga0501082_1007055 3300060353 Bacteria 728
1003 Ga0501082_1659796 3300060353 Bacteria 558
1004 Ga0530510_0003125 3300061734 Bacteria 11362
1005 Ga0530510_0028935 3300061734 Bacteria 3974
1006 Ga0530510_0046048 3300061734 Bacteria 3151
1007 Ga0530510_0150947 3300061734 Bacteria 1716
1008 Ga0530510_0409306 3300061734 Bacteria 1023
1009 Ga0530510_0429679 3300061734 Bacteria 997
1010 Ga0530510_0874054 3300061734 Bacteria 687
1011 Ga0530510_1223782 3300061734 Unclassified 576
1012 8055226841 8055225921 Bacteria 3341787
1013 Ga0065707_10682833
1014 JGI24750J21931_1012062
1015 JGI25406J46586_10112665
1016 Ga0058859_10482534
1017 Ga0065707_10002472
1018 Ga0065707_10008939
1019 Ga0065707_10032199
1020 Ga0065707_10142379
1021 Ga0065707_10421713
1022 Ga0065707_10742311
1023 Ga0065707_10843318
1024 Ga0065707_10863893
1025 Ga0070676_10267672
1026 Ga0070676_10289081
1027 Ga0070676_10302924
1028 Ga0070683_100164724
1029 Ga0070690_100000131
1030 Ga0070690_100009883
1031 Ga0070690_100123222
1032 Ga0070690_101040930
1033 Ga0068869_100000392
1034 Ga0068869_100032305
1035 Ga0068869_101253262
1036 Ga0070666_10295857
1037 Ga0070680_100052279
1038 Ga0070680_100055201
1039 Ga0070680_100130316
1040 Ga0070680_100168751
1041 Ga0070680_100644785
1042 Ga0070680_100903533
1043 Ga0070680_101717628
1044 Ga0070682_100024737
1045 Ga0068868_100000656
1046 Ga0068868_101081600
1047 Ga0070689_100006489
1048 Ga0070689_100098199
1049 Ga0070689_100441349
1050 Ga0070689_100614528
1051 Ga0070691_10000200
1052 Ga0070691_10034787
1053 Ga0070691_10094607
1054 Ga0070687_100000175
1055 Ga0070687_100127683
1056 Ga0070687_100318442
1057 Ga0070692_10001132
1058 Ga0070692_10018032
1059 Ga0070692_11059412
1060 Ga0070668_100055705
1061 Ga0070668_100226763
1062 Ga0070668_101331689
1063 Ga0070669_100190392
1064 Ga0070669_101272375
1065 Ga0070669_101835745
1066 Ga0070675_100050024
1067 Ga0070675_100076173
1068 Ga0070671_101381184
1069 Ga0070674_100069371
1070 Ga0070674_100688142
1071 Ga0070673_100078130
1072 Ga0070688_100216458
1073 Ga0070688_100702707
1074 Ga0070688_100734921
1075 Ga0070688_101069554
1076 Ga0070703_10140112
1077 Ga0070709_10978484
1078 Ga0070710_10193938
1079 Ga0070701_10000676
1080 Ga0070701_10181614
1081 Ga0070701_10337596
1082 Ga0070701_10356053
1083 Ga0070701_10667612
1084 Ga0070711_100267315
1085 Ga0070711_100562676
1086 Ga0070705_100003918
1087 Ga0070705_100144122
1088 Ga0070705_100250177
1089 Ga0070705_100719174
1090 Ga0070705_100849852
1091 Ga0070705_101056823
1092 Ga0070700_100000587
1093 Ga0070700_100044406
1094 Ga0070700_100530306
1095 Ga0070700_101148093
1096 Ga0070700_101215337
1097 Ga0070694_100000136
1098 Ga0070694_100367479
1099 Ga0070694_100474031
1100 Ga0070694_100680372
1101 Ga0070694_100740679
1102 Ga0070694_100842465
1103 Ga0070694_100890541
1104 Ga0070694_101103691
1105 Ga0070708_100045853
1106 Ga0070708_100493268
1107 Ga0070708_100503739
1108 Ga0070663_100431865
1109 Ga0070678_100988831
1110 Ga0070662_100832722
1111 Ga0070662_101650347
1112 Ga0070681_10007592
1113 Ga0068867_100001154
1114 Ga0068867_100002412
1115 Ga0068867_100251805
1116 Ga0068867_100559475
1117 Ga0068867_100837729
1118 Ga0070706_100078100
1119 Ga0070706_100119580
1120 Ga0070707_100047466
1121 Ga0070707_100753661
1122 Ga0070707_100808756
1123 Ga0070698_100009043
1124 Ga0070698_100013803
1125 Ga0070698_100094448
1126 Ga0070698_100402494
1127 Ga0070699_100305144
1128 Ga0070699_100343313
1129 Ga0070699_100352759
1130 Ga0070699_100438873
1131 Ga0070679_100110038
1132 Ga0070684_100080859
1133 Ga0070697_100028284
1134 Ga0070697_100038912
1135 Ga0070697_100183529
1136 Ga0070672_100571404
1137 Ga0070686_100000285
1138 Ga0070686_100034464
1139 Ga0070686_100382979
1140 Ga0070686_100729425
1141 Ga0070686_101062558
1142 Ga0070686_101738496
1143 Ga0070695_100000705
1144 Ga0070695_100494244
1145 Ga0070695_100576905
1146 Ga0070695_101335010
1147 Ga0070696_100002015
1148 Ga0070696_100015035
1149 Ga0070696_100025633
1150 Ga0070696_100173263
1151 Ga0070696_100276734
1152 Ga0070696_100981981
1153 Ga0070693_100000278
1154 Ga0070693_100480465
1155 Ga0070693_100931771
1156 Ga0070704_100000103
1157 Ga0070704_100001347
1158 Ga0070704_100102412
1159 Ga0070704_100213775
1160 Ga0070704_100488248
1161 Ga0070704_101264158
1162 Ga0070704_101907159
1163 Ga0068857_100410209
1164 Ga0068854_100001266
1165 Ga0068856_100025824
1166 Ga0070702_100000039
1167 Ga0070702_100011795
1168 Ga0070702_100263693
1169 Ga0068852_101909030
1170 Ga0068859_100000420
1171 Ga0068859_100181226
1172 Ga0068859_100332394
1173 Ga0068859_100509781
1174 Ga0068859_100894356
1175 Ga0068866_10001352
1176 Ga0068861_100000399
1177 Ga0068861_100121308
1178 Ga0068861_100452508
1179 Ga0068861_100715111
1180 Ga0068861_101178810
1181 Ga0068870_10036599
1182 Ga0068870_10066418
1183 Ga0068863_102666131
1184 Ga0068858_100005769
1185 Ga0068858_100112559
1186 Ga0068858_100520779
1187 Ga0068858_101170622
1188 Ga0068860_100002528
1189 Ga0068860_100099481
1190 Ga0068860_100533700
1191 Ga0068860_100602500
1192 Ga0068860_101460699
1193 Ga0068862_100005981
1194 Ga0068862_100048027
1195 Ga0068862_100166396
1196 Ga0068862_100553678
1197 Ga0068862_101458131
1198 Ga0068862_102493692
1199 Ga0081455_10003176
1200 Ga0081455_10450024
1201 Ga0081455_10614601
1202 Ga0081538_10337381
1203 Ga0081540_1000841
1204 Ga0081540_1023446
1205 Ga0081539_10000468
1206 Ga0081539_10029471
1207 Ga0075368_10106793
1208 Ga0075432_10105557
1209 Ga0070716_100481606
1210 Ga0070712_100001185
1211 Ga0097621_100000754
1212 Ga0097621_100028703
1213 Ga0097621_101106566
1214 Ga0068871_100003878
1215 Ga0068871_100009731
1216 Ga0068871_100367069
1217 Ga0068871_101363878
1218 Ga0075428_100001502
1219 Ga0075428_100016740
1220 Ga0075428_100101531
1221 Ga0075428_100169137
1222 Ga0075428_100185437
1223 Ga0075428_100209874
1224 Ga0075428_100277743
1225 Ga0075428_100370279
1226 Ga0075428_100400711
1227 Ga0075428_100533781
1228 Ga0075428_100583307
1229 Ga0075428_100846073
1230 Ga0075428_100970926
1231 Ga0075428_101384707
1232 Ga0075428_101511895
1233 Ga0075428_101908210
1234 Ga0075428_102122220
1235 Ga0075428_102475135
1236 Ga0075430_100001098
1237 Ga0075430_100002189
1238 Ga0075430_100004241
1239 Ga0075430_100011150
1240 Ga0075430_100044526
1241 Ga0075430_100243501
1242 Ga0075430_100251596
1243 Ga0075430_100351842
1244 Ga0075430_100736214
1245 Ga0075430_101346514
1246 Ga0075430_101660051
1247 Ga0075431_100012939
1248 Ga0075431_100021216
1249 Ga0075431_100059320
1250 Ga0075431_100115679
1251 Ga0075431_100145224
1252 Ga0075431_100150292
1253 Ga0075431_100276979
1254 Ga0075431_100317579
1255 Ga0075431_100355586
1256 Ga0075431_100729205
1257 Ga0075431_101512254
1258 Ga0075431_101849872
1259 Ga0075433_10011246
1260 Ga0075433_10033804
1261 Ga0075433_10060852
1262 Ga0075433_10131534
1263 Ga0075433_10131656
1264 Ga0075433_10154480
1265 Ga0075433_11540808
1266 Ga0075434_100006963
1267 Ga0075434_100043103
1268 Ga0075434_100064939
1269 Ga0075434_100083230
1270 Ga0075434_100156612
1271 Ga0075434_100379461
1272 Ga0075434_100389302
1273 Ga0075434_101351586
1274 Ga0075434_101359723
1275 Ga0075434_101777379
1276 Ga0075434_101787199
1277 Ga0075434_101958202
1278 Ga0075429_100000055
1279 Ga0075429_100000432
1280 Ga0075429_100001365
1281 Ga0075429_100028891
1282 Ga0075429_100044996
1283 Ga0075429_100098316
1284 Ga0075429_100184447
1285 Ga0075429_100473842
1286 Ga0075429_101677911
1287 Ga0075429_101964715
1288 Ga0068865_100001524
1289 Ga0068865_100040545
1290 Ga0068865_100252665
1291 Ga0075436_100007888
1292 Ga0075436_100114402
1293 Ga0097620_100000420
1294 Ga0097620_100181248
1295 Ga0097620_100332394
1296 Ga0097620_100509803
1297 Ga0097620_100894455
1298 Ga0075435_100007468
1299 Ga0075435_100024358
1300 Ga0075435_100048103
1301 Ga0075435_100200586
1302 Ga0075435_100201259
1303 Ga0075435_100351769
1304 Ga0075435_101268334
1305 Ga0099794_10064805
1306 Ga0099794_10295389
1307 Ga0099794_10494406
1308 Ga0099795_10335698
1309 Ga0099795_10425416
1310 Ga0105240_12017022
1311 Ga0111539_10006184
1312 Ga0111539_10026623
1313 Ga0111539_10088217
1314 Ga0111539_10102104
1315 Ga0111539_10131305
1316 Ga0111539_10184796
1317 Ga0111539_10237023
1318 Ga0111539_10240452
1319 Ga0111539_10251855
1320 Ga0111539_10402779
1321 Ga0111539_10782009
1322 Ga0111539_11135043
1323 Ga0111539_11245919
1324 Ga0111539_11980314
1325 Ga0105245_10012764
1326 Ga0114129_10002987
1327 Ga0114129_10006327
1328 Ga0114129_10012532
1329 Ga0114129_10030430
1330 Ga0114129_10060555
1331 Ga0114129_10067680
1332 Ga0114129_10073085
1333 Ga0114129_10124456
1334 Ga0114129_10224122
1335 Ga0114129_10237706
1336 Ga0114129_10281729
1337 Ga0114129_10299009
1338 Ga0114129_10301114
1339 Ga0114129_10308584
1340 Ga0114129_10356472
1341 Ga0114129_10365692
1342 Ga0114129_10768525
1343 Ga0114129_11628529
1344 Ga0114129_12639983
1345 Ga0105243_10002912
1346 Ga0105243_10035086
1347 Ga0105241_10044445
1348 Ga0105241_11425235
1349 Ga0105242_10000248
1350 Ga0105242_10227045
1351 Ga0105248_10631497
1352 Ga0105248_12160258
1353 Ga0105248_12161144
1354 Ga0105237_11902219
1355 Ga0105237_12111053
1356 Ga0105249_10054817
1357 Ga0105249_10066654
1358 Ga0105249_10287100
1359 Ga0105249_10539275
1360 Ga0105249_11122045
1361 Ga0105249_12037070
1362 Ga0105239_10199942
1363 Ga0157374_11997332
1364 Ga0157378_10000387
1365 Ga0157378_10108512
1366 Ga0157378_10721705
1367 Ga0157378_11255069
1368 Ga0163162_10633774
1369 Ga0163162_11634273
1370 Ga0163162_11694773
1371 Ga0163162_11740112
1372 Ga0163162_12447749
1373 Ga0157372_11314907
1374 Ga0157375_12124567
1375 Ga0157380_10011921
1376 Ga0157380_10025684
1377 Ga0157380_11671134
1378 Ga0157380_13121355
1379 Ga0157377_10603151
1380 Ga0157376_10012006
1381 Ga0157376_11450566
1382 Ga0163161_10365627
1383 Ga0163161_11353484
1384 Ga0213875_10072124
1385 Ga0207666_1045861
1386 Ga0207653_10004764
1387 Ga0207682_10363490
1388 Ga0207692_10180675
1389 Ga0207642_10005011
1390 Ga0207642_10053835
1391 Ga0207688_10057485
1392 Ga0207688_10617023
1393 Ga0207680_10055662
1394 Ga0207645_10049224
1395 Ga0207645_10472831
1396 Ga0207645_11018987
1397 Ga0207643_10064864
1398 Ga0207643_10077561
1399 Ga0207684_10019497
1400 Ga0207684_10399399
1401 Ga0207654_10252025
1402 Ga0207707_10011165
1403 Ga0207663_10302475
1404 Ga0207660_10041586
1405 Ga0207660_10043670
1406 Ga0207660_10067317
1407 Ga0207660_10160542
1408 Ga0207660_10562741
1409 Ga0207660_11075085
1410 Ga0207662_10000095
1411 Ga0207662_10268917
1412 Ga0207652_10026429
1413 Ga0207646_10003246
1414 Ga0207646_10858213
1415 Ga0207681_10194022
1416 Ga0207681_10208421
1417 Ga0207681_10311137
1418 Ga0207681_11610792
1419 Ga0207659_10024348
1420 Ga0207659_10159000
1421 Ga0207659_11863080
1422 Ga0207687_10003242
1423 Ga0207687_11727265
1424 Ga0207644_10408267
1425 Ga0207644_10933887
1426 Ga0207690_10673940
1427 Ga0207706_11152731
1428 Ga0207686_10001874
1429 Ga0207709_10001439
1430 Ga0207709_10040568
1431 Ga0207670_10002023
1432 Ga0207670_10115149
1433 Ga0207669_10016254
1434 Ga0207704_10000623
1435 Ga0207704_10040114
1436 Ga0207704_10467020
1437 Ga0207665_10129051
1438 Ga0207665_10374736
1439 Ga0207691_10396080
1440 Ga0207711_11247717
1441 Ga0207689_10000977
1442 Ga0207689_10048172
1443 Ga0207689_10284782
1444 Ga0207689_10986962
1445 Ga0207661_10561417
1446 Ga0207712_10013536
1447 Ga0207712_10108426
1448 Ga0207712_10587580
1449 Ga0207712_10665316
1450 Ga0207712_11313584
1451 Ga0207668_10083070
1452 Ga0207668_10163260
1453 Ga0207640_10019295
1454 Ga0207640_10627586
1455 Ga0207677_10017944
1456 Ga0207677_11316375
1457 Ga0207677_11911674
1458 Ga0207703_10012439
1459 Ga0207703_10018478
1460 Ga0207678_10460086
1461 Ga0207708_10000551
1462 Ga0207708_10005521
1463 Ga0207708_11361306
1464 Ga0207702_10064024
1465 Ga0207648_10000513
1466 Ga0207648_10002477
1467 Ga0207648_10076446
1468 Ga0207648_10233922
1469 Ga0207676_10760790
1470 Ga0207674_10810244
1471 Ga0207674_11950776
1472 Ga0207675_100001063
1473 Ga0207675_100104513
1474 Ga0207675_100796735
1475 Ga0207675_101912505
1476 Ga0207683_10080122
1477 Ga0207698_10742700
1478 Ga0209969_1018790
1479 Ga0209967_1015009
1480 Ga0209981_1010132
1481 Ga0210000_1015710
1482 Ga0209968_1047314
1483 Ga0209970_1003183
1484 Ga0209588_1027778
1485 Ga0209971_1003253
1486 Ga0209966_1002671
1487 Ga0209998_10009892
1488 Ga0209813_10243775
1489 Ga0209974_10148155
1490 Ga0207428_10000288
1491 Ga0207428_10011126
1492 Ga0207428_10081245
1493 Ga0207428_10129247
1494 Ga0207428_10212262
1495 Ga0207428_10872034
1496 Ga0268265_10009410
1497 Ga0268265_10043725
1498 Ga0268265_10409679
1499 Ga0268265_10714535
1500 Ga0268264_10005879
1501 Ga0268264_10087084
1502 Ga0307408_100108002
1503 Ga0307408_101546949
1504 Ga0307408_102465983
1505 Ga0307408_102508862
1506 Ga0307405_10323688
1507 Ga0307410_10524901
1508 Ga0307410_11031064
1509 Ga0307410_11889599
1510 Ga0307407_10112275
1511 Ga0307407_11375041
1512 Ga0307412_10283588
1513 Ga0307412_11074838
1514 Ga0307409_100094044
1515 Ga0307416_100218413
1516 Ga0307416_100480818
1517 Ga0307416_101129270
1518 Ga0307416_101873284
1519 Ga0307416_102076379
1520 Ga0307416_102708381
1521 Ga0307416_102808169
1522 Ga0307416_103143362
1523 Ga0307416_103284057
1524 Ga0307411_10210161
1525 Ga0307411_10318321
1526 Ga0307411_10569643
1527 Ga0307415_101071647
1528 Ga0373930_0054789
1529 Ga0373930_0078431
1530 Ga0373948_0011845
1531 Ga0373958_0194446
1532 Ga0373959_0026875
1533 Ga0373938_0238554
1534 Ga0373926_0002148
1535 Ga0373928_0005303
1536 Ga0373928_0010322
1537 Ga0373928_0072121
1538 Ga0373934_0100950
1539 Ga0373940_0002387
1540 Ga0373940_0065041
1541 Ga0373940_0087889
1542 Ga0373944_0005437
1543 Ga0373949_0127897
1544 Ga0373951_0026089
1545 Ga0373951_0048705
1546 Ga0373951_0208294
1547 Ga0373952_0004949
1548 Ga0373952_0261350
1549 Ga0373923_0062044
1550 Ga0373932_0002691
1551 Ga0373932_0024935
1552 Ga0373932_0051987
1553 Ga0373932_0076916
1554 Ga0373932_0224809
1555 Ga0373932_0254490
1556 Ga0373932_0340476
1557 Ga0373936_0040361
1558 Ga0373939_0007089
1559 Ga0373939_0044303
1560 Ga0373939_0052296
1561 Ga0373939_0068016
1562 Ga0373939_0076110
1563 Ga0373939_0110226
1564 Ga0373941_0005268
1565 Ga0373941_0017198
1566 Ga0373941_0019880
1567 Ga0373941_0143279
1568 Ga0373941_0376150
1569 Ga0373945_0048244
1570 Ga0373954_0000030
1571 Ga0373954_0259205
1572 Ga0373957_0056107
1573 Ga0373960_0022032
1574 Ga0373960_0028430
1575 Ga0373960_0037436
1576 Ga0373943_0068348
1577 Ga0373946_0047609
1578 Ga0373955_0084477
1579 Ga0373955_0353705
1580 Ga0373942_0019869
1581 Ga0373942_0058599
1582 Ga0373942_0063190
1583 Ga0373942_0131809
1584 Ga0373961_0021631
1585 Ga0373961_0038197
1586 Ga0373961_0073549
1587 Ga0373961_0105621
1588 Ga0373961_0448189
1589 Ga0373962_0008702
1590 Ga0373962_0012184
1591 Ga0373962_0013605
1592 Ga0373962_0100443
1593 Ga0373962_0171366
1594 Ga0373962_0357490
1595 Ga0373924_0016098
1596 Ga0373931_0001918
1597 Ga0373931_0002342
1598 Ga0373931_0006328
1599 Ga0373931_0010421
1600 Ga0373931_0025771
1601 Ga0373931_0029473
1602 Ga0373931_0033364
1603 Ga0373931_0073169
1604 Ga0373931_0213618
1605 Ga0373931_0250445
1606 Ga0373931_1260027
1607 Ga0373935_0125433
1608 Ga0373927_0008733
1609 Ga0373927_1012096
1610 Ga0373933_0022210
1611 Ga0373947_0048561
1612 Ga0373937_0025516
1613 Ga0373937_0604372
1614 Ga0373937_0622877
1615 Ga0373925_0012851
1616 Ga0395900_0003092
1617 Ga0395898_0011090
1618 Ga0395905_0252699
1619 Ga0436364_1195800
1620 Ga0395901_0001902
1621 Ga0436365_1664112
1622 Ga0436365_1801159
1623 Ga0451807_2725195
1624 Ga0451839_0304386
1625 Ga0439441_087449
1626 Ga0439441_185385
1627 Ga0439456_117078
1628 Ga0439435_0001468
1629 Ga0439460_0002117
1630 Ga0439460_0132936
1631 Ga0439460_0175014
1632 Ga0451577_0034679
1633 Ga0451577_0063848
1634 Ga0451577_0402867
1635 Ga0451577_0463491
1636 Ga0451577_0548330
1637 Ga0451577_0849017
1638 Ga0439440_0147678
1639 Ga0466972_0418143
1640 Ga0453683_0191599
1641 Ga0466965_0060429
1642 Ga0466960_0450872
1643 Ga0451576_0018030
1644 Ga0451576_0020308
1645 Ga0451576_0023304
1646 Ga0451576_0286661
1647 Ga0451576_0424788
1648 Ga0451576_0498059
1649 Ga0451576_1243971
1650 Ga0466967_1536089
1651 Ga0495592_0001475
1652 Ga0495603_0036255
1653 Ga0495629_0892549
1654 Ga0495653_0012697
1655 Ga0495580_0002475
1656 Ga0495580_0190977
1657 Ga0495582_0036167
1658 Ga0495582_0129869
1659 Ga0495639_0331543
1660 Ga0495662_0005331
1661 Ga0495662_0038196
1662 Ga0495584_0137983
1663 Ga0495608_0014819
1664 Ga0495608_0611753
1665 Ga0495618_0097543
1666 Ga0495628_0091825
1667 Ga0495630_0016927
1668 Ga0495630_0066008
1669 Ga0495630_0141363
1670 Ga0495630_1115995
1671 Ga0495666_0013108
1672 Ga0495666_0023766
1673 Ga0495642_0017372
1674 Ga0495642_0024669
1675 Ga0495642_0102755
1676 Ga0495652_0264328
1677 Ga0495652_0797629
1678 Ga0495665_0062602
1679 Ga0495665_0348724
1680 Ga0495640_0005456
1681 Ga0495640_0030921
1682 Ga0495586_0002272
1683 Ga0495586_0009170
1684 Ga0495587_0020738
1685 Ga0495587_0238668
1686 Ga0495598_0219483
1687 Ga0495621_0164081
1688 Ga0495621_0202782
1689 Ga0495621_0318220
1690 Ga0495645_0196269
1691 Ga0495667_0002694
1692 Ga0495667_0302105
1693 Ga0495656_0026757
1694 Ga0495656_0118188
1695 Ga0495656_0326102
1696 Ga0495634_0003551
1697 Ga0495635_0109075
1698 Ga0495659_0059792
1699 Ga0495659_0061294
1700 Ga0495659_0095715
1701 Ga0495661_0390800
1702 Ga0495588_0171347
1703 Ga0495599_0002703
1704 Ga0495599_0098574
1705 Ga0495646_0601941
1706 Ga0495647_0001740
1707 Ga0495647_0154543
1708 Ga0495647_0245078
1709 Ga0495658_0013614
1710 Ga0495658_0024614
1711 Ga0495669_0016289
1712 Ga0495669_0050743
1713 Ga0495669_0307721
1714 Ga0495669_0531461
1715 Ga0495613_0003446
1716 Ga0495624_0194193
1717 Ga0495600_0077653
1718 Ga0495600_0136839
1719 Ga0495581_0131514
1720 Ga0495604_0002697
1721 Ga0495604_0538134
1722 Ga0495636_0038176
1723 Ga0495636_0054880
1724 Ga0495636_0522371
1725 Ga0495636_0651902
1726 Ga0495674_0526202
1727 Ga0495674_0860094
1728 Ga0495680_0004055
1729 Ga0495680_0696338
1730 Ga0495675_0215029
1731 Ga0495677_0158614
1732 Ga0495684_0114616
1733 Ga0495684_0369720
1734 Ga0496100_0119819
1735 Ga0496101_0173194
1736 Ga0496102_0677997
1737 Ga0496103_0092576
1738 Ga0496104_0047284
1739 Ga0496105_0160233
1740 Ga0496106_0023172
1741 Ga0496107_0013207
1742 Ga0496109_0003297
1743 Ga0496110_0016127
1744 Ga0496111_0384820
1745 Ga0496112_0048142
1746 Ga0496113_1003104
1747 Ga0496115_0198577
1748 Ga0501299_101000
1749 Ga0501299_119268
1750 Ga0501031_0042679
1751 Ga0501032_0862865
1752 Ga0501033_0006002
1753 Ga0501033_0066352
1754 Ga0501034_0199915
1755 Ga0501036_0002811
1756 Ga0501036_0186397
1757 Ga0501036_0373424
1758 Ga0501036_0555224
1759 Ga0501036_1027854
1760 Ga0501036_1029896
1761 Ga0501036_1244350
1762 Ga0501037_0016719
1763 Ga0501037_0536499
1764 Ga0501037_0601433
1765 Ga0501037_1120708
1766 Ga0501038_0008069
1767 Ga0501038_0090474
1768 Ga0501038_0337775
1769 Ga0501039_0014392
1770 Ga0501039_0040879
1771 Ga0501039_0044419
1772 Ga0501039_0050433
1773 Ga0501039_0137551
1774 Ga0501039_0257536
1775 Ga0501039_0361291
1776 Ga0501039_1329603
1777 Ga0501040_0000376
1778 Ga0501040_0020631
1779 Ga0501040_0021173
1780 Ga0501040_0055396
1781 Ga0501040_0118826
1782 Ga0501040_0967783
1783 Ga0501041_0000609
1784 Ga0501041_0044711
1785 Ga0501041_0230173
1786 Ga0501041_0233771
1787 Ga0501041_0253432
1788 Ga0501041_0259263
1789 Ga0501041_0534239
1790 Ga0501042_0000217
1791 Ga0501042_0029750
1792 Ga0501042_0298264
1793 Ga0501042_0728428
1794 Ga0501042_0879999
1795 Ga0501042_1233331
1796 Ga0501043_0343407
1797 Ga0501043_0746534
1798 Ga0501046_0003851
1799 Ga0501046_0036615
1800 Ga0501046_1113013
1801 Ga0501046_1223563
1802 Ga0501048_0001002
1803 Ga0501048_0193203
1804 Ga0501048_0217621
1805 Ga0501048_0635887
1806 Ga0501048_0981891
1807 Ga0501048_1149143
1808 Ga0501067_0059070
1809 Ga0501067_0120572
1810 Ga0501067_0427476
1811 Ga0501068_0072013
1812 Ga0501068_0414487
1813 Ga0501068_0677900
1814 Ga0501068_0816443
1815 Ga0501068_0908294
1816 Ga0501068_1208693
1817 Ga0501069_0184637
1818 Ga0501070_0115292
1819 Ga0501071_0011096
1820 Ga0501071_0073797
1821 Ga0501071_0078746
1822 Ga0501071_0217319
1823 Ga0501071_0432788
1824 Ga0501071_0638314
1825 Ga0501072_0008373
1826 Ga0501072_0023786
1827 Ga0501072_0062249
1828 Ga0501072_0108474
1829 Ga0501072_0350928
1830 Ga0501072_1101838
1831 Ga0501072_1105660
1832 Ga0501072_1240763
1833 Ga0501073_0327130
1834 Ga0501073_0844070
1835 Ga0501074_0054650
1836 Ga0501074_0280235
1837 Ga0501074_1300868
1838 Ga0501075_0004474
1839 Ga0501075_0015921
1840 Ga0501075_0035366
1841 Ga0501075_0053786
1842 Ga0501075_0064978
1843 Ga0501075_0082723
1844 Ga0501075_0599301
1845 Ga0501075_0604425
1846 Ga0501076_0000526
1847 Ga0501076_0000778
1848 Ga0501076_0010510
1849 Ga0501076_0011445
1850 Ga0501076_0142561
1851 Ga0501076_0163537
1852 Ga0501076_0612339
1853 Ga0501076_1366318
1854 Ga0501077_0001082
1855 Ga0501077_0026200
1856 Ga0501077_0441809
1857 Ga0501199_024935
1858 Ga0501209_262894
1859 Ga0501079_0000010
1860 Ga0501079_0017301
1861 Ga0501079_0023005
1862 Ga0501079_0053522
1863 Ga0501079_0098297
1864 Ga0501079_0176662
1865 Ga0501079_0351802
1866 Ga0501079_0363463
1867 Ga0501079_0429811
1868 Ga0501079_0474012
1869 Ga0501080_0026635
1870 Ga0501080_0397483
1871 Ga0501080_0507160
1872 Ga0501080_0669886
1873 Ga0501080_0750522
1874 Ga0501081_0000811
1875 Ga0501081_0001107
1876 Ga0501081_0007636
1877 Ga0501081_0038926
1878 Ga0501081_0119593
1879 Ga0501081_1501706
1880 Ga0501035_0041997
1881 Ga0501035_0116958
1882 Ga0501035_0246262
1883 Ga0501035_0620111
1884 Ga0501044_0059444
1885 Ga0501045_0000946
1886 Ga0501045_0130617
1887 Ga0501045_0579165
1888 Ga0501045_1082688
1889 nmdc:mga04h51_275502_c1
1890 nmdc:mga05p37_1169323_c1
1891 nmdc:mga05p37_129800_c1
1892 nmdc:mga05p37_1935_c1
1893 nmdc:mga05p37_24531_c1
1894 nmdc:mga05p37_24611_c1
1895 nmdc:mga05p37_290444_c1
1896 nmdc:mga05p37_29685_c1
1897 nmdc:mga05p37_31849_c1
1898 nmdc:mga05p37_391130_c1
1899 nmdc:mga05p37_413587_c1
1900 nmdc:mga05p37_432823_c1
1901 nmdc:mga05p37_437652_c1
1902 nmdc:mga05p37_54085_c1
1903 nmdc:mga05p37_66268_c1
1904 nmdc:mga05p37_92690_c1
1905 nmdc:mga05p37_98208_c1
1906 nmdc:mga09592_1304195_c1
1907 nmdc:mga09592_1441079_c1
1908 nmdc:mga09592_15247_c1
1909 nmdc:mga09592_15522_c1
1910 nmdc:mga09592_1903_c1
1911 nmdc:mga09592_258426_c1
1912 nmdc:mga09592_28339_c1
1913 nmdc:mga09592_378224_c1
1914 nmdc:mga09592_400650_c1
1915 nmdc:mga09592_50783_c1
1916 nmdc:mga09592_622737_c1
1917 nmdc:mga09592_996446_c1
1918 nmdc:mga0qj67_129_c1
1919 nmdc:mga0qj67_1355991_c1
1920 nmdc:mga0qj67_263467_c1
1921 nmdc:mga0qj67_345846_c1
1922 nmdc:mga0qj67_523130_c1
1923 nmdc:mga0qj67_63996_c1
1924 nmdc:mga0qj67_733_c1
1925 nmdc:mga0qj67_831191_c1
1926 nmdc:mga0qj67_885_c1
1927 nmdc:mga06r32_10855_c1
1928 nmdc:mga06r32_118889_c1
1929 nmdc:mga06r32_1205052_c1
1930 nmdc:mga06r32_1301599_c1
1931 nmdc:mga06r32_1580981_c1
1932 nmdc:mga06r32_172098_c1
1933 nmdc:mga06r32_182123_c1
1934 nmdc:mga06r32_299792_c1
1935 nmdc:mga06r32_485259_c1
1936 nmdc:mga06r32_572428_c1
1937 nmdc:mga06r32_57445_c1
1938 nmdc:mga06r32_62963_c1
1939 nmdc:mga06r32_82372_c1
1940 nmdc:mga06r32_825828_c1
1941 nmdc:mga08y16_10187_c1
1942 nmdc:mga08y16_112369_c1
1943 nmdc:mga08y16_1325940_c1
1944 nmdc:mga08y16_152687_c1
1945 nmdc:mga08y16_181142_c1
1946 nmdc:mga08y16_2033_c1
1947 nmdc:mga08y16_2044345_c1
1948 nmdc:mga08y16_2110138_c1
1949 nmdc:mga08y16_254680_c1
1950 nmdc:mga08y16_279555_c1
1951 nmdc:mga08y16_299184_c1
1952 nmdc:mga08y16_39632_c1
1953 nmdc:mga08y16_397400_c1
1954 nmdc:mga08y16_44681_c2
1955 nmdc:mga08y16_894136_c1
1956 nmdc:mga0n895_13013_c1
1957 nmdc:mga0n895_1586586_c1
1958 nmdc:mga0n895_207855_c1
1959 nmdc:mga0n895_244277_c1
1960 nmdc:mga0n895_363814_c1
1961 nmdc:mga0n895_515275_c1
1962 nmdc:mga0n895_63738_c1
1963 nmdc:mga0n895_67283_c1
1964 nmdc:mga0n895_831915_c1
1965 nmdc:mga0n895_911213_c1
1966 nmdc:mga0n895_914440_c1
1967 nmdc:mga0rr50_1053066_c1
1968 nmdc:mga0rr50_32319_c1
1969 nmdc:mga0rr50_3348_c1
1970 nmdc:mga0rr50_35454_c1
1971 nmdc:mga0rr50_367426_c1
1972 nmdc:mga0rr50_373569_c1
1973 nmdc:mga0rr50_532655_c1
1974 nmdc:mga0rr50_659677_c1
1975 nmdc:mga0rr50_78197_c1
1976 nmdc:mga08x19_4462_c1
1977 nmdc:mga08x19_988589_c1
1978 nmdc:mga0a205_14700_c1
1979 nmdc:mga0a205_155193_c1
1980 nmdc:mga0a205_182067_c1
1981 nmdc:mga0a205_328091_c1
1982 nmdc:mga0a205_3699_c1
1983 nmdc:mga0a205_48854_c1
1984 nmdc:mga0a205_49050_c1
1985 nmdc:mga0a205_67799_c1
1986 Ga0495601_0057527
1987 Ga0495601_0269669
1988 Ga0495601_0315265
1989 Ga0495595_0353378
1990 Ga0495619_0162293
1991 Ga0500643_002271
1992 Ga0500651_0031020
1993 Ga0500651_0088309
1994 Ga0500566_0034058
1995 Ga0500595_000003
1996 Ga0500642_0412553
1997 Ga0500652_005161
1998 Ga0500577_0185485
1999 Ga0500616_0000002
2000 Ga0500645_000226
2001 Ga0500645_201682
2002 Ga0501084_0001073
2003 Ga0501084_0084857
2004 Ga0501084_0214935
2005 Ga0501084_0413873
2006 Ga0501084_0427176
2007 Ga0501084_0841933
2008 Ga0501084_0989198
2009 Ga0501082_0000809
2010 Ga0501082_0002254
2011 Ga0501082_0016215
2012 Ga0501082_0059202
2013 Ga0501082_0633352
2014 Ga0501082_1007055
2015 Ga0501082_1659796
2016 Ga0530510_0003125
2017 Ga0530510_0028935
2018 Ga0530510_0046048
2019 Ga0530510_0150947
2020 Ga0530510_0409306
2021 Ga0530510_0429679
2022 Ga0530510_0874054
2023 Ga0530510_1223782
2024 8055226841

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

10

106

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8958 2 106
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8935 1 106
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8905 2 105
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8851 1 106
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8632 2 106
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8935 1 106 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8851 1 106 2.60.40.10
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8155 1 104 2.60.40.10
af_Q58151_5_116_2.60.40.730 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.8103 5 106 2.60.40.730
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8083 4 106 2.60.40.2470
ID Description Score Start End GO Terms
AF-W7QMR9-F1-model_v4 Sulphur oxidation protein SoxZ domain-containing protein 0.924 45 103
AF-A0A6P1B118-F1-model_v4 deleted 0.9217 41 106
AF-A0A6P1B118-F1-model_v4 deleted 0.8961 41 106
AF-A0A3D9ZF85-F1-model_v4 Uncharacterized protein 0.8838 5 106
AF-A0A651FJ43-F1-model_v4 Sulfur oxidation protein 0.8837 1 106

Map