F488160
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1012 | 388 | 2024 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10280879|Ga0070658_102808791 |
| Length | 214 |
| Sequence | MSKSPNSVSGDARCRQCRRAGEKLFLKGARCYTKKCGIEKRNFPPGQHGNSGRPAKVTDYGMQLREKQKMRQIYRVLEGPFRSYVDEATRRKGVTGENLLQLLEMRLDNVVYRLGFAASRAQGRQLVNHGHFQVNGRRVDIPSYQTRPGDVVEVVEGSRRVPGIQEALAGVGNRIPGWLSLNANQFSGKVLAPPRRDEVDSDVHEQIIIEFYSR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 95 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 112 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 181 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 202 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 214 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 218 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 225 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 228 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 230 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 233 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 234 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 235 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 236 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 239 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 246 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 247 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 248 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 249 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 250 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 251 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 252 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 253 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 254 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 255 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 256 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 257 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 258 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 259 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 260 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 261 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 262 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 263 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 264 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 314 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 315 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 316 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 317 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 318 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 319 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 322 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 323 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 324 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 325 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 326 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 375 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 376 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 377 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 378 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.84 |
| Metatranscriptomes | 3.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 6.62 |
| Rhizosphere | 91.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10280879 | 3300005327 | Bacteria | 1417 |
| 2 | JGI24735J21928_10011983 | 3300002067 | Bacteria | 2743 |
| 3 | JGI24744J21845_10012636 | 3300002077 | Bacteria | 1710 |
| 4 | Ga0006778J45830_1011230 | 3300003162 | Bacteria | 4133 |
| 5 | JGI25406J46586_10008605 | 3300003203 | Bacteria | 4610 |
| 6 | rootL2_10029981 | 3300003322 | Bacteria | 3273 |
| 7 | Ga0006562J51391_1019008 | 3300003578 | Bacteria | 5176 |
| 8 | Ga0058863_10037182 | 3300004799 | Bacteria | 1501 |
| 9 | Ga0058862_12849316 | 3300004803 | Bacteria | 1224 |
| 10 | Ga0065704_10423144 | 3300005289 | Bacteria | 730 |
| 11 | Ga0065707_10320127 | 3300005295 | Bacteria | 968 |
| 12 | Ga0070676_10064352 | 3300005328 | Bacteria | 2186 |
| 13 | Ga0070683_100157459 | 3300005329 | Bacteria | 2154 |
| 14 | Ga0070683_100497249 | 3300005329 | Bacteria | 1165 |
| 15 | Ga0070683_100694216 | 3300005329 | Bacteria | 975 |
| 16 | Ga0070683_101119971 | 3300005329 | Bacteria | 756 |
| 17 | Ga0070690_100065223 | 3300005330 | Bacteria | 2355 |
| 18 | Ga0070690_100091201 | 3300005330 | Bacteria | 2007 |
| 19 | Ga0070670_100029629 | 3300005331 | Bacteria | 4713 |
| 20 | Ga0070670_100448765 | 3300005331 | Bacteria | 1143 |
| 21 | Ga0068869_100360265 | 3300005334 | Bacteria | 1187 |
| 22 | Ga0068869_100468851 | 3300005334 | Bacteria | 1047 |
| 23 | Ga0070666_10271538 | 3300005335 | Bacteria | 1204 |
| 24 | Ga0070680_100000015 | 3300005336 | Bacteria | 93646 |
| 25 | Ga0070680_100560389 | 3300005336 | Bacteria | 980 |
| 26 | Ga0070680_100919950 | 3300005336 | Bacteria | 755 |
| 27 | Ga0070682_100286223 | 3300005337 | Bacteria | 1203 |
| 28 | Ga0070682_100437240 | 3300005337 | Bacteria | 998 |
| 29 | Ga0070682_100563372 | 3300005337 | Bacteria | 894 |
| 30 | Ga0068868_100115200 | 3300005338 | Bacteria | 2188 |
| 31 | Ga0068868_100150634 | 3300005338 | Bacteria | 1915 |
| 32 | Ga0070660_100172010 | 3300005339 | Bacteria | 1750 |
| 33 | Ga0070691_10229783 | 3300005341 | Bacteria | 987 |
| 34 | Ga0070687_100007831 | 3300005343 | Bacteria | 4487 |
| 35 | Ga0070687_100055451 | 3300005343 | Bacteria | 2070 |
| 36 | Ga0070669_100574785 | 3300005353 | Bacteria | 942 |
| 37 | Ga0070675_100240672 | 3300005354 | Bacteria | 1581 |
| 38 | Ga0070675_100276625 | 3300005354 | Bacteria | 1474 |
| 39 | Ga0070675_100507915 | 3300005354 | Bacteria | 1087 |
| 40 | Ga0070671_100184383 | 3300005355 | Bacteria | 1768 |
| 41 | Ga0070674_100077936 | 3300005356 | Bacteria | 2361 |
| 42 | Ga0070674_100171292 | 3300005356 | Bacteria | 1655 |
| 43 | Ga0070674_100432382 | 3300005356 | Bacteria | 1083 |
| 44 | Ga0070674_100811884 | 3300005356 | Bacteria | 808 |
| 45 | Ga0070673_100135991 | 3300005364 | Bacteria | 2069 |
| 46 | Ga0070688_100014921 | 3300005365 | Bacteria | 4409 |
| 47 | Ga0070659_100035734 | 3300005366 | Bacteria | 3870 |
| 48 | Ga0070659_100675789 | 3300005366 | Bacteria | 892 |
| 49 | Ga0070667_100299142 | 3300005367 | Bacteria | 1449 |
| 50 | Ga0070703_10197758 | 3300005406 | Bacteria | 787 |
| 51 | Ga0070701_10009933 | 3300005438 | Bacteria | 4189 |
| 52 | Ga0070705_100001350 | 3300005440 | Bacteria | 13089 |
| 53 | Ga0070705_100123261 | 3300005440 | Bacteria | 1677 |
| 54 | Ga0070705_100283028 | 3300005440 | Bacteria | 1180 |
| 55 | Ga0070700_100099525 | 3300005441 | Bacteria | 1913 |
| 56 | Ga0070700_100135207 | 3300005441 | Bacteria | 1669 |
| 57 | Ga0070694_100061265 | 3300005444 | Bacteria | 2568 |
| 58 | Ga0070694_100233158 | 3300005444 | Bacteria | 1385 |
| 59 | Ga0070708_100000520 | 3300005445 | Bacteria | 28904 |
| 60 | Ga0070708_100018138 | 3300005445 | Bacteria | 5888 |
| 61 | Ga0070708_100265642 | 3300005445 | Bacteria | 1613 |
| 62 | Ga0070708_100350200 | 3300005445 | Bacteria | 1392 |
| 63 | Ga0070708_100546613 | 3300005445 | Bacteria | 1093 |
| 64 | Ga0070663_100525672 | 3300005455 | Bacteria | 986 |
| 65 | Ga0070678_100011053 | 3300005456 | Bacteria | 5549 |
| 66 | Ga0070678_100328339 | 3300005456 | Bacteria | 1308 |
| 67 | Ga0070662_100033609 | 3300005457 | Bacteria | 3612 |
| 68 | Ga0070681_10135310 | 3300005458 | Bacteria | 2395 |
| 69 | Ga0068867_100029916 | 3300005459 | Bacteria | 3926 |
| 70 | Ga0070685_10017473 | 3300005466 | Bacteria | 3841 |
| 71 | Ga0070706_100001506 | 3300005467 | Bacteria | 24455 |
| 72 | Ga0070706_100264471 | 3300005467 | Bacteria | 1605 |
| 73 | Ga0070706_100498750 | 3300005467 | Bacteria | 1133 |
| 74 | Ga0070707_100032692 | 3300005468 | Bacteria | 4956 |
| 75 | Ga0070707_100060819 | 3300005468 | Bacteria | 3622 |
| 76 | Ga0070707_100082375 | 3300005468 | Bacteria | 3107 |
| 77 | Ga0070707_100084133 | 3300005468 | Bacteria | 3074 |
| 78 | Ga0070707_100439727 | 3300005468 | Bacteria | 1265 |
| 79 | Ga0070707_100486478 | 3300005468 | Bacteria | 1196 |
| 80 | Ga0070707_101318628 | 3300005468 | Unclassified | 688 |
| 81 | Ga0070698_100041762 | 3300005471 | Bacteria | 4708 |
| 82 | Ga0070698_100288441 | 3300005471 | Bacteria | 1572 |
| 83 | Ga0070698_100493156 | 3300005471 | Bacteria | 1162 |
| 84 | Ga0070699_100008110 | 3300005518 | Bacteria | 9120 |
| 85 | Ga0070699_100033065 | 3300005518 | Bacteria | 4467 |
| 86 | Ga0070699_100661556 | 3300005518 | Bacteria | 954 |
| 87 | Ga0070679_100063377 | 3300005530 | Bacteria | 3685 |
| 88 | Ga0070679_100166632 | 3300005530 | Bacteria | 2176 |
| 89 | Ga0070684_100044180 | 3300005535 | Bacteria | 3852 |
| 90 | Ga0070684_100108161 | 3300005535 | Bacteria | 2491 |
| 91 | Ga0070684_100401649 | 3300005535 | Bacteria | 1263 |
| 92 | Ga0070684_100653707 | 3300005535 | Bacteria | 979 |
| 93 | Ga0070684_100732289 | 3300005535 | Bacteria | 923 |
| 94 | Ga0070697_100033207 | 3300005536 | Bacteria | 4155 |
| 95 | Ga0070697_100226800 | 3300005536 | Bacteria | 1593 |
| 96 | Ga0070697_100575318 | 3300005536 | Bacteria | 989 |
| 97 | Ga0068853_100263565 | 3300005539 | Bacteria | 1585 |
| 98 | Ga0070672_100022102 | 3300005543 | Bacteria | 4665 |
| 99 | Ga0070686_100016446 | 3300005544 | Bacteria | 4303 |
| 100 | Ga0070686_100096927 | 3300005544 | Bacteria | 1984 |
| 101 | Ga0070686_100161238 | 3300005544 | Bacteria | 1579 |
| 102 | Ga0070686_100335245 | 3300005544 | Bacteria | 1132 |
| 103 | Ga0070695_100006464 | 3300005545 | Bacteria | 6931 |
| 104 | Ga0070695_100032358 | 3300005545 | Bacteria | 3269 |
| 105 | Ga0070695_100086118 | 3300005545 | Bacteria | 2087 |
| 106 | Ga0070696_100005560 | 3300005546 | Bacteria | 8415 |
| 107 | Ga0070696_100048410 | 3300005546 | Bacteria | 2951 |
| 108 | Ga0070696_100063759 | 3300005546 | Bacteria | 2582 |
| 109 | Ga0070696_100235196 | 3300005546 | Bacteria | 1380 |
| 110 | Ga0070693_100041251 | 3300005547 | Bacteria | 2596 |
| 111 | Ga0070693_100463662 | 3300005547 | Bacteria | 892 |
| 112 | Ga0070704_100086007 | 3300005549 | Bacteria | 2328 |
| 113 | Ga0070704_100130394 | 3300005549 | Bacteria | 1947 |
| 114 | Ga0070704_100721572 | 3300005549 | Bacteria | 885 |
| 115 | Ga0070704_101088416 | 3300005549 | Bacteria | 725 |
| 116 | Ga0068855_100001385 | 3300005563 | Bacteria | 30013 |
| 117 | Ga0070664_100043320 | 3300005564 | Bacteria | 3797 |
| 118 | Ga0070664_100180409 | 3300005564 | Bacteria | 1876 |
| 119 | Ga0070664_100503152 | 3300005564 | Bacteria | 1117 |
| 120 | Ga0068857_100173322 | 3300005577 | Bacteria | 1961 |
| 121 | Ga0068857_100336314 | 3300005577 | Bacteria | 1396 |
| 122 | Ga0068854_100263590 | 3300005578 | Bacteria | 1380 |
| 123 | Ga0068854_100354077 | 3300005578 | Bacteria | 1202 |
| 124 | Ga0068856_100384069 | 3300005614 | Bacteria | 1424 |
| 125 | Ga0068856_100813753 | 3300005614 | Bacteria | 954 |
| 126 | Ga0070702_100000505 | 3300005615 | Bacteria | 14011 |
| 127 | Ga0070702_100070789 | 3300005615 | Bacteria | 2059 |
| 128 | Ga0070702_100085505 | 3300005615 | Bacteria | 1900 |
| 129 | Ga0070702_100367227 | 3300005615 | Bacteria | 1019 |
| 130 | Ga0068852_100112319 | 3300005616 | Bacteria | 2479 |
| 131 | Ga0068859_100026558 | 3300005617 | Bacteria | 5806 |
| 132 | Ga0068859_100029872 | 3300005617 | Bacteria | 5468 |
| 133 | Ga0068859_100682800 | 3300005617 | Bacteria | 1118 |
| 134 | Ga0068859_100766117 | 3300005617 | Bacteria | 1054 |
| 135 | Ga0068864_100004342 | 3300005618 | Bacteria | 11640 |
| 136 | Ga0068864_100307439 | 3300005618 | Bacteria | 1486 |
| 137 | Ga0068864_100374635 | 3300005618 | Bacteria | 1348 |
| 138 | Ga0068861_100374865 | 3300005719 | Bacteria | 1255 |
| 139 | Ga0068861_100376823 | 3300005719 | Bacteria | 1252 |
| 140 | Ga0068863_100200941 | 3300005841 | Bacteria | 1917 |
| 141 | Ga0068858_100419682 | 3300005842 | Bacteria | 1287 |
| 142 | Ga0068858_100434881 | 3300005842 | Bacteria | 1263 |
| 143 | Ga0068858_100817326 | 3300005842 | Bacteria | 910 |
| 144 | Ga0068860_100264332 | 3300005843 | Bacteria | 1678 |
| 145 | Ga0068860_100668813 | 3300005843 | Bacteria | 1047 |
| 146 | Ga0081455_10097228 | 3300005937 | Bacteria | 2373 |
| 147 | Ga0081455_10175650 | 3300005937 | Bacteria | 1627 |
| 148 | Ga0081539_10003252 | 3300005985 | Bacteria | 20412 |
| 149 | Ga0081539_10049195 | 3300005985 | Bacteria | 2394 |
| 150 | Ga0075365_10144530 | 3300006038 | Bacteria | 1652 |
| 151 | Ga0097621_100294479 | 3300006237 | Bacteria | 1432 |
| 152 | Ga0097621_100307483 | 3300006237 | Bacteria | 1401 |
| 153 | Ga0097621_100785334 | 3300006237 | Bacteria | 881 |
| 154 | Ga0068871_100113197 | 3300006358 | Bacteria | 2285 |
| 155 | Ga0068871_100456101 | 3300006358 | Bacteria | 1146 |
| 156 | Ga0075428_100068983 | 3300006844 | Bacteria | 3867 |
| 157 | Ga0075430_100028866 | 3300006846 | Bacteria | 4710 |
| 158 | Ga0075431_100243078 | 3300006847 | Bacteria | 1830 |
| 159 | Ga0075434_100001824 | 3300006871 | Bacteria | 18394 |
| 160 | Ga0075434_100003064 | 3300006871 | Bacteria | 14886 |
| 161 | Ga0075434_101010005 | 3300006871 | Bacteria | 846 |
| 162 | Ga0075429_100094041 | 3300006880 | Bacteria | 2614 |
| 163 | Ga0075429_100102858 | 3300006880 | Bacteria | 2494 |
| 164 | Ga0068865_100332499 | 3300006881 | Bacteria | 1225 |
| 165 | Ga0097620_100026558 | 3300006931 | Bacteria | 5806 |
| 166 | Ga0097620_100029873 | 3300006931 | Bacteria | 5468 |
| 167 | Ga0097620_100682998 | 3300006931 | Bacteria | 1118 |
| 168 | Ga0097620_100766158 | 3300006931 | Bacteria | 1054 |
| 169 | Ga0075435_100001508 | 3300007076 | Bacteria | 14962 |
| 170 | Ga0075435_100140140 | 3300007076 | Bacteria | 2029 |
| 171 | Ga0075435_100332825 | 3300007076 | Bacteria | 1301 |
| 172 | Ga0111539_10146000 | 3300009094 | Bacteria | 2770 |
| 173 | Ga0111539_10148167 | 3300009094 | Bacteria | 2748 |
| 174 | Ga0111539_10397539 | 3300009094 | Bacteria | 1605 |
| 175 | Ga0111539_10514170 | 3300009094 | Bacteria | 1395 |
| 176 | Ga0111539_10772458 | 3300009094 | Bacteria | 1118 |
| 177 | Ga0105245_10009735 | 3300009098 | Bacteria | 8379 |
| 178 | Ga0105245_10191774 | 3300009098 | Bacteria | 1958 |
| 179 | Ga0105245_10828387 | 3300009098 | Bacteria | 964 |
| 180 | Ga0105245_11234835 | 3300009098 | Bacteria | 795 |
| 181 | Ga0105245_11252860 | 3300009098 | Bacteria | 790 |
| 182 | Ga0114129_10015434 | 3300009147 | Bacteria | 10865 |
| 183 | Ga0114129_10030448 | 3300009147 | Bacteria | 7637 |
| 184 | Ga0114129_10172428 | 3300009147 | Bacteria | 2948 |
| 185 | Ga0114129_10436380 | 3300009147 | Bacteria | 1720 |
| 186 | Ga0114129_11601987 | 3300009147 | Bacteria | 797 |
| 187 | Ga0105243_10046824 | 3300009148 | Bacteria | 3403 |
| 188 | Ga0105243_10058119 | 3300009148 | Bacteria | 3081 |
| 189 | Ga0105243_11086950 | 3300009148 | Bacteria | 807 |
| 190 | Ga0105243_11252917 | 3300009148 | Bacteria | 757 |
| 191 | Ga0105241_10126535 | 3300009174 | Bacteria | 2064 |
| 192 | Ga0105242_10068639 | 3300009176 | Bacteria | 2933 |
| 193 | Ga0105242_10262786 | 3300009176 | Bacteria | 1560 |
| 194 | Ga0105242_10342440 | 3300009176 | Bacteria | 1378 |
| 195 | Ga0105242_10589672 | 3300009176 | Bacteria | 1072 |
| 196 | Ga0105242_10762856 | 3300009176 | Bacteria | 954 |
| 197 | Ga0105248_10378932 | 3300009177 | Bacteria | 1593 |
| 198 | Ga0105248_10687521 | 3300009177 | Bacteria | 1154 |
| 199 | Ga0105248_10734953 | 3300009177 | Bacteria | 1114 |
| 200 | Ga0105248_10771947 | 3300009177 | Bacteria | 1085 |
| 201 | Ga0105248_10856906 | 3300009177 | Bacteria | 1026 |
| 202 | Ga0105237_10000018 | 3300009545 | Bacteria | 237291 |
| 203 | Ga0105238_10078406 | 3300009551 | Bacteria | 3294 |
| 204 | Ga0105238_10684700 | 3300009551 | Bacteria | 1037 |
| 205 | Ga0105249_10085997 | 3300009553 | Bacteria | 2932 |
| 206 | Ga0105249_11579741 | 3300009553 | Bacteria | 728 |
| 207 | Ga0105030_100085 | 3300009987 | Bacteria | 6934 |
| 208 | Ga0105028_104375 | 3300009993 | Bacteria | 1471 |
| 209 | Ga0105239_10017378 | 3300010375 | Bacteria | 7957 |
| 210 | Ga0105239_10575647 | 3300010375 | Unclassified | 1283 |
| 211 | Ga0105246_10230992 | 3300011119 | Bacteria | 1457 |
| 212 | Ga0105246_10295461 | 3300011119 | Bacteria | 1305 |
| 213 | Ga0105246_10637846 | 3300011119 | Bacteria | 926 |
| 214 | Ga0157373_10279729 | 3300013100 | Bacteria | 1182 |
| 215 | Ga0157369_10826646 | 3300013105 | Bacteria | 951 |
| 216 | Ga0157374_10435538 | 3300013296 | Unclassified | 1311 |
| 217 | Ga0157374_10696928 | 3300013296 | Bacteria | 1028 |
| 218 | Ga0157378_11711337 | 3300013297 | Bacteria | 676 |
| 219 | Ga0163162_10764537 | 3300013306 | Bacteria | 1085 |
| 220 | Ga0157372_10406181 | 3300013307 | Bacteria | 1587 |
| 221 | Ga0157372_10468603 | 3300013307 | Bacteria | 1468 |
| 222 | Ga0157375_10051191 | 3300013308 | Bacteria | 4054 |
| 223 | Ga0157375_10169717 | 3300013308 | Bacteria | 2329 |
| 224 | Ga0157375_10379604 | 3300013308 | Bacteria | 1580 |
| 225 | Ga0157375_10494014 | 3300013308 | Bacteria | 1388 |
| 226 | Ga0157375_10650360 | 3300013308 | Bacteria | 1210 |
| 227 | Ga0157375_11176212 | 3300013308 | Bacteria | 899 |
| 228 | Ga0163163_10085409 | 3300014325 | Bacteria | 3164 |
| 229 | Ga0163163_10345158 | 3300014325 | Bacteria | 1544 |
| 230 | Ga0157380_10044224 | 3300014326 | Bacteria | 3489 |
| 231 | Ga0157380_10173908 | 3300014326 | Bacteria | 1885 |
| 232 | Ga0157380_10288228 | 3300014326 | Bacteria | 1506 |
| 233 | Ga0157380_10294639 | 3300014326 | Bacteria | 1491 |
| 234 | Ga0157380_10319124 | 3300014326 | Bacteria | 1439 |
| 235 | Ga0157380_10595098 | 3300014326 | Bacteria | 1093 |
| 236 | Ga0157380_11032752 | 3300014326 | Bacteria | 857 |
| 237 | Ga0157377_10010295 | 3300014745 | Bacteria | 4622 |
| 238 | Ga0157377_10119140 | 3300014745 | Bacteria | 1597 |
| 239 | Ga0157376_10610742 | 3300014969 | Bacteria | 1086 |
| 240 | Ga0163161_10797454 | 3300017792 | Bacteria | 793 |
| 241 | Ga0206356_11631052 | 3300020070 | Bacteria | 3090 |
| 242 | Ga0206355_1276195 | 3300020076 | Bacteria | 2693 |
| 243 | Ga0206351_10694611 | 3300020077 | Bacteria | 2137 |
| 244 | Ga0206352_11138927 | 3300020078 | Bacteria | 1126 |
| 245 | Ga0206350_11149335 | 3300020080 | Bacteria | 768 |
| 246 | Ga0206354_10584469 | 3300020081 | Bacteria | 2389 |
| 247 | Ga0154015_1342543 | 3300020610 | Bacteria | 2735 |
| 248 | Ga0213875_10008240 | 3300021388 | Bacteria | 5347 |
| 249 | Ga0207656_10159783 | 3300025321 | Bacteria | 1072 |
| 250 | Ga0207642_10118699 | 3300025899 | Bacteria | 1360 |
| 251 | Ga0207710_10119939 | 3300025900 | Bacteria | 1255 |
| 252 | Ga0207688_10103699 | 3300025901 | Bacteria | 1645 |
| 253 | Ga0207680_10381528 | 3300025903 | Bacteria | 994 |
| 254 | Ga0207680_10433319 | 3300025903 | Bacteria | 932 |
| 255 | Ga0207685_10202091 | 3300025905 | Bacteria | 934 |
| 256 | Ga0207645_10124354 | 3300025907 | Bacteria | 1676 |
| 257 | Ga0207643_10048923 | 3300025908 | Bacteria | 2396 |
| 258 | Ga0207684_10169294 | 3300025910 | Bacteria | 1883 |
| 259 | Ga0207684_10293919 | 3300025910 | Bacteria | 1401 |
| 260 | Ga0207684_10344295 | 3300025910 | Bacteria | 1284 |
| 261 | Ga0207654_10391605 | 3300025911 | Bacteria | 964 |
| 262 | Ga0207707_10521874 | 3300025912 | Bacteria | 1011 |
| 263 | Ga0207671_10000714 | 3300025914 | Bacteria | 42588 |
| 264 | Ga0207660_10197690 | 3300025917 | Bacteria | 1569 |
| 265 | Ga0207662_10070011 | 3300025918 | Bacteria | 2121 |
| 266 | Ga0207662_10330777 | 3300025918 | Bacteria | 1019 |
| 267 | Ga0207649_10031110 | 3300025920 | Bacteria | 3169 |
| 268 | Ga0207652_10056482 | 3300025921 | Bacteria | 3379 |
| 269 | Ga0207652_10398769 | 3300025921 | Bacteria | 1241 |
| 270 | Ga0207652_10451383 | 3300025921 | Bacteria | 1159 |
| 271 | Ga0207646_10032918 | 3300025922 | Bacteria | 4689 |
| 272 | Ga0207646_10037970 | 3300025922 | Bacteria | 4340 |
| 273 | Ga0207646_10177461 | 3300025922 | Bacteria | 1924 |
| 274 | Ga0207646_10396604 | 3300025922 | Bacteria | 1246 |
| 275 | Ga0207694_10691379 | 3300025924 | Bacteria | 860 |
| 276 | Ga0207650_10330642 | 3300025925 | Bacteria | 1250 |
| 277 | Ga0207650_10731533 | 3300025925 | Bacteria | 837 |
| 278 | Ga0207650_10780816 | 3300025925 | Bacteria | 809 |
| 279 | Ga0207659_10112935 | 3300025926 | Bacteria | 2068 |
| 280 | Ga0207659_10288633 | 3300025926 | Bacteria | 1344 |
| 281 | Ga0207659_10306941 | 3300025926 | Bacteria | 1305 |
| 282 | Ga0207687_10029499 | 3300025927 | Bacteria | 3691 |
| 283 | Ga0207687_10059539 | 3300025927 | Bacteria | 2691 |
| 284 | Ga0207690_10115370 | 3300025932 | Bacteria | 1941 |
| 285 | Ga0207706_10079031 | 3300025933 | Bacteria | 2893 |
| 286 | Ga0207706_10334424 | 3300025933 | Bacteria | 1318 |
| 287 | Ga0207706_10617978 | 3300025933 | Bacteria | 930 |
| 288 | Ga0207686_10086241 | 3300025934 | Bacteria | 2061 |
| 289 | Ga0207686_10147171 | 3300025934 | Bacteria | 1635 |
| 290 | Ga0207709_10012178 | 3300025935 | Bacteria | 4740 |
| 291 | Ga0207709_10063022 | 3300025935 | Bacteria | 2323 |
| 292 | Ga0207709_10185438 | 3300025935 | Bacteria | 1473 |
| 293 | Ga0207709_10230921 | 3300025935 | Bacteria | 1340 |
| 294 | Ga0207709_10239409 | 3300025935 | Bacteria | 1319 |
| 295 | Ga0207709_10327908 | 3300025935 | Bacteria | 1148 |
| 296 | Ga0207709_10416044 | 3300025935 | Bacteria | 1031 |
| 297 | Ga0207709_10527108 | 3300025935 | Bacteria | 926 |
| 298 | Ga0207670_10010346 | 3300025936 | Bacteria | 5367 |
| 299 | Ga0207669_10013209 | 3300025937 | Bacteria | 4092 |
| 300 | Ga0207669_10153788 | 3300025937 | Bacteria | 1615 |
| 301 | Ga0207669_10256342 | 3300025937 | Bacteria | 1306 |
| 302 | Ga0207669_10399492 | 3300025937 | Bacteria | 1076 |
| 303 | Ga0207704_10018579 | 3300025938 | Bacteria | 3632 |
| 304 | Ga0207704_10390009 | 3300025938 | Bacteria | 1096 |
| 305 | Ga0207704_10426397 | 3300025938 | Bacteria | 1053 |
| 306 | Ga0207665_10082394 | 3300025939 | Bacteria | 2217 |
| 307 | Ga0207691_10035584 | 3300025940 | Bacteria | 4620 |
| 308 | Ga0207691_10700843 | 3300025940 | Bacteria | 854 |
| 309 | Ga0207711_10167449 | 3300025941 | Bacteria | 1992 |
| 310 | Ga0207711_10441146 | 3300025941 | Bacteria | 1211 |
| 311 | Ga0207711_10482720 | 3300025941 | Bacteria | 1155 |
| 312 | Ga0207689_10103994 | 3300025942 | Bacteria | 2333 |
| 313 | Ga0207689_10188986 | 3300025942 | Bacteria | 1699 |
| 314 | Ga0207689_10247013 | 3300025942 | Bacteria | 1476 |
| 315 | Ga0207689_10500533 | 3300025942 | Bacteria | 1018 |
| 316 | Ga0207661_10097568 | 3300025944 | Bacteria | 2461 |
| 317 | Ga0207661_10139605 | 3300025944 | Bacteria | 2084 |
| 318 | Ga0207661_10383906 | 3300025944 | Bacteria | 1272 |
| 319 | Ga0207661_10437126 | 3300025944 | Bacteria | 1190 |
| 320 | Ga0207661_10649070 | 3300025944 | Bacteria | 970 |
| 321 | Ga0207679_10072323 | 3300025945 | Bacteria | 2604 |
| 322 | Ga0207667_10002682 | 3300025949 | Bacteria | 22012 |
| 323 | Ga0207651_10169573 | 3300025960 | Bacteria | 1720 |
| 324 | Ga0207651_10541407 | 3300025960 | Bacteria | 1011 |
| 325 | Ga0207712_10119117 | 3300025961 | Bacteria | 1994 |
| 326 | Ga0207712_10119463 | 3300025961 | Bacteria | 1992 |
| 327 | Ga0207712_10215395 | 3300025961 | Bacteria | 1532 |
| 328 | Ga0207668_10549174 | 3300025972 | Bacteria | 1000 |
| 329 | Ga0207668_10740370 | 3300025972 | Bacteria | 867 |
| 330 | Ga0207640_10121809 | 3300025981 | Bacteria | 1870 |
| 331 | Ga0207640_10417260 | 3300025981 | Bacteria | 1097 |
| 332 | Ga0207640_10772234 | 3300025981 | Bacteria | 830 |
| 333 | Ga0207677_10206096 | 3300026023 | Bacteria | 1566 |
| 334 | Ga0207677_10302159 | 3300026023 | Bacteria | 1322 |
| 335 | Ga0207703_10120934 | 3300026035 | Bacteria | 2248 |
| 336 | Ga0207703_10384310 | 3300026035 | Bacteria | 1299 |
| 337 | Ga0207703_10391937 | 3300026035 | Bacteria | 1287 |
| 338 | Ga0207703_10555670 | 3300026035 | Bacteria | 1083 |
| 339 | Ga0207639_10212694 | 3300026041 | Bacteria | 1665 |
| 340 | Ga0207639_10355345 | 3300026041 | Bacteria | 1310 |
| 341 | Ga0207678_10696647 | 3300026067 | Bacteria | 894 |
| 342 | Ga0207708_10210244 | 3300026075 | Bacteria | 1555 |
| 343 | Ga0207708_10413700 | 3300026075 | Bacteria | 1117 |
| 344 | Ga0207708_10468070 | 3300026075 | Bacteria | 1052 |
| 345 | Ga0207708_10611556 | 3300026075 | Bacteria | 924 |
| 346 | Ga0207702_10902198 | 3300026078 | Bacteria | 876 |
| 347 | Ga0207641_10092143 | 3300026088 | Bacteria | 2654 |
| 348 | Ga0207641_10192236 | 3300026088 | Bacteria | 1876 |
| 349 | Ga0207641_10692846 | 3300026088 | Bacteria | 1003 |
| 350 | Ga0207648_10007918 | 3300026089 | Bacteria | 10361 |
| 351 | Ga0207648_10645315 | 3300026089 | Bacteria | 978 |
| 352 | Ga0207676_10152136 | 3300026095 | Bacteria | 1994 |
| 353 | Ga0207676_10440845 | 3300026095 | Bacteria | 1226 |
| 354 | Ga0207674_10033770 | 3300026116 | Bacteria | 5354 |
| 355 | Ga0207674_10038269 | 3300026116 | Bacteria | 4981 |
| 356 | Ga0207674_10364334 | 3300026116 | Bacteria | 1397 |
| 357 | Ga0207675_100265542 | 3300026118 | Bacteria | 1664 |
| 358 | Ga0207675_100285075 | 3300026118 | Bacteria | 1606 |
| 359 | Ga0207675_100296144 | 3300026118 | Bacteria | 1575 |
| 360 | Ga0207675_101366504 | 3300026118 | Bacteria | 729 |
| 361 | Ga0207683_10013220 | 3300026121 | Bacteria | 7039 |
| 362 | Ga0207683_10057104 | 3300026121 | Bacteria | 3426 |
| 363 | Ga0207683_10168807 | 3300026121 | Bacteria | 1981 |
| 364 | Ga0207683_10504121 | 3300026121 | Bacteria | 1118 |
| 365 | Ga0207698_10399881 | 3300026142 | Bacteria | 1312 |
| 366 | Ga0207698_10586730 | 3300026142 | Bacteria | 1097 |
| 367 | Ga0209999_1005028 | 3300027543 | Bacteria | 2378 |
| 368 | Ga0210002_1008764 | 3300027617 | Bacteria | 1543 |
| 369 | Ga0209971_1001531 | 3300027682 | Bacteria | 5724 |
| 370 | Ga0209971_1007217 | 3300027682 | Bacteria | 2636 |
| 371 | Ga0209971_1024340 | 3300027682 | Bacteria | 1446 |
| 372 | Ga0209998_10000082 | 3300027717 | Bacteria | 37343 |
| 373 | Ga0209974_10000310 | 3300027876 | Bacteria | 15858 |
| 374 | Ga0209974_10039369 | 3300027876 | Bacteria | 1572 |
| 375 | Ga0209974_10072533 | 3300027876 | Bacteria | 1176 |
| 376 | Ga0207428_10014700 | 3300027907 | Bacteria | 6784 |
| 377 | Ga0207428_10065116 | 3300027907 | Bacteria | 2876 |
| 378 | Ga0207428_10110826 | 3300027907 | Bacteria | 2113 |
| 379 | Ga0207428_10141147 | 3300027907 | Bacteria | 1838 |
| 380 | Ga0268266_10262574 | 3300028379 | Bacteria | 1601 |
| 381 | Ga0268265_10754131 | 3300028380 | Bacteria | 945 |
| 382 | Ga0268264_10341923 | 3300028381 | Bacteria | 1422 |
| 383 | Ga0265337_1016621 | 3300028556 | Bacteria | 2373 |
| 384 | Ga0265326_10001467 | 3300028558 | Bacteria | 8293 |
| 385 | Ga0265326_10059094 | 3300028558 | Bacteria | 1084 |
| 386 | Ga0265319_1000855 | 3300028563 | Bacteria | 19414 |
| 387 | Ga0265319_1002743 | 3300028563 | Bacteria | 9454 |
| 388 | Ga0265319_1004372 | 3300028563 | Bacteria | 7005 |
| 389 | Ga0265319_1062405 | 3300028563 | Bacteria | 1207 |
| 390 | Ga0265334_10006646 | 3300028573 | Bacteria | 4970 |
| 391 | Ga0265334_10007969 | 3300028573 | Bacteria | 4525 |
| 392 | Ga0265334_10030742 | 3300028573 | Bacteria | 2148 |
| 393 | Ga0265318_10033646 | 3300028577 | Bacteria | 1977 |
| 394 | Ga0265318_10055552 | 3300028577 | Bacteria | 1481 |
| 395 | Ga0265318_10141328 | 3300028577 | Bacteria | 884 |
| 396 | Ga0265318_10196653 | 3300028577 | Bacteria | 737 |
| 397 | Ga0265322_10007639 | 3300028654 | Bacteria | 3152 |
| 398 | Ga0265322_10015188 | 3300028654 | Bacteria | 2225 |
| 399 | Ga0265336_10003758 | 3300028666 | Bacteria | 5867 |
| 400 | Ga0265336_10025379 | 3300028666 | Bacteria | 1868 |
| 401 | Ga0265336_10117209 | 3300028666 | Bacteria | 793 |
| 402 | Ga0265336_10157664 | 3300028666 | Bacteria | 675 |
| 403 | Ga0265338_10017263 | 3300028800 | Bacteria | 7791 |
| 404 | Ga0265338_10030239 | 3300028800 | Bacteria | 5344 |
| 405 | Ga0265338_10238622 | 3300028800 | Bacteria | 1348 |
| 406 | Ga0265324_10005764 | 3300029957 | Bacteria | 5274 |
| 407 | Ga0265324_10006460 | 3300029957 | Bacteria | 4886 |
| 408 | Ga0265330_10010314 | 3300031235 | Bacteria | 4409 |
| 409 | Ga0265332_10023897 | 3300031238 | Bacteria | 2693 |
| 410 | Ga0265332_10030283 | 3300031238 | Bacteria | 2364 |
| 411 | Ga0265332_10113633 | 3300031238 | Bacteria | 1139 |
| 412 | Ga0265320_10002674 | 3300031240 | Bacteria | 12328 |
| 413 | Ga0265320_10004554 | 3300031240 | Bacteria | 9068 |
| 414 | Ga0265320_10032811 | 3300031240 | Bacteria | 2655 |
| 415 | Ga0265320_10049372 | 3300031240 | Bacteria | 2049 |
| 416 | Ga0265325_10004083 | 3300031241 | Bacteria | 9300 |
| 417 | Ga0265325_10032494 | 3300031241 | Bacteria | 2786 |
| 418 | Ga0265325_10038622 | 3300031241 | Bacteria | 2519 |
| 419 | Ga0265325_10121573 | 3300031241 | Bacteria | 1258 |
| 420 | Ga0265329_10003710 | 3300031242 | Bacteria | 6583 |
| 421 | Ga0265329_10013070 | 3300031242 | Bacteria | 2968 |
| 422 | Ga0265340_10004482 | 3300031247 | Bacteria | 7797 |
| 423 | Ga0265340_10005089 | 3300031247 | Bacteria | 7315 |
| 424 | Ga0265340_10195193 | 3300031247 | Bacteria | 912 |
| 425 | Ga0265339_10012628 | 3300031249 | Bacteria | 5145 |
| 426 | Ga0265339_10023946 | 3300031249 | Bacteria | 3523 |
| 427 | Ga0265339_10098430 | 3300031249 | Bacteria | 1525 |
| 428 | Ga0265331_10060852 | 3300031250 | Bacteria | 1783 |
| 429 | Ga0265331_10066130 | 3300031250 | Bacteria | 1698 |
| 430 | Ga0265316_10007297 | 3300031344 | Bacteria | 10426 |
| 431 | Ga0265316_10007887 | 3300031344 | Bacteria | 9962 |
| 432 | Ga0265316_10087369 | 3300031344 | Bacteria | 2382 |
| 433 | Ga0265316_10438279 | 3300031344 | Bacteria | 938 |
| 434 | Ga0307408_100288202 | 3300031548 | Bacteria | 1370 |
| 435 | Ga0265313_10022874 | 3300031595 | Bacteria | 3380 |
| 436 | Ga0265313_10023806 | 3300031595 | Bacteria | 3290 |
| 437 | Ga0265313_10053419 | 3300031595 | Bacteria | 1923 |
| 438 | Ga0265314_10005777 | 3300031711 | Bacteria | 11104 |
| 439 | Ga0265314_10016170 | 3300031711 | Bacteria | 5907 |
| 440 | Ga0265314_10025293 | 3300031711 | Bacteria | 4483 |
| 441 | Ga0265314_10126566 | 3300031711 | Bacteria | 1599 |
| 442 | Ga0265314_10127818 | 3300031711 | Bacteria | 1589 |
| 443 | Ga0265314_10181206 | 3300031711 | Bacteria | 1262 |
| 444 | Ga0265342_10034561 | 3300031712 | Bacteria | 3101 |
| 445 | Ga0265342_10091222 | 3300031712 | Bacteria | 1746 |
| 446 | Ga0316576_10010839 | 3300031727 | Bacteria | 5943 |
| 447 | Ga0316576_10021409 | 3300031727 | Bacteria | 4472 |
| 448 | Ga0316576_10135882 | 3300031727 | Bacteria | 1850 |
| 449 | Ga0316578_10168298 | 3300031728 | Bacteria | 1321 |
| 450 | Ga0316578_10229517 | 3300031728 | Bacteria | 1115 |
| 451 | Ga0307405_10062496 | 3300031731 | Bacteria | 2359 |
| 452 | Ga0316577_10017827 | 3300031733 | Bacteria | 3924 |
| 453 | Ga0307413_10362867 | 3300031824 | Bacteria | 1122 |
| 454 | Ga0307413_10825540 | 3300031824 | Bacteria | 781 |
| 455 | Ga0307410_10097333 | 3300031852 | Bacteria | 2102 |
| 456 | Ga0307406_10193213 | 3300031901 | Bacteria | 1492 |
| 457 | Ga0307407_10184578 | 3300031903 | Bacteria | 1385 |
| 458 | Ga0307409_100210060 | 3300031995 | Bacteria | 1748 |
| 459 | Ga0307409_100264503 | 3300031995 | Bacteria | 1580 |
| 460 | Ga0307409_100276520 | 3300031995 | Bacteria | 1549 |
| 461 | Ga0307409_100349566 | 3300031995 | Bacteria | 1394 |
| 462 | Ga0307409_100526807 | 3300031995 | Bacteria | 1155 |
| 463 | Ga0307416_100037079 | 3300032002 | Bacteria | 3747 |
| 464 | Ga0307416_100148138 | 3300032002 | Bacteria | 2147 |
| 465 | Ga0307416_101119319 | 3300032002 | Bacteria | 892 |
| 466 | Ga0307411_10357280 | 3300032005 | Bacteria | 1193 |
| 467 | Ga0307415_100079024 | 3300032126 | Bacteria | 2342 |
| 468 | Ga0316585_10093609 | 3300032137 | Bacteria | 983 |
| 469 | Ga0316592_1002103 | 3300033524 | Bacteria | 3380 |
| 470 | Ga0316592_1011593 | 3300033524 | Unclassified | 1794 |
| 471 | Ga0316592_1019693 | 3300033524 | Bacteria | 1429 |
| 472 | Ga0316592_1042902 | 3300033524 | Bacteria | 1003 |
| 473 | Ga0316586_1005468 | 3300033527 | Unclassified | 1788 |
| 474 | Ga0316588_1003189 | 3300033528 | Bacteria | 2958 |
| 475 | Ga0316588_1040232 | 3300033528 | Bacteria | 1116 |
| 476 | Ga0316588_1113620 | 3300033528 | Bacteria | 682 |
| 477 | Ga0373938_0017643 | 3300034957 | Bacteria | 1407 |
| 478 | Ga0373940_0035433 | 3300035088 | Bacteria | 1351 |
| 479 | Ga0373932_0147664 | 3300035112 | Bacteria | 804 |
| 480 | Ga0373939_0061523 | 3300035114 | Bacteria | 1197 |
| 481 | Ga0373943_0012907 | 3300035170 | Bacteria | 3766 |
| 482 | Ga0373955_0433772 | 3300035172 | Bacteria | 800 |
| 483 | Ga0373961_0082112 | 3300035241 | Bacteria | 1016 |
| 484 | Ga0373962_0167390 | 3300035242 | Bacteria | 728 |
| 485 | Ga0316574_0180587 | 3300035398 | Bacteria | 1358 |
| 486 | Ga0373931_0020272 | 3300035691 | Bacteria | 3325 |
| 487 | Ga0373947_0128280 | 3300035725 | Bacteria | 1617 |
| 488 | Ga0373947_0293953 | 3300035725 | Bacteria | 1082 |
| 489 | Ga0265778_001794 | 3300036457 | Bacteria | 1998 |
| 490 | Ga0316582_0052148 | 3300036647 | Bacteria | 2599 |
| 491 | Ga0316582_0078778 | 3300036647 | Bacteria | 2147 |
| 492 | Ga0316582_0331977 | 3300036647 | Bacteria | 1046 |
| 493 | Ga0316584_0012025 | 3300036712 | Bacteria | 6096 |
| 494 | Ga0373925_0276137 | 3300037068 | Bacteria | 1353 |
| 495 | Ga0373925_0282783 | 3300037068 | Bacteria | 1336 |
| 496 | Ga0373925_0311632 | 3300037068 | Bacteria | 1272 |
| 497 | Ga0395899_0281057 | 3300037312 | Bacteria | 1132 |
| 498 | Ga0395899_0291030 | 3300037312 | Bacteria | 1108 |
| 499 | Ga0395900_0011458 | 3300037418 | Bacteria | 9076 |
| 500 | Ga0395900_0078136 | 3300037418 | Bacteria | 3401 |
| 501 | Ga0395900_0275191 | 3300037418 | Bacteria | 1677 |
| 502 | Ga0395898_0079653 | 3300037466 | Bacteria | 3160 |
| 503 | Ga0395898_0110637 | 3300037466 | Bacteria | 2633 |
| 504 | Ga0395905_1127060 | 3300037471 | Bacteria | 688 |
| 505 | Ga0436364_0945409 | 3300037853 | Bacteria | 21165 |
| 506 | Ga0436364_1144605 | 3300037853 | Bacteria | 697 |
| 507 | Ga0395901_0233292 | 3300038443 | Bacteria | 1921 |
| 508 | Ga0395901_0376966 | 3300038443 | Bacteria | 1461 |
| 509 | Ga0395901_0483605 | 3300038443 | Bacteria | 1262 |
| 510 | Ga0242420_063683 | 3300038996 | Bacteria | 740 |
| 511 | Ga0400489_49086 | 3300039093 | Bacteria | 1174 |
| 512 | Ga0436365_0127171 | 3300039437 | Bacteria | 1969 |
| 513 | Ga0439466_0009869 | 3300041411 | Bacteria | 3556 |
| 514 | Ga0439465_0021011 | 3300041413 | Bacteria | 2047 |
| 515 | Ga0451797_1013749 | 3300041453 | Bacteria | 1307 |
| 516 | Ga0451807_0792724 | 3300041486 | Bacteria | 1419 |
| 517 | Ga0451833_1296515 | 3300041491 | Bacteria | 1678 |
| 518 | Ga0451837_0275658 | 3300041494 | Bacteria | 1315 |
| 519 | Ga0451839_1023332 | 3300041496 | Bacteria | 718 |
| 520 | Ga0451849_1545658 | 3300041505 | Bacteria | 1423 |
| 521 | Ga0451851_0102479 | 3300041507 | Bacteria | 1091 |
| 522 | Ga0439441_000751 | 3300042001 | Bacteria | 3794 |
| 523 | Ga0439452_055181 | 3300042010 | Bacteria | 901 |
| 524 | Ga0439454_034915 | 3300042011 | Bacteria | 804 |
| 525 | Ga0439457_035114 | 3300042014 | Bacteria | 1115 |
| 526 | Ga0450920_028342 | 3300042122 | Bacteria | 1097 |
| 527 | Ga0450920_045691 | 3300042122 | Bacteria | 875 |
| 528 | Ga0450922_001928 | 3300042124 | Bacteria | 1994 |
| 529 | Ga0450923_019946 | 3300042125 | Bacteria | 1295 |
| 530 | Ga0450896_001980 | 3300042133 | Bacteria | 2604 |
| 531 | Ga0450896_005414 | 3300042133 | Bacteria | 1740 |
| 532 | Ga0450906_003872 | 3300042145 | Bacteria | 3179 |
| 533 | Ga0450907_015085 | 3300042146 | Bacteria | 1289 |
| 534 | Ga0450910_001751 | 3300042147 | Bacteria | 2787 |
| 535 | Ga0450909_017522 | 3300042185 | Bacteria | 1061 |
| 536 | Ga0439435_0031993 | 3300042436 | Bacteria | 1434 |
| 537 | Ga0450916_022700 | 3300042530 | Bacteria | 872 |
| 538 | Ga0450918_004007 | 3300042531 | Bacteria | 2706 |
| 539 | Ga0450918_045790 | 3300042531 | Bacteria | 791 |
| 540 | Ga0451577_0276905 | 3300042876 | Bacteria | 1520 |
| 541 | Ga0453684_0466336 | 3300044712 | Bacteria | 1403 |
| 542 | Ga0453684_0548723 | 3300044712 | Bacteria | 1273 |
| 543 | Ga0451576_0023373 | 3300045051 | Bacteria | 6692 |
| 544 | Ga0451576_0086855 | 3300045051 | Bacteria | 3254 |
| 545 | Ga0451576_0344057 | 3300045051 | Bacteria | 1561 |
| 546 | Ga0451576_0653509 | 3300045051 | Unclassified | 1105 |
| 547 | Ga0451576_0681422 | 3300045051 | Bacteria | 1080 |
| 548 | Ga0495592_0036914 | 3300046454 | Bacteria | 3679 |
| 549 | Ga0495603_0212344 | 3300046455 | Bacteria | 1117 |
| 550 | Ga0495653_0025679 | 3300046463 | Bacteria | 4729 |
| 551 | Ga0495653_0155606 | 3300046463 | Bacteria | 1592 |
| 552 | Ga0495653_0168547 | 3300046463 | Bacteria | 1514 |
| 553 | Ga0495580_0142735 | 3300046472 | Bacteria | 1660 |
| 554 | Ga0495582_0048474 | 3300046473 | Bacteria | 2339 |
| 555 | Ga0495585_0166132 | 3300046492 | Bacteria | 1143 |
| 556 | Ga0495607_0260361 | 3300046501 | Bacteria | 831 |
| 557 | Ga0495618_0000835 | 3300046514 | Bacteria | 21389 |
| 558 | Ga0495618_0029382 | 3300046514 | Bacteria | 3430 |
| 559 | Ga0495620_0089707 | 3300046515 | Bacteria | 1235 |
| 560 | Ga0495628_0230218 | 3300046516 | Bacteria | 1389 |
| 561 | Ga0495628_0594758 | 3300046516 | Bacteria | 791 |
| 562 | Ga0495630_0086260 | 3300046517 | Bacteria | 2371 |
| 563 | Ga0495630_0170906 | 3300046517 | Bacteria | 1656 |
| 564 | Ga0495630_0932450 | 3300046517 | Bacteria | 661 |
| 565 | Ga0495644_0165371 | 3300046523 | Bacteria | 849 |
| 566 | Ga0495663_0119657 | 3300046525 | Bacteria | 881 |
| 567 | Ga0495663_0139456 | 3300046525 | Bacteria | 822 |
| 568 | Ga0495652_0158629 | 3300046529 | Bacteria | 1759 |
| 569 | Ga0495665_0248215 | 3300046531 | Bacteria | 917 |
| 570 | Ga0495640_0021538 | 3300046533 | Bacteria | 4729 |
| 571 | Ga0495640_0147166 | 3300046533 | Bacteria | 1515 |
| 572 | Ga0495640_0280346 | 3300046533 | Bacteria | 1038 |
| 573 | Ga0495640_0327380 | 3300046533 | Bacteria | 948 |
| 574 | Ga0495586_0124240 | 3300046535 | Bacteria | 1443 |
| 575 | Ga0495586_0130327 | 3300046535 | Bacteria | 1408 |
| 576 | Ga0495587_0179182 | 3300046536 | Bacteria | 1202 |
| 577 | Ga0495645_0071267 | 3300046543 | Bacteria | 2506 |
| 578 | Ga0495633_0105433 | 3300046558 | Bacteria | 1308 |
| 579 | Ga0495667_0111906 | 3300046559 | Bacteria | 1764 |
| 580 | Ga0495667_0173389 | 3300046559 | Bacteria | 1385 |
| 581 | Ga0495656_0126279 | 3300046615 | Bacteria | 1213 |
| 582 | Ga0495656_0249520 | 3300046615 | Bacteria | 896 |
| 583 | Ga0495656_0254061 | 3300046615 | Bacteria | 889 |
| 584 | Ga0495668_0256247 | 3300046616 | Bacteria | 958 |
| 585 | Ga0495635_0027887 | 3300046663 | Bacteria | 3927 |
| 586 | Ga0495635_0233149 | 3300046663 | Bacteria | 1243 |
| 587 | Ga0495657_0109082 | 3300046675 | Bacteria | 1755 |
| 588 | Ga0495657_0117839 | 3300046675 | Bacteria | 1675 |
| 589 | Ga0495599_0069127 | 3300046678 | Bacteria | 2204 |
| 590 | Ga0495623_0109936 | 3300046679 | Bacteria | 1672 |
| 591 | Ga0495647_0213412 | 3300046681 | Bacteria | 850 |
| 592 | Ga0495658_0485572 | 3300046683 | Unclassified | 790 |
| 593 | Ga0495613_0030825 | 3300046689 | Bacteria | 3984 |
| 594 | Ga0495613_0560506 | 3300046689 | Bacteria | 764 |
| 595 | Ga0495624_0118892 | 3300046690 | Bacteria | 1624 |
| 596 | Ga0495624_0124578 | 3300046690 | Bacteria | 1582 |
| 597 | Ga0495670_0214773 | 3300046691 | Bacteria | 1021 |
| 598 | Ga0495670_0277101 | 3300046691 | Bacteria | 897 |
| 599 | Ga0495649_0245121 | 3300046694 | Bacteria | 922 |
| 600 | Ga0495600_0110489 | 3300046809 | Bacteria | 1790 |
| 601 | Ga0495600_0282854 | 3300046809 | Bacteria | 1050 |
| 602 | Ga0495581_0065506 | 3300047315 | Bacteria | 2101 |
| 603 | Ga0495604_0076847 | 3300047317 | Bacteria | 2511 |
| 604 | Ga0495604_0243013 | 3300047317 | Bacteria | 1230 |
| 605 | Ga0495604_0304356 | 3300047317 | Bacteria | 1070 |
| 606 | Ga0495604_0425579 | 3300047317 | Bacteria | 871 |
| 607 | Ga0495674_0021809 | 3300047319 | Bacteria | 5918 |
| 608 | Ga0495674_0023760 | 3300047319 | Bacteria | 5644 |
| 609 | Ga0495674_0179290 | 3300047319 | Bacteria | 1765 |
| 610 | Ga0495676_0108821 | 3300047321 | Bacteria | 2038 |
| 611 | Ga0495676_0395063 | 3300047321 | Bacteria | 918 |
| 612 | Ga0495676_0481641 | 3300047321 | Bacteria | 816 |
| 613 | Ga0495680_0018449 | 3300047322 | Bacteria | 5924 |
| 614 | Ga0495677_0023919 | 3300047445 | Bacteria | 2217 |
| 615 | Ga0495679_074150 | 3300047446 | Bacteria | 975 |
| 616 | Ga0495684_0014428 | 3300047471 | Bacteria | 6079 |
| 617 | Ga0495593_0329264 | 3300047673 | Bacteria | 763 |
| 618 | Ga0496100_0065733 | 3300048903 | Bacteria | 2404 |
| 619 | Ga0496100_0176399 | 3300048903 | Bacteria | 1543 |
| 620 | Ga0496100_0196497 | 3300048903 | Bacteria | 1468 |
| 621 | Ga0496101_0303721 | 3300048904 | Bacteria | 1250 |
| 622 | Ga0496102_0062414 | 3300048905 | Bacteria | 3412 |
| 623 | Ga0496102_0093348 | 3300048905 | Bacteria | 2788 |
| 624 | Ga0496102_0204953 | 3300048905 | Bacteria | 1859 |
| 625 | Ga0496102_0283726 | 3300048905 | Bacteria | 1561 |
| 626 | Ga0496102_0448319 | 3300048905 | Bacteria | 1211 |
| 627 | Ga0496102_0479623 | 3300048905 | Bacteria | 1165 |
| 628 | Ga0496103_0300912 | 3300048906 | Bacteria | 1032 |
| 629 | Ga0496104_0030684 | 3300048907 | Bacteria | 4996 |
| 630 | Ga0496104_0045348 | 3300048907 | Bacteria | 4134 |
| 631 | Ga0496104_0105890 | 3300048907 | Bacteria | 2695 |
| 632 | Ga0496104_0106484 | 3300048907 | Bacteria | 2687 |
| 633 | Ga0496104_0292437 | 3300048907 | Bacteria | 1541 |
| 634 | Ga0496104_0477921 | 3300048907 | Bacteria | 1157 |
| 635 | Ga0496104_0693702 | 3300048907 | Bacteria | 926 |
| 636 | Ga0496104_1027282 | 3300048907 | Bacteria | 728 |
| 637 | Ga0496105_0006302 | 3300048908 | Bacteria | 9113 |
| 638 | Ga0496105_0017099 | 3300048908 | Bacteria | 5807 |
| 639 | Ga0496105_0083357 | 3300048908 | Bacteria | 2640 |
| 640 | Ga0496105_0394569 | 3300048908 | Bacteria | 1099 |
| 641 | Ga0496106_0175060 | 3300048909 | Bacteria | 1702 |
| 642 | Ga0496106_0472103 | 3300048909 | Bacteria | 1008 |
| 643 | Ga0496107_0246314 | 3300048910 | Bacteria | 1330 |
| 644 | Ga0496107_0301517 | 3300048910 | Bacteria | 1192 |
| 645 | Ga0496108_0004171 | 3300048911 | Bacteria | 11634 |
| 646 | Ga0496108_0006346 | 3300048911 | Bacteria | 9583 |
| 647 | Ga0496108_0082677 | 3300048911 | Bacteria | 2723 |
| 648 | Ga0496108_0165463 | 3300048911 | Bacteria | 1912 |
| 649 | Ga0496108_0169926 | 3300048911 | Bacteria | 1886 |
| 650 | Ga0496108_0267302 | 3300048911 | Bacteria | 1488 |
| 651 | Ga0496108_0361917 | 3300048911 | Bacteria | 1266 |
| 652 | Ga0496109_0010919 | 3300048912 | Bacteria | 7780 |
| 653 | Ga0496109_0066887 | 3300048912 | Bacteria | 3291 |
| 654 | Ga0496109_0082254 | 3300048912 | Bacteria | 2967 |
| 655 | Ga0496109_0183191 | 3300048912 | Bacteria | 1967 |
| 656 | Ga0496109_0220804 | 3300048912 | Bacteria | 1782 |
| 657 | Ga0496109_0249529 | 3300048912 | Bacteria | 1671 |
| 658 | Ga0496109_0265962 | 3300048912 | Bacteria | 1615 |
| 659 | Ga0496109_0270643 | 3300048912 | Bacteria | 1600 |
| 660 | Ga0496109_0575489 | 3300048912 | Bacteria | 1062 |
| 661 | Ga0496109_0951889 | 3300048912 | Bacteria | 796 |
| 662 | Ga0496110_0011695 | 3300048913 | Bacteria | 7199 |
| 663 | Ga0496110_0208719 | 3300048913 | Bacteria | 1775 |
| 664 | Ga0496110_0616886 | 3300048913 | Bacteria | 983 |
| 665 | Ga0496111_0004472 | 3300048914 | Bacteria | 8845 |
| 666 | Ga0496111_0058011 | 3300048914 | Bacteria | 2803 |
| 667 | Ga0496111_0094502 | 3300048914 | Bacteria | 2192 |
| 668 | Ga0496112_0034588 | 3300048915 | Bacteria | 4917 |
| 669 | Ga0496112_0209892 | 3300048915 | Bacteria | 1905 |
| 670 | Ga0496112_0265216 | 3300048915 | Bacteria | 1666 |
| 671 | Ga0496112_0319696 | 3300048915 | Bacteria | 1496 |
| 672 | Ga0496112_0464302 | 3300048915 | Bacteria | 1203 |
| 673 | Ga0496112_0554930 | 3300048915 | Bacteria | 1082 |
| 674 | Ga0496113_0000388 | 3300048916 | Bacteria | 21265 |
| 675 | Ga0496113_0086046 | 3300048916 | Bacteria | 2415 |
| 676 | Ga0496114_0037887 | 3300048917 | Bacteria | 3989 |
| 677 | Ga0496114_0056294 | 3300048917 | Bacteria | 3281 |
| 678 | Ga0496114_0183723 | 3300048917 | Bacteria | 1827 |
| 679 | Ga0496114_0298884 | 3300048917 | Bacteria | 1421 |
| 680 | Ga0496114_0334740 | 3300048917 | Bacteria | 1338 |
| 681 | Ga0496114_0348369 | 3300048917 | Bacteria | 1310 |
| 682 | Ga0496114_0413911 | 3300048917 | Bacteria | 1194 |
| 683 | Ga0501313_000380 | 3300049529 | Bacteria | 2921 |
| 684 | Ga0501031_0002221 | 3300049568 | Bacteria | 12272 |
| 685 | Ga0501031_0006598 | 3300049568 | Bacteria | 7572 |
| 686 | Ga0501031_0007761 | 3300049568 | Bacteria | 6983 |
| 687 | Ga0501031_0032439 | 3300049568 | Bacteria | 3406 |
| 688 | Ga0501031_0038486 | 3300049568 | Bacteria | 3121 |
| 689 | Ga0501031_0120327 | 3300049568 | Bacteria | 1715 |
| 690 | Ga0501031_0243428 | 3300049568 | Bacteria | 1169 |
| 691 | Ga0501031_0283283 | 3300049568 | Bacteria | 1075 |
| 692 | Ga0501031_0311539 | 3300049568 | Bacteria | 1020 |
| 693 | Ga0501031_0407303 | 3300049568 | Bacteria | 879 |
| 694 | Ga0501031_0485215 | 3300049568 | Bacteria | 797 |
| 695 | Ga0501032_0041231 | 3300049569 | Bacteria | 3136 |
| 696 | Ga0501032_0178347 | 3300049569 | Bacteria | 1392 |
| 697 | Ga0501033_0268338 | 3300049570 | Bacteria | 1207 |
| 698 | Ga0501033_0610177 | 3300049570 | Bacteria | 748 |
| 699 | Ga0501034_0571846 | 3300049571 | Bacteria | 1038 |
| 700 | Ga0501036_0008133 | 3300049572 | Bacteria | 8596 |
| 701 | Ga0501036_0019967 | 3300049572 | Bacteria | 5625 |
| 702 | Ga0501036_0031368 | 3300049572 | Bacteria | 4491 |
| 703 | Ga0501036_0111993 | 3300049572 | Bacteria | 2306 |
| 704 | Ga0501036_0121956 | 3300049572 | Bacteria | 2201 |
| 705 | Ga0501036_0391487 | 3300049572 | Bacteria | 1159 |
| 706 | Ga0501036_0665812 | 3300049572 | Bacteria | 861 |
| 707 | Ga0501037_0036167 | 3300049573 | Bacteria | 3639 |
| 708 | Ga0501037_0082713 | 3300049573 | Bacteria | 2326 |
| 709 | Ga0501037_0237537 | 3300049573 | Bacteria | 1278 |
| 710 | Ga0501037_0368415 | 3300049573 | Bacteria | 989 |
| 711 | Ga0501037_0388833 | 3300049573 | Bacteria | 958 |
| 712 | Ga0501037_0560865 | 3300049573 | Bacteria | 770 |
| 713 | Ga0501038_0018194 | 3300049574 | Bacteria | 6343 |
| 714 | Ga0501038_0041796 | 3300049574 | Bacteria | 3997 |
| 715 | Ga0501038_0233696 | 3300049574 | Bacteria | 1462 |
| 716 | Ga0501038_0313729 | 3300049574 | Bacteria | 1228 |
| 717 | Ga0501038_0381144 | 3300049574 | Bacteria | 1094 |
| 718 | Ga0501038_0509930 | 3300049574 | Bacteria | 919 |
| 719 | Ga0501038_0716855 | 3300049574 | Bacteria | 748 |
| 720 | Ga0501039_0012581 | 3300049575 | Bacteria | 6466 |
| 721 | Ga0501039_0016553 | 3300049575 | Bacteria | 5647 |
| 722 | Ga0501039_0036471 | 3300049575 | Bacteria | 3794 |
| 723 | Ga0501039_0092904 | 3300049575 | Bacteria | 2351 |
| 724 | Ga0501039_0093591 | 3300049575 | Bacteria | 2342 |
| 725 | Ga0501039_0113529 | 3300049575 | Bacteria | 2119 |
| 726 | Ga0501039_0180062 | 3300049575 | Bacteria | 1662 |
| 727 | Ga0501039_0283438 | 3300049575 | Bacteria | 1302 |
| 728 | Ga0501039_0302139 | 3300049575 | Bacteria | 1258 |
| 729 | Ga0501039_0475241 | 3300049575 | Bacteria | 981 |
| 730 | Ga0501039_0669543 | 3300049575 | Bacteria | 812 |
| 731 | Ga0501040_0003390 | 3300049576 | Bacteria | 10281 |
| 732 | Ga0501040_0004923 | 3300049576 | Bacteria | 8643 |
| 733 | Ga0501040_0012347 | 3300049576 | Bacteria | 5596 |
| 734 | Ga0501040_0015872 | 3300049576 | Bacteria | 4978 |
| 735 | Ga0501040_0023669 | 3300049576 | Bacteria | 4119 |
| 736 | Ga0501040_0023904 | 3300049576 | Bacteria | 4098 |
| 737 | Ga0501040_0068761 | 3300049576 | Bacteria | 2442 |
| 738 | Ga0501040_0186983 | 3300049576 | Bacteria | 1469 |
| 739 | Ga0501040_0516066 | 3300049576 | Bacteria | 861 |
| 740 | Ga0501041_0003558 | 3300049577 | Bacteria | 8966 |
| 741 | Ga0501041_0013616 | 3300049577 | Bacteria | 4823 |
| 742 | Ga0501041_0013840 | 3300049577 | Bacteria | 4782 |
| 743 | Ga0501041_0148350 | 3300049577 | Bacteria | 1464 |
| 744 | Ga0501041_0198003 | 3300049577 | Bacteria | 1259 |
| 745 | Ga0501041_0252089 | 3300049577 | Bacteria | 1109 |
| 746 | Ga0501041_0332824 | 3300049577 | Bacteria | 958 |
| 747 | Ga0501042_0000354 | 3300049578 | Bacteria | 23064 |
| 748 | Ga0501042_0003443 | 3300049578 | Bacteria | 9942 |
| 749 | Ga0501042_0112599 | 3300049578 | Bacteria | 1959 |
| 750 | Ga0501042_0125271 | 3300049578 | Bacteria | 1850 |
| 751 | Ga0501042_0202837 | 3300049578 | Bacteria | 1430 |
| 752 | Ga0501042_0243980 | 3300049578 | Bacteria | 1296 |
| 753 | Ga0501042_0246349 | 3300049578 | Bacteria | 1289 |
| 754 | Ga0501042_0654652 | 3300049578 | Bacteria | 764 |
| 755 | Ga0501042_0714937 | 3300049578 | Bacteria | 728 |
| 756 | Ga0501043_0117940 | 3300049579 | Bacteria | 2082 |
| 757 | Ga0501046_0013506 | 3300049580 | Bacteria | 6913 |
| 758 | Ga0501046_0062650 | 3300049580 | Bacteria | 2905 |
| 759 | Ga0501046_0127168 | 3300049580 | Bacteria | 1935 |
| 760 | Ga0501046_0134747 | 3300049580 | Bacteria | 1871 |
| 761 | Ga0501046_0162054 | 3300049580 | Bacteria | 1681 |
| 762 | Ga0501046_0234838 | 3300049580 | Bacteria | 1354 |
| 763 | Ga0501046_0307618 | 3300049580 | Bacteria | 1156 |
| 764 | Ga0501048_0004627 | 3300049582 | Bacteria | 10470 |
| 765 | Ga0501048_0010287 | 3300049582 | Bacteria | 6994 |
| 766 | Ga0501048_0028679 | 3300049582 | Bacteria | 4041 |
| 767 | Ga0501048_0033054 | 3300049582 | Bacteria | 3738 |
| 768 | Ga0501048_0074559 | 3300049582 | Bacteria | 2394 |
| 769 | Ga0501048_0254374 | 3300049582 | Bacteria | 1247 |
| 770 | Ga0501048_0686000 | 3300049582 | Bacteria | 735 |
| 771 | Ga0501048_0726957 | 3300049582 | Bacteria | 713 |
| 772 | Ga0501067_0018522 | 3300049583 | Bacteria | 3856 |
| 773 | Ga0501067_0086124 | 3300049583 | Bacteria | 1743 |
| 774 | Ga0501067_0118378 | 3300049583 | Bacteria | 1473 |
| 775 | Ga0501067_0137377 | 3300049583 | Bacteria | 1361 |
| 776 | Ga0501068_0052733 | 3300049584 | Bacteria | 2461 |
| 777 | Ga0501068_0082289 | 3300049584 | Bacteria | 1977 |
| 778 | Ga0501068_0177987 | 3300049584 | Bacteria | 1344 |
| 779 | Ga0501068_0225629 | 3300049584 | Bacteria | 1191 |
| 780 | Ga0501068_0322273 | 3300049584 | Bacteria | 991 |
| 781 | Ga0501068_0673635 | 3300049584 | Bacteria | 676 |
| 782 | Ga0501069_0005185 | 3300049585 | Bacteria | 6772 |
| 783 | Ga0501069_0014693 | 3300049585 | Bacteria | 4188 |
| 784 | Ga0501069_0019906 | 3300049585 | Bacteria | 3631 |
| 785 | Ga0501069_0028143 | 3300049585 | Bacteria | 3081 |
| 786 | Ga0501069_0063145 | 3300049585 | Bacteria | 2068 |
| 787 | Ga0501069_0071411 | 3300049585 | Bacteria | 1946 |
| 788 | Ga0501069_0107172 | 3300049585 | Bacteria | 1589 |
| 789 | Ga0501069_0120939 | 3300049585 | Bacteria | 1495 |
| 790 | Ga0501070_0020406 | 3300049586 | Bacteria | 5559 |
| 791 | Ga0501070_0022493 | 3300049586 | Bacteria | 5280 |
| 792 | Ga0501070_0107865 | 3300049586 | Bacteria | 2301 |
| 793 | Ga0501070_0332233 | 3300049586 | Bacteria | 1235 |
| 794 | Ga0501070_0431875 | 3300049586 | Bacteria | 1063 |
| 795 | Ga0501070_0490009 | 3300049586 | Bacteria | 988 |
| 796 | Ga0501071_0002073 | 3300049587 | Bacteria | 12021 |
| 797 | Ga0501071_0003597 | 3300049587 | Bacteria | 9710 |
| 798 | Ga0501071_0010617 | 3300049587 | Bacteria | 6177 |
| 799 | Ga0501071_0012949 | 3300049587 | Bacteria | 5673 |
| 800 | Ga0501071_0028427 | 3300049587 | Bacteria | 3941 |
| 801 | Ga0501071_0107509 | 3300049587 | Bacteria | 2060 |
| 802 | Ga0501071_0216864 | 3300049587 | Bacteria | 1439 |
| 803 | Ga0501071_0263287 | 3300049587 | Bacteria | 1302 |
| 804 | Ga0501071_0551392 | 3300049587 | Bacteria | 885 |
| 805 | Ga0501071_0583079 | 3300049587 | Bacteria | 859 |
| 806 | Ga0501071_0698273 | 3300049587 | Bacteria | 781 |
| 807 | Ga0501072_0000902 | 3300049588 | Bacteria | 21781 |
| 808 | Ga0501072_0003791 | 3300049588 | Bacteria | 11412 |
| 809 | Ga0501072_0012319 | 3300049588 | Bacteria | 6535 |
| 810 | Ga0501072_0020781 | 3300049588 | Bacteria | 5088 |
| 811 | Ga0501072_0047498 | 3300049588 | Bacteria | 3380 |
| 812 | Ga0501072_0132579 | 3300049588 | Bacteria | 1986 |
| 813 | Ga0501072_0305160 | 3300049588 | Bacteria | 1265 |
| 814 | Ga0501072_0454250 | 3300049588 | Bacteria | 1014 |
| 815 | Ga0501072_0765873 | 3300049588 | Bacteria | 757 |
| 816 | Ga0501073_0073359 | 3300049589 | Bacteria | 2383 |
| 817 | Ga0501073_0155143 | 3300049589 | Bacteria | 1587 |
| 818 | Ga0501073_0218913 | 3300049589 | Bacteria | 1315 |
| 819 | Ga0501073_0236165 | 3300049589 | Bacteria | 1262 |
| 820 | Ga0501073_0334233 | 3300049589 | Bacteria | 1046 |
| 821 | Ga0501073_0461354 | 3300049589 | Bacteria | 878 |
| 822 | Ga0501074_0013091 | 3300049590 | Bacteria | 6030 |
| 823 | Ga0501074_0018872 | 3300049590 | Bacteria | 5009 |
| 824 | Ga0501074_0080636 | 3300049590 | Bacteria | 2334 |
| 825 | Ga0501074_0126796 | 3300049590 | Bacteria | 1826 |
| 826 | Ga0501074_0149642 | 3300049590 | Bacteria | 1669 |
| 827 | Ga0501074_0214662 | 3300049590 | Bacteria | 1370 |
| 828 | Ga0501074_0246949 | 3300049590 | Bacteria | 1269 |
| 829 | Ga0501074_0459732 | 3300049590 | Bacteria | 902 |
| 830 | Ga0501075_0003239 | 3300049591 | Bacteria | 10896 |
| 831 | Ga0501075_0045819 | 3300049591 | Bacteria | 3283 |
| 832 | Ga0501075_0074087 | 3300049591 | Bacteria | 2575 |
| 833 | Ga0501075_0089617 | 3300049591 | Bacteria | 2332 |
| 834 | Ga0501075_0144303 | 3300049591 | Bacteria | 1814 |
| 835 | Ga0501075_0165768 | 3300049591 | Bacteria | 1685 |
| 836 | Ga0501075_0185168 | 3300049591 | Bacteria | 1588 |
| 837 | Ga0501075_0196272 | 3300049591 | Bacteria | 1539 |
| 838 | Ga0501075_0216075 | 3300049591 | Bacteria | 1462 |
| 839 | Ga0501075_0406120 | 3300049591 | Bacteria | 1038 |
| 840 | Ga0501075_0420767 | 3300049591 | Bacteria | 1019 |
| 841 | Ga0501075_0426359 | 3300049591 | Bacteria | 1011 |
| 842 | Ga0501075_0452144 | 3300049591 | Bacteria | 979 |
| 843 | Ga0501076_0001686 | 3300049592 | Bacteria | 14936 |
| 844 | Ga0501076_0004778 | 3300049592 | Bacteria | 9670 |
| 845 | Ga0501076_0007739 | 3300049592 | Bacteria | 7830 |
| 846 | Ga0501076_0016016 | 3300049592 | Bacteria | 5675 |
| 847 | Ga0501076_0018028 | 3300049592 | Bacteria | 5372 |
| 848 | Ga0501076_0030831 | 3300049592 | Bacteria | 4178 |
| 849 | Ga0501076_0042677 | 3300049592 | Bacteria | 3571 |
| 850 | Ga0501076_0053047 | 3300049592 | Bacteria | 3212 |
| 851 | Ga0501076_0075645 | 3300049592 | Bacteria | 2699 |
| 852 | Ga0501076_0083058 | 3300049592 | Bacteria | 2572 |
| 853 | Ga0501076_0132266 | 3300049592 | Bacteria | 2023 |
| 854 | Ga0501076_0153554 | 3300049592 | Bacteria | 1873 |
| 855 | Ga0501076_0298269 | 3300049592 | Bacteria | 1321 |
| 856 | Ga0501076_0446908 | 3300049592 | Bacteria | 1064 |
| 857 | Ga0501077_0003237 | 3300049593 | Bacteria | 9808 |
| 858 | Ga0501077_0008753 | 3300049593 | Bacteria | 6280 |
| 859 | Ga0501077_0052363 | 3300049593 | Bacteria | 2593 |
| 860 | Ga0501077_0128182 | 3300049593 | Bacteria | 1608 |
| 861 | Ga0501077_0140380 | 3300049593 | Bacteria | 1532 |
| 862 | Ga0501245_027459 | 3300049708 | Bacteria | 924 |
| 863 | Ga0501079_0001191 | 3300049741 | Bacteria | 18223 |
| 864 | Ga0501079_0014153 | 3300049741 | Bacteria | 6080 |
| 865 | Ga0501079_0026730 | 3300049741 | Bacteria | 4424 |
| 866 | Ga0501079_0051529 | 3300049741 | Bacteria | 3178 |
| 867 | Ga0501079_0102887 | 3300049741 | Bacteria | 2215 |
| 868 | Ga0501079_0131569 | 3300049741 | Bacteria | 1947 |
| 869 | Ga0501079_0270213 | 3300049741 | Bacteria | 1329 |
| 870 | Ga0501079_0287564 | 3300049741 | Bacteria | 1285 |
| 871 | Ga0501079_0322925 | 3300049741 | Bacteria | 1208 |
| 872 | Ga0501079_0387093 | 3300049741 | Bacteria | 1096 |
| 873 | Ga0501079_0430790 | 3300049741 | Bacteria | 1035 |
| 874 | Ga0501079_0614527 | 3300049741 | Bacteria | 855 |
| 875 | Ga0501079_0929154 | 3300049741 | Bacteria | 685 |
| 876 | Ga0501080_0001271 | 3300049742 | Bacteria | 20969 |
| 877 | Ga0501080_0013538 | 3300049742 | Bacteria | 7508 |
| 878 | Ga0501080_0037024 | 3300049742 | Bacteria | 4555 |
| 879 | Ga0501080_0047334 | 3300049742 | Bacteria | 4003 |
| 880 | Ga0501080_0124356 | 3300049742 | Bacteria | 2389 |
| 881 | Ga0501080_0164349 | 3300049742 | Bacteria | 2049 |
| 882 | Ga0501080_0178051 | 3300049742 | Bacteria | 1958 |
| 883 | Ga0501080_0325256 | 3300049742 | Bacteria | 1391 |
| 884 | Ga0501080_0397571 | 3300049742 | Bacteria | 1240 |
| 885 | Ga0501080_0409644 | 3300049742 | Bacteria | 1219 |
| 886 | Ga0501080_0723607 | 3300049742 | Bacteria | 877 |
| 887 | Ga0501080_0777010 | 3300049742 | Bacteria | 841 |
| 888 | Ga0501081_0000266 | 3300049743 | Bacteria | 27345 |
| 889 | Ga0501081_0010955 | 3300049743 | Bacteria | 5925 |
| 890 | Ga0501081_0020465 | 3300049743 | Bacteria | 4410 |
| 891 | Ga0501081_0028468 | 3300049743 | Bacteria | 3771 |
| 892 | Ga0501081_0058222 | 3300049743 | Bacteria | 2673 |
| 893 | Ga0501081_0097743 | 3300049743 | Bacteria | 2072 |
| 894 | Ga0501081_0187191 | 3300049743 | Bacteria | 1498 |
| 895 | Ga0501081_0199623 | 3300049743 | Bacteria | 1450 |
| 896 | Ga0501081_0262858 | 3300049743 | Bacteria | 1261 |
| 897 | Ga0501081_0385559 | 3300049743 | Bacteria | 1036 |
| 898 | Ga0501083_0046415 | 3300049744 | Bacteria | 2937 |
| 899 | Ga0501083_0049872 | 3300049744 | Bacteria | 2820 |
| 900 | Ga0501083_0058547 | 3300049744 | Bacteria | 2578 |
| 901 | Ga0501083_0063865 | 3300049744 | Bacteria | 2455 |
| 902 | Ga0501083_0499761 | 3300049744 | Bacteria | 792 |
| 903 | Ga0501035_0025187 | 3300049822 | Bacteria | 5454 |
| 904 | Ga0501035_0032231 | 3300049822 | Bacteria | 4769 |
| 905 | Ga0501035_0036258 | 3300049822 | Bacteria | 4471 |
| 906 | Ga0501035_0324345 | 3300049822 | Bacteria | 1293 |
| 907 | Ga0501035_0366214 | 3300049822 | Bacteria | 1204 |
| 908 | Ga0501044_0047472 | 3300049823 | Bacteria | 4441 |
| 909 | Ga0501044_0323262 | 3300049823 | Bacteria | 1467 |
| 910 | Ga0501045_0002435 | 3300049824 | Bacteria | 12648 |
| 911 | Ga0501045_0011994 | 3300049824 | Bacteria | 6093 |
| 912 | Ga0501045_0031322 | 3300049824 | Bacteria | 3852 |
| 913 | Ga0501045_0050905 | 3300049824 | Bacteria | 3022 |
| 914 | Ga0501045_0056481 | 3300049824 | Bacteria | 2871 |
| 915 | Ga0501045_0085387 | 3300049824 | Bacteria | 2329 |
| 916 | Ga0501045_0135570 | 3300049824 | Bacteria | 1830 |
| 917 | Ga0501045_0339821 | 3300049824 | Bacteria | 1117 |
| 918 | Ga0501045_0367641 | 3300049824 | Bacteria | 1070 |
| 919 | Ga0501045_0606375 | 3300049824 | Bacteria | 810 |
| 920 | nmdc:mga06z11_30935_c1 | 3300050494 | Bacteria | 2595 |
| 921 | nmdc:mga05p37_24103_c1 | 3300050507 | Bacteria | 7391 |
| 922 | nmdc:mga05p37_326858_c1 | 3300050507 | Bacteria | 1813 |
| 923 | nmdc:mga05p37_455407_c1 | 3300050507 | Bacteria | 1480 |
| 924 | nmdc:mga05p37_520300_c1 | 3300050507 | Bacteria | 1361 |
| 925 | nmdc:mga05p37_67483_c1 | 3300050507 | Bacteria | 4401 |
| 926 | nmdc:mga05p37_931826_c1 | 3300050507 | Bacteria | 932 |
| 927 | nmdc:mga09592_29303_c1 | 3300050508 | Bacteria | 4578 |
| 928 | nmdc:mga0qj67_7823_c1 | 3300050509 | Bacteria | 7902 |
| 929 | nmdc:mga08y16_128154_c1 | 3300050511 | Bacteria | 2640 |
| 930 | nmdc:mga08y16_162446_c1 | 3300050511 | Bacteria | 2321 |
| 931 | nmdc:mga08y16_193536_c1 | 3300050511 | Bacteria | 2108 |
| 932 | nmdc:mga08y16_266255_c1 | 3300050511 | Bacteria | 1769 |
| 933 | nmdc:mga08y16_41644_c1 | 3300050511 | Bacteria | 4811 |
| 934 | nmdc:mga08y16_804969_c1 | 3300050511 | Bacteria | 932 |
| 935 | nmdc:mga0n895_1231530_c1 | 3300050512 | Bacteria | 721 |
| 936 | nmdc:mga0n895_523953_c1 | 3300050512 | Bacteria | 1193 |
| 937 | nmdc:mga0n895_68491_c1 | 3300050512 | Bacteria | 3516 |
| 938 | nmdc:mga0n895_841206_c1 | 3300050512 | Bacteria | 906 |
| 939 | nmdc:mga0rr50_150012_c1 | 3300050513 | Bacteria | 1883 |
| 940 | nmdc:mga0rr50_237462_c1 | 3300050513 | Bacteria | 1510 |
| 941 | nmdc:mga08x19_730973_c1 | 3300050514 | Bacteria | 703 |
| 942 | nmdc:mga0a205_305261_c1 | 3300050515 | Bacteria | 1464 |
| 943 | nmdc:mga0a205_31904_c1 | 3300050515 | Bacteria | 5050 |
| 944 | nmdc:mga0a205_392696_c1 | 3300050515 | Bacteria | 1251 |
| 945 | nmdc:mga0a205_92626_c1 | 3300050515 | Bacteria | 2920 |
| 946 | Ga0495601_0015733 | 3300053077 | Bacteria | 4576 |
| 947 | Ga0495601_0016271 | 3300053077 | Bacteria | 4506 |
| 948 | Ga0495601_0223341 | 3300053077 | Bacteria | 1230 |
| 949 | Ga0495595_0046669 | 3300053084 | Bacteria | 1996 |
| 950 | Ga0495595_0113592 | 3300053084 | Bacteria | 1315 |
| 951 | Ga0495619_0062715 | 3300053085 | Bacteria | 2475 |
| 952 | Ga0495619_0067168 | 3300053085 | Bacteria | 2393 |
| 953 | Ga0495619_0121015 | 3300053085 | Bacteria | 1795 |
| 954 | Ga0495619_0124250 | 3300053085 | Bacteria | 1770 |
| 955 | Ga0495619_0607651 | 3300053085 | Bacteria | 748 |
| 956 | Ga0500641_0169825 | 3300053096 | Bacteria | 939 |
| 957 | Ga0501084_0006409 | 3300054114 | Bacteria | 9674 |
| 958 | Ga0501084_0007201 | 3300054114 | Bacteria | 9166 |
| 959 | Ga0501084_0007985 | 3300054114 | Bacteria | 8712 |
| 960 | Ga0501084_0011498 | 3300054114 | Bacteria | 7329 |
| 961 | Ga0501084_0017618 | 3300054114 | Bacteria | 5943 |
| 962 | Ga0501084_0027958 | 3300054114 | Bacteria | 4712 |
| 963 | Ga0501084_0183163 | 3300054114 | Bacteria | 1768 |
| 964 | Ga0501084_0212895 | 3300054114 | Bacteria | 1630 |
| 965 | Ga0501084_0219686 | 3300054114 | Bacteria | 1603 |
| 966 | Ga0501084_0222010 | 3300054114 | Bacteria | 1594 |
| 967 | Ga0501084_0233509 | 3300054114 | Bacteria | 1552 |
| 968 | Ga0501084_0255193 | 3300054114 | Bacteria | 1480 |
| 969 | Ga0501084_0461003 | 3300054114 | Bacteria | 1074 |
| 970 | Ga0501084_0749082 | 3300054114 | Bacteria | 823 |
| 971 | Ga0590071_001535 | 3300059421 | Bacteria | 6043 |
| 972 | Ga0590074_001128 | 3300059423 | Bacteria | 4203 |
| 973 | Ga0590075_001726 | 3300059424 | Bacteria | 5353 |
| 974 | Ga0590075_003707 | 3300059424 | Bacteria | 3628 |
| 975 | Ga0590077_002811 | 3300059426 | Bacteria | 3663 |
| 976 | Ga0587066_004149 | 3300059490 | Bacteria | 1759 |
| 977 | Ga0587086_002384 | 3300059507 | Bacteria | 1769 |
| 978 | Ga0587086_012970 | 3300059507 | Bacteria | 1044 |
| 979 | Ga0587098_017119 | 3300059604 | Bacteria | 885 |
| 980 | Ga0587109_014070 | 3300059624 | Bacteria | 1337 |
| 981 | Ga0587122_007305 | 3300059628 | Bacteria | 976 |
| 982 | Ga0587062_002485 | 3300059639 | Bacteria | 1760 |
| 983 | Ga0587062_032872 | 3300059639 | Bacteria | 804 |
| 984 | Ga0587072_004262 | 3300059643 | Bacteria | 2067 |
| 985 | Ga0587076_004005 | 3300059645 | Bacteria | 1807 |
| 986 | Ga0587111_0015289 | 3300060346 | Bacteria | 1401 |
| 987 | Ga0501082_0005427 | 3300060353 | Bacteria | 11067 |
| 988 | Ga0501082_0016210 | 3300060353 | Bacteria | 6414 |
| 989 | Ga0501082_0020323 | 3300060353 | Bacteria | 5724 |
| 990 | Ga0501082_0041465 | 3300060353 | Bacteria | 3969 |
| 991 | Ga0501082_0070499 | 3300060353 | Bacteria | 3009 |
| 992 | Ga0501082_0122351 | 3300060353 | Bacteria | 2256 |
| 993 | Ga0501082_0166131 | 3300060353 | Bacteria | 1918 |
| 994 | Ga0501082_0185205 | 3300060353 | Bacteria | 1811 |
| 995 | Ga0501082_0270315 | 3300060353 | Bacteria | 1479 |
| 996 | Ga0501082_0494243 | 3300060353 | Bacteria | 1069 |
| 997 | Ga0501082_0534703 | 3300060353 | Bacteria | 1025 |
| 998 | Ga0501082_0688611 | 3300060353 | Bacteria | 895 |
| 999 | Ga0530510_0005977 | 3300061734 | Bacteria | 8443 |
| 1000 | Ga0530510_0007526 | 3300061734 | Bacteria | 7585 |
| 1001 | Ga0530510_0009346 | 3300061734 | Bacteria | 6875 |
| 1002 | Ga0530510_0012738 | 3300061734 | Bacteria | 5911 |
| 1003 | Ga0530510_0017434 | 3300061734 | Bacteria | 5090 |
| 1004 | Ga0530510_0019709 | 3300061734 | Bacteria | 4790 |
| 1005 | Ga0530510_0027649 | 3300061734 | Bacteria | 4064 |
| 1006 | Ga0530510_0042765 | 3300061734 | Bacteria | 3273 |
| 1007 | Ga0530510_0047244 | 3300061734 | Bacteria | 3110 |
| 1008 | Ga0530510_0072734 | 3300061734 | Bacteria | 2495 |
| 1009 | Ga0530510_0306949 | 3300061734 | Bacteria | 1188 |
| 1010 | Ga0530510_0359033 | 3300061734 | Bacteria | 1095 |
| 1011 | Ga0530510_0403613 | 3300061734 | Bacteria | 1030 |
| 1012 | Ga0530510_0670923 | 3300061734 | Bacteria | 790 |
| 1013 | Ga0070658_10280879 | |||
| 1014 | JGI24735J21928_10011983 | |||
| 1015 | JGI24744J21845_10012636 | |||
| 1016 | Ga0006778J45830_1011230 | |||
| 1017 | JGI25406J46586_10008605 | |||
| 1018 | rootL2_10029981 | |||
| 1019 | Ga0006562J51391_1019008 | |||
| 1020 | Ga0058863_10037182 | |||
| 1021 | Ga0058862_12849316 | |||
| 1022 | Ga0065704_10423144 | |||
| 1023 | Ga0065707_10320127 | |||
| 1024 | Ga0070676_10064352 | |||
| 1025 | Ga0070683_100157459 | |||
| 1026 | Ga0070683_100497249 | |||
| 1027 | Ga0070683_100694216 | |||
| 1028 | Ga0070683_101119971 | |||
| 1029 | Ga0070690_100065223 | |||
| 1030 | Ga0070690_100091201 | |||
| 1031 | Ga0070670_100029629 | |||
| 1032 | Ga0070670_100448765 | |||
| 1033 | Ga0068869_100360265 | |||
| 1034 | Ga0068869_100468851 | |||
| 1035 | Ga0070666_10271538 | |||
| 1036 | Ga0070680_100000015 | |||
| 1037 | Ga0070680_100560389 | |||
| 1038 | Ga0070680_100919950 | |||
| 1039 | Ga0070682_100286223 | |||
| 1040 | Ga0070682_100437240 | |||
| 1041 | Ga0070682_100563372 | |||
| 1042 | Ga0068868_100115200 | |||
| 1043 | Ga0068868_100150634 | |||
| 1044 | Ga0070660_100172010 | |||
| 1045 | Ga0070691_10229783 | |||
| 1046 | Ga0070687_100007831 | |||
| 1047 | Ga0070687_100055451 | |||
| 1048 | Ga0070669_100574785 | |||
| 1049 | Ga0070675_100240672 | |||
| 1050 | Ga0070675_100276625 | |||
| 1051 | Ga0070675_100507915 | |||
| 1052 | Ga0070671_100184383 | |||
| 1053 | Ga0070674_100077936 | |||
| 1054 | Ga0070674_100171292 | |||
| 1055 | Ga0070674_100432382 | |||
| 1056 | Ga0070674_100811884 | |||
| 1057 | Ga0070673_100135991 | |||
| 1058 | Ga0070688_100014921 | |||
| 1059 | Ga0070659_100035734 | |||
| 1060 | Ga0070659_100675789 | |||
| 1061 | Ga0070667_100299142 | |||
| 1062 | Ga0070703_10197758 | |||
| 1063 | Ga0070701_10009933 | |||
| 1064 | Ga0070705_100001350 | |||
| 1065 | Ga0070705_100123261 | |||
| 1066 | Ga0070705_100283028 | |||
| 1067 | Ga0070700_100099525 | |||
| 1068 | Ga0070700_100135207 | |||
| 1069 | Ga0070694_100061265 | |||
| 1070 | Ga0070694_100233158 | |||
| 1071 | Ga0070708_100000520 | |||
| 1072 | Ga0070708_100018138 | |||
| 1073 | Ga0070708_100265642 | |||
| 1074 | Ga0070708_100350200 | |||
| 1075 | Ga0070708_100546613 | |||
| 1076 | Ga0070663_100525672 | |||
| 1077 | Ga0070678_100011053 | |||
| 1078 | Ga0070678_100328339 | |||
| 1079 | Ga0070662_100033609 | |||
| 1080 | Ga0070681_10135310 | |||
| 1081 | Ga0068867_100029916 | |||
| 1082 | Ga0070685_10017473 | |||
| 1083 | Ga0070706_100001506 | |||
| 1084 | Ga0070706_100264471 | |||
| 1085 | Ga0070706_100498750 | |||
| 1086 | Ga0070707_100032692 | |||
| 1087 | Ga0070707_100060819 | |||
| 1088 | Ga0070707_100082375 | |||
| 1089 | Ga0070707_100084133 | |||
| 1090 | Ga0070707_100439727 | |||
| 1091 | Ga0070707_100486478 | |||
| 1092 | Ga0070707_101318628 | |||
| 1093 | Ga0070698_100041762 | |||
| 1094 | Ga0070698_100288441 | |||
| 1095 | Ga0070698_100493156 | |||
| 1096 | Ga0070699_100008110 | |||
| 1097 | Ga0070699_100033065 | |||
| 1098 | Ga0070699_100661556 | |||
| 1099 | Ga0070679_100063377 | |||
| 1100 | Ga0070679_100166632 | |||
| 1101 | Ga0070684_100044180 | |||
| 1102 | Ga0070684_100108161 | |||
| 1103 | Ga0070684_100401649 | |||
| 1104 | Ga0070684_100653707 | |||
| 1105 | Ga0070684_100732289 | |||
| 1106 | Ga0070697_100033207 | |||
| 1107 | Ga0070697_100226800 | |||
| 1108 | Ga0070697_100575318 | |||
| 1109 | Ga0068853_100263565 | |||
| 1110 | Ga0070672_100022102 | |||
| 1111 | Ga0070686_100016446 | |||
| 1112 | Ga0070686_100096927 | |||
| 1113 | Ga0070686_100161238 | |||
| 1114 | Ga0070686_100335245 | |||
| 1115 | Ga0070695_100006464 | |||
| 1116 | Ga0070695_100032358 | |||
| 1117 | Ga0070695_100086118 | |||
| 1118 | Ga0070696_100005560 | |||
| 1119 | Ga0070696_100048410 | |||
| 1120 | Ga0070696_100063759 | |||
| 1121 | Ga0070696_100235196 | |||
| 1122 | Ga0070693_100041251 | |||
| 1123 | Ga0070693_100463662 | |||
| 1124 | Ga0070704_100086007 | |||
| 1125 | Ga0070704_100130394 | |||
| 1126 | Ga0070704_100721572 | |||
| 1127 | Ga0070704_101088416 | |||
| 1128 | Ga0068855_100001385 | |||
| 1129 | Ga0070664_100043320 | |||
| 1130 | Ga0070664_100180409 | |||
| 1131 | Ga0070664_100503152 | |||
| 1132 | Ga0068857_100173322 | |||
| 1133 | Ga0068857_100336314 | |||
| 1134 | Ga0068854_100263590 | |||
| 1135 | Ga0068854_100354077 | |||
| 1136 | Ga0068856_100384069 | |||
| 1137 | Ga0068856_100813753 | |||
| 1138 | Ga0070702_100000505 | |||
| 1139 | Ga0070702_100070789 | |||
| 1140 | Ga0070702_100085505 | |||
| 1141 | Ga0070702_100367227 | |||
| 1142 | Ga0068852_100112319 | |||
| 1143 | Ga0068859_100026558 | |||
| 1144 | Ga0068859_100029872 | |||
| 1145 | Ga0068859_100682800 | |||
| 1146 | Ga0068859_100766117 | |||
| 1147 | Ga0068864_100004342 | |||
| 1148 | Ga0068864_100307439 | |||
| 1149 | Ga0068864_100374635 | |||
| 1150 | Ga0068861_100374865 | |||
| 1151 | Ga0068861_100376823 | |||
| 1152 | Ga0068863_100200941 | |||
| 1153 | Ga0068858_100419682 | |||
| 1154 | Ga0068858_100434881 | |||
| 1155 | Ga0068858_100817326 | |||
| 1156 | Ga0068860_100264332 | |||
| 1157 | Ga0068860_100668813 | |||
| 1158 | Ga0081455_10097228 | |||
| 1159 | Ga0081455_10175650 | |||
| 1160 | Ga0081539_10003252 | |||
| 1161 | Ga0081539_10049195 | |||
| 1162 | Ga0075365_10144530 | |||
| 1163 | Ga0097621_100294479 | |||
| 1164 | Ga0097621_100307483 | |||
| 1165 | Ga0097621_100785334 | |||
| 1166 | Ga0068871_100113197 | |||
| 1167 | Ga0068871_100456101 | |||
| 1168 | Ga0075428_100068983 | |||
| 1169 | Ga0075430_100028866 | |||
| 1170 | Ga0075431_100243078 | |||
| 1171 | Ga0075434_100001824 | |||
| 1172 | Ga0075434_100003064 | |||
| 1173 | Ga0075434_101010005 | |||
| 1174 | Ga0075429_100094041 | |||
| 1175 | Ga0075429_100102858 | |||
| 1176 | Ga0068865_100332499 | |||
| 1177 | Ga0097620_100026558 | |||
| 1178 | Ga0097620_100029873 | |||
| 1179 | Ga0097620_100682998 | |||
| 1180 | Ga0097620_100766158 | |||
| 1181 | Ga0075435_100001508 | |||
| 1182 | Ga0075435_100140140 | |||
| 1183 | Ga0075435_100332825 | |||
| 1184 | Ga0111539_10146000 | |||
| 1185 | Ga0111539_10148167 | |||
| 1186 | Ga0111539_10397539 | |||
| 1187 | Ga0111539_10514170 | |||
| 1188 | Ga0111539_10772458 | |||
| 1189 | Ga0105245_10009735 | |||
| 1190 | Ga0105245_10191774 | |||
| 1191 | Ga0105245_10828387 | |||
| 1192 | Ga0105245_11234835 | |||
| 1193 | Ga0105245_11252860 | |||
| 1194 | Ga0114129_10015434 | |||
| 1195 | Ga0114129_10030448 | |||
| 1196 | Ga0114129_10172428 | |||
| 1197 | Ga0114129_10436380 | |||
| 1198 | Ga0114129_11601987 | |||
| 1199 | Ga0105243_10046824 | |||
| 1200 | Ga0105243_10058119 | |||
| 1201 | Ga0105243_11086950 | |||
| 1202 | Ga0105243_11252917 | |||
| 1203 | Ga0105241_10126535 | |||
| 1204 | Ga0105242_10068639 | |||
| 1205 | Ga0105242_10262786 | |||
| 1206 | Ga0105242_10342440 | |||
| 1207 | Ga0105242_10589672 | |||
| 1208 | Ga0105242_10762856 | |||
| 1209 | Ga0105248_10378932 | |||
| 1210 | Ga0105248_10687521 | |||
| 1211 | Ga0105248_10734953 | |||
| 1212 | Ga0105248_10771947 | |||
| 1213 | Ga0105248_10856906 | |||
| 1214 | Ga0105237_10000018 | |||
| 1215 | Ga0105238_10078406 | |||
| 1216 | Ga0105238_10684700 | |||
| 1217 | Ga0105249_10085997 | |||
| 1218 | Ga0105249_11579741 | |||
| 1219 | Ga0105030_100085 | |||
| 1220 | Ga0105028_104375 | |||
| 1221 | Ga0105239_10017378 | |||
| 1222 | Ga0105239_10575647 | |||
| 1223 | Ga0105246_10230992 | |||
| 1224 | Ga0105246_10295461 | |||
| 1225 | Ga0105246_10637846 | |||
| 1226 | Ga0157373_10279729 | |||
| 1227 | Ga0157369_10826646 | |||
| 1228 | Ga0157374_10435538 | |||
| 1229 | Ga0157374_10696928 | |||
| 1230 | Ga0157378_11711337 | |||
| 1231 | Ga0163162_10764537 | |||
| 1232 | Ga0157372_10406181 | |||
| 1233 | Ga0157372_10468603 | |||
| 1234 | Ga0157375_10051191 | |||
| 1235 | Ga0157375_10169717 | |||
| 1236 | Ga0157375_10379604 | |||
| 1237 | Ga0157375_10494014 | |||
| 1238 | Ga0157375_10650360 | |||
| 1239 | Ga0157375_11176212 | |||
| 1240 | Ga0163163_10085409 | |||
| 1241 | Ga0163163_10345158 | |||
| 1242 | Ga0157380_10044224 | |||
| 1243 | Ga0157380_10173908 | |||
| 1244 | Ga0157380_10288228 | |||
| 1245 | Ga0157380_10294639 | |||
| 1246 | Ga0157380_10319124 | |||
| 1247 | Ga0157380_10595098 | |||
| 1248 | Ga0157380_11032752 | |||
| 1249 | Ga0157377_10010295 | |||
| 1250 | Ga0157377_10119140 | |||
| 1251 | Ga0157376_10610742 | |||
| 1252 | Ga0163161_10797454 | |||
| 1253 | Ga0206356_11631052 | |||
| 1254 | Ga0206355_1276195 | |||
| 1255 | Ga0206351_10694611 | |||
| 1256 | Ga0206352_11138927 | |||
| 1257 | Ga0206350_11149335 | |||
| 1258 | Ga0206354_10584469 | |||
| 1259 | Ga0154015_1342543 | |||
| 1260 | Ga0213875_10008240 | |||
| 1261 | Ga0207656_10159783 | |||
| 1262 | Ga0207642_10118699 | |||
| 1263 | Ga0207710_10119939 | |||
| 1264 | Ga0207688_10103699 | |||
| 1265 | Ga0207680_10381528 | |||
| 1266 | Ga0207680_10433319 | |||
| 1267 | Ga0207685_10202091 | |||
| 1268 | Ga0207645_10124354 | |||
| 1269 | Ga0207643_10048923 | |||
| 1270 | Ga0207684_10169294 | |||
| 1271 | Ga0207684_10293919 | |||
| 1272 | Ga0207684_10344295 | |||
| 1273 | Ga0207654_10391605 | |||
| 1274 | Ga0207707_10521874 | |||
| 1275 | Ga0207671_10000714 | |||
| 1276 | Ga0207660_10197690 | |||
| 1277 | Ga0207662_10070011 | |||
| 1278 | Ga0207662_10330777 | |||
| 1279 | Ga0207649_10031110 | |||
| 1280 | Ga0207652_10056482 | |||
| 1281 | Ga0207652_10398769 | |||
| 1282 | Ga0207652_10451383 | |||
| 1283 | Ga0207646_10032918 | |||
| 1284 | Ga0207646_10037970 | |||
| 1285 | Ga0207646_10177461 | |||
| 1286 | Ga0207646_10396604 | |||
| 1287 | Ga0207694_10691379 | |||
| 1288 | Ga0207650_10330642 | |||
| 1289 | Ga0207650_10731533 | |||
| 1290 | Ga0207650_10780816 | |||
| 1291 | Ga0207659_10112935 | |||
| 1292 | Ga0207659_10288633 | |||
| 1293 | Ga0207659_10306941 | |||
| 1294 | Ga0207687_10029499 | |||
| 1295 | Ga0207687_10059539 | |||
| 1296 | Ga0207690_10115370 | |||
| 1297 | Ga0207706_10079031 | |||
| 1298 | Ga0207706_10334424 | |||
| 1299 | Ga0207706_10617978 | |||
| 1300 | Ga0207686_10086241 | |||
| 1301 | Ga0207686_10147171 | |||
| 1302 | Ga0207709_10012178 | |||
| 1303 | Ga0207709_10063022 | |||
| 1304 | Ga0207709_10185438 | |||
| 1305 | Ga0207709_10230921 | |||
| 1306 | Ga0207709_10239409 | |||
| 1307 | Ga0207709_10327908 | |||
| 1308 | Ga0207709_10416044 | |||
| 1309 | Ga0207709_10527108 | |||
| 1310 | Ga0207670_10010346 | |||
| 1311 | Ga0207669_10013209 | |||
| 1312 | Ga0207669_10153788 | |||
| 1313 | Ga0207669_10256342 | |||
| 1314 | Ga0207669_10399492 | |||
| 1315 | Ga0207704_10018579 | |||
| 1316 | Ga0207704_10390009 | |||
| 1317 | Ga0207704_10426397 | |||
| 1318 | Ga0207665_10082394 | |||
| 1319 | Ga0207691_10035584 | |||
| 1320 | Ga0207691_10700843 | |||
| 1321 | Ga0207711_10167449 | |||
| 1322 | Ga0207711_10441146 | |||
| 1323 | Ga0207711_10482720 | |||
| 1324 | Ga0207689_10103994 | |||
| 1325 | Ga0207689_10188986 | |||
| 1326 | Ga0207689_10247013 | |||
| 1327 | Ga0207689_10500533 | |||
| 1328 | Ga0207661_10097568 | |||
| 1329 | Ga0207661_10139605 | |||
| 1330 | Ga0207661_10383906 | |||
| 1331 | Ga0207661_10437126 | |||
| 1332 | Ga0207661_10649070 | |||
| 1333 | Ga0207679_10072323 | |||
| 1334 | Ga0207667_10002682 | |||
| 1335 | Ga0207651_10169573 | |||
| 1336 | Ga0207651_10541407 | |||
| 1337 | Ga0207712_10119117 | |||
| 1338 | Ga0207712_10119463 | |||
| 1339 | Ga0207712_10215395 | |||
| 1340 | Ga0207668_10549174 | |||
| 1341 | Ga0207668_10740370 | |||
| 1342 | Ga0207640_10121809 | |||
| 1343 | Ga0207640_10417260 | |||
| 1344 | Ga0207640_10772234 | |||
| 1345 | Ga0207677_10206096 | |||
| 1346 | Ga0207677_10302159 | |||
| 1347 | Ga0207703_10120934 | |||
| 1348 | Ga0207703_10384310 | |||
| 1349 | Ga0207703_10391937 | |||
| 1350 | Ga0207703_10555670 | |||
| 1351 | Ga0207639_10212694 | |||
| 1352 | Ga0207639_10355345 | |||
| 1353 | Ga0207678_10696647 | |||
| 1354 | Ga0207708_10210244 | |||
| 1355 | Ga0207708_10413700 | |||
| 1356 | Ga0207708_10468070 | |||
| 1357 | Ga0207708_10611556 | |||
| 1358 | Ga0207702_10902198 | |||
| 1359 | Ga0207641_10092143 | |||
| 1360 | Ga0207641_10192236 | |||
| 1361 | Ga0207641_10692846 | |||
| 1362 | Ga0207648_10007918 | |||
| 1363 | Ga0207648_10645315 | |||
| 1364 | Ga0207676_10152136 | |||
| 1365 | Ga0207676_10440845 | |||
| 1366 | Ga0207674_10033770 | |||
| 1367 | Ga0207674_10038269 | |||
| 1368 | Ga0207674_10364334 | |||
| 1369 | Ga0207675_100265542 | |||
| 1370 | Ga0207675_100285075 | |||
| 1371 | Ga0207675_100296144 | |||
| 1372 | Ga0207675_101366504 | |||
| 1373 | Ga0207683_10013220 | |||
| 1374 | Ga0207683_10057104 | |||
| 1375 | Ga0207683_10168807 | |||
| 1376 | Ga0207683_10504121 | |||
| 1377 | Ga0207698_10399881 | |||
| 1378 | Ga0207698_10586730 | |||
| 1379 | Ga0209999_1005028 | |||
| 1380 | Ga0210002_1008764 | |||
| 1381 | Ga0209971_1001531 | |||
| 1382 | Ga0209971_1007217 | |||
| 1383 | Ga0209971_1024340 | |||
| 1384 | Ga0209998_10000082 | |||
| 1385 | Ga0209974_10000310 | |||
| 1386 | Ga0209974_10039369 | |||
| 1387 | Ga0209974_10072533 | |||
| 1388 | Ga0207428_10014700 | |||
| 1389 | Ga0207428_10065116 | |||
| 1390 | Ga0207428_10110826 | |||
| 1391 | Ga0207428_10141147 | |||
| 1392 | Ga0268266_10262574 | |||
| 1393 | Ga0268265_10754131 | |||
| 1394 | Ga0268264_10341923 | |||
| 1395 | Ga0265337_1016621 | |||
| 1396 | Ga0265326_10001467 | |||
| 1397 | Ga0265326_10059094 | |||
| 1398 | Ga0265319_1000855 | |||
| 1399 | Ga0265319_1002743 | |||
| 1400 | Ga0265319_1004372 | |||
| 1401 | Ga0265319_1062405 | |||
| 1402 | Ga0265334_10006646 | |||
| 1403 | Ga0265334_10007969 | |||
| 1404 | Ga0265334_10030742 | |||
| 1405 | Ga0265318_10033646 | |||
| 1406 | Ga0265318_10055552 | |||
| 1407 | Ga0265318_10141328 | |||
| 1408 | Ga0265318_10196653 | |||
| 1409 | Ga0265322_10007639 | |||
| 1410 | Ga0265322_10015188 | |||
| 1411 | Ga0265336_10003758 | |||
| 1412 | Ga0265336_10025379 | |||
| 1413 | Ga0265336_10117209 | |||
| 1414 | Ga0265336_10157664 | |||
| 1415 | Ga0265338_10017263 | |||
| 1416 | Ga0265338_10030239 | |||
| 1417 | Ga0265338_10238622 | |||
| 1418 | Ga0265324_10005764 | |||
| 1419 | Ga0265324_10006460 | |||
| 1420 | Ga0265330_10010314 | |||
| 1421 | Ga0265332_10023897 | |||
| 1422 | Ga0265332_10030283 | |||
| 1423 | Ga0265332_10113633 | |||
| 1424 | Ga0265320_10002674 | |||
| 1425 | Ga0265320_10004554 | |||
| 1426 | Ga0265320_10032811 | |||
| 1427 | Ga0265320_10049372 | |||
| 1428 | Ga0265325_10004083 | |||
| 1429 | Ga0265325_10032494 | |||
| 1430 | Ga0265325_10038622 | |||
| 1431 | Ga0265325_10121573 | |||
| 1432 | Ga0265329_10003710 | |||
| 1433 | Ga0265329_10013070 | |||
| 1434 | Ga0265340_10004482 | |||
| 1435 | Ga0265340_10005089 | |||
| 1436 | Ga0265340_10195193 | |||
| 1437 | Ga0265339_10012628 | |||
| 1438 | Ga0265339_10023946 | |||
| 1439 | Ga0265339_10098430 | |||
| 1440 | Ga0265331_10060852 | |||
| 1441 | Ga0265331_10066130 | |||
| 1442 | Ga0265316_10007297 | |||
| 1443 | Ga0265316_10007887 | |||
| 1444 | Ga0265316_10087369 | |||
| 1445 | Ga0265316_10438279 | |||
| 1446 | Ga0307408_100288202 | |||
| 1447 | Ga0265313_10022874 | |||
| 1448 | Ga0265313_10023806 | |||
| 1449 | Ga0265313_10053419 | |||
| 1450 | Ga0265314_10005777 | |||
| 1451 | Ga0265314_10016170 | |||
| 1452 | Ga0265314_10025293 | |||
| 1453 | Ga0265314_10126566 | |||
| 1454 | Ga0265314_10127818 | |||
| 1455 | Ga0265314_10181206 | |||
| 1456 | Ga0265342_10034561 | |||
| 1457 | Ga0265342_10091222 | |||
| 1458 | Ga0316576_10010839 | |||
| 1459 | Ga0316576_10021409 | |||
| 1460 | Ga0316576_10135882 | |||
| 1461 | Ga0316578_10168298 | |||
| 1462 | Ga0316578_10229517 | |||
| 1463 | Ga0307405_10062496 | |||
| 1464 | Ga0316577_10017827 | |||
| 1465 | Ga0307413_10362867 | |||
| 1466 | Ga0307413_10825540 | |||
| 1467 | Ga0307410_10097333 | |||
| 1468 | Ga0307406_10193213 | |||
| 1469 | Ga0307407_10184578 | |||
| 1470 | Ga0307409_100210060 | |||
| 1471 | Ga0307409_100264503 | |||
| 1472 | Ga0307409_100276520 | |||
| 1473 | Ga0307409_100349566 | |||
| 1474 | Ga0307409_100526807 | |||
| 1475 | Ga0307416_100037079 | |||
| 1476 | Ga0307416_100148138 | |||
| 1477 | Ga0307416_101119319 | |||
| 1478 | Ga0307411_10357280 | |||
| 1479 | Ga0307415_100079024 | |||
| 1480 | Ga0316585_10093609 | |||
| 1481 | Ga0316592_1002103 | |||
| 1482 | Ga0316592_1011593 | |||
| 1483 | Ga0316592_1019693 | |||
| 1484 | Ga0316592_1042902 | |||
| 1485 | Ga0316586_1005468 | |||
| 1486 | Ga0316588_1003189 | |||
| 1487 | Ga0316588_1040232 | |||
| 1488 | Ga0316588_1113620 | |||
| 1489 | Ga0373938_0017643 | |||
| 1490 | Ga0373940_0035433 | |||
| 1491 | Ga0373932_0147664 | |||
| 1492 | Ga0373939_0061523 | |||
| 1493 | Ga0373943_0012907 | |||
| 1494 | Ga0373955_0433772 | |||
| 1495 | Ga0373961_0082112 | |||
| 1496 | Ga0373962_0167390 | |||
| 1497 | Ga0316574_0180587 | |||
| 1498 | Ga0373931_0020272 | |||
| 1499 | Ga0373947_0128280 | |||
| 1500 | Ga0373947_0293953 | |||
| 1501 | Ga0265778_001794 | |||
| 1502 | Ga0316582_0052148 | |||
| 1503 | Ga0316582_0078778 | |||
| 1504 | Ga0316582_0331977 | |||
| 1505 | Ga0316584_0012025 | |||
| 1506 | Ga0373925_0276137 | |||
| 1507 | Ga0373925_0282783 | |||
| 1508 | Ga0373925_0311632 | |||
| 1509 | Ga0395899_0281057 | |||
| 1510 | Ga0395899_0291030 | |||
| 1511 | Ga0395900_0011458 | |||
| 1512 | Ga0395900_0078136 | |||
| 1513 | Ga0395900_0275191 | |||
| 1514 | Ga0395898_0079653 | |||
| 1515 | Ga0395898_0110637 | |||
| 1516 | Ga0395905_1127060 | |||
| 1517 | Ga0436364_0945409 | |||
| 1518 | Ga0436364_1144605 | |||
| 1519 | Ga0395901_0233292 | |||
| 1520 | Ga0395901_0376966 | |||
| 1521 | Ga0395901_0483605 | |||
| 1522 | Ga0242420_063683 | |||
| 1523 | Ga0400489_49086 | |||
| 1524 | Ga0436365_0127171 | |||
| 1525 | Ga0439466_0009869 | |||
| 1526 | Ga0439465_0021011 | |||
| 1527 | Ga0451797_1013749 | |||
| 1528 | Ga0451807_0792724 | |||
| 1529 | Ga0451833_1296515 | |||
| 1530 | Ga0451837_0275658 | |||
| 1531 | Ga0451839_1023332 | |||
| 1532 | Ga0451849_1545658 | |||
| 1533 | Ga0451851_0102479 | |||
| 1534 | Ga0439441_000751 | |||
| 1535 | Ga0439452_055181 | |||
| 1536 | Ga0439454_034915 | |||
| 1537 | Ga0439457_035114 | |||
| 1538 | Ga0450920_028342 | |||
| 1539 | Ga0450920_045691 | |||
| 1540 | Ga0450922_001928 | |||
| 1541 | Ga0450923_019946 | |||
| 1542 | Ga0450896_001980 | |||
| 1543 | Ga0450896_005414 | |||
| 1544 | Ga0450906_003872 | |||
| 1545 | Ga0450907_015085 | |||
| 1546 | Ga0450910_001751 | |||
| 1547 | Ga0450909_017522 | |||
| 1548 | Ga0439435_0031993 | |||
| 1549 | Ga0450916_022700 | |||
| 1550 | Ga0450918_004007 | |||
| 1551 | Ga0450918_045790 | |||
| 1552 | Ga0451577_0276905 | |||
| 1553 | Ga0453684_0466336 | |||
| 1554 | Ga0453684_0548723 | |||
| 1555 | Ga0451576_0023373 | |||
| 1556 | Ga0451576_0086855 | |||
| 1557 | Ga0451576_0344057 | |||
| 1558 | Ga0451576_0653509 | |||
| 1559 | Ga0451576_0681422 | |||
| 1560 | Ga0495592_0036914 | |||
| 1561 | Ga0495603_0212344 | |||
| 1562 | Ga0495653_0025679 | |||
| 1563 | Ga0495653_0155606 | |||
| 1564 | Ga0495653_0168547 | |||
| 1565 | Ga0495580_0142735 | |||
| 1566 | Ga0495582_0048474 | |||
| 1567 | Ga0495585_0166132 | |||
| 1568 | Ga0495607_0260361 | |||
| 1569 | Ga0495618_0000835 | |||
| 1570 | Ga0495618_0029382 | |||
| 1571 | Ga0495620_0089707 | |||
| 1572 | Ga0495628_0230218 | |||
| 1573 | Ga0495628_0594758 | |||
| 1574 | Ga0495630_0086260 | |||
| 1575 | Ga0495630_0170906 | |||
| 1576 | Ga0495630_0932450 | |||
| 1577 | Ga0495644_0165371 | |||
| 1578 | Ga0495663_0119657 | |||
| 1579 | Ga0495663_0139456 | |||
| 1580 | Ga0495652_0158629 | |||
| 1581 | Ga0495665_0248215 | |||
| 1582 | Ga0495640_0021538 | |||
| 1583 | Ga0495640_0147166 | |||
| 1584 | Ga0495640_0280346 | |||
| 1585 | Ga0495640_0327380 | |||
| 1586 | Ga0495586_0124240 | |||
| 1587 | Ga0495586_0130327 | |||
| 1588 | Ga0495587_0179182 | |||
| 1589 | Ga0495645_0071267 | |||
| 1590 | Ga0495633_0105433 | |||
| 1591 | Ga0495667_0111906 | |||
| 1592 | Ga0495667_0173389 | |||
| 1593 | Ga0495656_0126279 | |||
| 1594 | Ga0495656_0249520 | |||
| 1595 | Ga0495656_0254061 | |||
| 1596 | Ga0495668_0256247 | |||
| 1597 | Ga0495635_0027887 | |||
| 1598 | Ga0495635_0233149 | |||
| 1599 | Ga0495657_0109082 | |||
| 1600 | Ga0495657_0117839 | |||
| 1601 | Ga0495599_0069127 | |||
| 1602 | Ga0495623_0109936 | |||
| 1603 | Ga0495647_0213412 | |||
| 1604 | Ga0495658_0485572 | |||
| 1605 | Ga0495613_0030825 | |||
| 1606 | Ga0495613_0560506 | |||
| 1607 | Ga0495624_0118892 | |||
| 1608 | Ga0495624_0124578 | |||
| 1609 | Ga0495670_0214773 | |||
| 1610 | Ga0495670_0277101 | |||
| 1611 | Ga0495649_0245121 | |||
| 1612 | Ga0495600_0110489 | |||
| 1613 | Ga0495600_0282854 | |||
| 1614 | Ga0495581_0065506 | |||
| 1615 | Ga0495604_0076847 | |||
| 1616 | Ga0495604_0243013 | |||
| 1617 | Ga0495604_0304356 | |||
| 1618 | Ga0495604_0425579 | |||
| 1619 | Ga0495674_0021809 | |||
| 1620 | Ga0495674_0023760 | |||
| 1621 | Ga0495674_0179290 | |||
| 1622 | Ga0495676_0108821 | |||
| 1623 | Ga0495676_0395063 | |||
| 1624 | Ga0495676_0481641 | |||
| 1625 | Ga0495680_0018449 | |||
| 1626 | Ga0495677_0023919 | |||
| 1627 | Ga0495679_074150 | |||
| 1628 | Ga0495684_0014428 | |||
| 1629 | Ga0495593_0329264 | |||
| 1630 | Ga0496100_0065733 | |||
| 1631 | Ga0496100_0176399 | |||
| 1632 | Ga0496100_0196497 | |||
| 1633 | Ga0496101_0303721 | |||
| 1634 | Ga0496102_0062414 | |||
| 1635 | Ga0496102_0093348 | |||
| 1636 | Ga0496102_0204953 | |||
| 1637 | Ga0496102_0283726 | |||
| 1638 | Ga0496102_0448319 | |||
| 1639 | Ga0496102_0479623 | |||
| 1640 | Ga0496103_0300912 | |||
| 1641 | Ga0496104_0030684 | |||
| 1642 | Ga0496104_0045348 | |||
| 1643 | Ga0496104_0105890 | |||
| 1644 | Ga0496104_0106484 | |||
| 1645 | Ga0496104_0292437 | |||
| 1646 | Ga0496104_0477921 | |||
| 1647 | Ga0496104_0693702 | |||
| 1648 | Ga0496104_1027282 | |||
| 1649 | Ga0496105_0006302 | |||
| 1650 | Ga0496105_0017099 | |||
| 1651 | Ga0496105_0083357 | |||
| 1652 | Ga0496105_0394569 | |||
| 1653 | Ga0496106_0175060 | |||
| 1654 | Ga0496106_0472103 | |||
| 1655 | Ga0496107_0246314 | |||
| 1656 | Ga0496107_0301517 | |||
| 1657 | Ga0496108_0004171 | |||
| 1658 | Ga0496108_0006346 | |||
| 1659 | Ga0496108_0082677 | |||
| 1660 | Ga0496108_0165463 | |||
| 1661 | Ga0496108_0169926 | |||
| 1662 | Ga0496108_0267302 | |||
| 1663 | Ga0496108_0361917 | |||
| 1664 | Ga0496109_0010919 | |||
| 1665 | Ga0496109_0066887 | |||
| 1666 | Ga0496109_0082254 | |||
| 1667 | Ga0496109_0183191 | |||
| 1668 | Ga0496109_0220804 | |||
| 1669 | Ga0496109_0249529 | |||
| 1670 | Ga0496109_0265962 | |||
| 1671 | Ga0496109_0270643 | |||
| 1672 | Ga0496109_0575489 | |||
| 1673 | Ga0496109_0951889 | |||
| 1674 | Ga0496110_0011695 | |||
| 1675 | Ga0496110_0208719 | |||
| 1676 | Ga0496110_0616886 | |||
| 1677 | Ga0496111_0004472 | |||
| 1678 | Ga0496111_0058011 | |||
| 1679 | Ga0496111_0094502 | |||
| 1680 | Ga0496112_0034588 | |||
| 1681 | Ga0496112_0209892 | |||
| 1682 | Ga0496112_0265216 | |||
| 1683 | Ga0496112_0319696 | |||
| 1684 | Ga0496112_0464302 | |||
| 1685 | Ga0496112_0554930 | |||
| 1686 | Ga0496113_0000388 | |||
| 1687 | Ga0496113_0086046 | |||
| 1688 | Ga0496114_0037887 | |||
| 1689 | Ga0496114_0056294 | |||
| 1690 | Ga0496114_0183723 | |||
| 1691 | Ga0496114_0298884 | |||
| 1692 | Ga0496114_0334740 | |||
| 1693 | Ga0496114_0348369 | |||
| 1694 | Ga0496114_0413911 | |||
| 1695 | Ga0501313_000380 | |||
| 1696 | Ga0501031_0002221 | |||
| 1697 | Ga0501031_0006598 | |||
| 1698 | Ga0501031_0007761 | |||
| 1699 | Ga0501031_0032439 | |||
| 1700 | Ga0501031_0038486 | |||
| 1701 | Ga0501031_0120327 | |||
| 1702 | Ga0501031_0243428 | |||
| 1703 | Ga0501031_0283283 | |||
| 1704 | Ga0501031_0311539 | |||
| 1705 | Ga0501031_0407303 | |||
| 1706 | Ga0501031_0485215 | |||
| 1707 | Ga0501032_0041231 | |||
| 1708 | Ga0501032_0178347 | |||
| 1709 | Ga0501033_0268338 | |||
| 1710 | Ga0501033_0610177 | |||
| 1711 | Ga0501034_0571846 | |||
| 1712 | Ga0501036_0008133 | |||
| 1713 | Ga0501036_0019967 | |||
| 1714 | Ga0501036_0031368 | |||
| 1715 | Ga0501036_0111993 | |||
| 1716 | Ga0501036_0121956 | |||
| 1717 | Ga0501036_0391487 | |||
| 1718 | Ga0501036_0665812 | |||
| 1719 | Ga0501037_0036167 | |||
| 1720 | Ga0501037_0082713 | |||
| 1721 | Ga0501037_0237537 | |||
| 1722 | Ga0501037_0368415 | |||
| 1723 | Ga0501037_0388833 | |||
| 1724 | Ga0501037_0560865 | |||
| 1725 | Ga0501038_0018194 | |||
| 1726 | Ga0501038_0041796 | |||
| 1727 | Ga0501038_0233696 | |||
| 1728 | Ga0501038_0313729 | |||
| 1729 | Ga0501038_0381144 | |||
| 1730 | Ga0501038_0509930 | |||
| 1731 | Ga0501038_0716855 | |||
| 1732 | Ga0501039_0012581 | |||
| 1733 | Ga0501039_0016553 | |||
| 1734 | Ga0501039_0036471 | |||
| 1735 | Ga0501039_0092904 | |||
| 1736 | Ga0501039_0093591 | |||
| 1737 | Ga0501039_0113529 | |||
| 1738 | Ga0501039_0180062 | |||
| 1739 | Ga0501039_0283438 | |||
| 1740 | Ga0501039_0302139 | |||
| 1741 | Ga0501039_0475241 | |||
| 1742 | Ga0501039_0669543 | |||
| 1743 | Ga0501040_0003390 | |||
| 1744 | Ga0501040_0004923 | |||
| 1745 | Ga0501040_0012347 | |||
| 1746 | Ga0501040_0015872 | |||
| 1747 | Ga0501040_0023669 | |||
| 1748 | Ga0501040_0023904 | |||
| 1749 | Ga0501040_0068761 | |||
| 1750 | Ga0501040_0186983 | |||
| 1751 | Ga0501040_0516066 | |||
| 1752 | Ga0501041_0003558 | |||
| 1753 | Ga0501041_0013616 | |||
| 1754 | Ga0501041_0013840 | |||
| 1755 | Ga0501041_0148350 | |||
| 1756 | Ga0501041_0198003 | |||
| 1757 | Ga0501041_0252089 | |||
| 1758 | Ga0501041_0332824 | |||
| 1759 | Ga0501042_0000354 | |||
| 1760 | Ga0501042_0003443 | |||
| 1761 | Ga0501042_0112599 | |||
| 1762 | Ga0501042_0125271 | |||
| 1763 | Ga0501042_0202837 | |||
| 1764 | Ga0501042_0243980 | |||
| 1765 | Ga0501042_0246349 | |||
| 1766 | Ga0501042_0654652 | |||
| 1767 | Ga0501042_0714937 | |||
| 1768 | Ga0501043_0117940 | |||
| 1769 | Ga0501046_0013506 | |||
| 1770 | Ga0501046_0062650 | |||
| 1771 | Ga0501046_0127168 | |||
| 1772 | Ga0501046_0134747 | |||
| 1773 | Ga0501046_0162054 | |||
| 1774 | Ga0501046_0234838 | |||
| 1775 | Ga0501046_0307618 | |||
| 1776 | Ga0501048_0004627 | |||
| 1777 | Ga0501048_0010287 | |||
| 1778 | Ga0501048_0028679 | |||
| 1779 | Ga0501048_0033054 | |||
| 1780 | Ga0501048_0074559 | |||
| 1781 | Ga0501048_0254374 | |||
| 1782 | Ga0501048_0686000 | |||
| 1783 | Ga0501048_0726957 | |||
| 1784 | Ga0501067_0018522 | |||
| 1785 | Ga0501067_0086124 | |||
| 1786 | Ga0501067_0118378 | |||
| 1787 | Ga0501067_0137377 | |||
| 1788 | Ga0501068_0052733 | |||
| 1789 | Ga0501068_0082289 | |||
| 1790 | Ga0501068_0177987 | |||
| 1791 | Ga0501068_0225629 | |||
| 1792 | Ga0501068_0322273 | |||
| 1793 | Ga0501068_0673635 | |||
| 1794 | Ga0501069_0005185 | |||
| 1795 | Ga0501069_0014693 | |||
| 1796 | Ga0501069_0019906 | |||
| 1797 | Ga0501069_0028143 | |||
| 1798 | Ga0501069_0063145 | |||
| 1799 | Ga0501069_0071411 | |||
| 1800 | Ga0501069_0107172 | |||
| 1801 | Ga0501069_0120939 | |||
| 1802 | Ga0501070_0020406 | |||
| 1803 | Ga0501070_0022493 | |||
| 1804 | Ga0501070_0107865 | |||
| 1805 | Ga0501070_0332233 | |||
| 1806 | Ga0501070_0431875 | |||
| 1807 | Ga0501070_0490009 | |||
| 1808 | Ga0501071_0002073 | |||
| 1809 | Ga0501071_0003597 | |||
| 1810 | Ga0501071_0010617 | |||
| 1811 | Ga0501071_0012949 | |||
| 1812 | Ga0501071_0028427 | |||
| 1813 | Ga0501071_0107509 | |||
| 1814 | Ga0501071_0216864 | |||
| 1815 | Ga0501071_0263287 | |||
| 1816 | Ga0501071_0551392 | |||
| 1817 | Ga0501071_0583079 | |||
| 1818 | Ga0501071_0698273 | |||
| 1819 | Ga0501072_0000902 | |||
| 1820 | Ga0501072_0003791 | |||
| 1821 | Ga0501072_0012319 | |||
| 1822 | Ga0501072_0020781 | |||
| 1823 | Ga0501072_0047498 | |||
| 1824 | Ga0501072_0132579 | |||
| 1825 | Ga0501072_0305160 | |||
| 1826 | Ga0501072_0454250 | |||
| 1827 | Ga0501072_0765873 | |||
| 1828 | Ga0501073_0073359 | |||
| 1829 | Ga0501073_0155143 | |||
| 1830 | Ga0501073_0218913 | |||
| 1831 | Ga0501073_0236165 | |||
| 1832 | Ga0501073_0334233 | |||
| 1833 | Ga0501073_0461354 | |||
| 1834 | Ga0501074_0013091 | |||
| 1835 | Ga0501074_0018872 | |||
| 1836 | Ga0501074_0080636 | |||
| 1837 | Ga0501074_0126796 | |||
| 1838 | Ga0501074_0149642 | |||
| 1839 | Ga0501074_0214662 | |||
| 1840 | Ga0501074_0246949 | |||
| 1841 | Ga0501074_0459732 | |||
| 1842 | Ga0501075_0003239 | |||
| 1843 | Ga0501075_0045819 | |||
| 1844 | Ga0501075_0074087 | |||
| 1845 | Ga0501075_0089617 | |||
| 1846 | Ga0501075_0144303 | |||
| 1847 | Ga0501075_0165768 | |||
| 1848 | Ga0501075_0185168 | |||
| 1849 | Ga0501075_0196272 | |||
| 1850 | Ga0501075_0216075 | |||
| 1851 | Ga0501075_0406120 | |||
| 1852 | Ga0501075_0420767 | |||
| 1853 | Ga0501075_0426359 | |||
| 1854 | Ga0501075_0452144 | |||
| 1855 | Ga0501076_0001686 | |||
| 1856 | Ga0501076_0004778 | |||
| 1857 | Ga0501076_0007739 | |||
| 1858 | Ga0501076_0016016 | |||
| 1859 | Ga0501076_0018028 | |||
| 1860 | Ga0501076_0030831 | |||
| 1861 | Ga0501076_0042677 | |||
| 1862 | Ga0501076_0053047 | |||
| 1863 | Ga0501076_0075645 | |||
| 1864 | Ga0501076_0083058 | |||
| 1865 | Ga0501076_0132266 | |||
| 1866 | Ga0501076_0153554 | |||
| 1867 | Ga0501076_0298269 | |||
| 1868 | Ga0501076_0446908 | |||
| 1869 | Ga0501077_0003237 | |||
| 1870 | Ga0501077_0008753 | |||
| 1871 | Ga0501077_0052363 | |||
| 1872 | Ga0501077_0128182 | |||
| 1873 | Ga0501077_0140380 | |||
| 1874 | Ga0501245_027459 | |||
| 1875 | Ga0501079_0001191 | |||
| 1876 | Ga0501079_0014153 | |||
| 1877 | Ga0501079_0026730 | |||
| 1878 | Ga0501079_0051529 | |||
| 1879 | Ga0501079_0102887 | |||
| 1880 | Ga0501079_0131569 | |||
| 1881 | Ga0501079_0270213 | |||
| 1882 | Ga0501079_0287564 | |||
| 1883 | Ga0501079_0322925 | |||
| 1884 | Ga0501079_0387093 | |||
| 1885 | Ga0501079_0430790 | |||
| 1886 | Ga0501079_0614527 | |||
| 1887 | Ga0501079_0929154 | |||
| 1888 | Ga0501080_0001271 | |||
| 1889 | Ga0501080_0013538 | |||
| 1890 | Ga0501080_0037024 | |||
| 1891 | Ga0501080_0047334 | |||
| 1892 | Ga0501080_0124356 | |||
| 1893 | Ga0501080_0164349 | |||
| 1894 | Ga0501080_0178051 | |||
| 1895 | Ga0501080_0325256 | |||
| 1896 | Ga0501080_0397571 | |||
| 1897 | Ga0501080_0409644 | |||
| 1898 | Ga0501080_0723607 | |||
| 1899 | Ga0501080_0777010 | |||
| 1900 | Ga0501081_0000266 | |||
| 1901 | Ga0501081_0010955 | |||
| 1902 | Ga0501081_0020465 | |||
| 1903 | Ga0501081_0028468 | |||
| 1904 | Ga0501081_0058222 | |||
| 1905 | Ga0501081_0097743 | |||
| 1906 | Ga0501081_0187191 | |||
| 1907 | Ga0501081_0199623 | |||
| 1908 | Ga0501081_0262858 | |||
| 1909 | Ga0501081_0385559 | |||
| 1910 | Ga0501083_0046415 | |||
| 1911 | Ga0501083_0049872 | |||
| 1912 | Ga0501083_0058547 | |||
| 1913 | Ga0501083_0063865 | |||
| 1914 | Ga0501083_0499761 | |||
| 1915 | Ga0501035_0025187 | |||
| 1916 | Ga0501035_0032231 | |||
| 1917 | Ga0501035_0036258 | |||
| 1918 | Ga0501035_0324345 | |||
| 1919 | Ga0501035_0366214 | |||
| 1920 | Ga0501044_0047472 | |||
| 1921 | Ga0501044_0323262 | |||
| 1922 | Ga0501045_0002435 | |||
| 1923 | Ga0501045_0011994 | |||
| 1924 | Ga0501045_0031322 | |||
| 1925 | Ga0501045_0050905 | |||
| 1926 | Ga0501045_0056481 | |||
| 1927 | Ga0501045_0085387 | |||
| 1928 | Ga0501045_0135570 | |||
| 1929 | Ga0501045_0339821 | |||
| 1930 | Ga0501045_0367641 | |||
| 1931 | Ga0501045_0606375 | |||
| 1932 | nmdc:mga06z11_30935_c1 | |||
| 1933 | nmdc:mga05p37_24103_c1 | |||
| 1934 | nmdc:mga05p37_326858_c1 | |||
| 1935 | nmdc:mga05p37_455407_c1 | |||
| 1936 | nmdc:mga05p37_520300_c1 | |||
| 1937 | nmdc:mga05p37_67483_c1 | |||
| 1938 | nmdc:mga05p37_931826_c1 | |||
| 1939 | nmdc:mga09592_29303_c1 | |||
| 1940 | nmdc:mga0qj67_7823_c1 | |||
| 1941 | nmdc:mga08y16_128154_c1 | |||
| 1942 | nmdc:mga08y16_162446_c1 | |||
| 1943 | nmdc:mga08y16_193536_c1 | |||
| 1944 | nmdc:mga08y16_266255_c1 | |||
| 1945 | nmdc:mga08y16_41644_c1 | |||
| 1946 | nmdc:mga08y16_804969_c1 | |||
| 1947 | nmdc:mga0n895_1231530_c1 | |||
| 1948 | nmdc:mga0n895_523953_c1 | |||
| 1949 | nmdc:mga0n895_68491_c1 | |||
| 1950 | nmdc:mga0n895_841206_c1 | |||
| 1951 | nmdc:mga0rr50_150012_c1 | |||
| 1952 | nmdc:mga0rr50_237462_c1 | |||
| 1953 | nmdc:mga08x19_730973_c1 | |||
| 1954 | nmdc:mga0a205_305261_c1 | |||
| 1955 | nmdc:mga0a205_31904_c1 | |||
| 1956 | nmdc:mga0a205_392696_c1 | |||
| 1957 | nmdc:mga0a205_92626_c1 | |||
| 1958 | Ga0495601_0015733 | |||
| 1959 | Ga0495601_0016271 | |||
| 1960 | Ga0495601_0223341 | |||
| 1961 | Ga0495595_0046669 | |||
| 1962 | Ga0495595_0113592 | |||
| 1963 | Ga0495619_0062715 | |||
| 1964 | Ga0495619_0067168 | |||
| 1965 | Ga0495619_0121015 | |||
| 1966 | Ga0495619_0124250 | |||
| 1967 | Ga0495619_0607651 | |||
| 1968 | Ga0500641_0169825 | |||
| 1969 | Ga0501084_0006409 | |||
| 1970 | Ga0501084_0007201 | |||
| 1971 | Ga0501084_0007985 | |||
| 1972 | Ga0501084_0011498 | |||
| 1973 | Ga0501084_0017618 | |||
| 1974 | Ga0501084_0027958 | |||
| 1975 | Ga0501084_0183163 | |||
| 1976 | Ga0501084_0212895 | |||
| 1977 | Ga0501084_0219686 | |||
| 1978 | Ga0501084_0222010 | |||
| 1979 | Ga0501084_0233509 | |||
| 1980 | Ga0501084_0255193 | |||
| 1981 | Ga0501084_0461003 | |||
| 1982 | Ga0501084_0749082 | |||
| 1983 | Ga0590071_001535 | |||
| 1984 | Ga0590074_001128 | |||
| 1985 | Ga0590075_001726 | |||
| 1986 | Ga0590075_003707 | |||
| 1987 | Ga0590077_002811 | |||
| 1988 | Ga0587066_004149 | |||
| 1989 | Ga0587086_002384 | |||
| 1990 | Ga0587086_012970 | |||
| 1991 | Ga0587098_017119 | |||
| 1992 | Ga0587109_014070 | |||
| 1993 | Ga0587122_007305 | |||
| 1994 | Ga0587062_002485 | |||
| 1995 | Ga0587062_032872 | |||
| 1996 | Ga0587072_004262 | |||
| 1997 | Ga0587076_004005 | |||
| 1998 | Ga0587111_0015289 | |||
| 1999 | Ga0501082_0005427 | |||
| 2000 | Ga0501082_0016210 | |||
| 2001 | Ga0501082_0020323 | |||
| 2002 | Ga0501082_0041465 | |||
| 2003 | Ga0501082_0070499 | |||
| 2004 | Ga0501082_0122351 | |||
| 2005 | Ga0501082_0166131 | |||
| 2006 | Ga0501082_0185205 | |||
| 2007 | Ga0501082_0270315 | |||
| 2008 | Ga0501082_0494243 | |||
| 2009 | Ga0501082_0534703 | |||
| 2010 | Ga0501082_0688611 | |||
| 2011 | Ga0530510_0005977 | |||
| 2012 | Ga0530510_0007526 | |||
| 2013 | Ga0530510_0009346 | |||
| 2014 | Ga0530510_0012738 | |||
| 2015 | Ga0530510_0017434 | |||
| 2016 | Ga0530510_0019709 | |||
| 2017 | Ga0530510_0027649 | |||
| 2018 | Ga0530510_0042765 | |||
| 2019 | Ga0530510_0047244 | |||
| 2020 | Ga0530510_0072734 | |||
| 2021 | Ga0530510_0306949 | |||
| 2022 | Ga0530510_0359033 | |||
| 2023 | Ga0530510_0403613 | |||
| 2024 | Ga0530510_0670923 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v5z-assembly1.cif.gz_Ad | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.9815 | 54 | 155 |
| 1qd7-assembly1.cif.gz_C | partial model for 30s ribosomal subunit | 0.9735 | 50 | 208 |
| 4v5z-assembly1.cif.gz_Ad | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.9629 | 54 | 155 |
| 1qd7-assembly1.cif.gz_C | partial model for 30s ribosomal subunit | 0.9615 | 50 | 208 |
| 6vwl-assembly1.cif.gz_c | 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) | 0.9571 | 52 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9LXG1_108_164_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9692 | 98 | 141 | 3.10.290.10 |
| af_A0A0P0Y445_123_179_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9668 | 100 | 142 | 3.10.290.10 |
| af_Q9XPI8_145_195_3.10.290.10 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9668 | 98 | 148 | 3.10.290.10 |
| 5o5jD02 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9606 | 101 | 193 | 3.10.290.10 |
| 1c06A02 | Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain | 0.9566 | 100 | 188 | 3.10.290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A660Y094-F1-model_v4 | 30S ribosomal protein S4 | 0.9838 | 87 | 208 |
GO:0003735
GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A3D6DLJ3-F1-model_v4 | Small ribosomal subunit protein uS4 | 0.982 | 60 | 208 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A3C0VSH8-F1-model_v4 | Small ribosomal subunit protein uS4 | 0.9816 | 64 | 208 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 GO:0042274 |
| AF-W4RV18-F1-model_v4 | Small ribosomal subunit protein uS4 (30S ribosomal protein S4) | 0.9809 | 68 | 192 |
GO:0003735
GO:0015935 GO:0019843 GO:0042274 |
| AF-A0A6J6KWK0-F1-model_v4 | Unannotated protein | 0.9806 | 59 | 208 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 GO:0042274 |