F488165
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1012 | 436 | 2024 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10238890|Ga0105248_102388903 |
| Length | 176 |
| Sequence | LKSGDETPIIVSRRLLSLHAISEADPMPALVTFGRVLFAVLFMYTGATKLFAIQPTADFIASKVTIPSVLAPYTSQLETMTGMPMPQLLAISVGGFEILAGLMIAVNFGARFFSILLIFFVIGATFYFHDFWNQPAPENAKALIDALKNLSIIGALFMIAGYGRGPRPNEAAYGDV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 201 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 202 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 209 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 210 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 211 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 220 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 221 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 230 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 231 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 234 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 237 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 238 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 239 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 242 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 247 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 338 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 339 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 340 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 341 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 342 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 343 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 346 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 347 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 348 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 352 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 353 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 354 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 355 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 356 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 357 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 369 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 371 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 372 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 379 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 382 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 386 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 387 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 388 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 389 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 391 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 392 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 393 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 394 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 395 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 396 | 3300053114 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere | Metagenome | Endosphere |
| 397 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 398 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 399 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 400 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 401 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 402 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 404 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 406 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 407 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 408 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 409 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 410 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 411 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 412 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 413 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 415 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 416 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 417 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 418 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 419 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 420 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 422 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 423 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 424 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 425 | 2791355199 | |||
| 426 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 427 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 428 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 429 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 430 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 431 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 432 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 433 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 434 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 435 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 436 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.52 |
| Metatranscriptomes | 0 |
| Isolates | 1.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.07 |
| Nodule | 1.09 |
| Rhizoplane | 6.42 |
| Rhizosphere | 75.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105248_10238890 | 3300009177 | Bacteria | 2045 |
| 2 | JGI24750J21931_1028729 | 3300002070 | Bacteria | 808 |
| 3 | JGI25406J46586_10167307 | 3300003203 | Bacteria | 641 |
| 4 | JGI25153J46596_10001106 | 3300003215 | Bacteria | 16363 |
| 5 | rootH1_10049394 | 3300003316 | Bacteria | 1424 |
| 6 | rootL2_10062449 | 3300003322 | Bacteria | 1531 |
| 7 | JGI25404J52841_10052368 | 3300003659 | Bacteria | 857 |
| 8 | Ga0065704_10666121 | 3300005289 | Bacteria | 576 |
| 9 | Ga0065707_10250855 | 3300005295 | Bacteria | 1112 |
| 10 | Ga0070658_10247790 | 3300005327 | Bacteria | 1511 |
| 11 | Ga0070658_10358392 | 3300005327 | Bacteria | 1249 |
| 12 | Ga0070676_10246735 | 3300005328 | Bacteria | 1190 |
| 13 | Ga0070676_10247677 | 3300005328 | Bacteria | 1188 |
| 14 | Ga0070690_100418309 | 3300005330 | Bacteria | 988 |
| 15 | Ga0070670_100206023 | 3300005331 | Bacteria | 1709 |
| 16 | Ga0070670_100562681 | 3300005331 | Bacteria | 1018 |
| 17 | Ga0070670_100592193 | 3300005331 | Bacteria | 992 |
| 18 | Ga0068869_100102861 | 3300005334 | Bacteria | 2163 |
| 19 | Ga0068869_100198829 | 3300005334 | Bacteria | 1579 |
| 20 | Ga0068869_100298342 | 3300005334 | Bacteria | 1300 |
| 21 | Ga0070680_100028149 | 3300005336 | Bacteria | 4507 |
| 22 | Ga0070682_100163513 | 3300005337 | Bacteria | 1540 |
| 23 | Ga0070682_100182044 | 3300005337 | Bacteria | 1469 |
| 24 | Ga0070682_100876662 | 3300005337 | Bacteria | 735 |
| 25 | Ga0070682_100932277 | 3300005337 | Bacteria | 716 |
| 26 | Ga0070682_101746713 | 3300005337 | Bacteria | 541 |
| 27 | Ga0068868_100007248 | 3300005338 | Bacteria | 7885 |
| 28 | Ga0068868_100034333 | 3300005338 | Bacteria | 3915 |
| 29 | Ga0068868_100281031 | 3300005338 | Bacteria | 1409 |
| 30 | Ga0068868_101266019 | 3300005338 | Bacteria | 684 |
| 31 | Ga0070660_101493385 | 3300005339 | Bacteria | 575 |
| 32 | Ga0070687_100835132 | 3300005343 | Bacteria | 656 |
| 33 | Ga0070661_100064797 | 3300005344 | Bacteria | 2686 |
| 34 | Ga0070692_10167836 | 3300005345 | Bacteria | 1263 |
| 35 | Ga0070668_100169745 | 3300005347 | Bacteria | 1775 |
| 36 | Ga0070668_100667527 | 3300005347 | Bacteria | 914 |
| 37 | Ga0070668_100740310 | 3300005347 | Bacteria | 869 |
| 38 | Ga0070668_101129771 | 3300005347 | Bacteria | 708 |
| 39 | Ga0070669_100054862 | 3300005353 | Bacteria | 2919 |
| 40 | Ga0070669_100484947 | 3300005353 | Bacteria | 1023 |
| 41 | Ga0070675_100298665 | 3300005354 | Bacteria | 1418 |
| 42 | Ga0070675_101212564 | 3300005354 | Bacteria | 695 |
| 43 | Ga0070671_100160036 | 3300005355 | Bacteria | 1903 |
| 44 | Ga0070671_100200989 | 3300005355 | Bacteria | 1690 |
| 45 | Ga0070671_101333228 | 3300005355 | Bacteria | 633 |
| 46 | Ga0070671_101493719 | 3300005355 | Bacteria | 598 |
| 47 | Ga0070674_100038183 | 3300005356 | Bacteria | 3234 |
| 48 | Ga0070674_100595106 | 3300005356 | Bacteria | 934 |
| 49 | Ga0070674_100822581 | 3300005356 | Bacteria | 804 |
| 50 | Ga0070673_100600802 | 3300005364 | Bacteria | 1004 |
| 51 | Ga0070673_100871453 | 3300005364 | Bacteria | 834 |
| 52 | Ga0070688_100110288 | 3300005365 | Bacteria | 1829 |
| 53 | Ga0070659_100013386 | 3300005366 | Bacteria | 6104 |
| 54 | Ga0070659_100029963 | 3300005366 | Bacteria | 4208 |
| 55 | Ga0070659_100120478 | 3300005366 | Bacteria | 2124 |
| 56 | Ga0070659_101504332 | 3300005366 | Bacteria | 600 |
| 57 | Ga0070667_100062286 | 3300005367 | Bacteria | 3159 |
| 58 | Ga0070667_100082128 | 3300005367 | Bacteria | 2758 |
| 59 | Ga0070667_100542178 | 3300005367 | Bacteria | 1069 |
| 60 | Ga0070667_100576129 | 3300005367 | Bacteria | 1036 |
| 61 | Ga0070667_100589692 | 3300005367 | Bacteria | 1023 |
| 62 | Ga0070667_100634250 | 3300005367 | Bacteria | 986 |
| 63 | Ga0070667_101078421 | 3300005367 | Bacteria | 750 |
| 64 | Ga0070667_101906528 | 3300005367 | Bacteria | 559 |
| 65 | Ga0070709_10087636 | 3300005434 | Bacteria | 2046 |
| 66 | Ga0070713_100123239 | 3300005436 | Bacteria | 2276 |
| 67 | Ga0070713_100194529 | 3300005436 | Bacteria | 1829 |
| 68 | Ga0070713_101682353 | 3300005436 | Bacteria | 616 |
| 69 | Ga0070701_10182076 | 3300005438 | Bacteria | 1231 |
| 70 | Ga0070701_10443537 | 3300005438 | Bacteria | 832 |
| 71 | Ga0070711_100833901 | 3300005439 | Bacteria | 784 |
| 72 | Ga0070711_101402764 | 3300005439 | Bacteria | 608 |
| 73 | Ga0070700_100083281 | 3300005441 | Bacteria | 2070 |
| 74 | Ga0070700_100128523 | 3300005441 | Bacteria | 1707 |
| 75 | Ga0070700_100331451 | 3300005441 | Bacteria | 1122 |
| 76 | Ga0070700_100629094 | 3300005441 | Bacteria | 845 |
| 77 | Ga0070700_101214542 | 3300005441 | Bacteria | 630 |
| 78 | Ga0070694_100199793 | 3300005444 | Bacteria | 1490 |
| 79 | Ga0070663_100031336 | 3300005455 | Bacteria | 3654 |
| 80 | Ga0070663_100054677 | 3300005455 | Bacteria | 2854 |
| 81 | Ga0070663_100054728 | 3300005455 | Bacteria | 2853 |
| 82 | Ga0070663_100078560 | 3300005455 | Bacteria | 2419 |
| 83 | Ga0070663_100102129 | 3300005455 | Bacteria | 2142 |
| 84 | Ga0070663_100208976 | 3300005455 | Bacteria | 1527 |
| 85 | Ga0070678_100016899 | 3300005456 | Bacteria | 4680 |
| 86 | Ga0070678_100129344 | 3300005456 | Bacteria | 2004 |
| 87 | Ga0070678_100135610 | 3300005456 | Bacteria | 1962 |
| 88 | Ga0070678_100169375 | 3300005456 | Bacteria | 1777 |
| 89 | Ga0070678_100336473 | 3300005456 | Bacteria | 1294 |
| 90 | Ga0070678_100338181 | 3300005456 | Bacteria | 1291 |
| 91 | Ga0070678_100405945 | 3300005456 | Bacteria | 1185 |
| 92 | Ga0070678_100617267 | 3300005456 | Bacteria | 969 |
| 93 | Ga0070678_100714384 | 3300005456 | Bacteria | 904 |
| 94 | Ga0070662_100028974 | 3300005457 | Bacteria | 3859 |
| 95 | Ga0070662_100115348 | 3300005457 | Bacteria | 2052 |
| 96 | Ga0070662_100688005 | 3300005457 | Bacteria | 864 |
| 97 | Ga0070662_100877026 | 3300005457 | Bacteria | 765 |
| 98 | Ga0070681_10133684 | 3300005458 | Bacteria | 2412 |
| 99 | Ga0068867_100060657 | 3300005459 | Bacteria | 2806 |
| 100 | Ga0068867_101353192 | 3300005459 | Bacteria | 659 |
| 101 | Ga0070685_10677491 | 3300005466 | Bacteria | 750 |
| 102 | Ga0070698_100112992 | 3300005471 | Bacteria | 2681 |
| 103 | Ga0070698_100725587 | 3300005471 | Bacteria | 936 |
| 104 | Ga0070699_100083550 | 3300005518 | Bacteria | 2785 |
| 105 | Ga0070679_100020404 | 3300005530 | Bacteria | 6461 |
| 106 | Ga0070679_100083975 | 3300005530 | Bacteria | 3173 |
| 107 | Ga0070684_100095276 | 3300005535 | Bacteria | 2652 |
| 108 | Ga0070697_100077284 | 3300005536 | Bacteria | 2738 |
| 109 | Ga0070697_101276538 | 3300005536 | Bacteria | 655 |
| 110 | Ga0068853_100084664 | 3300005539 | Bacteria | 2778 |
| 111 | Ga0068853_100508583 | 3300005539 | Bacteria | 1138 |
| 112 | Ga0068853_100714044 | 3300005539 | Bacteria | 957 |
| 113 | Ga0068853_100814082 | 3300005539 | Bacteria | 895 |
| 114 | Ga0068853_101227004 | 3300005539 | Bacteria | 724 |
| 115 | Ga0070672_100304521 | 3300005543 | Bacteria | 1352 |
| 116 | Ga0070672_100519508 | 3300005543 | Bacteria | 1031 |
| 117 | Ga0070672_100842846 | 3300005543 | Bacteria | 808 |
| 118 | Ga0070686_100166509 | 3300005544 | Bacteria | 1556 |
| 119 | Ga0070686_100195646 | 3300005544 | Bacteria | 1446 |
| 120 | Ga0070686_100196558 | 3300005544 | Bacteria | 1443 |
| 121 | Ga0070695_100269109 | 3300005545 | Bacteria | 1248 |
| 122 | Ga0070696_100392060 | 3300005546 | Bacteria | 1084 |
| 123 | Ga0070693_100052550 | 3300005547 | Bacteria | 2336 |
| 124 | Ga0070693_100128856 | 3300005547 | Bacteria | 1579 |
| 125 | Ga0070665_100052300 | 3300005548 | Bacteria | 4097 |
| 126 | Ga0070665_100160319 | 3300005548 | Bacteria | 2251 |
| 127 | Ga0070665_100312102 | 3300005548 | Bacteria | 1576 |
| 128 | Ga0070665_100382771 | 3300005548 | Bacteria | 1414 |
| 129 | Ga0068855_100017635 | 3300005563 | Bacteria | 8585 |
| 130 | Ga0068855_100029614 | 3300005563 | Bacteria | 6543 |
| 131 | Ga0068855_100277159 | 3300005563 | Bacteria | 1863 |
| 132 | Ga0068855_100429279 | 3300005563 | Bacteria | 1445 |
| 133 | Ga0068855_100438123 | 3300005563 | Bacteria | 1428 |
| 134 | Ga0068855_100629848 | 3300005563 | Bacteria | 1154 |
| 135 | Ga0068855_100703755 | 3300005563 | Bacteria | 1081 |
| 136 | Ga0070664_100932192 | 3300005564 | Bacteria | 815 |
| 137 | Ga0070664_100936596 | 3300005564 | Bacteria | 813 |
| 138 | Ga0070664_101795669 | 3300005564 | Bacteria | 582 |
| 139 | Ga0068857_100054957 | 3300005577 | Bacteria | 3534 |
| 140 | Ga0068857_100758475 | 3300005577 | Bacteria | 925 |
| 141 | Ga0068854_100117469 | 3300005578 | Bacteria | 2014 |
| 142 | Ga0068854_100613413 | 3300005578 | Bacteria | 930 |
| 143 | Ga0068856_100044548 | 3300005614 | Bacteria | 4366 |
| 144 | Ga0068856_100050315 | 3300005614 | Bacteria | 4108 |
| 145 | Ga0068856_100153965 | 3300005614 | Bacteria | 2309 |
| 146 | Ga0068856_100396542 | 3300005614 | Bacteria | 1400 |
| 147 | Ga0068856_101834432 | 3300005614 | Unclassified | 618 |
| 148 | Ga0070702_100032858 | 3300005615 | Bacteria | 2850 |
| 149 | Ga0068852_100056294 | 3300005616 | Bacteria | 3398 |
| 150 | Ga0068852_100112587 | 3300005616 | Bacteria | 2477 |
| 151 | Ga0068852_100130524 | 3300005616 | Bacteria | 2313 |
| 152 | Ga0068852_100140996 | 3300005616 | Bacteria | 2231 |
| 153 | Ga0068852_100312903 | 3300005616 | Bacteria | 1523 |
| 154 | Ga0068859_100226342 | 3300005617 | Bacteria | 1958 |
| 155 | Ga0068859_100395407 | 3300005617 | Bacteria | 1478 |
| 156 | Ga0068859_100404271 | 3300005617 | Bacteria | 1461 |
| 157 | Ga0068864_100025302 | 3300005618 | Bacteria | 4998 |
| 158 | Ga0068864_100080894 | 3300005618 | Bacteria | 2847 |
| 159 | Ga0068866_10040005 | 3300005718 | Bacteria | 2318 |
| 160 | Ga0068866_10043942 | 3300005718 | Bacteria | 2233 |
| 161 | Ga0068866_10242586 | 3300005718 | Bacteria | 1098 |
| 162 | Ga0068866_10949598 | 3300005718 | Bacteria | 608 |
| 163 | Ga0068861_100057452 | 3300005719 | Bacteria | 2972 |
| 164 | Ga0068861_100060580 | 3300005719 | Bacteria | 2901 |
| 165 | Ga0068861_100081324 | 3300005719 | Bacteria | 2536 |
| 166 | Ga0068861_100201859 | 3300005719 | Bacteria | 1669 |
| 167 | Ga0068861_101168821 | 3300005719 | Bacteria | 743 |
| 168 | Ga0068851_10244456 | 3300005834 | Bacteria | 1016 |
| 169 | Ga0068870_10115913 | 3300005840 | Bacteria | 1536 |
| 170 | Ga0068863_100285834 | 3300005841 | Bacteria | 1598 |
| 171 | Ga0068863_100317508 | 3300005841 | Bacteria | 1513 |
| 172 | Ga0068863_100652672 | 3300005841 | Bacteria | 1043 |
| 173 | Ga0068863_100727088 | 3300005841 | Bacteria | 988 |
| 174 | Ga0068858_100121056 | 3300005842 | Bacteria | 2447 |
| 175 | Ga0068858_100177260 | 3300005842 | Bacteria | 2012 |
| 176 | Ga0068858_100618255 | 3300005842 | Bacteria | 1052 |
| 177 | Ga0068860_100000058 | 3300005843 | Bacteria | 197181 |
| 178 | Ga0068860_100251166 | 3300005843 | Bacteria | 1722 |
| 179 | Ga0068862_100053834 | 3300005844 | Bacteria | 3445 |
| 180 | Ga0068862_100106659 | 3300005844 | Bacteria | 2456 |
| 181 | Ga0068862_100140583 | 3300005844 | Bacteria | 2142 |
| 182 | Ga0068862_100253886 | 3300005844 | Bacteria | 1603 |
| 183 | Ga0068862_100365200 | 3300005844 | Bacteria | 1342 |
| 184 | Ga0068862_100437267 | 3300005844 | Bacteria | 1231 |
| 185 | Ga0068862_100466778 | 3300005844 | Bacteria | 1192 |
| 186 | Ga0068862_100818592 | 3300005844 | Bacteria | 910 |
| 187 | Ga0081455_10002419 | 3300005937 | Bacteria | 22263 |
| 188 | Ga0081455_10097911 | 3300005937 | Bacteria | 2363 |
| 189 | Ga0081538_10124731 | 3300005981 | Bacteria | 1228 |
| 190 | Ga0081540_1002092 | 3300005983 | Bacteria | 16629 |
| 191 | Ga0081540_1004102 | 3300005983 | Bacteria | 11245 |
| 192 | Ga0081540_1009301 | 3300005983 | Bacteria | 6780 |
| 193 | Ga0081540_1016640 | 3300005983 | Bacteria | 4591 |
| 194 | Ga0081539_10026414 | 3300005985 | Bacteria | 3705 |
| 195 | Ga0070717_10005335 | 3300006028 | Bacteria | 9370 |
| 196 | Ga0070717_11513364 | 3300006028 | Bacteria | 609 |
| 197 | Ga0075365_10005918 | 3300006038 | Bacteria | 6658 |
| 198 | Ga0075365_10033942 | 3300006038 | Bacteria | 3292 |
| 199 | Ga0075365_10096308 | 3300006038 | Bacteria | 2022 |
| 200 | Ga0075365_10322223 | 3300006038 | Bacteria | 1088 |
| 201 | Ga0075365_10417989 | 3300006038 | Bacteria | 947 |
| 202 | Ga0075368_10050537 | 3300006042 | Bacteria | 1652 |
| 203 | Ga0075368_10142947 | 3300006042 | Bacteria | 998 |
| 204 | Ga0075368_10261632 | 3300006042 | Bacteria | 741 |
| 205 | Ga0075363_100010147 | 3300006048 | Bacteria | 4455 |
| 206 | Ga0075363_100039459 | 3300006048 | Bacteria | 2485 |
| 207 | Ga0075363_100138720 | 3300006048 | Bacteria | 1368 |
| 208 | Ga0075363_100162658 | 3300006048 | Bacteria | 1264 |
| 209 | Ga0075363_100197272 | 3300006048 | Bacteria | 1149 |
| 210 | Ga0075364_10064370 | 3300006051 | Bacteria | 2407 |
| 211 | Ga0075364_10590878 | 3300006051 | Bacteria | 759 |
| 212 | Ga0070715_10110516 | 3300006163 | Bacteria | 1296 |
| 213 | Ga0070716_100127732 | 3300006173 | Bacteria | 1602 |
| 214 | Ga0070716_100822414 | 3300006173 | Bacteria | 721 |
| 215 | Ga0070712_100048117 | 3300006175 | Bacteria | 2955 |
| 216 | Ga0075362_10038981 | 3300006177 | Bacteria | 2087 |
| 217 | Ga0075362_10132718 | 3300006177 | Bacteria | 1186 |
| 218 | Ga0075362_10199527 | 3300006177 | Bacteria | 974 |
| 219 | Ga0075362_10349812 | 3300006177 | Bacteria | 739 |
| 220 | Ga0075367_10067366 | 3300006178 | Bacteria | 2146 |
| 221 | Ga0075367_10070568 | 3300006178 | Bacteria | 2100 |
| 222 | Ga0075367_10079229 | 3300006178 | Bacteria | 1985 |
| 223 | Ga0075367_10144432 | 3300006178 | Bacteria | 1475 |
| 224 | Ga0075367_10237094 | 3300006178 | Bacteria | 1143 |
| 225 | Ga0075369_10015050 | 3300006186 | Bacteria | 3099 |
| 226 | Ga0075369_10112709 | 3300006186 | Bacteria | 1226 |
| 227 | Ga0075369_10180704 | 3300006186 | Bacteria | 971 |
| 228 | Ga0075366_10114713 | 3300006195 | Bacteria | 1622 |
| 229 | Ga0075366_10130334 | 3300006195 | Bacteria | 1517 |
| 230 | Ga0075366_10230488 | 3300006195 | Bacteria | 1128 |
| 231 | Ga0075366_10240040 | 3300006195 | Bacteria | 1105 |
| 232 | Ga0075366_10287195 | 3300006195 | Bacteria | 1006 |
| 233 | Ga0097621_100083061 | 3300006237 | Bacteria | 2668 |
| 234 | Ga0097621_100194605 | 3300006237 | Bacteria | 1757 |
| 235 | Ga0097621_100406302 | 3300006237 | Bacteria | 1220 |
| 236 | Ga0097621_101410444 | 3300006237 | Bacteria | 660 |
| 237 | Ga0075370_10017192 | 3300006353 | Bacteria | 3904 |
| 238 | Ga0075370_10119300 | 3300006353 | Bacteria | 1535 |
| 239 | Ga0075370_10287608 | 3300006353 | Bacteria | 977 |
| 240 | Ga0068871_100339866 | 3300006358 | Bacteria | 1325 |
| 241 | Ga0068871_100372787 | 3300006358 | Bacteria | 1266 |
| 242 | Ga0068871_100582597 | 3300006358 | Bacteria | 1016 |
| 243 | Ga0068871_101010930 | 3300006358 | Bacteria | 775 |
| 244 | Ga0075428_100174800 | 3300006844 | Bacteria | 2326 |
| 245 | Ga0075434_100931220 | 3300006871 | Bacteria | 883 |
| 246 | Ga0068865_100054115 | 3300006881 | Bacteria | 2787 |
| 247 | Ga0068865_100111722 | 3300006881 | Bacteria | 2017 |
| 248 | Ga0068865_100198421 | 3300006881 | Bacteria | 1556 |
| 249 | Ga0097620_100226341 | 3300006931 | Bacteria | 1958 |
| 250 | Ga0097620_100395360 | 3300006931 | Bacteria | 1478 |
| 251 | Ga0097620_100404287 | 3300006931 | Bacteria | 1461 |
| 252 | Ga0099795_10005197 | 3300007788 | Bacteria | 3438 |
| 253 | Ga0099795_10131623 | 3300007788 | Bacteria | 1010 |
| 254 | Ga0099795_10216224 | 3300007788 | Bacteria | 814 |
| 255 | Ga0105251_10267285 | 3300009011 | Bacteria | 772 |
| 256 | Ga0105240_10050611 | 3300009093 | Bacteria | 5236 |
| 257 | Ga0105240_10567872 | 3300009093 | Bacteria | 1253 |
| 258 | Ga0105245_10356075 | 3300009098 | Bacteria | 1451 |
| 259 | Ga0105245_10709834 | 3300009098 | Bacteria | 1039 |
| 260 | Ga0105245_10803915 | 3300009098 | Bacteria | 978 |
| 261 | Ga0105245_11405919 | 3300009098 | Bacteria | 748 |
| 262 | Ga0105247_10016251 | 3300009101 | Bacteria | 4458 |
| 263 | Ga0105247_10036592 | 3300009101 | Bacteria | 2992 |
| 264 | Ga0105247_10271868 | 3300009101 | Bacteria | 1166 |
| 265 | Ga0105247_10491980 | 3300009101 | Bacteria | 892 |
| 266 | Ga0105247_11351934 | 3300009101 | Bacteria | 574 |
| 267 | Ga0114129_10064849 | 3300009147 | Bacteria | 5098 |
| 268 | Ga0105243_10324591 | 3300009148 | Bacteria | 1404 |
| 269 | Ga0105243_10427228 | 3300009148 | Bacteria | 1237 |
| 270 | Ga0105241_10041152 | 3300009174 | Bacteria | 3490 |
| 271 | Ga0105241_10099499 | 3300009174 | Bacteria | 2309 |
| 272 | Ga0105242_10402070 | 3300009176 | Bacteria | 1278 |
| 273 | Ga0105248_10033538 | 3300009177 | Bacteria | 5736 |
| 274 | Ga0105248_10223621 | 3300009177 | Bacteria | 2119 |
| 275 | Ga0105248_10478146 | 3300009177 | Bacteria | 1404 |
| 276 | Ga0105248_11467355 | 3300009177 | Bacteria | 772 |
| 277 | Ga0105237_10090818 | 3300009545 | Bacteria | 3043 |
| 278 | Ga0105237_10250559 | 3300009545 | Bacteria | 1773 |
| 279 | Ga0105237_10318388 | 3300009545 | Bacteria | 1559 |
| 280 | Ga0105237_10475461 | 3300009545 | Bacteria | 1256 |
| 281 | Ga0105237_10587200 | 3300009545 | Bacteria | 1121 |
| 282 | Ga0105237_11061828 | 3300009545 | Bacteria | 817 |
| 283 | Ga0105237_11104506 | 3300009545 | Bacteria | 800 |
| 284 | Ga0105238_10205293 | 3300009551 | Bacteria | 1946 |
| 285 | Ga0105238_10297161 | 3300009551 | Bacteria | 1598 |
| 286 | Ga0105238_10650285 | 3300009551 | Bacteria | 1064 |
| 287 | Ga0105238_11123670 | 3300009551 | Bacteria | 809 |
| 288 | Ga0105249_10237127 | 3300009553 | Bacteria | 1802 |
| 289 | Ga0105249_10241385 | 3300009553 | Bacteria | 1786 |
| 290 | Ga0105249_10278071 | 3300009553 | Bacteria | 1670 |
| 291 | Ga0105249_10584526 | 3300009553 | Bacteria | 1170 |
| 292 | Ga0105249_11301589 | 3300009553 | Bacteria | 798 |
| 293 | Ga0105249_11793807 | 3300009553 | Bacteria | 686 |
| 294 | Ga0099796_10016836 | 3300010159 | Bacteria | 2166 |
| 295 | Ga0099796_10017000 | 3300010159 | Bacteria | 2158 |
| 296 | Ga0099796_10046732 | 3300010159 | Bacteria | 1487 |
| 297 | Ga0099796_10161181 | 3300010159 | Bacteria | 889 |
| 298 | Ga0099796_10267336 | 3300010159 | Bacteria | 715 |
| 299 | Ga0105239_10272943 | 3300010375 | Bacteria | 1902 |
| 300 | Ga0105239_10440714 | 3300010375 | Bacteria | 1477 |
| 301 | Ga0105239_10518013 | 3300010375 | Bacteria | 1357 |
| 302 | Ga0105239_10528120 | 3300010375 | Bacteria | 1343 |
| 303 | Ga0105246_10096777 | 3300011119 | Bacteria | 2140 |
| 304 | Ga0105246_10170406 | 3300011119 | Bacteria | 1667 |
| 305 | Ga0105246_10207518 | 3300011119 | Bacteria | 1527 |
| 306 | Ga0105246_10379792 | 3300011119 | Bacteria | 1167 |
| 307 | Ga0105246_10451735 | 3300011119 | Bacteria | 1080 |
| 308 | Ga0105246_10642111 | 3300011119 | Bacteria | 923 |
| 309 | Ga0157315_1017804 | 3300012508 | Bacteria | 719 |
| 310 | Ga0157373_10161499 | 3300013100 | Bacteria | 1576 |
| 311 | Ga0157373_10318242 | 3300013100 | Bacteria | 1106 |
| 312 | Ga0157371_10103344 | 3300013102 | Bacteria | 2022 |
| 313 | Ga0157371_10663113 | 3300013102 | Bacteria | 779 |
| 314 | Ga0157370_10083279 | 3300013104 | Bacteria | 3008 |
| 315 | Ga0157370_10162333 | 3300013104 | Bacteria | 2079 |
| 316 | Ga0157370_11245970 | 3300013104 | Bacteria | 671 |
| 317 | Ga0157369_10609199 | 3300013105 | Bacteria | 1127 |
| 318 | Ga0157369_10712082 | 3300013105 | Bacteria | 1034 |
| 319 | Ga0157374_10636559 | 3300013296 | Bacteria | 1078 |
| 320 | Ga0157374_12207020 | 3300013296 | Bacteria | 578 |
| 321 | Ga0157374_12260717 | 3300013296 | Bacteria | 571 |
| 322 | Ga0157378_10052830 | 3300013297 | Bacteria | 3615 |
| 323 | Ga0157378_10397007 | 3300013297 | Bacteria | 1358 |
| 324 | Ga0163162_10003676 | 3300013306 | Bacteria | 14707 |
| 325 | Ga0163162_10635262 | 3300013306 | Bacteria | 1192 |
| 326 | Ga0163162_10684744 | 3300013306 | Bacteria | 1148 |
| 327 | Ga0163162_10920615 | 3300013306 | Bacteria | 986 |
| 328 | Ga0163162_11196669 | 3300013306 | Bacteria | 862 |
| 329 | Ga0157372_10221124 | 3300013307 | Bacteria | 2195 |
| 330 | Ga0157372_10688229 | 3300013307 | Bacteria | 1190 |
| 331 | Ga0157375_10581822 | 3300013308 | Bacteria | 1280 |
| 332 | Ga0157375_10806841 | 3300013308 | Bacteria | 1087 |
| 333 | Ga0157375_12720541 | 3300013308 | Bacteria | 591 |
| 334 | Ga0163163_10274800 | 3300014325 | Bacteria | 1736 |
| 335 | Ga0163163_10381819 | 3300014325 | Bacteria | 1466 |
| 336 | Ga0163163_10494780 | 3300014325 | Bacteria | 1284 |
| 337 | Ga0163163_12233145 | 3300014325 | Bacteria | 606 |
| 338 | Ga0157380_10571212 | 3300014326 | Bacteria | 1113 |
| 339 | Ga0157380_10659933 | 3300014326 | Bacteria | 1045 |
| 340 | Ga0157380_11171104 | 3300014326 | Bacteria | 811 |
| 341 | Ga0157380_11713979 | 3300014326 | Bacteria | 686 |
| 342 | Ga0157379_10075745 | 3300014968 | Bacteria | 3013 |
| 343 | Ga0157379_10085223 | 3300014968 | Bacteria | 2831 |
| 344 | Ga0157379_10554598 | 3300014968 | Bacteria | 1069 |
| 345 | Ga0157379_10620189 | 3300014968 | Bacteria | 1011 |
| 346 | Ga0157379_11217209 | 3300014968 | Bacteria | 725 |
| 347 | Ga0157376_10013748 | 3300014969 | Bacteria | 6052 |
| 348 | Ga0157376_10437417 | 3300014969 | Bacteria | 1273 |
| 349 | Ga0157376_10627328 | 3300014969 | Bacteria | 1073 |
| 350 | Ga0157376_10895874 | 3300014969 | Bacteria | 905 |
| 351 | Ga0163161_10012760 | 3300017792 | Bacteria | 5836 |
| 352 | Ga0163161_10219488 | 3300017792 | Bacteria | 1472 |
| 353 | Ga0163161_10850982 | 3300017792 | Bacteria | 770 |
| 354 | Ga0213874_10014179 | 3300021377 | Bacteria | 2079 |
| 355 | Ga0213874_10177991 | 3300021377 | Bacteria | 755 |
| 356 | Ga0209026_1015260 | 3300025250 | Bacteria | 1265 |
| 357 | Ga0209758_1032872 | 3300025297 | Bacteria | 2097 |
| 358 | Ga0207697_10090582 | 3300025315 | Bacteria | 1296 |
| 359 | Ga0207656_10243163 | 3300025321 | Bacteria | 880 |
| 360 | Ga0207682_10236688 | 3300025893 | Bacteria | 848 |
| 361 | Ga0207682_10266242 | 3300025893 | Bacteria | 800 |
| 362 | Ga0207692_10293747 | 3300025898 | Bacteria | 987 |
| 363 | Ga0207642_10193472 | 3300025899 | Bacteria | 1118 |
| 364 | Ga0207642_10196391 | 3300025899 | Bacteria | 1111 |
| 365 | Ga0207642_10383017 | 3300025899 | Bacteria | 837 |
| 366 | Ga0207710_10030090 | 3300025900 | Bacteria | 2366 |
| 367 | Ga0207710_10040008 | 3300025900 | Bacteria | 2077 |
| 368 | Ga0207710_10167797 | 3300025900 | Bacteria | 1072 |
| 369 | Ga0207710_10253517 | 3300025900 | Bacteria | 880 |
| 370 | Ga0207688_10037109 | 3300025901 | Bacteria | 2702 |
| 371 | Ga0207688_10457381 | 3300025901 | Bacteria | 796 |
| 372 | Ga0207680_10074752 | 3300025903 | Bacteria | 2111 |
| 373 | Ga0207680_10774173 | 3300025903 | Bacteria | 688 |
| 374 | Ga0207647_10052558 | 3300025904 | Bacteria | 2515 |
| 375 | Ga0207685_10166861 | 3300025905 | Bacteria | 1010 |
| 376 | Ga0207699_10034310 | 3300025906 | Bacteria | 2877 |
| 377 | Ga0207645_10104054 | 3300025907 | Bacteria | 1833 |
| 378 | Ga0207645_10524651 | 3300025907 | Bacteria | 803 |
| 379 | Ga0207645_10567032 | 3300025907 | Bacteria | 770 |
| 380 | Ga0207643_10037354 | 3300025908 | Bacteria | 2725 |
| 381 | Ga0207643_10048012 | 3300025908 | Bacteria | 2417 |
| 382 | Ga0207705_10128371 | 3300025909 | Bacteria | 1885 |
| 383 | Ga0207705_10137452 | 3300025909 | Bacteria | 1823 |
| 384 | Ga0207684_11286903 | 3300025910 | Bacteria | 602 |
| 385 | Ga0207654_10011369 | 3300025911 | Bacteria | 4542 |
| 386 | Ga0207654_10208786 | 3300025911 | Bacteria | 1289 |
| 387 | Ga0207707_10154844 | 3300025912 | Bacteria | 2004 |
| 388 | Ga0207707_10155477 | 3300025912 | Bacteria | 2000 |
| 389 | Ga0207695_10341192 | 3300025913 | Bacteria | 1386 |
| 390 | Ga0207695_10399936 | 3300025913 | Bacteria | 1258 |
| 391 | Ga0207671_10078202 | 3300025914 | Bacteria | 2477 |
| 392 | Ga0207671_10156675 | 3300025914 | Bacteria | 1762 |
| 393 | Ga0207671_10158726 | 3300025914 | Bacteria | 1750 |
| 394 | Ga0207671_10787196 | 3300025914 | Bacteria | 755 |
| 395 | Ga0207693_10022609 | 3300025915 | Bacteria | 4995 |
| 396 | Ga0207693_10029036 | 3300025915 | Bacteria | 4371 |
| 397 | Ga0207693_10096969 | 3300025915 | Bacteria | 2312 |
| 398 | Ga0207663_10566172 | 3300025916 | Bacteria | 890 |
| 399 | Ga0207663_10647604 | 3300025916 | Bacteria | 834 |
| 400 | Ga0207663_11491768 | 3300025916 | Bacteria | 544 |
| 401 | Ga0207660_10027655 | 3300025917 | Bacteria | 3873 |
| 402 | Ga0207660_10158654 | 3300025917 | Bacteria | 1743 |
| 403 | Ga0207660_10350779 | 3300025917 | Bacteria | 1183 |
| 404 | Ga0207657_10007732 | 3300025919 | Bacteria | 10976 |
| 405 | Ga0207657_10135694 | 3300025919 | Bacteria | 2014 |
| 406 | Ga0207657_10705319 | 3300025919 | Bacteria | 783 |
| 407 | Ga0207657_10975191 | 3300025919 | Bacteria | 651 |
| 408 | Ga0207649_10071248 | 3300025920 | Bacteria | 2219 |
| 409 | Ga0207649_10499447 | 3300025920 | Bacteria | 925 |
| 410 | Ga0207652_10071088 | 3300025921 | Bacteria | 3023 |
| 411 | Ga0207652_10278639 | 3300025921 | Bacteria | 1508 |
| 412 | Ga0207681_10509590 | 3300025923 | Bacteria | 986 |
| 413 | Ga0207681_10849328 | 3300025923 | Bacteria | 763 |
| 414 | Ga0207694_10310874 | 3300025924 | Bacteria | 1299 |
| 415 | Ga0207694_10587206 | 3300025924 | Bacteria | 936 |
| 416 | Ga0207694_10830651 | 3300025924 | Bacteria | 781 |
| 417 | Ga0207650_10699033 | 3300025925 | Bacteria | 856 |
| 418 | Ga0207659_10091363 | 3300025926 | Bacteria | 2274 |
| 419 | Ga0207659_10276610 | 3300025926 | Bacteria | 1371 |
| 420 | Ga0207659_11071959 | 3300025926 | Bacteria | 693 |
| 421 | Ga0207687_10031494 | 3300025927 | Bacteria | 3585 |
| 422 | Ga0207687_10620980 | 3300025927 | Bacteria | 912 |
| 423 | Ga0207700_10031958 | 3300025928 | Bacteria | 3747 |
| 424 | Ga0207644_10242514 | 3300025931 | Bacteria | 1435 |
| 425 | Ga0207644_10369151 | 3300025931 | Bacteria | 1169 |
| 426 | Ga0207690_10025604 | 3300025932 | Bacteria | 3707 |
| 427 | Ga0207690_10153233 | 3300025932 | Bacteria | 1710 |
| 428 | Ga0207690_10827888 | 3300025932 | Bacteria | 766 |
| 429 | Ga0207706_10069272 | 3300025933 | Bacteria | 3103 |
| 430 | Ga0207706_10091791 | 3300025933 | Bacteria | 2670 |
| 431 | Ga0207706_10303480 | 3300025933 | Bacteria | 1391 |
| 432 | Ga0207706_10767624 | 3300025933 | Bacteria | 821 |
| 433 | Ga0207706_10845433 | 3300025933 | Bacteria | 775 |
| 434 | Ga0207686_10191222 | 3300025934 | Bacteria | 1459 |
| 435 | Ga0207686_10691787 | 3300025934 | Bacteria | 810 |
| 436 | Ga0207709_10047871 | 3300025935 | Bacteria | 2602 |
| 437 | Ga0207709_10282676 | 3300025935 | Bacteria | 1226 |
| 438 | Ga0207669_10149924 | 3300025937 | Bacteria | 1632 |
| 439 | Ga0207669_10356105 | 3300025937 | Bacteria | 1132 |
| 440 | Ga0207669_10393449 | 3300025937 | Bacteria | 1083 |
| 441 | Ga0207669_10431840 | 3300025937 | Bacteria | 1039 |
| 442 | Ga0207669_10443621 | 3300025937 | Bacteria | 1027 |
| 443 | Ga0207669_10594559 | 3300025937 | Bacteria | 898 |
| 444 | Ga0207704_10131490 | 3300025938 | Bacteria | 1734 |
| 445 | Ga0207704_10569802 | 3300025938 | Bacteria | 923 |
| 446 | Ga0207704_11659438 | 3300025938 | Bacteria | 549 |
| 447 | Ga0207665_10240753 | 3300025939 | Bacteria | 1333 |
| 448 | Ga0207665_10574923 | 3300025939 | Bacteria | 878 |
| 449 | Ga0207691_10215676 | 3300025940 | Bacteria | 1665 |
| 450 | Ga0207691_10373085 | 3300025940 | Bacteria | 1219 |
| 451 | Ga0207691_10445410 | 3300025940 | Bacteria | 1102 |
| 452 | Ga0207711_10032973 | 3300025941 | Bacteria | 4380 |
| 453 | Ga0207711_10135139 | 3300025941 | Bacteria | 2214 |
| 454 | Ga0207711_10547306 | 3300025941 | Bacteria | 1079 |
| 455 | Ga0207711_10841788 | 3300025941 | Bacteria | 854 |
| 456 | Ga0207711_11454386 | 3300025941 | Bacteria | 628 |
| 457 | Ga0207689_10016101 | 3300025942 | Bacteria | 6329 |
| 458 | Ga0207689_10150749 | 3300025942 | Bacteria | 1916 |
| 459 | Ga0207689_10514696 | 3300025942 | Bacteria | 1003 |
| 460 | Ga0207661_10056472 | 3300025944 | Bacteria | 3152 |
| 461 | Ga0207679_10103264 | 3300025945 | Bacteria | 2234 |
| 462 | Ga0207667_10124426 | 3300025949 | Bacteria | 2656 |
| 463 | Ga0207667_10602403 | 3300025949 | Bacteria | 1108 |
| 464 | Ga0207667_10705428 | 3300025949 | Bacteria | 1011 |
| 465 | Ga0207651_10920981 | 3300025960 | Bacteria | 779 |
| 466 | Ga0207712_10061492 | 3300025961 | Bacteria | 2666 |
| 467 | Ga0207712_10143860 | 3300025961 | Bacteria | 1833 |
| 468 | Ga0207712_10302748 | 3300025961 | Bacteria | 1313 |
| 469 | Ga0207712_10355405 | 3300025961 | Bacteria | 1219 |
| 470 | Ga0207712_10409719 | 3300025961 | Bacteria | 1141 |
| 471 | Ga0207668_10014887 | 3300025972 | Bacteria | 4822 |
| 472 | Ga0207668_10060845 | 3300025972 | Bacteria | 2652 |
| 473 | Ga0207668_10083922 | 3300025972 | Bacteria | 2319 |
| 474 | Ga0207668_10212704 | 3300025972 | Bacteria | 1547 |
| 475 | Ga0207668_10325700 | 3300025972 | Bacteria | 1276 |
| 476 | Ga0207668_10608455 | 3300025972 | Bacteria | 952 |
| 477 | Ga0207640_10016462 | 3300025981 | Bacteria | 4301 |
| 478 | Ga0207640_10108236 | 3300025981 | Bacteria | 1964 |
| 479 | Ga0207658_10075699 | 3300025986 | Bacteria | 2562 |
| 480 | Ga0207658_10565004 | 3300025986 | Bacteria | 1019 |
| 481 | Ga0207658_10729787 | 3300025986 | Bacteria | 896 |
| 482 | Ga0207658_11069225 | 3300025986 | Bacteria | 737 |
| 483 | Ga0207677_10175882 | 3300026023 | Bacteria | 1679 |
| 484 | Ga0207677_10383062 | 3300026023 | Bacteria | 1188 |
| 485 | Ga0207677_10562528 | 3300026023 | Bacteria | 995 |
| 486 | Ga0207677_10590228 | 3300026023 | Bacteria | 974 |
| 487 | Ga0207677_11181017 | 3300026023 | Bacteria | 700 |
| 488 | Ga0207703_10025797 | 3300026035 | Bacteria | 4625 |
| 489 | Ga0207703_10884165 | 3300026035 | Bacteria | 855 |
| 490 | Ga0207639_10306886 | 3300026041 | Bacteria | 1405 |
| 491 | Ga0207639_10308315 | 3300026041 | Bacteria | 1401 |
| 492 | Ga0207639_10482044 | 3300026041 | Bacteria | 1130 |
| 493 | Ga0207639_10503831 | 3300026041 | Bacteria | 1107 |
| 494 | Ga0207678_10019509 | 3300026067 | Bacteria | 5957 |
| 495 | Ga0207678_10026492 | 3300026067 | Bacteria | 5057 |
| 496 | Ga0207678_10028300 | 3300026067 | Bacteria | 4893 |
| 497 | Ga0207678_10037339 | 3300026067 | Bacteria | 4225 |
| 498 | Ga0207678_10113723 | 3300026067 | Bacteria | 2309 |
| 499 | Ga0207678_10253830 | 3300026067 | Bacteria | 1506 |
| 500 | Ga0207678_10366204 | 3300026067 | Bacteria | 1244 |
| 501 | Ga0207708_10044451 | 3300026075 | Bacteria | 3384 |
| 502 | Ga0207708_10531347 | 3300026075 | Bacteria | 989 |
| 503 | Ga0207708_10840917 | 3300026075 | Bacteria | 792 |
| 504 | Ga0207702_10089626 | 3300026078 | Bacteria | 2690 |
| 505 | Ga0207702_10666186 | 3300026078 | Bacteria | 1024 |
| 506 | Ga0207702_11000885 | 3300026078 | Bacteria | 829 |
| 507 | Ga0207641_10567305 | 3300026088 | Bacteria | 1108 |
| 508 | Ga0207641_10570643 | 3300026088 | Bacteria | 1105 |
| 509 | Ga0207648_10016066 | 3300026089 | Bacteria | 6858 |
| 510 | Ga0207648_10464869 | 3300026089 | Bacteria | 1154 |
| 511 | Ga0207648_10915692 | 3300026089 | Bacteria | 819 |
| 512 | Ga0207676_10689546 | 3300026095 | Bacteria | 989 |
| 513 | Ga0207676_12123471 | 3300026095 | Bacteria | 560 |
| 514 | Ga0207676_12436706 | 3300026095 | Bacteria | 520 |
| 515 | Ga0207674_10004659 | 3300026116 | Bacteria | 16461 |
| 516 | Ga0207674_10165973 | 3300026116 | Bacteria | 2162 |
| 517 | Ga0207675_100018787 | 3300026118 | Bacteria | 6450 |
| 518 | Ga0207675_100262760 | 3300026118 | Bacteria | 1673 |
| 519 | Ga0207675_100291447 | 3300026118 | Bacteria | 1588 |
| 520 | Ga0207675_100462680 | 3300026118 | Bacteria | 1258 |
| 521 | Ga0207675_100639498 | 3300026118 | Bacteria | 1069 |
| 522 | Ga0207675_100820892 | 3300026118 | Bacteria | 944 |
| 523 | Ga0207683_10016292 | 3300026121 | Bacteria | 6326 |
| 524 | Ga0207683_10082790 | 3300026121 | Bacteria | 2851 |
| 525 | Ga0207683_10083791 | 3300026121 | Bacteria | 2833 |
| 526 | Ga0207683_10096169 | 3300026121 | Bacteria | 2641 |
| 527 | Ga0207683_10328129 | 3300026121 | Bacteria | 1402 |
| 528 | Ga0207683_10670631 | 3300026121 | Bacteria | 961 |
| 529 | Ga0207698_10069860 | 3300026142 | Bacteria | 2780 |
| 530 | Ga0207698_10504412 | 3300026142 | Bacteria | 1178 |
| 531 | Ga0207698_10966652 | 3300026142 | Bacteria | 861 |
| 532 | Ga0209179_1009134 | 3300027512 | Bacteria | 1690 |
| 533 | Ga0209179_1035329 | 3300027512 | Bacteria | 1038 |
| 534 | Ga0209813_10088416 | 3300027866 | Bacteria | 1036 |
| 535 | Ga0207428_10344633 | 3300027907 | Bacteria | 1097 |
| 536 | Ga0268266_10002475 | 3300028379 | Bacteria | 19733 |
| 537 | Ga0268266_10004442 | 3300028379 | Bacteria | 13419 |
| 538 | Ga0268266_10126879 | 3300028379 | Bacteria | 2278 |
| 539 | Ga0268266_10209865 | 3300028379 | Bacteria | 1785 |
| 540 | Ga0268266_10361320 | 3300028379 | Bacteria | 1366 |
| 541 | Ga0268266_10429418 | 3300028379 | Bacteria | 1253 |
| 542 | Ga0268266_10955735 | 3300028379 | Bacteria | 829 |
| 543 | Ga0268265_10094178 | 3300028380 | Bacteria | 2401 |
| 544 | Ga0268265_10129487 | 3300028380 | Bacteria | 2094 |
| 545 | Ga0268265_10205650 | 3300028380 | Bacteria | 1711 |
| 546 | Ga0268265_10280937 | 3300028380 | Bacteria | 1489 |
| 547 | Ga0268265_10328264 | 3300028380 | Bacteria | 1388 |
| 548 | Ga0268265_11001553 | 3300028380 | Bacteria | 825 |
| 549 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 550 | Ga0268264_11452154 | 3300028381 | Bacteria | 696 |
| 551 | Ga0268264_11642585 | 3300028381 | Bacteria | 653 |
| 552 | Ga0265334_10039005 | 3300028573 | Bacteria | 1865 |
| 553 | Ga0307517_10436195 | 3300028786 | Bacteria | 683 |
| 554 | Ga0307515_10007547 | 3300028794 | Bacteria | 21484 |
| 555 | Ga0307515_10190719 | 3300028794 | Bacteria | 1961 |
| 556 | Ga0307515_10629270 | 3300028794 | Bacteria | 685 |
| 557 | Ga0307511_10026276 | 3300030521 | Bacteria | 5344 |
| 558 | Ga0307511_10056903 | 3300030521 | Bacteria | 3049 |
| 559 | Ga0307512_10272233 | 3300030522 | Bacteria | 819 |
| 560 | Ga0265330_10015725 | 3300031235 | Bacteria | 3498 |
| 561 | Ga0265330_10466232 | 3300031235 | Bacteria | 536 |
| 562 | Ga0265332_10029159 | 3300031238 | Bacteria | 2414 |
| 563 | Ga0265339_10210650 | 3300031249 | Bacteria | 955 |
| 564 | Ga0307513_10166927 | 3300031456 | Bacteria | 2084 |
| 565 | Ga0307513_10412663 | 3300031456 | Bacteria | 1082 |
| 566 | Ga0307513_10639897 | 3300031456 | Bacteria | 771 |
| 567 | Ga0307509_10075236 | 3300031507 | Bacteria | 3508 |
| 568 | Ga0307509_10111062 | 3300031507 | Bacteria | 2745 |
| 569 | Ga0307408_100465966 | 3300031548 | Bacteria | 1099 |
| 570 | Ga0307508_10000009 | 3300031616 | Bacteria | 256966 |
| 571 | Ga0307508_10047463 | 3300031616 | Bacteria | 3830 |
| 572 | Ga0307508_10226454 | 3300031616 | Bacteria | 1469 |
| 573 | Ga0307508_10447711 | 3300031616 | Bacteria | 884 |
| 574 | Ga0307508_10586964 | 3300031616 | Bacteria | 715 |
| 575 | Ga0307516_10058764 | 3300031730 | Bacteria | 3741 |
| 576 | Ga0307516_10087356 | 3300031730 | Bacteria | 2953 |
| 577 | Ga0307516_10101855 | 3300031730 | Bacteria | 2687 |
| 578 | Ga0307516_10254800 | 3300031730 | Bacteria | 1448 |
| 579 | Ga0307516_10379955 | 3300031730 | Bacteria | 1074 |
| 580 | Ga0307516_10579252 | 3300031730 | Bacteria | 776 |
| 581 | Ga0307413_11228058 | 3300031824 | Bacteria | 653 |
| 582 | Ga0307410_10273312 | 3300031852 | Bacteria | 1323 |
| 583 | Ga0307410_10436164 | 3300031852 | Bacteria | 1066 |
| 584 | Ga0307406_10422848 | 3300031901 | Bacteria | 1062 |
| 585 | Ga0307406_10679988 | 3300031901 | Bacteria | 857 |
| 586 | Ga0307412_11044861 | 3300031911 | Bacteria | 724 |
| 587 | Ga0307409_101161344 | 3300031995 | Bacteria | 795 |
| 588 | Ga0307409_101208319 | 3300031995 | Bacteria | 779 |
| 589 | Ga0307416_100371409 | 3300032002 | Bacteria | 1456 |
| 590 | Ga0307416_103072376 | 3300032002 | Bacteria | 558 |
| 591 | Ga0307414_11126070 | 3300032004 | Bacteria | 725 |
| 592 | Ga0307414_11380891 | 3300032004 | Bacteria | 654 |
| 593 | Ga0307411_10480109 | 3300032005 | Bacteria | 1046 |
| 594 | Ga0307411_10514787 | 3300032005 | Bacteria | 1014 |
| 595 | Ga0307415_100044407 | 3300032126 | Bacteria | 2971 |
| 596 | Ga0307415_100107062 | 3300032126 | Bacteria | 2065 |
| 597 | Ga0307415_100139109 | 3300032126 | Bacteria | 1851 |
| 598 | Ga0307415_101357453 | 3300032126 | Bacteria | 675 |
| 599 | Ga0307507_10188130 | 3300033179 | Bacteria | 1458 |
| 600 | Ga0307510_10041082 | 3300033180 | Bacteria | 5064 |
| 601 | Ga0373934_0017581 | 3300035086 | Bacteria | 2731 |
| 602 | Ga0373951_0049666 | 3300035091 | Bacteria | 1030 |
| 603 | Ga0373923_0002332 | 3300035111 | Bacteria | 5818 |
| 604 | Ga0373923_0275279 | 3300035111 | Bacteria | 792 |
| 605 | Ga0373936_0011675 | 3300035113 | Bacteria | 3331 |
| 606 | Ga0373936_0026082 | 3300035113 | Bacteria | 2288 |
| 607 | Ga0373936_0042885 | 3300035113 | Bacteria | 1817 |
| 608 | Ga0373936_0211681 | 3300035113 | Bacteria | 858 |
| 609 | Ga0373939_0079359 | 3300035114 | Bacteria | 1087 |
| 610 | Ga0373953_0000473 | 3300035117 | Bacteria | 11091 |
| 611 | Ga0373954_0000442 | 3300035118 | Bacteria | 15520 |
| 612 | Ga0373954_0010918 | 3300035118 | Bacteria | 4015 |
| 613 | Ga0373954_0386505 | 3300035118 | Bacteria | 692 |
| 614 | Ga0373956_0001159 | 3300035119 | Bacteria | 10897 |
| 615 | Ga0373956_0058457 | 3300035119 | Bacteria | 1743 |
| 616 | Ga0373957_0000837 | 3300035120 | Bacteria | 8045 |
| 617 | Ga0373957_0082576 | 3300035120 | Bacteria | 1270 |
| 618 | Ga0373943_0006178 | 3300035170 | Bacteria | 5377 |
| 619 | Ga0373943_0469653 | 3300035170 | Bacteria | 733 |
| 620 | Ga0373946_0007625 | 3300035171 | Bacteria | 3963 |
| 621 | Ga0373955_0000840 | 3300035172 | Bacteria | 13157 |
| 622 | Ga0373955_0019884 | 3300035172 | Bacteria | 3366 |
| 623 | Ga0373955_0111431 | 3300035172 | Bacteria | 1582 |
| 624 | Ga0373955_1008664 | 3300035172 | Bacteria | 513 |
| 625 | Ga0373962_0045346 | 3300035242 | Bacteria | 1252 |
| 626 | Ga0373931_0015131 | 3300035691 | Bacteria | 3780 |
| 627 | Ga0373935_0001167 | 3300035692 | Bacteria | 14418 |
| 628 | Ga0373935_0130812 | 3300035692 | Bacteria | 1686 |
| 629 | Ga0373927_0001744 | 3300035695 | Bacteria | 16246 |
| 630 | Ga0373927_0010992 | 3300035695 | Bacteria | 6028 |
| 631 | Ga0373927_0319500 | 3300035695 | Bacteria | 1022 |
| 632 | Ga0373933_0012552 | 3300035724 | Bacteria | 4681 |
| 633 | Ga0373933_0214946 | 3300035724 | Bacteria | 1232 |
| 634 | Ga0373933_0543972 | 3300035724 | Bacteria | 762 |
| 635 | Ga0373947_0005344 | 3300035725 | Bacteria | 7496 |
| 636 | Ga0373947_0265277 | 3300035725 | Bacteria | 1139 |
| 637 | Ga0373937_0014572 | 3300036401 | Bacteria | 6943 |
| 638 | Ga0373937_0330973 | 3300036401 | Bacteria | 1441 |
| 639 | Ga0373937_0751771 | 3300036401 | Bacteria | 922 |
| 640 | Ga0373925_0013749 | 3300037068 | Bacteria | 5858 |
| 641 | Ga0373925_0188035 | 3300037068 | Bacteria | 1638 |
| 642 | Ga0373925_0795689 | 3300037068 | Bacteria | 780 |
| 643 | Ga0395900_0071894 | 3300037418 | Bacteria | 3557 |
| 644 | Ga0395898_0333137 | 3300037466 | Bacteria | 1447 |
| 645 | Ga0436365_0157279 | 3300039437 | Bacteria | 2553 |
| 646 | Ga0436360_1070790 | 3300039438 | Bacteria | 1921 |
| 647 | Ga0436361_0402017 | 3300039447 | Bacteria | 697 |
| 648 | Ga0436363_0312883 | 3300039450 | Bacteria | 1780 |
| 649 | Ga0436363_0872365 | 3300039450 | Bacteria | 2693 |
| 650 | Ga0451791_0639961 | 3300041451 | Bacteria | 1286 |
| 651 | Ga0451793_0200984 | 3300041452 | Bacteria | 844 |
| 652 | Ga0451797_0987490 | 3300041453 | Bacteria | 843 |
| 653 | Ga0451795_0725544 | 3300041456 | Bacteria | 863 |
| 654 | Ga0451800_1010296 | 3300041459 | Bacteria | 808 |
| 655 | Ga0451802_1555424 | 3300041460 | Bacteria | 1127 |
| 656 | Ga0451807_0582585 | 3300041486 | Bacteria | 1010 |
| 657 | Ga0451855_1946904 | 3300041511 | Bacteria | 1040 |
| 658 | Ga0466957_0388110 | 3300044842 | Bacteria | 953 |
| 659 | Ga0466967_0110502 | 3300045976 | Bacteria | 2525 |
| 660 | Ga0495617_003836 | 3300046452 | Bacteria | 5545 |
| 661 | Ga0495592_0020075 | 3300046454 | Bacteria | 5080 |
| 662 | Ga0495592_0028166 | 3300046454 | Bacteria | 4256 |
| 663 | Ga0495592_0139266 | 3300046454 | Bacteria | 1689 |
| 664 | Ga0495603_0003551 | 3300046455 | Bacteria | 9285 |
| 665 | Ga0495603_0008022 | 3300046455 | Bacteria | 6375 |
| 666 | Ga0495603_0114512 | 3300046455 | Bacteria | 1572 |
| 667 | Ga0495590_0066570 | 3300046457 | Bacteria | 1261 |
| 668 | Ga0495629_0008864 | 3300046459 | Bacteria | 7396 |
| 669 | Ga0495629_0515483 | 3300046459 | Bacteria | 805 |
| 670 | Ga0495638_0097415 | 3300046460 | Bacteria | 1763 |
| 671 | Ga0495641_0011704 | 3300046461 | Bacteria | 4968 |
| 672 | Ga0495651_0026680 | 3300046462 | Bacteria | 4498 |
| 673 | Ga0495651_0186619 | 3300046462 | Bacteria | 1463 |
| 674 | Ga0495651_0310249 | 3300046462 | Bacteria | 1055 |
| 675 | Ga0495653_0035279 | 3300046463 | Bacteria | 3948 |
| 676 | Ga0495653_0187734 | 3300046463 | Bacteria | 1413 |
| 677 | Ga0495580_0009095 | 3300046472 | Bacteria | 7834 |
| 678 | Ga0495582_0000739 | 3300046473 | Bacteria | 18050 |
| 679 | Ga0495582_0158839 | 3300046473 | Bacteria | 1285 |
| 680 | Ga0495605_0110145 | 3300046474 | Bacteria | 1257 |
| 681 | Ga0495605_0119536 | 3300046474 | Bacteria | 1195 |
| 682 | Ga0495639_0003522 | 3300046475 | Bacteria | 6758 |
| 683 | Ga0495639_0262691 | 3300046475 | Bacteria | 855 |
| 684 | Ga0495662_0000437 | 3300046476 | Bacteria | 18723 |
| 685 | Ga0495662_0137983 | 3300046476 | Bacteria | 1200 |
| 686 | Ga0495664_0130686 | 3300046477 | Bacteria | 1520 |
| 687 | Ga0495664_0732720 | 3300046477 | Bacteria | 583 |
| 688 | Ga0495584_0129036 | 3300046491 | Bacteria | 1282 |
| 689 | Ga0495584_0310847 | 3300046491 | Bacteria | 800 |
| 690 | Ga0495585_0268401 | 3300046492 | Bacteria | 846 |
| 691 | Ga0495585_0383548 | 3300046492 | Bacteria | 679 |
| 692 | Ga0495594_0013772 | 3300046499 | Bacteria | 4226 |
| 693 | Ga0495594_0038684 | 3300046499 | Bacteria | 2606 |
| 694 | Ga0495594_0307169 | 3300046499 | Bacteria | 904 |
| 695 | Ga0495606_0194227 | 3300046507 | Bacteria | 1161 |
| 696 | Ga0495606_0295052 | 3300046507 | Bacteria | 881 |
| 697 | Ga0495606_0301711 | 3300046507 | Bacteria | 868 |
| 698 | Ga0495608_0005163 | 3300046511 | Bacteria | 9327 |
| 699 | Ga0495608_0407807 | 3300046511 | Bacteria | 830 |
| 700 | Ga0495608_0589439 | 3300046511 | Bacteria | 668 |
| 701 | Ga0495618_0055282 | 3300046514 | Bacteria | 2513 |
| 702 | Ga0495618_0082750 | 3300046514 | Bacteria | 2050 |
| 703 | Ga0495620_0081714 | 3300046515 | Bacteria | 1306 |
| 704 | Ga0495620_0269477 | 3300046515 | Bacteria | 648 |
| 705 | Ga0495628_0027929 | 3300046516 | Bacteria | 4588 |
| 706 | Ga0495628_0041356 | 3300046516 | Bacteria | 3679 |
| 707 | Ga0495628_0785085 | 3300046516 | Bacteria | 667 |
| 708 | Ga0495630_0008430 | 3300046517 | Bacteria | 7394 |
| 709 | Ga0495631_0092953 | 3300046518 | Bacteria | 1298 |
| 710 | Ga0495631_0429260 | 3300046518 | Bacteria | 563 |
| 711 | Ga0495632_0080177 | 3300046519 | Bacteria | 1557 |
| 712 | Ga0495644_0066798 | 3300046523 | Bacteria | 1351 |
| 713 | Ga0495648_0049954 | 3300046524 | Bacteria | 2560 |
| 714 | Ga0495666_0009748 | 3300046526 | Bacteria | 4800 |
| 715 | Ga0495652_0002339 | 3300046529 | Bacteria | 19668 |
| 716 | Ga0495652_0036756 | 3300046529 | Bacteria | 4254 |
| 717 | Ga0495652_0073700 | 3300046529 | Bacteria | 2842 |
| 718 | Ga0495652_0585551 | 3300046529 | Bacteria | 763 |
| 719 | Ga0495654_0035071 | 3300046530 | Bacteria | 2529 |
| 720 | Ga0495665_0011208 | 3300046531 | Bacteria | 4854 |
| 721 | Ga0495640_0000826 | 3300046533 | Bacteria | 23573 |
| 722 | Ga0495640_0020781 | 3300046533 | Bacteria | 4826 |
| 723 | Ga0495586_0177428 | 3300046535 | Bacteria | 1205 |
| 724 | Ga0495586_0265385 | 3300046535 | Bacteria | 981 |
| 725 | Ga0495587_0033793 | 3300046536 | Bacteria | 3085 |
| 726 | Ga0495587_0156726 | 3300046536 | Bacteria | 1297 |
| 727 | Ga0495587_0273488 | 3300046536 | Bacteria | 947 |
| 728 | Ga0495598_0074485 | 3300046537 | Bacteria | 1076 |
| 729 | Ga0495621_0090957 | 3300046539 | Bacteria | 1150 |
| 730 | Ga0495597_0098721 | 3300046542 | Bacteria | 1233 |
| 731 | Ga0495597_0387661 | 3300046542 | Bacteria | 532 |
| 732 | Ga0495645_0019281 | 3300046543 | Bacteria | 4911 |
| 733 | Ga0495622_0008636 | 3300046557 | Bacteria | 4722 |
| 734 | Ga0495622_0012865 | 3300046557 | Bacteria | 3880 |
| 735 | Ga0495633_0039118 | 3300046558 | Bacteria | 2264 |
| 736 | Ga0495633_0142997 | 3300046558 | Bacteria | 1106 |
| 737 | Ga0495667_0001528 | 3300046559 | Bacteria | 15306 |
| 738 | Ga0495667_0030123 | 3300046559 | Bacteria | 3649 |
| 739 | Ga0495667_0400517 | 3300046559 | Bacteria | 864 |
| 740 | Ga0495656_0016790 | 3300046615 | Bacteria | 2783 |
| 741 | Ga0495656_0107122 | 3300046615 | Bacteria | 1302 |
| 742 | Ga0495668_0611460 | 3300046616 | Bacteria | 602 |
| 743 | Ga0495634_0000762 | 3300046642 | Bacteria | 31177 |
| 744 | Ga0495634_0002573 | 3300046642 | Bacteria | 14976 |
| 745 | Ga0495625_0234122 | 3300046660 | Bacteria | 1198 |
| 746 | Ga0495625_0280239 | 3300046660 | Bacteria | 1073 |
| 747 | Ga0495625_0431671 | 3300046660 | Bacteria | 817 |
| 748 | Ga0495635_0000187 | 3300046663 | Bacteria | 39002 |
| 749 | Ga0495635_0001091 | 3300046663 | Bacteria | 18022 |
| 750 | Ga0495635_0704281 | 3300046663 | Bacteria | 654 |
| 751 | Ga0495588_0001370 | 3300046674 | Bacteria | 10406 |
| 752 | Ga0495588_0002045 | 3300046674 | Bacteria | 8625 |
| 753 | Ga0495588_0189588 | 3300046674 | Bacteria | 1086 |
| 754 | Ga0495657_0016934 | 3300046675 | Bacteria | 5297 |
| 755 | Ga0495657_0023684 | 3300046675 | Bacteria | 4385 |
| 756 | Ga0495599_0002320 | 3300046678 | Bacteria | 11052 |
| 757 | Ga0495599_0210894 | 3300046678 | Bacteria | 1191 |
| 758 | Ga0495623_0019613 | 3300046679 | Bacteria | 4370 |
| 759 | Ga0495623_0027785 | 3300046679 | Bacteria | 3642 |
| 760 | Ga0495646_0005680 | 3300046680 | Bacteria | 7901 |
| 761 | Ga0495646_0039618 | 3300046680 | Bacteria | 2904 |
| 762 | Ga0495646_0074198 | 3300046680 | Bacteria | 1997 |
| 763 | Ga0495647_0000422 | 3300046681 | Bacteria | 12102 |
| 764 | Ga0495658_0000047 | 3300046683 | Bacteria | 59626 |
| 765 | Ga0495658_0502382 | 3300046683 | Bacteria | 776 |
| 766 | Ga0495669_0172040 | 3300046684 | Bacteria | 1030 |
| 767 | Ga0495669_0267039 | 3300046684 | Bacteria | 822 |
| 768 | Ga0495613_0002415 | 3300046689 | Bacteria | 14130 |
| 769 | Ga0495613_0023851 | 3300046689 | Bacteria | 4559 |
| 770 | Ga0495624_0002051 | 3300046690 | Bacteria | 15345 |
| 771 | Ga0495624_0873845 | 3300046690 | Bacteria | 530 |
| 772 | Ga0495671_0106079 | 3300046692 | Bacteria | 1372 |
| 773 | Ga0495671_0234800 | 3300046692 | Bacteria | 886 |
| 774 | Ga0495649_0065974 | 3300046694 | Bacteria | 1943 |
| 775 | Ga0495649_0472496 | 3300046694 | Bacteria | 625 |
| 776 | Ga0495589_0050614 | 3300046794 | Bacteria | 2054 |
| 777 | Ga0495600_0002218 | 3300046809 | Bacteria | 11048 |
| 778 | Ga0495600_0011285 | 3300046809 | Bacteria | 5563 |
| 779 | Ga0495600_0093163 | 3300046809 | Bacteria | 1964 |
| 780 | Ga0495600_0223033 | 3300046809 | Bacteria | 1205 |
| 781 | Ga0495581_0002021 | 3300047315 | Bacteria | 11404 |
| 782 | Ga0495581_0016629 | 3300047315 | Bacteria | 4276 |
| 783 | Ga0495581_0521516 | 3300047315 | Bacteria | 690 |
| 784 | Ga0495604_0094508 | 3300047317 | Bacteria | 2210 |
| 785 | Ga0495604_0154886 | 3300047317 | Bacteria | 1624 |
| 786 | Ga0495604_0383164 | 3300047317 | Bacteria | 929 |
| 787 | Ga0495604_0387183 | 3300047317 | Bacteria | 923 |
| 788 | Ga0495604_0542484 | 3300047317 | Bacteria | 751 |
| 789 | Ga0495604_0698727 | 3300047317 | Bacteria | 644 |
| 790 | Ga0495636_0521797 | 3300047318 | Bacteria | 576 |
| 791 | Ga0495674_0001402 | 3300047319 | Bacteria | 23571 |
| 792 | Ga0495674_0030894 | 3300047319 | Bacteria | 4867 |
| 793 | Ga0495674_0051843 | 3300047319 | Bacteria | 3615 |
| 794 | Ga0495672_0010426 | 3300047320 | Bacteria | 6618 |
| 795 | Ga0495672_0021570 | 3300047320 | Bacteria | 4199 |
| 796 | Ga0495676_0005620 | 3300047321 | Bacteria | 11494 |
| 797 | Ga0495676_0034176 | 3300047321 | Bacteria | 4269 |
| 798 | Ga0495680_0005405 | 3300047322 | Bacteria | 12029 |
| 799 | Ga0495680_0184568 | 3300047322 | Bacteria | 1503 |
| 800 | Ga0495683_0284033 | 3300047323 | Bacteria | 715 |
| 801 | Ga0495675_0038736 | 3300047444 | Bacteria | 3035 |
| 802 | Ga0495675_0096848 | 3300047444 | Bacteria | 1849 |
| 803 | Ga0495673_0029067 | 3300047469 | Bacteria | 2612 |
| 804 | Ga0495681_0343729 | 3300047470 | Bacteria | 569 |
| 805 | Ga0495684_0001482 | 3300047471 | Bacteria | 18783 |
| 806 | Ga0495684_0093049 | 3300047471 | Bacteria | 2283 |
| 807 | Ga0495684_0447688 | 3300047471 | Bacteria | 898 |
| 808 | Ga0495686_0130279 | 3300047472 | Bacteria | 1492 |
| 809 | Ga0495593_0000723 | 3300047673 | Bacteria | 19146 |
| 810 | Ga0495593_0070853 | 3300047673 | Bacteria | 1811 |
| 811 | Ga0495593_0077595 | 3300047673 | Bacteria | 1721 |
| 812 | Ga0495602_0068925 | 3300048088 | Bacteria | 3035 |
| 813 | Ga0495602_0093929 | 3300048088 | Bacteria | 2480 |
| 814 | Ga0495602_0283596 | 3300048088 | Bacteria | 1219 |
| 815 | Ga0495614_0286812 | 3300048089 | Bacteria | 759 |
| 816 | Ga0495626_0058553 | 3300048091 | Bacteria | 1760 |
| 817 | Ga0496100_0002635 | 3300048903 | Bacteria | 9149 |
| 818 | Ga0496100_0139073 | 3300048903 | Bacteria | 1719 |
| 819 | Ga0496100_0284502 | 3300048903 | Bacteria | 1234 |
| 820 | Ga0496100_0793866 | 3300048903 | Bacteria | 742 |
| 821 | Ga0496101_0011050 | 3300048904 | Bacteria | 5981 |
| 822 | Ga0496101_0489136 | 3300048904 | Bacteria | 972 |
| 823 | Ga0496101_0779701 | 3300048904 | Bacteria | 754 |
| 824 | Ga0496101_1082972 | 3300048904 | Bacteria | 629 |
| 825 | Ga0496102_0003268 | 3300048905 | Bacteria | 13736 |
| 826 | Ga0496102_0126479 | 3300048905 | Bacteria | 2389 |
| 827 | Ga0496102_0204326 | 3300048905 | Bacteria | 1862 |
| 828 | Ga0496102_0406775 | 3300048905 | Bacteria | 1279 |
| 829 | Ga0496102_0518107 | 3300048905 | Bacteria | 1115 |
| 830 | Ga0496102_1157566 | 3300048905 | Bacteria | 693 |
| 831 | Ga0496103_0011931 | 3300048906 | Bacteria | 5159 |
| 832 | Ga0496103_0090433 | 3300048906 | Bacteria | 1931 |
| 833 | Ga0496103_0241289 | 3300048906 | Bacteria | 1163 |
| 834 | Ga0496104_0016540 | 3300048907 | Bacteria | 6702 |
| 835 | Ga0496104_0028918 | 3300048907 | Bacteria | 5139 |
| 836 | Ga0496104_0089038 | 3300048907 | Bacteria | 2949 |
| 837 | Ga0496104_0736902 | 3300048907 | Bacteria | 893 |
| 838 | Ga0496105_0027843 | 3300048908 | Bacteria | 4620 |
| 839 | Ga0496105_0398587 | 3300048908 | Bacteria | 1093 |
| 840 | Ga0496105_0412465 | 3300048908 | Bacteria | 1070 |
| 841 | Ga0496106_0000477 | 3300048909 | Bacteria | 28442 |
| 842 | Ga0496106_0027131 | 3300048909 | Bacteria | 4265 |
| 843 | Ga0496106_0065167 | 3300048909 | Bacteria | 2773 |
| 844 | Ga0496106_0374537 | 3300048909 | Bacteria | 1144 |
| 845 | Ga0496106_0834121 | 3300048909 | Bacteria | 730 |
| 846 | Ga0496106_0884873 | 3300048909 | Bacteria | 706 |
| 847 | Ga0496106_1190084 | 3300048909 | Bacteria | 595 |
| 848 | Ga0496107_0002282 | 3300048910 | Bacteria | 12380 |
| 849 | Ga0496107_0105014 | 3300048910 | Bacteria | 2073 |
| 850 | Ga0496108_0015096 | 3300048911 | Bacteria | 6304 |
| 851 | Ga0496108_0371059 | 3300048911 | Bacteria | 1249 |
| 852 | Ga0496108_0534520 | 3300048911 | Bacteria | 1023 |
| 853 | Ga0496109_0032340 | 3300048912 | Bacteria | 4702 |
| 854 | Ga0496109_0103827 | 3300048912 | Bacteria | 2638 |
| 855 | Ga0496109_0360581 | 3300048912 | Bacteria | 1373 |
| 856 | Ga0496110_0010493 | 3300048913 | Bacteria | 7539 |
| 857 | Ga0496110_0079927 | 3300048913 | Bacteria | 2912 |
| 858 | Ga0496110_0151390 | 3300048913 | Bacteria | 2101 |
| 859 | Ga0496110_0571162 | 3300048913 | Bacteria | 1027 |
| 860 | Ga0496110_1158866 | 3300048913 | Bacteria | 682 |
| 861 | Ga0496111_0150239 | 3300048914 | Bacteria | 1728 |
| 862 | Ga0496112_0023640 | 3300048915 | Bacteria | 5876 |
| 863 | Ga0496112_0127846 | 3300048915 | Bacteria | 2512 |
| 864 | Ga0496112_0155738 | 3300048915 | Bacteria | 2251 |
| 865 | Ga0496112_0315846 | 3300048915 | Bacteria | 1507 |
| 866 | Ga0496113_0012966 | 3300048916 | Bacteria | 5623 |
| 867 | Ga0496113_0064609 | 3300048916 | Bacteria | 2767 |
| 868 | Ga0496113_0856397 | 3300048916 | Bacteria | 720 |
| 869 | Ga0496114_0020349 | 3300048917 | Bacteria | 5386 |
| 870 | Ga0496114_0559037 | 3300048917 | Bacteria | 1010 |
| 871 | Ga0496114_0843840 | 3300048917 | Bacteria | 796 |
| 872 | Ga0496115_0001335 | 3300048918 | Bacteria | 17580 |
| 873 | Ga0496115_0013365 | 3300048918 | Bacteria | 6211 |
| 874 | Ga0496115_0065535 | 3300048918 | Bacteria | 2934 |
| 875 | Ga0496117_0020387 | 3300048920 | Bacteria | 5405 |
| 876 | Ga0496118_0004957 | 3300048921 | Bacteria | 15416 |
| 877 | Ga0496119_0093097 | 3300048922 | Bacteria | 1708 |
| 878 | Ga0496119_0126065 | 3300048922 | Bacteria | 1401 |
| 879 | Ga0496121_0000456 | 3300048924 | Bacteria | 80536 |
| 880 | Ga0496121_0011588 | 3300048924 | Bacteria | 9761 |
| 881 | Ga0496121_0080209 | 3300048924 | Bacteria | 2588 |
| 882 | Ga0496121_0093992 | 3300048924 | Bacteria | 2333 |
| 883 | Ga0496121_0387200 | 3300048924 | Bacteria | 920 |
| 884 | Ga0496124_0000685 | 3300048927 | Bacteria | 55748 |
| 885 | Ga0496124_0231946 | 3300048927 | Bacteria | 1379 |
| 886 | Ga0496125_0062506 | 3300048928 | Bacteria | 2977 |
| 887 | Ga0496125_0234418 | 3300048928 | Bacteria | 1171 |
| 888 | Ga0496125_0411712 | 3300048928 | Bacteria | 787 |
| 889 | Ga0496126_0002820 | 3300048929 | Bacteria | 22789 |
| 890 | Ga0496126_0007653 | 3300048929 | Bacteria | 11790 |
| 891 | Ga0496126_0010701 | 3300048929 | Bacteria | 9583 |
| 892 | Ga0496126_0111157 | 3300048929 | Bacteria | 2386 |
| 893 | Ga0496126_0286451 | 3300048929 | Bacteria | 1363 |
| 894 | Ga0496126_0294066 | 3300048929 | Bacteria | 1342 |
| 895 | Ga0496126_0369571 | 3300048929 | Bacteria | 1170 |
| 896 | Ga0501036_1577035 | 3300049572 | Bacteria | 530 |
| 897 | Ga0501046_0145221 | 3300049580 | Bacteria | 1792 |
| 898 | Ga0501067_0021493 | 3300049583 | Bacteria | 3571 |
| 899 | Ga0501067_0149277 | 3300049583 | Bacteria | 1302 |
| 900 | Ga0501070_0773034 | 3300049586 | Bacteria | 756 |
| 901 | Ga0501076_0409288 | 3300049592 | Bacteria | 1116 |
| 902 | Ga0501083_1031677 | 3300049744 | Bacteria | 535 |
| 903 | Ga0501035_0193141 | 3300049822 | Bacteria | 1750 |
| 904 | Ga0501045_0832842 | 3300049824 | Bacteria | 679 |
| 905 | nmdc:mga03683_133759_c1 | 3300050489 | Bacteria | 1111 |
| 906 | nmdc:mga03683_31439_c1 | 3300050489 | Bacteria | 2130 |
| 907 | nmdc:mga03683_339833_c1 | 3300050489 | Bacteria | 709 |
| 908 | nmdc:mga03n38_16168_c1 | 3300050490 | Bacteria | 2899 |
| 909 | nmdc:mga03n38_27443_c1 | 3300050490 | Bacteria | 2362 |
| 910 | nmdc:mga03n38_37121_c1 | 3300050490 | Bacteria | 2099 |
| 911 | nmdc:mga00v17_22557_c1 | 3300050491 | Bacteria | 3633 |
| 912 | nmdc:mga00v17_351141_c1 | 3300050491 | Bacteria | 959 |
| 913 | nmdc:mga0yw44_1163403_c1 | 3300050492 | Bacteria | 521 |
| 914 | nmdc:mga0yw44_320441_c1 | 3300050492 | Bacteria | 1041 |
| 915 | nmdc:mga0yw44_332466_c1 | 3300050492 | Bacteria | 1021 |
| 916 | nmdc:mga0yw44_34735_c1 | 3300050492 | Bacteria | 2957 |
| 917 | nmdc:mga0yw44_528599_c1 | 3300050492 | Bacteria | 801 |
| 918 | nmdc:mga0yw44_5923_c1 | 3300050492 | Bacteria | 5845 |
| 919 | nmdc:mga0k408_103122_c1 | 3300050493 | Bacteria | 1683 |
| 920 | nmdc:mga0k408_167258_c1 | 3300050493 | Bacteria | 1310 |
| 921 | nmdc:mga0k408_334839_c1 | 3300050493 | Bacteria | 903 |
| 922 | nmdc:mga0k408_511767_c1 | 3300050493 | Bacteria | 711 |
| 923 | nmdc:mga06z11_118768_c1 | 3300050494 | Bacteria | 1473 |
| 924 | nmdc:mga04h51_84363_c1 | 3300050495 | Bacteria | 1133 |
| 925 | nmdc:mga07m45_421575_c1 | 3300050496 | Bacteria | 774 |
| 926 | nmdc:mga07m45_55711_c1 | 3300050496 | Bacteria | 2235 |
| 927 | nmdc:mga05p37_209207_c1 | 3300050507 | Bacteria | 2359 |
| 928 | nmdc:mga0qj67_224802_c1 | 3300050509 | Bacteria | 1523 |
| 929 | nmdc:mga08y16_228382_c1 | 3300050511 | Bacteria | 1925 |
| 930 | nmdc:mga0rr50_628964_c1 | 3300050513 | Bacteria | 915 |
| 931 | nmdc:mga0sz30_19314_c1 | 3300050516 | Bacteria | 2738 |
| 932 | Ga0495601_0085005 | 3300053077 | Bacteria | 2032 |
| 933 | Ga0495601_0119969 | 3300053077 | Bacteria | 1707 |
| 934 | Ga0495601_0290864 | 3300053077 | Bacteria | 1065 |
| 935 | Ga0495612_0108278 | 3300053078 | Bacteria | 1187 |
| 936 | Ga0495612_0219544 | 3300053078 | Bacteria | 841 |
| 937 | Ga0500635_0033304 | 3300053080 | Bacteria | 1680 |
| 938 | Ga0495655_0144660 | 3300053083 | Bacteria | 743 |
| 939 | Ga0495595_0006061 | 3300053084 | Bacteria | 4913 |
| 940 | Ga0495595_0022229 | 3300053084 | Bacteria | 2782 |
| 941 | Ga0495619_0002231 | 3300053085 | Bacteria | 12815 |
| 942 | Ga0495619_0037434 | 3300053085 | Bacteria | 3161 |
| 943 | Ga0495619_0190472 | 3300053085 | Bacteria | 1419 |
| 944 | Ga0495619_0206880 | 3300053085 | Bacteria | 1359 |
| 945 | Ga0495619_0491269 | 3300053085 | Bacteria | 844 |
| 946 | Ga0500646_0145632 | 3300053090 | Bacteria | 781 |
| 947 | Ga0500647_0018439 | 3300053091 | Bacteria | 3232 |
| 948 | Ga0500647_0245693 | 3300053091 | Bacteria | 789 |
| 949 | Ga0500583_0137708 | 3300053092 | Bacteria | 1212 |
| 950 | Ga0500651_0189209 | 3300053093 | Bacteria | 1219 |
| 951 | Ga0500566_0013410 | 3300053094 | Bacteria | 4826 |
| 952 | Ga0500566_0285489 | 3300053094 | Bacteria | 784 |
| 953 | Ga0500640_005820 | 3300053095 | Bacteria | 4643 |
| 954 | Ga0500641_0011445 | 3300053096 | Bacteria | 3220 |
| 955 | Ga0500641_0077801 | 3300053096 | Bacteria | 1404 |
| 956 | Ga0500641_0174650 | 3300053096 | Bacteria | 924 |
| 957 | Ga0500648_074567 | 3300053097 | Bacteria | 1916 |
| 958 | Ga0500556_0061823 | 3300053104 | Bacteria | 1381 |
| 959 | Ga0500562_052210 | 3300053108 | Bacteria | 1094 |
| 960 | Ga0500572_000217 | 3300053111 | Bacteria | 20413 |
| 961 | Ga0500582_190476 | 3300053114 | Bacteria | 694 |
| 962 | Ga0500595_000438 | 3300053119 | Bacteria | 25956 |
| 963 | Ga0500595_034504 | 3300053119 | Bacteria | 1673 |
| 964 | Ga0500595_046627 | 3300053119 | Bacteria | 1361 |
| 965 | Ga0500597_343811 | 3300053120 | Bacteria | 583 |
| 966 | Ga0500608_002059 | 3300053122 | Bacteria | 7209 |
| 967 | Ga0500614_001377 | 3300053123 | Bacteria | 5851 |
| 968 | Ga0500642_0056964 | 3300053130 | Bacteria | 1743 |
| 969 | Ga0500642_0512600 | 3300053130 | Bacteria | 504 |
| 970 | Ga0500658_0069098 | 3300053134 | Bacteria | 1486 |
| 971 | Ga0500658_0154435 | 3300053134 | Bacteria | 1036 |
| 972 | Ga0500559_0008610 | 3300053136 | Bacteria | 4462 |
| 973 | Ga0500559_0458831 | 3300053136 | Bacteria | 588 |
| 974 | Ga0500568_0010219 | 3300053139 | Bacteria | 4408 |
| 975 | Ga0500573_0069876 | 3300053140 | Bacteria | 2003 |
| 976 | Ga0500588_0093026 | 3300053146 | Bacteria | 1028 |
| 977 | Ga0500603_002023 | 3300053150 | Bacteria | 4490 |
| 978 | Ga0500604_0023541 | 3300053151 | Bacteria | 1757 |
| 979 | Ga0500630_000537 | 3300053159 | Bacteria | 17060 |
| 980 | Ga0500634_0008812 | 3300053161 | Bacteria | 5063 |
| 981 | Ga0500638_000078 | 3300053162 | Bacteria | 17252 |
| 982 | Ga0500638_013999 | 3300053162 | Bacteria | 3647 |
| 983 | Ga0500638_071658 | 3300053162 | Bacteria | 1656 |
| 984 | Ga0500639_000001 | 3300053163 | Bacteria | 244795 |
| 985 | Ga0500639_086000 | 3300053163 | Bacteria | 1575 |
| 986 | Ga0500636_0093571 | 3300053177 | Bacteria | 1718 |
| 987 | Ga0500637_0000088 | 3300053178 | Bacteria | 33146 |
| 988 | Ga0500637_0094657 | 3300053178 | Bacteria | 1730 |
| 989 | Ga0500637_0397258 | 3300053178 | Bacteria | 717 |
| 990 | Ga0500576_061368 | 3300053725 | Bacteria | 1643 |
| 991 | Ga0500609_036777 | 3300053731 | Bacteria | 676 |
| 992 | Ga0500596_001084 | 3300053735 | Bacteria | 5478 |
| 993 | Ga0500596_017423 | 3300053735 | Bacteria | 1077 |
| 994 | Ga0500601_005309 | 3300053737 | Bacteria | 1410 |
| 995 | Ga0500661_000025 | 3300055283 | Bacteria | 22926 |
| 996 | Ga0501082_0218887 | 3300060353 | Bacteria | 1657 |
| 997 | 2513675889 | 2513237098 | Bacteria | 9902361 |
| 998 | 2513692589 | 2513237101 | Bacteria | 7952346 |
| 999 | 2524468938 | 2524023210 | Bacteria | 9029266 |
| 1000 | 2723845025 | 2721755755 | Bacteria | 8322773 |
| 1001 | 2793082108 | |||
| 1002 | 2874605259 | 2874604998 | Bacteria | 7834745 |
| 1003 | 2885386549 | 2885383462 | Bacteria | 9473874 |
| 1004 | 2889039777 | 2889033259 | Bacteria | 9099371 |
| 1005 | 2903774128 | 2903768456 | Bacteria | 9749579 |
| 1006 | 2922365418 | 2922361189 | Bacteria | 7436256 |
| 1007 | 2922391027 | 2922386360 | Bacteria | 7017218 |
| 1008 | 8006965805 | 8006964411 | Bacteria | 8966052 |
| 1009 | 8006986457 | 8006984368 | Bacteria | 9651211 |
| 1010 | 8006995974 | 8006994254 | Bacteria | 8309700 |
| 1011 | 8056673807 | 8056673599 | Bacteria | 7871253 |
| 1012 | 8056686711 | 8056681323 | Bacteria | 8472857 |
| 1013 | Ga0105248_10238890 | |||
| 1014 | JGI24750J21931_1028729 | |||
| 1015 | JGI25406J46586_10167307 | |||
| 1016 | JGI25153J46596_10001106 | |||
| 1017 | rootH1_10049394 | |||
| 1018 | rootL2_10062449 | |||
| 1019 | JGI25404J52841_10052368 | |||
| 1020 | Ga0065704_10666121 | |||
| 1021 | Ga0065707_10250855 | |||
| 1022 | Ga0070658_10247790 | |||
| 1023 | Ga0070658_10358392 | |||
| 1024 | Ga0070676_10246735 | |||
| 1025 | Ga0070676_10247677 | |||
| 1026 | Ga0070690_100418309 | |||
| 1027 | Ga0070670_100206023 | |||
| 1028 | Ga0070670_100562681 | |||
| 1029 | Ga0070670_100592193 | |||
| 1030 | Ga0068869_100102861 | |||
| 1031 | Ga0068869_100198829 | |||
| 1032 | Ga0068869_100298342 | |||
| 1033 | Ga0070680_100028149 | |||
| 1034 | Ga0070682_100163513 | |||
| 1035 | Ga0070682_100182044 | |||
| 1036 | Ga0070682_100876662 | |||
| 1037 | Ga0070682_100932277 | |||
| 1038 | Ga0070682_101746713 | |||
| 1039 | Ga0068868_100007248 | |||
| 1040 | Ga0068868_100034333 | |||
| 1041 | Ga0068868_100281031 | |||
| 1042 | Ga0068868_101266019 | |||
| 1043 | Ga0070660_101493385 | |||
| 1044 | Ga0070687_100835132 | |||
| 1045 | Ga0070661_100064797 | |||
| 1046 | Ga0070692_10167836 | |||
| 1047 | Ga0070668_100169745 | |||
| 1048 | Ga0070668_100667527 | |||
| 1049 | Ga0070668_100740310 | |||
| 1050 | Ga0070668_101129771 | |||
| 1051 | Ga0070669_100054862 | |||
| 1052 | Ga0070669_100484947 | |||
| 1053 | Ga0070675_100298665 | |||
| 1054 | Ga0070675_101212564 | |||
| 1055 | Ga0070671_100160036 | |||
| 1056 | Ga0070671_100200989 | |||
| 1057 | Ga0070671_101333228 | |||
| 1058 | Ga0070671_101493719 | |||
| 1059 | Ga0070674_100038183 | |||
| 1060 | Ga0070674_100595106 | |||
| 1061 | Ga0070674_100822581 | |||
| 1062 | Ga0070673_100600802 | |||
| 1063 | Ga0070673_100871453 | |||
| 1064 | Ga0070688_100110288 | |||
| 1065 | Ga0070659_100013386 | |||
| 1066 | Ga0070659_100029963 | |||
| 1067 | Ga0070659_100120478 | |||
| 1068 | Ga0070659_101504332 | |||
| 1069 | Ga0070667_100062286 | |||
| 1070 | Ga0070667_100082128 | |||
| 1071 | Ga0070667_100542178 | |||
| 1072 | Ga0070667_100576129 | |||
| 1073 | Ga0070667_100589692 | |||
| 1074 | Ga0070667_100634250 | |||
| 1075 | Ga0070667_101078421 | |||
| 1076 | Ga0070667_101906528 | |||
| 1077 | Ga0070709_10087636 | |||
| 1078 | Ga0070713_100123239 | |||
| 1079 | Ga0070713_100194529 | |||
| 1080 | Ga0070713_101682353 | |||
| 1081 | Ga0070701_10182076 | |||
| 1082 | Ga0070701_10443537 | |||
| 1083 | Ga0070711_100833901 | |||
| 1084 | Ga0070711_101402764 | |||
| 1085 | Ga0070700_100083281 | |||
| 1086 | Ga0070700_100128523 | |||
| 1087 | Ga0070700_100331451 | |||
| 1088 | Ga0070700_100629094 | |||
| 1089 | Ga0070700_101214542 | |||
| 1090 | Ga0070694_100199793 | |||
| 1091 | Ga0070663_100031336 | |||
| 1092 | Ga0070663_100054677 | |||
| 1093 | Ga0070663_100054728 | |||
| 1094 | Ga0070663_100078560 | |||
| 1095 | Ga0070663_100102129 | |||
| 1096 | Ga0070663_100208976 | |||
| 1097 | Ga0070678_100016899 | |||
| 1098 | Ga0070678_100129344 | |||
| 1099 | Ga0070678_100135610 | |||
| 1100 | Ga0070678_100169375 | |||
| 1101 | Ga0070678_100336473 | |||
| 1102 | Ga0070678_100338181 | |||
| 1103 | Ga0070678_100405945 | |||
| 1104 | Ga0070678_100617267 | |||
| 1105 | Ga0070678_100714384 | |||
| 1106 | Ga0070662_100028974 | |||
| 1107 | Ga0070662_100115348 | |||
| 1108 | Ga0070662_100688005 | |||
| 1109 | Ga0070662_100877026 | |||
| 1110 | Ga0070681_10133684 | |||
| 1111 | Ga0068867_100060657 | |||
| 1112 | Ga0068867_101353192 | |||
| 1113 | Ga0070685_10677491 | |||
| 1114 | Ga0070698_100112992 | |||
| 1115 | Ga0070698_100725587 | |||
| 1116 | Ga0070699_100083550 | |||
| 1117 | Ga0070679_100020404 | |||
| 1118 | Ga0070679_100083975 | |||
| 1119 | Ga0070684_100095276 | |||
| 1120 | Ga0070697_100077284 | |||
| 1121 | Ga0070697_101276538 | |||
| 1122 | Ga0068853_100084664 | |||
| 1123 | Ga0068853_100508583 | |||
| 1124 | Ga0068853_100714044 | |||
| 1125 | Ga0068853_100814082 | |||
| 1126 | Ga0068853_101227004 | |||
| 1127 | Ga0070672_100304521 | |||
| 1128 | Ga0070672_100519508 | |||
| 1129 | Ga0070672_100842846 | |||
| 1130 | Ga0070686_100166509 | |||
| 1131 | Ga0070686_100195646 | |||
| 1132 | Ga0070686_100196558 | |||
| 1133 | Ga0070695_100269109 | |||
| 1134 | Ga0070696_100392060 | |||
| 1135 | Ga0070693_100052550 | |||
| 1136 | Ga0070693_100128856 | |||
| 1137 | Ga0070665_100052300 | |||
| 1138 | Ga0070665_100160319 | |||
| 1139 | Ga0070665_100312102 | |||
| 1140 | Ga0070665_100382771 | |||
| 1141 | Ga0068855_100017635 | |||
| 1142 | Ga0068855_100029614 | |||
| 1143 | Ga0068855_100277159 | |||
| 1144 | Ga0068855_100429279 | |||
| 1145 | Ga0068855_100438123 | |||
| 1146 | Ga0068855_100629848 | |||
| 1147 | Ga0068855_100703755 | |||
| 1148 | Ga0070664_100932192 | |||
| 1149 | Ga0070664_100936596 | |||
| 1150 | Ga0070664_101795669 | |||
| 1151 | Ga0068857_100054957 | |||
| 1152 | Ga0068857_100758475 | |||
| 1153 | Ga0068854_100117469 | |||
| 1154 | Ga0068854_100613413 | |||
| 1155 | Ga0068856_100044548 | |||
| 1156 | Ga0068856_100050315 | |||
| 1157 | Ga0068856_100153965 | |||
| 1158 | Ga0068856_100396542 | |||
| 1159 | Ga0068856_101834432 | |||
| 1160 | Ga0070702_100032858 | |||
| 1161 | Ga0068852_100056294 | |||
| 1162 | Ga0068852_100112587 | |||
| 1163 | Ga0068852_100130524 | |||
| 1164 | Ga0068852_100140996 | |||
| 1165 | Ga0068852_100312903 | |||
| 1166 | Ga0068859_100226342 | |||
| 1167 | Ga0068859_100395407 | |||
| 1168 | Ga0068859_100404271 | |||
| 1169 | Ga0068864_100025302 | |||
| 1170 | Ga0068864_100080894 | |||
| 1171 | Ga0068866_10040005 | |||
| 1172 | Ga0068866_10043942 | |||
| 1173 | Ga0068866_10242586 | |||
| 1174 | Ga0068866_10949598 | |||
| 1175 | Ga0068861_100057452 | |||
| 1176 | Ga0068861_100060580 | |||
| 1177 | Ga0068861_100081324 | |||
| 1178 | Ga0068861_100201859 | |||
| 1179 | Ga0068861_101168821 | |||
| 1180 | Ga0068851_10244456 | |||
| 1181 | Ga0068870_10115913 | |||
| 1182 | Ga0068863_100285834 | |||
| 1183 | Ga0068863_100317508 | |||
| 1184 | Ga0068863_100652672 | |||
| 1185 | Ga0068863_100727088 | |||
| 1186 | Ga0068858_100121056 | |||
| 1187 | Ga0068858_100177260 | |||
| 1188 | Ga0068858_100618255 | |||
| 1189 | Ga0068860_100000058 | |||
| 1190 | Ga0068860_100251166 | |||
| 1191 | Ga0068862_100053834 | |||
| 1192 | Ga0068862_100106659 | |||
| 1193 | Ga0068862_100140583 | |||
| 1194 | Ga0068862_100253886 | |||
| 1195 | Ga0068862_100365200 | |||
| 1196 | Ga0068862_100437267 | |||
| 1197 | Ga0068862_100466778 | |||
| 1198 | Ga0068862_100818592 | |||
| 1199 | Ga0081455_10002419 | |||
| 1200 | Ga0081455_10097911 | |||
| 1201 | Ga0081538_10124731 | |||
| 1202 | Ga0081540_1002092 | |||
| 1203 | Ga0081540_1004102 | |||
| 1204 | Ga0081540_1009301 | |||
| 1205 | Ga0081540_1016640 | |||
| 1206 | Ga0081539_10026414 | |||
| 1207 | Ga0070717_10005335 | |||
| 1208 | Ga0070717_11513364 | |||
| 1209 | Ga0075365_10005918 | |||
| 1210 | Ga0075365_10033942 | |||
| 1211 | Ga0075365_10096308 | |||
| 1212 | Ga0075365_10322223 | |||
| 1213 | Ga0075365_10417989 | |||
| 1214 | Ga0075368_10050537 | |||
| 1215 | Ga0075368_10142947 | |||
| 1216 | Ga0075368_10261632 | |||
| 1217 | Ga0075363_100010147 | |||
| 1218 | Ga0075363_100039459 | |||
| 1219 | Ga0075363_100138720 | |||
| 1220 | Ga0075363_100162658 | |||
| 1221 | Ga0075363_100197272 | |||
| 1222 | Ga0075364_10064370 | |||
| 1223 | Ga0075364_10590878 | |||
| 1224 | Ga0070715_10110516 | |||
| 1225 | Ga0070716_100127732 | |||
| 1226 | Ga0070716_100822414 | |||
| 1227 | Ga0070712_100048117 | |||
| 1228 | Ga0075362_10038981 | |||
| 1229 | Ga0075362_10132718 | |||
| 1230 | Ga0075362_10199527 | |||
| 1231 | Ga0075362_10349812 | |||
| 1232 | Ga0075367_10067366 | |||
| 1233 | Ga0075367_10070568 | |||
| 1234 | Ga0075367_10079229 | |||
| 1235 | Ga0075367_10144432 | |||
| 1236 | Ga0075367_10237094 | |||
| 1237 | Ga0075369_10015050 | |||
| 1238 | Ga0075369_10112709 | |||
| 1239 | Ga0075369_10180704 | |||
| 1240 | Ga0075366_10114713 | |||
| 1241 | Ga0075366_10130334 | |||
| 1242 | Ga0075366_10230488 | |||
| 1243 | Ga0075366_10240040 | |||
| 1244 | Ga0075366_10287195 | |||
| 1245 | Ga0097621_100083061 | |||
| 1246 | Ga0097621_100194605 | |||
| 1247 | Ga0097621_100406302 | |||
| 1248 | Ga0097621_101410444 | |||
| 1249 | Ga0075370_10017192 | |||
| 1250 | Ga0075370_10119300 | |||
| 1251 | Ga0075370_10287608 | |||
| 1252 | Ga0068871_100339866 | |||
| 1253 | Ga0068871_100372787 | |||
| 1254 | Ga0068871_100582597 | |||
| 1255 | Ga0068871_101010930 | |||
| 1256 | Ga0075428_100174800 | |||
| 1257 | Ga0075434_100931220 | |||
| 1258 | Ga0068865_100054115 | |||
| 1259 | Ga0068865_100111722 | |||
| 1260 | Ga0068865_100198421 | |||
| 1261 | Ga0097620_100226341 | |||
| 1262 | Ga0097620_100395360 | |||
| 1263 | Ga0097620_100404287 | |||
| 1264 | Ga0099795_10005197 | |||
| 1265 | Ga0099795_10131623 | |||
| 1266 | Ga0099795_10216224 | |||
| 1267 | Ga0105251_10267285 | |||
| 1268 | Ga0105240_10050611 | |||
| 1269 | Ga0105240_10567872 | |||
| 1270 | Ga0105245_10356075 | |||
| 1271 | Ga0105245_10709834 | |||
| 1272 | Ga0105245_10803915 | |||
| 1273 | Ga0105245_11405919 | |||
| 1274 | Ga0105247_10016251 | |||
| 1275 | Ga0105247_10036592 | |||
| 1276 | Ga0105247_10271868 | |||
| 1277 | Ga0105247_10491980 | |||
| 1278 | Ga0105247_11351934 | |||
| 1279 | Ga0114129_10064849 | |||
| 1280 | Ga0105243_10324591 | |||
| 1281 | Ga0105243_10427228 | |||
| 1282 | Ga0105241_10041152 | |||
| 1283 | Ga0105241_10099499 | |||
| 1284 | Ga0105242_10402070 | |||
| 1285 | Ga0105248_10033538 | |||
| 1286 | Ga0105248_10223621 | |||
| 1287 | Ga0105248_10478146 | |||
| 1288 | Ga0105248_11467355 | |||
| 1289 | Ga0105237_10090818 | |||
| 1290 | Ga0105237_10250559 | |||
| 1291 | Ga0105237_10318388 | |||
| 1292 | Ga0105237_10475461 | |||
| 1293 | Ga0105237_10587200 | |||
| 1294 | Ga0105237_11061828 | |||
| 1295 | Ga0105237_11104506 | |||
| 1296 | Ga0105238_10205293 | |||
| 1297 | Ga0105238_10297161 | |||
| 1298 | Ga0105238_10650285 | |||
| 1299 | Ga0105238_11123670 | |||
| 1300 | Ga0105249_10237127 | |||
| 1301 | Ga0105249_10241385 | |||
| 1302 | Ga0105249_10278071 | |||
| 1303 | Ga0105249_10584526 | |||
| 1304 | Ga0105249_11301589 | |||
| 1305 | Ga0105249_11793807 | |||
| 1306 | Ga0099796_10016836 | |||
| 1307 | Ga0099796_10017000 | |||
| 1308 | Ga0099796_10046732 | |||
| 1309 | Ga0099796_10161181 | |||
| 1310 | Ga0099796_10267336 | |||
| 1311 | Ga0105239_10272943 | |||
| 1312 | Ga0105239_10440714 | |||
| 1313 | Ga0105239_10518013 | |||
| 1314 | Ga0105239_10528120 | |||
| 1315 | Ga0105246_10096777 | |||
| 1316 | Ga0105246_10170406 | |||
| 1317 | Ga0105246_10207518 | |||
| 1318 | Ga0105246_10379792 | |||
| 1319 | Ga0105246_10451735 | |||
| 1320 | Ga0105246_10642111 | |||
| 1321 | Ga0157315_1017804 | |||
| 1322 | Ga0157373_10161499 | |||
| 1323 | Ga0157373_10318242 | |||
| 1324 | Ga0157371_10103344 | |||
| 1325 | Ga0157371_10663113 | |||
| 1326 | Ga0157370_10083279 | |||
| 1327 | Ga0157370_10162333 | |||
| 1328 | Ga0157370_11245970 | |||
| 1329 | Ga0157369_10609199 | |||
| 1330 | Ga0157369_10712082 | |||
| 1331 | Ga0157374_10636559 | |||
| 1332 | Ga0157374_12207020 | |||
| 1333 | Ga0157374_12260717 | |||
| 1334 | Ga0157378_10052830 | |||
| 1335 | Ga0157378_10397007 | |||
| 1336 | Ga0163162_10003676 | |||
| 1337 | Ga0163162_10635262 | |||
| 1338 | Ga0163162_10684744 | |||
| 1339 | Ga0163162_10920615 | |||
| 1340 | Ga0163162_11196669 | |||
| 1341 | Ga0157372_10221124 | |||
| 1342 | Ga0157372_10688229 | |||
| 1343 | Ga0157375_10581822 | |||
| 1344 | Ga0157375_10806841 | |||
| 1345 | Ga0157375_12720541 | |||
| 1346 | Ga0163163_10274800 | |||
| 1347 | Ga0163163_10381819 | |||
| 1348 | Ga0163163_10494780 | |||
| 1349 | Ga0163163_12233145 | |||
| 1350 | Ga0157380_10571212 | |||
| 1351 | Ga0157380_10659933 | |||
| 1352 | Ga0157380_11171104 | |||
| 1353 | Ga0157380_11713979 | |||
| 1354 | Ga0157379_10075745 | |||
| 1355 | Ga0157379_10085223 | |||
| 1356 | Ga0157379_10554598 | |||
| 1357 | Ga0157379_10620189 | |||
| 1358 | Ga0157379_11217209 | |||
| 1359 | Ga0157376_10013748 | |||
| 1360 | Ga0157376_10437417 | |||
| 1361 | Ga0157376_10627328 | |||
| 1362 | Ga0157376_10895874 | |||
| 1363 | Ga0163161_10012760 | |||
| 1364 | Ga0163161_10219488 | |||
| 1365 | Ga0163161_10850982 | |||
| 1366 | Ga0213874_10014179 | |||
| 1367 | Ga0213874_10177991 | |||
| 1368 | Ga0209026_1015260 | |||
| 1369 | Ga0209758_1032872 | |||
| 1370 | Ga0207697_10090582 | |||
| 1371 | Ga0207656_10243163 | |||
| 1372 | Ga0207682_10236688 | |||
| 1373 | Ga0207682_10266242 | |||
| 1374 | Ga0207692_10293747 | |||
| 1375 | Ga0207642_10193472 | |||
| 1376 | Ga0207642_10196391 | |||
| 1377 | Ga0207642_10383017 | |||
| 1378 | Ga0207710_10030090 | |||
| 1379 | Ga0207710_10040008 | |||
| 1380 | Ga0207710_10167797 | |||
| 1381 | Ga0207710_10253517 | |||
| 1382 | Ga0207688_10037109 | |||
| 1383 | Ga0207688_10457381 | |||
| 1384 | Ga0207680_10074752 | |||
| 1385 | Ga0207680_10774173 | |||
| 1386 | Ga0207647_10052558 | |||
| 1387 | Ga0207685_10166861 | |||
| 1388 | Ga0207699_10034310 | |||
| 1389 | Ga0207645_10104054 | |||
| 1390 | Ga0207645_10524651 | |||
| 1391 | Ga0207645_10567032 | |||
| 1392 | Ga0207643_10037354 | |||
| 1393 | Ga0207643_10048012 | |||
| 1394 | Ga0207705_10128371 | |||
| 1395 | Ga0207705_10137452 | |||
| 1396 | Ga0207684_11286903 | |||
| 1397 | Ga0207654_10011369 | |||
| 1398 | Ga0207654_10208786 | |||
| 1399 | Ga0207707_10154844 | |||
| 1400 | Ga0207707_10155477 | |||
| 1401 | Ga0207695_10341192 | |||
| 1402 | Ga0207695_10399936 | |||
| 1403 | Ga0207671_10078202 | |||
| 1404 | Ga0207671_10156675 | |||
| 1405 | Ga0207671_10158726 | |||
| 1406 | Ga0207671_10787196 | |||
| 1407 | Ga0207693_10022609 | |||
| 1408 | Ga0207693_10029036 | |||
| 1409 | Ga0207693_10096969 | |||
| 1410 | Ga0207663_10566172 | |||
| 1411 | Ga0207663_10647604 | |||
| 1412 | Ga0207663_11491768 | |||
| 1413 | Ga0207660_10027655 | |||
| 1414 | Ga0207660_10158654 | |||
| 1415 | Ga0207660_10350779 | |||
| 1416 | Ga0207657_10007732 | |||
| 1417 | Ga0207657_10135694 | |||
| 1418 | Ga0207657_10705319 | |||
| 1419 | Ga0207657_10975191 | |||
| 1420 | Ga0207649_10071248 | |||
| 1421 | Ga0207649_10499447 | |||
| 1422 | Ga0207652_10071088 | |||
| 1423 | Ga0207652_10278639 | |||
| 1424 | Ga0207681_10509590 | |||
| 1425 | Ga0207681_10849328 | |||
| 1426 | Ga0207694_10310874 | |||
| 1427 | Ga0207694_10587206 | |||
| 1428 | Ga0207694_10830651 | |||
| 1429 | Ga0207650_10699033 | |||
| 1430 | Ga0207659_10091363 | |||
| 1431 | Ga0207659_10276610 | |||
| 1432 | Ga0207659_11071959 | |||
| 1433 | Ga0207687_10031494 | |||
| 1434 | Ga0207687_10620980 | |||
| 1435 | Ga0207700_10031958 | |||
| 1436 | Ga0207644_10242514 | |||
| 1437 | Ga0207644_10369151 | |||
| 1438 | Ga0207690_10025604 | |||
| 1439 | Ga0207690_10153233 | |||
| 1440 | Ga0207690_10827888 | |||
| 1441 | Ga0207706_10069272 | |||
| 1442 | Ga0207706_10091791 | |||
| 1443 | Ga0207706_10303480 | |||
| 1444 | Ga0207706_10767624 | |||
| 1445 | Ga0207706_10845433 | |||
| 1446 | Ga0207686_10191222 | |||
| 1447 | Ga0207686_10691787 | |||
| 1448 | Ga0207709_10047871 | |||
| 1449 | Ga0207709_10282676 | |||
| 1450 | Ga0207669_10149924 | |||
| 1451 | Ga0207669_10356105 | |||
| 1452 | Ga0207669_10393449 | |||
| 1453 | Ga0207669_10431840 | |||
| 1454 | Ga0207669_10443621 | |||
| 1455 | Ga0207669_10594559 | |||
| 1456 | Ga0207704_10131490 | |||
| 1457 | Ga0207704_10569802 | |||
| 1458 | Ga0207704_11659438 | |||
| 1459 | Ga0207665_10240753 | |||
| 1460 | Ga0207665_10574923 | |||
| 1461 | Ga0207691_10215676 | |||
| 1462 | Ga0207691_10373085 | |||
| 1463 | Ga0207691_10445410 | |||
| 1464 | Ga0207711_10032973 | |||
| 1465 | Ga0207711_10135139 | |||
| 1466 | Ga0207711_10547306 | |||
| 1467 | Ga0207711_10841788 | |||
| 1468 | Ga0207711_11454386 | |||
| 1469 | Ga0207689_10016101 | |||
| 1470 | Ga0207689_10150749 | |||
| 1471 | Ga0207689_10514696 | |||
| 1472 | Ga0207661_10056472 | |||
| 1473 | Ga0207679_10103264 | |||
| 1474 | Ga0207667_10124426 | |||
| 1475 | Ga0207667_10602403 | |||
| 1476 | Ga0207667_10705428 | |||
| 1477 | Ga0207651_10920981 | |||
| 1478 | Ga0207712_10061492 | |||
| 1479 | Ga0207712_10143860 | |||
| 1480 | Ga0207712_10302748 | |||
| 1481 | Ga0207712_10355405 | |||
| 1482 | Ga0207712_10409719 | |||
| 1483 | Ga0207668_10014887 | |||
| 1484 | Ga0207668_10060845 | |||
| 1485 | Ga0207668_10083922 | |||
| 1486 | Ga0207668_10212704 | |||
| 1487 | Ga0207668_10325700 | |||
| 1488 | Ga0207668_10608455 | |||
| 1489 | Ga0207640_10016462 | |||
| 1490 | Ga0207640_10108236 | |||
| 1491 | Ga0207658_10075699 | |||
| 1492 | Ga0207658_10565004 | |||
| 1493 | Ga0207658_10729787 | |||
| 1494 | Ga0207658_11069225 | |||
| 1495 | Ga0207677_10175882 | |||
| 1496 | Ga0207677_10383062 | |||
| 1497 | Ga0207677_10562528 | |||
| 1498 | Ga0207677_10590228 | |||
| 1499 | Ga0207677_11181017 | |||
| 1500 | Ga0207703_10025797 | |||
| 1501 | Ga0207703_10884165 | |||
| 1502 | Ga0207639_10306886 | |||
| 1503 | Ga0207639_10308315 | |||
| 1504 | Ga0207639_10482044 | |||
| 1505 | Ga0207639_10503831 | |||
| 1506 | Ga0207678_10019509 | |||
| 1507 | Ga0207678_10026492 | |||
| 1508 | Ga0207678_10028300 | |||
| 1509 | Ga0207678_10037339 | |||
| 1510 | Ga0207678_10113723 | |||
| 1511 | Ga0207678_10253830 | |||
| 1512 | Ga0207678_10366204 | |||
| 1513 | Ga0207708_10044451 | |||
| 1514 | Ga0207708_10531347 | |||
| 1515 | Ga0207708_10840917 | |||
| 1516 | Ga0207702_10089626 | |||
| 1517 | Ga0207702_10666186 | |||
| 1518 | Ga0207702_11000885 | |||
| 1519 | Ga0207641_10567305 | |||
| 1520 | Ga0207641_10570643 | |||
| 1521 | Ga0207648_10016066 | |||
| 1522 | Ga0207648_10464869 | |||
| 1523 | Ga0207648_10915692 | |||
| 1524 | Ga0207676_10689546 | |||
| 1525 | Ga0207676_12123471 | |||
| 1526 | Ga0207676_12436706 | |||
| 1527 | Ga0207674_10004659 | |||
| 1528 | Ga0207674_10165973 | |||
| 1529 | Ga0207675_100018787 | |||
| 1530 | Ga0207675_100262760 | |||
| 1531 | Ga0207675_100291447 | |||
| 1532 | Ga0207675_100462680 | |||
| 1533 | Ga0207675_100639498 | |||
| 1534 | Ga0207675_100820892 | |||
| 1535 | Ga0207683_10016292 | |||
| 1536 | Ga0207683_10082790 | |||
| 1537 | Ga0207683_10083791 | |||
| 1538 | Ga0207683_10096169 | |||
| 1539 | Ga0207683_10328129 | |||
| 1540 | Ga0207683_10670631 | |||
| 1541 | Ga0207698_10069860 | |||
| 1542 | Ga0207698_10504412 | |||
| 1543 | Ga0207698_10966652 | |||
| 1544 | Ga0209179_1009134 | |||
| 1545 | Ga0209179_1035329 | |||
| 1546 | Ga0209813_10088416 | |||
| 1547 | Ga0207428_10344633 | |||
| 1548 | Ga0268266_10002475 | |||
| 1549 | Ga0268266_10004442 | |||
| 1550 | Ga0268266_10126879 | |||
| 1551 | Ga0268266_10209865 | |||
| 1552 | Ga0268266_10361320 | |||
| 1553 | Ga0268266_10429418 | |||
| 1554 | Ga0268266_10955735 | |||
| 1555 | Ga0268265_10094178 | |||
| 1556 | Ga0268265_10129487 | |||
| 1557 | Ga0268265_10205650 | |||
| 1558 | Ga0268265_10280937 | |||
| 1559 | Ga0268265_10328264 | |||
| 1560 | Ga0268265_11001553 | |||
| 1561 | Ga0268264_10000022 | |||
| 1562 | Ga0268264_11452154 | |||
| 1563 | Ga0268264_11642585 | |||
| 1564 | Ga0265334_10039005 | |||
| 1565 | Ga0307517_10436195 | |||
| 1566 | Ga0307515_10007547 | |||
| 1567 | Ga0307515_10190719 | |||
| 1568 | Ga0307515_10629270 | |||
| 1569 | Ga0307511_10026276 | |||
| 1570 | Ga0307511_10056903 | |||
| 1571 | Ga0307512_10272233 | |||
| 1572 | Ga0265330_10015725 | |||
| 1573 | Ga0265330_10466232 | |||
| 1574 | Ga0265332_10029159 | |||
| 1575 | Ga0265339_10210650 | |||
| 1576 | Ga0307513_10166927 | |||
| 1577 | Ga0307513_10412663 | |||
| 1578 | Ga0307513_10639897 | |||
| 1579 | Ga0307509_10075236 | |||
| 1580 | Ga0307509_10111062 | |||
| 1581 | Ga0307408_100465966 | |||
| 1582 | Ga0307508_10000009 | |||
| 1583 | Ga0307508_10047463 | |||
| 1584 | Ga0307508_10226454 | |||
| 1585 | Ga0307508_10447711 | |||
| 1586 | Ga0307508_10586964 | |||
| 1587 | Ga0307516_10058764 | |||
| 1588 | Ga0307516_10087356 | |||
| 1589 | Ga0307516_10101855 | |||
| 1590 | Ga0307516_10254800 | |||
| 1591 | Ga0307516_10379955 | |||
| 1592 | Ga0307516_10579252 | |||
| 1593 | Ga0307413_11228058 | |||
| 1594 | Ga0307410_10273312 | |||
| 1595 | Ga0307410_10436164 | |||
| 1596 | Ga0307406_10422848 | |||
| 1597 | Ga0307406_10679988 | |||
| 1598 | Ga0307412_11044861 | |||
| 1599 | Ga0307409_101161344 | |||
| 1600 | Ga0307409_101208319 | |||
| 1601 | Ga0307416_100371409 | |||
| 1602 | Ga0307416_103072376 | |||
| 1603 | Ga0307414_11126070 | |||
| 1604 | Ga0307414_11380891 | |||
| 1605 | Ga0307411_10480109 | |||
| 1606 | Ga0307411_10514787 | |||
| 1607 | Ga0307415_100044407 | |||
| 1608 | Ga0307415_100107062 | |||
| 1609 | Ga0307415_100139109 | |||
| 1610 | Ga0307415_101357453 | |||
| 1611 | Ga0307507_10188130 | |||
| 1612 | Ga0307510_10041082 | |||
| 1613 | Ga0373934_0017581 | |||
| 1614 | Ga0373951_0049666 | |||
| 1615 | Ga0373923_0002332 | |||
| 1616 | Ga0373923_0275279 | |||
| 1617 | Ga0373936_0011675 | |||
| 1618 | Ga0373936_0026082 | |||
| 1619 | Ga0373936_0042885 | |||
| 1620 | Ga0373936_0211681 | |||
| 1621 | Ga0373939_0079359 | |||
| 1622 | Ga0373953_0000473 | |||
| 1623 | Ga0373954_0000442 | |||
| 1624 | Ga0373954_0010918 | |||
| 1625 | Ga0373954_0386505 | |||
| 1626 | Ga0373956_0001159 | |||
| 1627 | Ga0373956_0058457 | |||
| 1628 | Ga0373957_0000837 | |||
| 1629 | Ga0373957_0082576 | |||
| 1630 | Ga0373943_0006178 | |||
| 1631 | Ga0373943_0469653 | |||
| 1632 | Ga0373946_0007625 | |||
| 1633 | Ga0373955_0000840 | |||
| 1634 | Ga0373955_0019884 | |||
| 1635 | Ga0373955_0111431 | |||
| 1636 | Ga0373955_1008664 | |||
| 1637 | Ga0373962_0045346 | |||
| 1638 | Ga0373931_0015131 | |||
| 1639 | Ga0373935_0001167 | |||
| 1640 | Ga0373935_0130812 | |||
| 1641 | Ga0373927_0001744 | |||
| 1642 | Ga0373927_0010992 | |||
| 1643 | Ga0373927_0319500 | |||
| 1644 | Ga0373933_0012552 | |||
| 1645 | Ga0373933_0214946 | |||
| 1646 | Ga0373933_0543972 | |||
| 1647 | Ga0373947_0005344 | |||
| 1648 | Ga0373947_0265277 | |||
| 1649 | Ga0373937_0014572 | |||
| 1650 | Ga0373937_0330973 | |||
| 1651 | Ga0373937_0751771 | |||
| 1652 | Ga0373925_0013749 | |||
| 1653 | Ga0373925_0188035 | |||
| 1654 | Ga0373925_0795689 | |||
| 1655 | Ga0395900_0071894 | |||
| 1656 | Ga0395898_0333137 | |||
| 1657 | Ga0436365_0157279 | |||
| 1658 | Ga0436360_1070790 | |||
| 1659 | Ga0436361_0402017 | |||
| 1660 | Ga0436363_0312883 | |||
| 1661 | Ga0436363_0872365 | |||
| 1662 | Ga0451791_0639961 | |||
| 1663 | Ga0451793_0200984 | |||
| 1664 | Ga0451797_0987490 | |||
| 1665 | Ga0451795_0725544 | |||
| 1666 | Ga0451800_1010296 | |||
| 1667 | Ga0451802_1555424 | |||
| 1668 | Ga0451807_0582585 | |||
| 1669 | Ga0451855_1946904 | |||
| 1670 | Ga0466957_0388110 | |||
| 1671 | Ga0466967_0110502 | |||
| 1672 | Ga0495617_003836 | |||
| 1673 | Ga0495592_0020075 | |||
| 1674 | Ga0495592_0028166 | |||
| 1675 | Ga0495592_0139266 | |||
| 1676 | Ga0495603_0003551 | |||
| 1677 | Ga0495603_0008022 | |||
| 1678 | Ga0495603_0114512 | |||
| 1679 | Ga0495590_0066570 | |||
| 1680 | Ga0495629_0008864 | |||
| 1681 | Ga0495629_0515483 | |||
| 1682 | Ga0495638_0097415 | |||
| 1683 | Ga0495641_0011704 | |||
| 1684 | Ga0495651_0026680 | |||
| 1685 | Ga0495651_0186619 | |||
| 1686 | Ga0495651_0310249 | |||
| 1687 | Ga0495653_0035279 | |||
| 1688 | Ga0495653_0187734 | |||
| 1689 | Ga0495580_0009095 | |||
| 1690 | Ga0495582_0000739 | |||
| 1691 | Ga0495582_0158839 | |||
| 1692 | Ga0495605_0110145 | |||
| 1693 | Ga0495605_0119536 | |||
| 1694 | Ga0495639_0003522 | |||
| 1695 | Ga0495639_0262691 | |||
| 1696 | Ga0495662_0000437 | |||
| 1697 | Ga0495662_0137983 | |||
| 1698 | Ga0495664_0130686 | |||
| 1699 | Ga0495664_0732720 | |||
| 1700 | Ga0495584_0129036 | |||
| 1701 | Ga0495584_0310847 | |||
| 1702 | Ga0495585_0268401 | |||
| 1703 | Ga0495585_0383548 | |||
| 1704 | Ga0495594_0013772 | |||
| 1705 | Ga0495594_0038684 | |||
| 1706 | Ga0495594_0307169 | |||
| 1707 | Ga0495606_0194227 | |||
| 1708 | Ga0495606_0295052 | |||
| 1709 | Ga0495606_0301711 | |||
| 1710 | Ga0495608_0005163 | |||
| 1711 | Ga0495608_0407807 | |||
| 1712 | Ga0495608_0589439 | |||
| 1713 | Ga0495618_0055282 | |||
| 1714 | Ga0495618_0082750 | |||
| 1715 | Ga0495620_0081714 | |||
| 1716 | Ga0495620_0269477 | |||
| 1717 | Ga0495628_0027929 | |||
| 1718 | Ga0495628_0041356 | |||
| 1719 | Ga0495628_0785085 | |||
| 1720 | Ga0495630_0008430 | |||
| 1721 | Ga0495631_0092953 | |||
| 1722 | Ga0495631_0429260 | |||
| 1723 | Ga0495632_0080177 | |||
| 1724 | Ga0495644_0066798 | |||
| 1725 | Ga0495648_0049954 | |||
| 1726 | Ga0495666_0009748 | |||
| 1727 | Ga0495652_0002339 | |||
| 1728 | Ga0495652_0036756 | |||
| 1729 | Ga0495652_0073700 | |||
| 1730 | Ga0495652_0585551 | |||
| 1731 | Ga0495654_0035071 | |||
| 1732 | Ga0495665_0011208 | |||
| 1733 | Ga0495640_0000826 | |||
| 1734 | Ga0495640_0020781 | |||
| 1735 | Ga0495586_0177428 | |||
| 1736 | Ga0495586_0265385 | |||
| 1737 | Ga0495587_0033793 | |||
| 1738 | Ga0495587_0156726 | |||
| 1739 | Ga0495587_0273488 | |||
| 1740 | Ga0495598_0074485 | |||
| 1741 | Ga0495621_0090957 | |||
| 1742 | Ga0495597_0098721 | |||
| 1743 | Ga0495597_0387661 | |||
| 1744 | Ga0495645_0019281 | |||
| 1745 | Ga0495622_0008636 | |||
| 1746 | Ga0495622_0012865 | |||
| 1747 | Ga0495633_0039118 | |||
| 1748 | Ga0495633_0142997 | |||
| 1749 | Ga0495667_0001528 | |||
| 1750 | Ga0495667_0030123 | |||
| 1751 | Ga0495667_0400517 | |||
| 1752 | Ga0495656_0016790 | |||
| 1753 | Ga0495656_0107122 | |||
| 1754 | Ga0495668_0611460 | |||
| 1755 | Ga0495634_0000762 | |||
| 1756 | Ga0495634_0002573 | |||
| 1757 | Ga0495625_0234122 | |||
| 1758 | Ga0495625_0280239 | |||
| 1759 | Ga0495625_0431671 | |||
| 1760 | Ga0495635_0000187 | |||
| 1761 | Ga0495635_0001091 | |||
| 1762 | Ga0495635_0704281 | |||
| 1763 | Ga0495588_0001370 | |||
| 1764 | Ga0495588_0002045 | |||
| 1765 | Ga0495588_0189588 | |||
| 1766 | Ga0495657_0016934 | |||
| 1767 | Ga0495657_0023684 | |||
| 1768 | Ga0495599_0002320 | |||
| 1769 | Ga0495599_0210894 | |||
| 1770 | Ga0495623_0019613 | |||
| 1771 | Ga0495623_0027785 | |||
| 1772 | Ga0495646_0005680 | |||
| 1773 | Ga0495646_0039618 | |||
| 1774 | Ga0495646_0074198 | |||
| 1775 | Ga0495647_0000422 | |||
| 1776 | Ga0495658_0000047 | |||
| 1777 | Ga0495658_0502382 | |||
| 1778 | Ga0495669_0172040 | |||
| 1779 | Ga0495669_0267039 | |||
| 1780 | Ga0495613_0002415 | |||
| 1781 | Ga0495613_0023851 | |||
| 1782 | Ga0495624_0002051 | |||
| 1783 | Ga0495624_0873845 | |||
| 1784 | Ga0495671_0106079 | |||
| 1785 | Ga0495671_0234800 | |||
| 1786 | Ga0495649_0065974 | |||
| 1787 | Ga0495649_0472496 | |||
| 1788 | Ga0495589_0050614 | |||
| 1789 | Ga0495600_0002218 | |||
| 1790 | Ga0495600_0011285 | |||
| 1791 | Ga0495600_0093163 | |||
| 1792 | Ga0495600_0223033 | |||
| 1793 | Ga0495581_0002021 | |||
| 1794 | Ga0495581_0016629 | |||
| 1795 | Ga0495581_0521516 | |||
| 1796 | Ga0495604_0094508 | |||
| 1797 | Ga0495604_0154886 | |||
| 1798 | Ga0495604_0383164 | |||
| 1799 | Ga0495604_0387183 | |||
| 1800 | Ga0495604_0542484 | |||
| 1801 | Ga0495604_0698727 | |||
| 1802 | Ga0495636_0521797 | |||
| 1803 | Ga0495674_0001402 | |||
| 1804 | Ga0495674_0030894 | |||
| 1805 | Ga0495674_0051843 | |||
| 1806 | Ga0495672_0010426 | |||
| 1807 | Ga0495672_0021570 | |||
| 1808 | Ga0495676_0005620 | |||
| 1809 | Ga0495676_0034176 | |||
| 1810 | Ga0495680_0005405 | |||
| 1811 | Ga0495680_0184568 | |||
| 1812 | Ga0495683_0284033 | |||
| 1813 | Ga0495675_0038736 | |||
| 1814 | Ga0495675_0096848 | |||
| 1815 | Ga0495673_0029067 | |||
| 1816 | Ga0495681_0343729 | |||
| 1817 | Ga0495684_0001482 | |||
| 1818 | Ga0495684_0093049 | |||
| 1819 | Ga0495684_0447688 | |||
| 1820 | Ga0495686_0130279 | |||
| 1821 | Ga0495593_0000723 | |||
| 1822 | Ga0495593_0070853 | |||
| 1823 | Ga0495593_0077595 | |||
| 1824 | Ga0495602_0068925 | |||
| 1825 | Ga0495602_0093929 | |||
| 1826 | Ga0495602_0283596 | |||
| 1827 | Ga0495614_0286812 | |||
| 1828 | Ga0495626_0058553 | |||
| 1829 | Ga0496100_0002635 | |||
| 1830 | Ga0496100_0139073 | |||
| 1831 | Ga0496100_0284502 | |||
| 1832 | Ga0496100_0793866 | |||
| 1833 | Ga0496101_0011050 | |||
| 1834 | Ga0496101_0489136 | |||
| 1835 | Ga0496101_0779701 | |||
| 1836 | Ga0496101_1082972 | |||
| 1837 | Ga0496102_0003268 | |||
| 1838 | Ga0496102_0126479 | |||
| 1839 | Ga0496102_0204326 | |||
| 1840 | Ga0496102_0406775 | |||
| 1841 | Ga0496102_0518107 | |||
| 1842 | Ga0496102_1157566 | |||
| 1843 | Ga0496103_0011931 | |||
| 1844 | Ga0496103_0090433 | |||
| 1845 | Ga0496103_0241289 | |||
| 1846 | Ga0496104_0016540 | |||
| 1847 | Ga0496104_0028918 | |||
| 1848 | Ga0496104_0089038 | |||
| 1849 | Ga0496104_0736902 | |||
| 1850 | Ga0496105_0027843 | |||
| 1851 | Ga0496105_0398587 | |||
| 1852 | Ga0496105_0412465 | |||
| 1853 | Ga0496106_0000477 | |||
| 1854 | Ga0496106_0027131 | |||
| 1855 | Ga0496106_0065167 | |||
| 1856 | Ga0496106_0374537 | |||
| 1857 | Ga0496106_0834121 | |||
| 1858 | Ga0496106_0884873 | |||
| 1859 | Ga0496106_1190084 | |||
| 1860 | Ga0496107_0002282 | |||
| 1861 | Ga0496107_0105014 | |||
| 1862 | Ga0496108_0015096 | |||
| 1863 | Ga0496108_0371059 | |||
| 1864 | Ga0496108_0534520 | |||
| 1865 | Ga0496109_0032340 | |||
| 1866 | Ga0496109_0103827 | |||
| 1867 | Ga0496109_0360581 | |||
| 1868 | Ga0496110_0010493 | |||
| 1869 | Ga0496110_0079927 | |||
| 1870 | Ga0496110_0151390 | |||
| 1871 | Ga0496110_0571162 | |||
| 1872 | Ga0496110_1158866 | |||
| 1873 | Ga0496111_0150239 | |||
| 1874 | Ga0496112_0023640 | |||
| 1875 | Ga0496112_0127846 | |||
| 1876 | Ga0496112_0155738 | |||
| 1877 | Ga0496112_0315846 | |||
| 1878 | Ga0496113_0012966 | |||
| 1879 | Ga0496113_0064609 | |||
| 1880 | Ga0496113_0856397 | |||
| 1881 | Ga0496114_0020349 | |||
| 1882 | Ga0496114_0559037 | |||
| 1883 | Ga0496114_0843840 | |||
| 1884 | Ga0496115_0001335 | |||
| 1885 | Ga0496115_0013365 | |||
| 1886 | Ga0496115_0065535 | |||
| 1887 | Ga0496117_0020387 | |||
| 1888 | Ga0496118_0004957 | |||
| 1889 | Ga0496119_0093097 | |||
| 1890 | Ga0496119_0126065 | |||
| 1891 | Ga0496121_0000456 | |||
| 1892 | Ga0496121_0011588 | |||
| 1893 | Ga0496121_0080209 | |||
| 1894 | Ga0496121_0093992 | |||
| 1895 | Ga0496121_0387200 | |||
| 1896 | Ga0496124_0000685 | |||
| 1897 | Ga0496124_0231946 | |||
| 1898 | Ga0496125_0062506 | |||
| 1899 | Ga0496125_0234418 | |||
| 1900 | Ga0496125_0411712 | |||
| 1901 | Ga0496126_0002820 | |||
| 1902 | Ga0496126_0007653 | |||
| 1903 | Ga0496126_0010701 | |||
| 1904 | Ga0496126_0111157 | |||
| 1905 | Ga0496126_0286451 | |||
| 1906 | Ga0496126_0294066 | |||
| 1907 | Ga0496126_0369571 | |||
| 1908 | Ga0501036_1577035 | |||
| 1909 | Ga0501046_0145221 | |||
| 1910 | Ga0501067_0021493 | |||
| 1911 | Ga0501067_0149277 | |||
| 1912 | Ga0501070_0773034 | |||
| 1913 | Ga0501076_0409288 | |||
| 1914 | Ga0501083_1031677 | |||
| 1915 | Ga0501035_0193141 | |||
| 1916 | Ga0501045_0832842 | |||
| 1917 | nmdc:mga03683_133759_c1 | |||
| 1918 | nmdc:mga03683_31439_c1 | |||
| 1919 | nmdc:mga03683_339833_c1 | |||
| 1920 | nmdc:mga03n38_16168_c1 | |||
| 1921 | nmdc:mga03n38_27443_c1 | |||
| 1922 | nmdc:mga03n38_37121_c1 | |||
| 1923 | nmdc:mga00v17_22557_c1 | |||
| 1924 | nmdc:mga00v17_351141_c1 | |||
| 1925 | nmdc:mga0yw44_1163403_c1 | |||
| 1926 | nmdc:mga0yw44_320441_c1 | |||
| 1927 | nmdc:mga0yw44_332466_c1 | |||
| 1928 | nmdc:mga0yw44_34735_c1 | |||
| 1929 | nmdc:mga0yw44_528599_c1 | |||
| 1930 | nmdc:mga0yw44_5923_c1 | |||
| 1931 | nmdc:mga0k408_103122_c1 | |||
| 1932 | nmdc:mga0k408_167258_c1 | |||
| 1933 | nmdc:mga0k408_334839_c1 | |||
| 1934 | nmdc:mga0k408_511767_c1 | |||
| 1935 | nmdc:mga06z11_118768_c1 | |||
| 1936 | nmdc:mga04h51_84363_c1 | |||
| 1937 | nmdc:mga07m45_421575_c1 | |||
| 1938 | nmdc:mga07m45_55711_c1 | |||
| 1939 | nmdc:mga05p37_209207_c1 | |||
| 1940 | nmdc:mga0qj67_224802_c1 | |||
| 1941 | nmdc:mga08y16_228382_c1 | |||
| 1942 | nmdc:mga0rr50_628964_c1 | |||
| 1943 | nmdc:mga0sz30_19314_c1 | |||
| 1944 | Ga0495601_0085005 | |||
| 1945 | Ga0495601_0119969 | |||
| 1946 | Ga0495601_0290864 | |||
| 1947 | Ga0495612_0108278 | |||
| 1948 | Ga0495612_0219544 | |||
| 1949 | Ga0500635_0033304 | |||
| 1950 | Ga0495655_0144660 | |||
| 1951 | Ga0495595_0006061 | |||
| 1952 | Ga0495595_0022229 | |||
| 1953 | Ga0495619_0002231 | |||
| 1954 | Ga0495619_0037434 | |||
| 1955 | Ga0495619_0190472 | |||
| 1956 | Ga0495619_0206880 | |||
| 1957 | Ga0495619_0491269 | |||
| 1958 | Ga0500646_0145632 | |||
| 1959 | Ga0500647_0018439 | |||
| 1960 | Ga0500647_0245693 | |||
| 1961 | Ga0500583_0137708 | |||
| 1962 | Ga0500651_0189209 | |||
| 1963 | Ga0500566_0013410 | |||
| 1964 | Ga0500566_0285489 | |||
| 1965 | Ga0500640_005820 | |||
| 1966 | Ga0500641_0011445 | |||
| 1967 | Ga0500641_0077801 | |||
| 1968 | Ga0500641_0174650 | |||
| 1969 | Ga0500648_074567 | |||
| 1970 | Ga0500556_0061823 | |||
| 1971 | Ga0500562_052210 | |||
| 1972 | Ga0500572_000217 | |||
| 1973 | Ga0500582_190476 | |||
| 1974 | Ga0500595_000438 | |||
| 1975 | Ga0500595_034504 | |||
| 1976 | Ga0500595_046627 | |||
| 1977 | Ga0500597_343811 | |||
| 1978 | Ga0500608_002059 | |||
| 1979 | Ga0500614_001377 | |||
| 1980 | Ga0500642_0056964 | |||
| 1981 | Ga0500642_0512600 | |||
| 1982 | Ga0500658_0069098 | |||
| 1983 | Ga0500658_0154435 | |||
| 1984 | Ga0500559_0008610 | |||
| 1985 | Ga0500559_0458831 | |||
| 1986 | Ga0500568_0010219 | |||
| 1987 | Ga0500573_0069876 | |||
| 1988 | Ga0500588_0093026 | |||
| 1989 | Ga0500603_002023 | |||
| 1990 | Ga0500604_0023541 | |||
| 1991 | Ga0500630_000537 | |||
| 1992 | Ga0500634_0008812 | |||
| 1993 | Ga0500638_000078 | |||
| 1994 | Ga0500638_013999 | |||
| 1995 | Ga0500638_071658 | |||
| 1996 | Ga0500639_000001 | |||
| 1997 | Ga0500639_086000 | |||
| 1998 | Ga0500636_0093571 | |||
| 1999 | Ga0500637_0000088 | |||
| 2000 | Ga0500637_0094657 | |||
| 2001 | Ga0500637_0397258 | |||
| 2002 | Ga0500576_061368 | |||
| 2003 | Ga0500609_036777 | |||
| 2004 | Ga0500596_001084 | |||
| 2005 | Ga0500596_017423 | |||
| 2006 | Ga0500601_005309 | |||
| 2007 | Ga0500661_000025 | |||
| 2008 | Ga0501082_0218887 | |||
| 2009 | 2513675889 | |||
| 2010 | 2513692589 | |||
| 2011 | 2524468938 | |||
| 2012 | 2723845025 | |||
| 2013 | 2793082108 | |||
| 2014 | 2874605259 | |||
| 2015 | 2885386549 | |||
| 2016 | 2889039777 | |||
| 2017 | 2903774128 | |||
| 2018 | 2922365418 | |||
| 2019 | 2922391027 | |||
| 2020 | 8006965805 | |||
| 2021 | 8006986457 | |||
| 2022 | 8006995974 | |||
| 2023 | 8056673807 | |||
| 2024 | 8056686711 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7a0g-assembly1.cif.gz_EEE | structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. | 0.4833 | 6 | 135 |
| 7a0g-assembly1.cif.gz_FFF | structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. | 0.4695 | 6 | 136 |
| 5szk-assembly1.cif.gz_A | structure of human n-terminally engineered rab1b in complex with the bmerb domain of mical-cl | 0.4465 | 7 | 135 |
| 6o3e-assembly1.cif.gz_B | mouse ae-catenin 82-883 | 0.4444 | 13 | 132 |
| 5szi-assembly1.cif.gz_B | structure of human rab8a in complex with the bmerb domain of mical-cl | 0.4414 | 7 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5jdlA01 | Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region | 0.6163 | 6 | 91 | 6.10.280.80 |
| af_Q19983_1_107_1.20.5.780 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin | 0.592 | 5 | 81 | 1.20.5.780 |
| 5jdlA01 | Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region | 0.56 | 6 | 91 | 6.10.280.80 |
| af_Q6AYR9_1_113_1.20.5.780 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin | 0.5226 | 3 | 97 | 1.20.5.780 |
| af_A0A2R8QPH7_1_107_1.20.5.110 | Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; | 0.4932 | 3 | 102 | 1.20.5.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A431NXQ7-F1-model_v4 | deleted | 0.6744 | 1 | 117 |
|
| AF-A0A431NXQ7-F1-model_v4 | deleted | 0.6633 | 1 | 117 |
|
| AF-A0A1J5PBD5-F1-model_v4 | Inner membrane protein YphA | 0.605 | 60 | 147 |
GO:0016020
|
| AF-A0A1J5PBD5-F1-model_v4 | Inner membrane protein YphA | 0.5797 | 60 | 147 |
GO:0016020
|
| AF-A0A533J396-F1-model_v4 | deleted | 0.5756 | 1 | 129 |
|