F488165

General Info

Members Datasets Scaffolds Average Seq Length
1012 436 2024 150

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10238890|Ga0105248_102388903
Length 176
Sequence LKSGDETPIIVSRRLLSLHAISEADPMPALVTFGRVLFAVLFMYTGATKLFAIQPTADFIASKVTIPSVLAPYTSQLETMTGMPMPQLLAISVGGFEILAGLMIAVNFGARFFSILLIFFVIGATFYFHDFWNQPAPENAKALIDALKNLSIIGALFMIAGYGRGPRPNEAAYGDV

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
201 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
209 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
220 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
223 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
228 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
229 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
232 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
242 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
248 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
249 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
250 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
251 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
252 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
253 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
254 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
261 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
262 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
263 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
264 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
265 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
271 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
272 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
273 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
284 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
285 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
293 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
294 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
312 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
313 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
316 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
317 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
320 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
323 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
324 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
325 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
326 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
327 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
328 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
334 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
335 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
336 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
337 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
338 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
339 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
340 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
341 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
342 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
343 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
344 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
345 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
346 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
347 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
352 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
353 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
354 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
355 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
356 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
369 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
370 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
371 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
372 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
376 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
381 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
382 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
386 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
387 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
388 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
389 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
390 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
391 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
392 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
393 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
394 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
395 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
396 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
397 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
398 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
399 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
400 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
401 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
402 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
403 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
404 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
405 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
406 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
407 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
408 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
409 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
410 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
411 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
412 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
413 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
414 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
415 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
416 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
417 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
418 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
419 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
420 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
421 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
422 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
423 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
424 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
425 2791355199
426 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
427 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
428 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
429 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
430 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
431 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
432 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
433 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
434 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
435 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
436 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.07
Nodule 1.09
Rhizoplane 6.42
Rhizosphere 75.49
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10238890 3300009177 Bacteria 2045
2 JGI24750J21931_1028729 3300002070 Bacteria 808
3 JGI25406J46586_10167307 3300003203 Bacteria 641
4 JGI25153J46596_10001106 3300003215 Bacteria 16363
5 rootH1_10049394 3300003316 Bacteria 1424
6 rootL2_10062449 3300003322 Bacteria 1531
7 JGI25404J52841_10052368 3300003659 Bacteria 857
8 Ga0065704_10666121 3300005289 Bacteria 576
9 Ga0065707_10250855 3300005295 Bacteria 1112
10 Ga0070658_10247790 3300005327 Bacteria 1511
11 Ga0070658_10358392 3300005327 Bacteria 1249
12 Ga0070676_10246735 3300005328 Bacteria 1190
13 Ga0070676_10247677 3300005328 Bacteria 1188
14 Ga0070690_100418309 3300005330 Bacteria 988
15 Ga0070670_100206023 3300005331 Bacteria 1709
16 Ga0070670_100562681 3300005331 Bacteria 1018
17 Ga0070670_100592193 3300005331 Bacteria 992
18 Ga0068869_100102861 3300005334 Bacteria 2163
19 Ga0068869_100198829 3300005334 Bacteria 1579
20 Ga0068869_100298342 3300005334 Bacteria 1300
21 Ga0070680_100028149 3300005336 Bacteria 4507
22 Ga0070682_100163513 3300005337 Bacteria 1540
23 Ga0070682_100182044 3300005337 Bacteria 1469
24 Ga0070682_100876662 3300005337 Bacteria 735
25 Ga0070682_100932277 3300005337 Bacteria 716
26 Ga0070682_101746713 3300005337 Bacteria 541
27 Ga0068868_100007248 3300005338 Bacteria 7885
28 Ga0068868_100034333 3300005338 Bacteria 3915
29 Ga0068868_100281031 3300005338 Bacteria 1409
30 Ga0068868_101266019 3300005338 Bacteria 684
31 Ga0070660_101493385 3300005339 Bacteria 575
32 Ga0070687_100835132 3300005343 Bacteria 656
33 Ga0070661_100064797 3300005344 Bacteria 2686
34 Ga0070692_10167836 3300005345 Bacteria 1263
35 Ga0070668_100169745 3300005347 Bacteria 1775
36 Ga0070668_100667527 3300005347 Bacteria 914
37 Ga0070668_100740310 3300005347 Bacteria 869
38 Ga0070668_101129771 3300005347 Bacteria 708
39 Ga0070669_100054862 3300005353 Bacteria 2919
40 Ga0070669_100484947 3300005353 Bacteria 1023
41 Ga0070675_100298665 3300005354 Bacteria 1418
42 Ga0070675_101212564 3300005354 Bacteria 695
43 Ga0070671_100160036 3300005355 Bacteria 1903
44 Ga0070671_100200989 3300005355 Bacteria 1690
45 Ga0070671_101333228 3300005355 Bacteria 633
46 Ga0070671_101493719 3300005355 Bacteria 598
47 Ga0070674_100038183 3300005356 Bacteria 3234
48 Ga0070674_100595106 3300005356 Bacteria 934
49 Ga0070674_100822581 3300005356 Bacteria 804
50 Ga0070673_100600802 3300005364 Bacteria 1004
51 Ga0070673_100871453 3300005364 Bacteria 834
52 Ga0070688_100110288 3300005365 Bacteria 1829
53 Ga0070659_100013386 3300005366 Bacteria 6104
54 Ga0070659_100029963 3300005366 Bacteria 4208
55 Ga0070659_100120478 3300005366 Bacteria 2124
56 Ga0070659_101504332 3300005366 Bacteria 600
57 Ga0070667_100062286 3300005367 Bacteria 3159
58 Ga0070667_100082128 3300005367 Bacteria 2758
59 Ga0070667_100542178 3300005367 Bacteria 1069
60 Ga0070667_100576129 3300005367 Bacteria 1036
61 Ga0070667_100589692 3300005367 Bacteria 1023
62 Ga0070667_100634250 3300005367 Bacteria 986
63 Ga0070667_101078421 3300005367 Bacteria 750
64 Ga0070667_101906528 3300005367 Bacteria 559
65 Ga0070709_10087636 3300005434 Bacteria 2046
66 Ga0070713_100123239 3300005436 Bacteria 2276
67 Ga0070713_100194529 3300005436 Bacteria 1829
68 Ga0070713_101682353 3300005436 Bacteria 616
69 Ga0070701_10182076 3300005438 Bacteria 1231
70 Ga0070701_10443537 3300005438 Bacteria 832
71 Ga0070711_100833901 3300005439 Bacteria 784
72 Ga0070711_101402764 3300005439 Bacteria 608
73 Ga0070700_100083281 3300005441 Bacteria 2070
74 Ga0070700_100128523 3300005441 Bacteria 1707
75 Ga0070700_100331451 3300005441 Bacteria 1122
76 Ga0070700_100629094 3300005441 Bacteria 845
77 Ga0070700_101214542 3300005441 Bacteria 630
78 Ga0070694_100199793 3300005444 Bacteria 1490
79 Ga0070663_100031336 3300005455 Bacteria 3654
80 Ga0070663_100054677 3300005455 Bacteria 2854
81 Ga0070663_100054728 3300005455 Bacteria 2853
82 Ga0070663_100078560 3300005455 Bacteria 2419
83 Ga0070663_100102129 3300005455 Bacteria 2142
84 Ga0070663_100208976 3300005455 Bacteria 1527
85 Ga0070678_100016899 3300005456 Bacteria 4680
86 Ga0070678_100129344 3300005456 Bacteria 2004
87 Ga0070678_100135610 3300005456 Bacteria 1962
88 Ga0070678_100169375 3300005456 Bacteria 1777
89 Ga0070678_100336473 3300005456 Bacteria 1294
90 Ga0070678_100338181 3300005456 Bacteria 1291
91 Ga0070678_100405945 3300005456 Bacteria 1185
92 Ga0070678_100617267 3300005456 Bacteria 969
93 Ga0070678_100714384 3300005456 Bacteria 904
94 Ga0070662_100028974 3300005457 Bacteria 3859
95 Ga0070662_100115348 3300005457 Bacteria 2052
96 Ga0070662_100688005 3300005457 Bacteria 864
97 Ga0070662_100877026 3300005457 Bacteria 765
98 Ga0070681_10133684 3300005458 Bacteria 2412
99 Ga0068867_100060657 3300005459 Bacteria 2806
100 Ga0068867_101353192 3300005459 Bacteria 659
101 Ga0070685_10677491 3300005466 Bacteria 750
102 Ga0070698_100112992 3300005471 Bacteria 2681
103 Ga0070698_100725587 3300005471 Bacteria 936
104 Ga0070699_100083550 3300005518 Bacteria 2785
105 Ga0070679_100020404 3300005530 Bacteria 6461
106 Ga0070679_100083975 3300005530 Bacteria 3173
107 Ga0070684_100095276 3300005535 Bacteria 2652
108 Ga0070697_100077284 3300005536 Bacteria 2738
109 Ga0070697_101276538 3300005536 Bacteria 655
110 Ga0068853_100084664 3300005539 Bacteria 2778
111 Ga0068853_100508583 3300005539 Bacteria 1138
112 Ga0068853_100714044 3300005539 Bacteria 957
113 Ga0068853_100814082 3300005539 Bacteria 895
114 Ga0068853_101227004 3300005539 Bacteria 724
115 Ga0070672_100304521 3300005543 Bacteria 1352
116 Ga0070672_100519508 3300005543 Bacteria 1031
117 Ga0070672_100842846 3300005543 Bacteria 808
118 Ga0070686_100166509 3300005544 Bacteria 1556
119 Ga0070686_100195646 3300005544 Bacteria 1446
120 Ga0070686_100196558 3300005544 Bacteria 1443
121 Ga0070695_100269109 3300005545 Bacteria 1248
122 Ga0070696_100392060 3300005546 Bacteria 1084
123 Ga0070693_100052550 3300005547 Bacteria 2336
124 Ga0070693_100128856 3300005547 Bacteria 1579
125 Ga0070665_100052300 3300005548 Bacteria 4097
126 Ga0070665_100160319 3300005548 Bacteria 2251
127 Ga0070665_100312102 3300005548 Bacteria 1576
128 Ga0070665_100382771 3300005548 Bacteria 1414
129 Ga0068855_100017635 3300005563 Bacteria 8585
130 Ga0068855_100029614 3300005563 Bacteria 6543
131 Ga0068855_100277159 3300005563 Bacteria 1863
132 Ga0068855_100429279 3300005563 Bacteria 1445
133 Ga0068855_100438123 3300005563 Bacteria 1428
134 Ga0068855_100629848 3300005563 Bacteria 1154
135 Ga0068855_100703755 3300005563 Bacteria 1081
136 Ga0070664_100932192 3300005564 Bacteria 815
137 Ga0070664_100936596 3300005564 Bacteria 813
138 Ga0070664_101795669 3300005564 Bacteria 582
139 Ga0068857_100054957 3300005577 Bacteria 3534
140 Ga0068857_100758475 3300005577 Bacteria 925
141 Ga0068854_100117469 3300005578 Bacteria 2014
142 Ga0068854_100613413 3300005578 Bacteria 930
143 Ga0068856_100044548 3300005614 Bacteria 4366
144 Ga0068856_100050315 3300005614 Bacteria 4108
145 Ga0068856_100153965 3300005614 Bacteria 2309
146 Ga0068856_100396542 3300005614 Bacteria 1400
147 Ga0068856_101834432 3300005614 Unclassified 618
148 Ga0070702_100032858 3300005615 Bacteria 2850
149 Ga0068852_100056294 3300005616 Bacteria 3398
150 Ga0068852_100112587 3300005616 Bacteria 2477
151 Ga0068852_100130524 3300005616 Bacteria 2313
152 Ga0068852_100140996 3300005616 Bacteria 2231
153 Ga0068852_100312903 3300005616 Bacteria 1523
154 Ga0068859_100226342 3300005617 Bacteria 1958
155 Ga0068859_100395407 3300005617 Bacteria 1478
156 Ga0068859_100404271 3300005617 Bacteria 1461
157 Ga0068864_100025302 3300005618 Bacteria 4998
158 Ga0068864_100080894 3300005618 Bacteria 2847
159 Ga0068866_10040005 3300005718 Bacteria 2318
160 Ga0068866_10043942 3300005718 Bacteria 2233
161 Ga0068866_10242586 3300005718 Bacteria 1098
162 Ga0068866_10949598 3300005718 Bacteria 608
163 Ga0068861_100057452 3300005719 Bacteria 2972
164 Ga0068861_100060580 3300005719 Bacteria 2901
165 Ga0068861_100081324 3300005719 Bacteria 2536
166 Ga0068861_100201859 3300005719 Bacteria 1669
167 Ga0068861_101168821 3300005719 Bacteria 743
168 Ga0068851_10244456 3300005834 Bacteria 1016
169 Ga0068870_10115913 3300005840 Bacteria 1536
170 Ga0068863_100285834 3300005841 Bacteria 1598
171 Ga0068863_100317508 3300005841 Bacteria 1513
172 Ga0068863_100652672 3300005841 Bacteria 1043
173 Ga0068863_100727088 3300005841 Bacteria 988
174 Ga0068858_100121056 3300005842 Bacteria 2447
175 Ga0068858_100177260 3300005842 Bacteria 2012
176 Ga0068858_100618255 3300005842 Bacteria 1052
177 Ga0068860_100000058 3300005843 Bacteria 197181
178 Ga0068860_100251166 3300005843 Bacteria 1722
179 Ga0068862_100053834 3300005844 Bacteria 3445
180 Ga0068862_100106659 3300005844 Bacteria 2456
181 Ga0068862_100140583 3300005844 Bacteria 2142
182 Ga0068862_100253886 3300005844 Bacteria 1603
183 Ga0068862_100365200 3300005844 Bacteria 1342
184 Ga0068862_100437267 3300005844 Bacteria 1231
185 Ga0068862_100466778 3300005844 Bacteria 1192
186 Ga0068862_100818592 3300005844 Bacteria 910
187 Ga0081455_10002419 3300005937 Bacteria 22263
188 Ga0081455_10097911 3300005937 Bacteria 2363
189 Ga0081538_10124731 3300005981 Bacteria 1228
190 Ga0081540_1002092 3300005983 Bacteria 16629
191 Ga0081540_1004102 3300005983 Bacteria 11245
192 Ga0081540_1009301 3300005983 Bacteria 6780
193 Ga0081540_1016640 3300005983 Bacteria 4591
194 Ga0081539_10026414 3300005985 Bacteria 3705
195 Ga0070717_10005335 3300006028 Bacteria 9370
196 Ga0070717_11513364 3300006028 Bacteria 609
197 Ga0075365_10005918 3300006038 Bacteria 6658
198 Ga0075365_10033942 3300006038 Bacteria 3292
199 Ga0075365_10096308 3300006038 Bacteria 2022
200 Ga0075365_10322223 3300006038 Bacteria 1088
201 Ga0075365_10417989 3300006038 Bacteria 947
202 Ga0075368_10050537 3300006042 Bacteria 1652
203 Ga0075368_10142947 3300006042 Bacteria 998
204 Ga0075368_10261632 3300006042 Bacteria 741
205 Ga0075363_100010147 3300006048 Bacteria 4455
206 Ga0075363_100039459 3300006048 Bacteria 2485
207 Ga0075363_100138720 3300006048 Bacteria 1368
208 Ga0075363_100162658 3300006048 Bacteria 1264
209 Ga0075363_100197272 3300006048 Bacteria 1149
210 Ga0075364_10064370 3300006051 Bacteria 2407
211 Ga0075364_10590878 3300006051 Bacteria 759
212 Ga0070715_10110516 3300006163 Bacteria 1296
213 Ga0070716_100127732 3300006173 Bacteria 1602
214 Ga0070716_100822414 3300006173 Bacteria 721
215 Ga0070712_100048117 3300006175 Bacteria 2955
216 Ga0075362_10038981 3300006177 Bacteria 2087
217 Ga0075362_10132718 3300006177 Bacteria 1186
218 Ga0075362_10199527 3300006177 Bacteria 974
219 Ga0075362_10349812 3300006177 Bacteria 739
220 Ga0075367_10067366 3300006178 Bacteria 2146
221 Ga0075367_10070568 3300006178 Bacteria 2100
222 Ga0075367_10079229 3300006178 Bacteria 1985
223 Ga0075367_10144432 3300006178 Bacteria 1475
224 Ga0075367_10237094 3300006178 Bacteria 1143
225 Ga0075369_10015050 3300006186 Bacteria 3099
226 Ga0075369_10112709 3300006186 Bacteria 1226
227 Ga0075369_10180704 3300006186 Bacteria 971
228 Ga0075366_10114713 3300006195 Bacteria 1622
229 Ga0075366_10130334 3300006195 Bacteria 1517
230 Ga0075366_10230488 3300006195 Bacteria 1128
231 Ga0075366_10240040 3300006195 Bacteria 1105
232 Ga0075366_10287195 3300006195 Bacteria 1006
233 Ga0097621_100083061 3300006237 Bacteria 2668
234 Ga0097621_100194605 3300006237 Bacteria 1757
235 Ga0097621_100406302 3300006237 Bacteria 1220
236 Ga0097621_101410444 3300006237 Bacteria 660
237 Ga0075370_10017192 3300006353 Bacteria 3904
238 Ga0075370_10119300 3300006353 Bacteria 1535
239 Ga0075370_10287608 3300006353 Bacteria 977
240 Ga0068871_100339866 3300006358 Bacteria 1325
241 Ga0068871_100372787 3300006358 Bacteria 1266
242 Ga0068871_100582597 3300006358 Bacteria 1016
243 Ga0068871_101010930 3300006358 Bacteria 775
244 Ga0075428_100174800 3300006844 Bacteria 2326
245 Ga0075434_100931220 3300006871 Bacteria 883
246 Ga0068865_100054115 3300006881 Bacteria 2787
247 Ga0068865_100111722 3300006881 Bacteria 2017
248 Ga0068865_100198421 3300006881 Bacteria 1556
249 Ga0097620_100226341 3300006931 Bacteria 1958
250 Ga0097620_100395360 3300006931 Bacteria 1478
251 Ga0097620_100404287 3300006931 Bacteria 1461
252 Ga0099795_10005197 3300007788 Bacteria 3438
253 Ga0099795_10131623 3300007788 Bacteria 1010
254 Ga0099795_10216224 3300007788 Bacteria 814
255 Ga0105251_10267285 3300009011 Bacteria 772
256 Ga0105240_10050611 3300009093 Bacteria 5236
257 Ga0105240_10567872 3300009093 Bacteria 1253
258 Ga0105245_10356075 3300009098 Bacteria 1451
259 Ga0105245_10709834 3300009098 Bacteria 1039
260 Ga0105245_10803915 3300009098 Bacteria 978
261 Ga0105245_11405919 3300009098 Bacteria 748
262 Ga0105247_10016251 3300009101 Bacteria 4458
263 Ga0105247_10036592 3300009101 Bacteria 2992
264 Ga0105247_10271868 3300009101 Bacteria 1166
265 Ga0105247_10491980 3300009101 Bacteria 892
266 Ga0105247_11351934 3300009101 Bacteria 574
267 Ga0114129_10064849 3300009147 Bacteria 5098
268 Ga0105243_10324591 3300009148 Bacteria 1404
269 Ga0105243_10427228 3300009148 Bacteria 1237
270 Ga0105241_10041152 3300009174 Bacteria 3490
271 Ga0105241_10099499 3300009174 Bacteria 2309
272 Ga0105242_10402070 3300009176 Bacteria 1278
273 Ga0105248_10033538 3300009177 Bacteria 5736
274 Ga0105248_10223621 3300009177 Bacteria 2119
275 Ga0105248_10478146 3300009177 Bacteria 1404
276 Ga0105248_11467355 3300009177 Bacteria 772
277 Ga0105237_10090818 3300009545 Bacteria 3043
278 Ga0105237_10250559 3300009545 Bacteria 1773
279 Ga0105237_10318388 3300009545 Bacteria 1559
280 Ga0105237_10475461 3300009545 Bacteria 1256
281 Ga0105237_10587200 3300009545 Bacteria 1121
282 Ga0105237_11061828 3300009545 Bacteria 817
283 Ga0105237_11104506 3300009545 Bacteria 800
284 Ga0105238_10205293 3300009551 Bacteria 1946
285 Ga0105238_10297161 3300009551 Bacteria 1598
286 Ga0105238_10650285 3300009551 Bacteria 1064
287 Ga0105238_11123670 3300009551 Bacteria 809
288 Ga0105249_10237127 3300009553 Bacteria 1802
289 Ga0105249_10241385 3300009553 Bacteria 1786
290 Ga0105249_10278071 3300009553 Bacteria 1670
291 Ga0105249_10584526 3300009553 Bacteria 1170
292 Ga0105249_11301589 3300009553 Bacteria 798
293 Ga0105249_11793807 3300009553 Bacteria 686
294 Ga0099796_10016836 3300010159 Bacteria 2166
295 Ga0099796_10017000 3300010159 Bacteria 2158
296 Ga0099796_10046732 3300010159 Bacteria 1487
297 Ga0099796_10161181 3300010159 Bacteria 889
298 Ga0099796_10267336 3300010159 Bacteria 715
299 Ga0105239_10272943 3300010375 Bacteria 1902
300 Ga0105239_10440714 3300010375 Bacteria 1477
301 Ga0105239_10518013 3300010375 Bacteria 1357
302 Ga0105239_10528120 3300010375 Bacteria 1343
303 Ga0105246_10096777 3300011119 Bacteria 2140
304 Ga0105246_10170406 3300011119 Bacteria 1667
305 Ga0105246_10207518 3300011119 Bacteria 1527
306 Ga0105246_10379792 3300011119 Bacteria 1167
307 Ga0105246_10451735 3300011119 Bacteria 1080
308 Ga0105246_10642111 3300011119 Bacteria 923
309 Ga0157315_1017804 3300012508 Bacteria 719
310 Ga0157373_10161499 3300013100 Bacteria 1576
311 Ga0157373_10318242 3300013100 Bacteria 1106
312 Ga0157371_10103344 3300013102 Bacteria 2022
313 Ga0157371_10663113 3300013102 Bacteria 779
314 Ga0157370_10083279 3300013104 Bacteria 3008
315 Ga0157370_10162333 3300013104 Bacteria 2079
316 Ga0157370_11245970 3300013104 Bacteria 671
317 Ga0157369_10609199 3300013105 Bacteria 1127
318 Ga0157369_10712082 3300013105 Bacteria 1034
319 Ga0157374_10636559 3300013296 Bacteria 1078
320 Ga0157374_12207020 3300013296 Bacteria 578
321 Ga0157374_12260717 3300013296 Bacteria 571
322 Ga0157378_10052830 3300013297 Bacteria 3615
323 Ga0157378_10397007 3300013297 Bacteria 1358
324 Ga0163162_10003676 3300013306 Bacteria 14707
325 Ga0163162_10635262 3300013306 Bacteria 1192
326 Ga0163162_10684744 3300013306 Bacteria 1148
327 Ga0163162_10920615 3300013306 Bacteria 986
328 Ga0163162_11196669 3300013306 Bacteria 862
329 Ga0157372_10221124 3300013307 Bacteria 2195
330 Ga0157372_10688229 3300013307 Bacteria 1190
331 Ga0157375_10581822 3300013308 Bacteria 1280
332 Ga0157375_10806841 3300013308 Bacteria 1087
333 Ga0157375_12720541 3300013308 Bacteria 591
334 Ga0163163_10274800 3300014325 Bacteria 1736
335 Ga0163163_10381819 3300014325 Bacteria 1466
336 Ga0163163_10494780 3300014325 Bacteria 1284
337 Ga0163163_12233145 3300014325 Bacteria 606
338 Ga0157380_10571212 3300014326 Bacteria 1113
339 Ga0157380_10659933 3300014326 Bacteria 1045
340 Ga0157380_11171104 3300014326 Bacteria 811
341 Ga0157380_11713979 3300014326 Bacteria 686
342 Ga0157379_10075745 3300014968 Bacteria 3013
343 Ga0157379_10085223 3300014968 Bacteria 2831
344 Ga0157379_10554598 3300014968 Bacteria 1069
345 Ga0157379_10620189 3300014968 Bacteria 1011
346 Ga0157379_11217209 3300014968 Bacteria 725
347 Ga0157376_10013748 3300014969 Bacteria 6052
348 Ga0157376_10437417 3300014969 Bacteria 1273
349 Ga0157376_10627328 3300014969 Bacteria 1073
350 Ga0157376_10895874 3300014969 Bacteria 905
351 Ga0163161_10012760 3300017792 Bacteria 5836
352 Ga0163161_10219488 3300017792 Bacteria 1472
353 Ga0163161_10850982 3300017792 Bacteria 770
354 Ga0213874_10014179 3300021377 Bacteria 2079
355 Ga0213874_10177991 3300021377 Bacteria 755
356 Ga0209026_1015260 3300025250 Bacteria 1265
357 Ga0209758_1032872 3300025297 Bacteria 2097
358 Ga0207697_10090582 3300025315 Bacteria 1296
359 Ga0207656_10243163 3300025321 Bacteria 880
360 Ga0207682_10236688 3300025893 Bacteria 848
361 Ga0207682_10266242 3300025893 Bacteria 800
362 Ga0207692_10293747 3300025898 Bacteria 987
363 Ga0207642_10193472 3300025899 Bacteria 1118
364 Ga0207642_10196391 3300025899 Bacteria 1111
365 Ga0207642_10383017 3300025899 Bacteria 837
366 Ga0207710_10030090 3300025900 Bacteria 2366
367 Ga0207710_10040008 3300025900 Bacteria 2077
368 Ga0207710_10167797 3300025900 Bacteria 1072
369 Ga0207710_10253517 3300025900 Bacteria 880
370 Ga0207688_10037109 3300025901 Bacteria 2702
371 Ga0207688_10457381 3300025901 Bacteria 796
372 Ga0207680_10074752 3300025903 Bacteria 2111
373 Ga0207680_10774173 3300025903 Bacteria 688
374 Ga0207647_10052558 3300025904 Bacteria 2515
375 Ga0207685_10166861 3300025905 Bacteria 1010
376 Ga0207699_10034310 3300025906 Bacteria 2877
377 Ga0207645_10104054 3300025907 Bacteria 1833
378 Ga0207645_10524651 3300025907 Bacteria 803
379 Ga0207645_10567032 3300025907 Bacteria 770
380 Ga0207643_10037354 3300025908 Bacteria 2725
381 Ga0207643_10048012 3300025908 Bacteria 2417
382 Ga0207705_10128371 3300025909 Bacteria 1885
383 Ga0207705_10137452 3300025909 Bacteria 1823
384 Ga0207684_11286903 3300025910 Bacteria 602
385 Ga0207654_10011369 3300025911 Bacteria 4542
386 Ga0207654_10208786 3300025911 Bacteria 1289
387 Ga0207707_10154844 3300025912 Bacteria 2004
388 Ga0207707_10155477 3300025912 Bacteria 2000
389 Ga0207695_10341192 3300025913 Bacteria 1386
390 Ga0207695_10399936 3300025913 Bacteria 1258
391 Ga0207671_10078202 3300025914 Bacteria 2477
392 Ga0207671_10156675 3300025914 Bacteria 1762
393 Ga0207671_10158726 3300025914 Bacteria 1750
394 Ga0207671_10787196 3300025914 Bacteria 755
395 Ga0207693_10022609 3300025915 Bacteria 4995
396 Ga0207693_10029036 3300025915 Bacteria 4371
397 Ga0207693_10096969 3300025915 Bacteria 2312
398 Ga0207663_10566172 3300025916 Bacteria 890
399 Ga0207663_10647604 3300025916 Bacteria 834
400 Ga0207663_11491768 3300025916 Bacteria 544
401 Ga0207660_10027655 3300025917 Bacteria 3873
402 Ga0207660_10158654 3300025917 Bacteria 1743
403 Ga0207660_10350779 3300025917 Bacteria 1183
404 Ga0207657_10007732 3300025919 Bacteria 10976
405 Ga0207657_10135694 3300025919 Bacteria 2014
406 Ga0207657_10705319 3300025919 Bacteria 783
407 Ga0207657_10975191 3300025919 Bacteria 651
408 Ga0207649_10071248 3300025920 Bacteria 2219
409 Ga0207649_10499447 3300025920 Bacteria 925
410 Ga0207652_10071088 3300025921 Bacteria 3023
411 Ga0207652_10278639 3300025921 Bacteria 1508
412 Ga0207681_10509590 3300025923 Bacteria 986
413 Ga0207681_10849328 3300025923 Bacteria 763
414 Ga0207694_10310874 3300025924 Bacteria 1299
415 Ga0207694_10587206 3300025924 Bacteria 936
416 Ga0207694_10830651 3300025924 Bacteria 781
417 Ga0207650_10699033 3300025925 Bacteria 856
418 Ga0207659_10091363 3300025926 Bacteria 2274
419 Ga0207659_10276610 3300025926 Bacteria 1371
420 Ga0207659_11071959 3300025926 Bacteria 693
421 Ga0207687_10031494 3300025927 Bacteria 3585
422 Ga0207687_10620980 3300025927 Bacteria 912
423 Ga0207700_10031958 3300025928 Bacteria 3747
424 Ga0207644_10242514 3300025931 Bacteria 1435
425 Ga0207644_10369151 3300025931 Bacteria 1169
426 Ga0207690_10025604 3300025932 Bacteria 3707
427 Ga0207690_10153233 3300025932 Bacteria 1710
428 Ga0207690_10827888 3300025932 Bacteria 766
429 Ga0207706_10069272 3300025933 Bacteria 3103
430 Ga0207706_10091791 3300025933 Bacteria 2670
431 Ga0207706_10303480 3300025933 Bacteria 1391
432 Ga0207706_10767624 3300025933 Bacteria 821
433 Ga0207706_10845433 3300025933 Bacteria 775
434 Ga0207686_10191222 3300025934 Bacteria 1459
435 Ga0207686_10691787 3300025934 Bacteria 810
436 Ga0207709_10047871 3300025935 Bacteria 2602
437 Ga0207709_10282676 3300025935 Bacteria 1226
438 Ga0207669_10149924 3300025937 Bacteria 1632
439 Ga0207669_10356105 3300025937 Bacteria 1132
440 Ga0207669_10393449 3300025937 Bacteria 1083
441 Ga0207669_10431840 3300025937 Bacteria 1039
442 Ga0207669_10443621 3300025937 Bacteria 1027
443 Ga0207669_10594559 3300025937 Bacteria 898
444 Ga0207704_10131490 3300025938 Bacteria 1734
445 Ga0207704_10569802 3300025938 Bacteria 923
446 Ga0207704_11659438 3300025938 Bacteria 549
447 Ga0207665_10240753 3300025939 Bacteria 1333
448 Ga0207665_10574923 3300025939 Bacteria 878
449 Ga0207691_10215676 3300025940 Bacteria 1665
450 Ga0207691_10373085 3300025940 Bacteria 1219
451 Ga0207691_10445410 3300025940 Bacteria 1102
452 Ga0207711_10032973 3300025941 Bacteria 4380
453 Ga0207711_10135139 3300025941 Bacteria 2214
454 Ga0207711_10547306 3300025941 Bacteria 1079
455 Ga0207711_10841788 3300025941 Bacteria 854
456 Ga0207711_11454386 3300025941 Bacteria 628
457 Ga0207689_10016101 3300025942 Bacteria 6329
458 Ga0207689_10150749 3300025942 Bacteria 1916
459 Ga0207689_10514696 3300025942 Bacteria 1003
460 Ga0207661_10056472 3300025944 Bacteria 3152
461 Ga0207679_10103264 3300025945 Bacteria 2234
462 Ga0207667_10124426 3300025949 Bacteria 2656
463 Ga0207667_10602403 3300025949 Bacteria 1108
464 Ga0207667_10705428 3300025949 Bacteria 1011
465 Ga0207651_10920981 3300025960 Bacteria 779
466 Ga0207712_10061492 3300025961 Bacteria 2666
467 Ga0207712_10143860 3300025961 Bacteria 1833
468 Ga0207712_10302748 3300025961 Bacteria 1313
469 Ga0207712_10355405 3300025961 Bacteria 1219
470 Ga0207712_10409719 3300025961 Bacteria 1141
471 Ga0207668_10014887 3300025972 Bacteria 4822
472 Ga0207668_10060845 3300025972 Bacteria 2652
473 Ga0207668_10083922 3300025972 Bacteria 2319
474 Ga0207668_10212704 3300025972 Bacteria 1547
475 Ga0207668_10325700 3300025972 Bacteria 1276
476 Ga0207668_10608455 3300025972 Bacteria 952
477 Ga0207640_10016462 3300025981 Bacteria 4301
478 Ga0207640_10108236 3300025981 Bacteria 1964
479 Ga0207658_10075699 3300025986 Bacteria 2562
480 Ga0207658_10565004 3300025986 Bacteria 1019
481 Ga0207658_10729787 3300025986 Bacteria 896
482 Ga0207658_11069225 3300025986 Bacteria 737
483 Ga0207677_10175882 3300026023 Bacteria 1679
484 Ga0207677_10383062 3300026023 Bacteria 1188
485 Ga0207677_10562528 3300026023 Bacteria 995
486 Ga0207677_10590228 3300026023 Bacteria 974
487 Ga0207677_11181017 3300026023 Bacteria 700
488 Ga0207703_10025797 3300026035 Bacteria 4625
489 Ga0207703_10884165 3300026035 Bacteria 855
490 Ga0207639_10306886 3300026041 Bacteria 1405
491 Ga0207639_10308315 3300026041 Bacteria 1401
492 Ga0207639_10482044 3300026041 Bacteria 1130
493 Ga0207639_10503831 3300026041 Bacteria 1107
494 Ga0207678_10019509 3300026067 Bacteria 5957
495 Ga0207678_10026492 3300026067 Bacteria 5057
496 Ga0207678_10028300 3300026067 Bacteria 4893
497 Ga0207678_10037339 3300026067 Bacteria 4225
498 Ga0207678_10113723 3300026067 Bacteria 2309
499 Ga0207678_10253830 3300026067 Bacteria 1506
500 Ga0207678_10366204 3300026067 Bacteria 1244
501 Ga0207708_10044451 3300026075 Bacteria 3384
502 Ga0207708_10531347 3300026075 Bacteria 989
503 Ga0207708_10840917 3300026075 Bacteria 792
504 Ga0207702_10089626 3300026078 Bacteria 2690
505 Ga0207702_10666186 3300026078 Bacteria 1024
506 Ga0207702_11000885 3300026078 Bacteria 829
507 Ga0207641_10567305 3300026088 Bacteria 1108
508 Ga0207641_10570643 3300026088 Bacteria 1105
509 Ga0207648_10016066 3300026089 Bacteria 6858
510 Ga0207648_10464869 3300026089 Bacteria 1154
511 Ga0207648_10915692 3300026089 Bacteria 819
512 Ga0207676_10689546 3300026095 Bacteria 989
513 Ga0207676_12123471 3300026095 Bacteria 560
514 Ga0207676_12436706 3300026095 Bacteria 520
515 Ga0207674_10004659 3300026116 Bacteria 16461
516 Ga0207674_10165973 3300026116 Bacteria 2162
517 Ga0207675_100018787 3300026118 Bacteria 6450
518 Ga0207675_100262760 3300026118 Bacteria 1673
519 Ga0207675_100291447 3300026118 Bacteria 1588
520 Ga0207675_100462680 3300026118 Bacteria 1258
521 Ga0207675_100639498 3300026118 Bacteria 1069
522 Ga0207675_100820892 3300026118 Bacteria 944
523 Ga0207683_10016292 3300026121 Bacteria 6326
524 Ga0207683_10082790 3300026121 Bacteria 2851
525 Ga0207683_10083791 3300026121 Bacteria 2833
526 Ga0207683_10096169 3300026121 Bacteria 2641
527 Ga0207683_10328129 3300026121 Bacteria 1402
528 Ga0207683_10670631 3300026121 Bacteria 961
529 Ga0207698_10069860 3300026142 Bacteria 2780
530 Ga0207698_10504412 3300026142 Bacteria 1178
531 Ga0207698_10966652 3300026142 Bacteria 861
532 Ga0209179_1009134 3300027512 Bacteria 1690
533 Ga0209179_1035329 3300027512 Bacteria 1038
534 Ga0209813_10088416 3300027866 Bacteria 1036
535 Ga0207428_10344633 3300027907 Bacteria 1097
536 Ga0268266_10002475 3300028379 Bacteria 19733
537 Ga0268266_10004442 3300028379 Bacteria 13419
538 Ga0268266_10126879 3300028379 Bacteria 2278
539 Ga0268266_10209865 3300028379 Bacteria 1785
540 Ga0268266_10361320 3300028379 Bacteria 1366
541 Ga0268266_10429418 3300028379 Bacteria 1253
542 Ga0268266_10955735 3300028379 Bacteria 829
543 Ga0268265_10094178 3300028380 Bacteria 2401
544 Ga0268265_10129487 3300028380 Bacteria 2094
545 Ga0268265_10205650 3300028380 Bacteria 1711
546 Ga0268265_10280937 3300028380 Bacteria 1489
547 Ga0268265_10328264 3300028380 Bacteria 1388
548 Ga0268265_11001553 3300028380 Bacteria 825
549 Ga0268264_10000022 3300028381 Bacteria 476624
550 Ga0268264_11452154 3300028381 Bacteria 696
551 Ga0268264_11642585 3300028381 Bacteria 653
552 Ga0265334_10039005 3300028573 Bacteria 1865
553 Ga0307517_10436195 3300028786 Bacteria 683
554 Ga0307515_10007547 3300028794 Bacteria 21484
555 Ga0307515_10190719 3300028794 Bacteria 1961
556 Ga0307515_10629270 3300028794 Bacteria 685
557 Ga0307511_10026276 3300030521 Bacteria 5344
558 Ga0307511_10056903 3300030521 Bacteria 3049
559 Ga0307512_10272233 3300030522 Bacteria 819
560 Ga0265330_10015725 3300031235 Bacteria 3498
561 Ga0265330_10466232 3300031235 Bacteria 536
562 Ga0265332_10029159 3300031238 Bacteria 2414
563 Ga0265339_10210650 3300031249 Bacteria 955
564 Ga0307513_10166927 3300031456 Bacteria 2084
565 Ga0307513_10412663 3300031456 Bacteria 1082
566 Ga0307513_10639897 3300031456 Bacteria 771
567 Ga0307509_10075236 3300031507 Bacteria 3508
568 Ga0307509_10111062 3300031507 Bacteria 2745
569 Ga0307408_100465966 3300031548 Bacteria 1099
570 Ga0307508_10000009 3300031616 Bacteria 256966
571 Ga0307508_10047463 3300031616 Bacteria 3830
572 Ga0307508_10226454 3300031616 Bacteria 1469
573 Ga0307508_10447711 3300031616 Bacteria 884
574 Ga0307508_10586964 3300031616 Bacteria 715
575 Ga0307516_10058764 3300031730 Bacteria 3741
576 Ga0307516_10087356 3300031730 Bacteria 2953
577 Ga0307516_10101855 3300031730 Bacteria 2687
578 Ga0307516_10254800 3300031730 Bacteria 1448
579 Ga0307516_10379955 3300031730 Bacteria 1074
580 Ga0307516_10579252 3300031730 Bacteria 776
581 Ga0307413_11228058 3300031824 Bacteria 653
582 Ga0307410_10273312 3300031852 Bacteria 1323
583 Ga0307410_10436164 3300031852 Bacteria 1066
584 Ga0307406_10422848 3300031901 Bacteria 1062
585 Ga0307406_10679988 3300031901 Bacteria 857
586 Ga0307412_11044861 3300031911 Bacteria 724
587 Ga0307409_101161344 3300031995 Bacteria 795
588 Ga0307409_101208319 3300031995 Bacteria 779
589 Ga0307416_100371409 3300032002 Bacteria 1456
590 Ga0307416_103072376 3300032002 Bacteria 558
591 Ga0307414_11126070 3300032004 Bacteria 725
592 Ga0307414_11380891 3300032004 Bacteria 654
593 Ga0307411_10480109 3300032005 Bacteria 1046
594 Ga0307411_10514787 3300032005 Bacteria 1014
595 Ga0307415_100044407 3300032126 Bacteria 2971
596 Ga0307415_100107062 3300032126 Bacteria 2065
597 Ga0307415_100139109 3300032126 Bacteria 1851
598 Ga0307415_101357453 3300032126 Bacteria 675
599 Ga0307507_10188130 3300033179 Bacteria 1458
600 Ga0307510_10041082 3300033180 Bacteria 5064
601 Ga0373934_0017581 3300035086 Bacteria 2731
602 Ga0373951_0049666 3300035091 Bacteria 1030
603 Ga0373923_0002332 3300035111 Bacteria 5818
604 Ga0373923_0275279 3300035111 Bacteria 792
605 Ga0373936_0011675 3300035113 Bacteria 3331
606 Ga0373936_0026082 3300035113 Bacteria 2288
607 Ga0373936_0042885 3300035113 Bacteria 1817
608 Ga0373936_0211681 3300035113 Bacteria 858
609 Ga0373939_0079359 3300035114 Bacteria 1087
610 Ga0373953_0000473 3300035117 Bacteria 11091
611 Ga0373954_0000442 3300035118 Bacteria 15520
612 Ga0373954_0010918 3300035118 Bacteria 4015
613 Ga0373954_0386505 3300035118 Bacteria 692
614 Ga0373956_0001159 3300035119 Bacteria 10897
615 Ga0373956_0058457 3300035119 Bacteria 1743
616 Ga0373957_0000837 3300035120 Bacteria 8045
617 Ga0373957_0082576 3300035120 Bacteria 1270
618 Ga0373943_0006178 3300035170 Bacteria 5377
619 Ga0373943_0469653 3300035170 Bacteria 733
620 Ga0373946_0007625 3300035171 Bacteria 3963
621 Ga0373955_0000840 3300035172 Bacteria 13157
622 Ga0373955_0019884 3300035172 Bacteria 3366
623 Ga0373955_0111431 3300035172 Bacteria 1582
624 Ga0373955_1008664 3300035172 Bacteria 513
625 Ga0373962_0045346 3300035242 Bacteria 1252
626 Ga0373931_0015131 3300035691 Bacteria 3780
627 Ga0373935_0001167 3300035692 Bacteria 14418
628 Ga0373935_0130812 3300035692 Bacteria 1686
629 Ga0373927_0001744 3300035695 Bacteria 16246
630 Ga0373927_0010992 3300035695 Bacteria 6028
631 Ga0373927_0319500 3300035695 Bacteria 1022
632 Ga0373933_0012552 3300035724 Bacteria 4681
633 Ga0373933_0214946 3300035724 Bacteria 1232
634 Ga0373933_0543972 3300035724 Bacteria 762
635 Ga0373947_0005344 3300035725 Bacteria 7496
636 Ga0373947_0265277 3300035725 Bacteria 1139
637 Ga0373937_0014572 3300036401 Bacteria 6943
638 Ga0373937_0330973 3300036401 Bacteria 1441
639 Ga0373937_0751771 3300036401 Bacteria 922
640 Ga0373925_0013749 3300037068 Bacteria 5858
641 Ga0373925_0188035 3300037068 Bacteria 1638
642 Ga0373925_0795689 3300037068 Bacteria 780
643 Ga0395900_0071894 3300037418 Bacteria 3557
644 Ga0395898_0333137 3300037466 Bacteria 1447
645 Ga0436365_0157279 3300039437 Bacteria 2553
646 Ga0436360_1070790 3300039438 Bacteria 1921
647 Ga0436361_0402017 3300039447 Bacteria 697
648 Ga0436363_0312883 3300039450 Bacteria 1780
649 Ga0436363_0872365 3300039450 Bacteria 2693
650 Ga0451791_0639961 3300041451 Bacteria 1286
651 Ga0451793_0200984 3300041452 Bacteria 844
652 Ga0451797_0987490 3300041453 Bacteria 843
653 Ga0451795_0725544 3300041456 Bacteria 863
654 Ga0451800_1010296 3300041459 Bacteria 808
655 Ga0451802_1555424 3300041460 Bacteria 1127
656 Ga0451807_0582585 3300041486 Bacteria 1010
657 Ga0451855_1946904 3300041511 Bacteria 1040
658 Ga0466957_0388110 3300044842 Bacteria 953
659 Ga0466967_0110502 3300045976 Bacteria 2525
660 Ga0495617_003836 3300046452 Bacteria 5545
661 Ga0495592_0020075 3300046454 Bacteria 5080
662 Ga0495592_0028166 3300046454 Bacteria 4256
663 Ga0495592_0139266 3300046454 Bacteria 1689
664 Ga0495603_0003551 3300046455 Bacteria 9285
665 Ga0495603_0008022 3300046455 Bacteria 6375
666 Ga0495603_0114512 3300046455 Bacteria 1572
667 Ga0495590_0066570 3300046457 Bacteria 1261
668 Ga0495629_0008864 3300046459 Bacteria 7396
669 Ga0495629_0515483 3300046459 Bacteria 805
670 Ga0495638_0097415 3300046460 Bacteria 1763
671 Ga0495641_0011704 3300046461 Bacteria 4968
672 Ga0495651_0026680 3300046462 Bacteria 4498
673 Ga0495651_0186619 3300046462 Bacteria 1463
674 Ga0495651_0310249 3300046462 Bacteria 1055
675 Ga0495653_0035279 3300046463 Bacteria 3948
676 Ga0495653_0187734 3300046463 Bacteria 1413
677 Ga0495580_0009095 3300046472 Bacteria 7834
678 Ga0495582_0000739 3300046473 Bacteria 18050
679 Ga0495582_0158839 3300046473 Bacteria 1285
680 Ga0495605_0110145 3300046474 Bacteria 1257
681 Ga0495605_0119536 3300046474 Bacteria 1195
682 Ga0495639_0003522 3300046475 Bacteria 6758
683 Ga0495639_0262691 3300046475 Bacteria 855
684 Ga0495662_0000437 3300046476 Bacteria 18723
685 Ga0495662_0137983 3300046476 Bacteria 1200
686 Ga0495664_0130686 3300046477 Bacteria 1520
687 Ga0495664_0732720 3300046477 Bacteria 583
688 Ga0495584_0129036 3300046491 Bacteria 1282
689 Ga0495584_0310847 3300046491 Bacteria 800
690 Ga0495585_0268401 3300046492 Bacteria 846
691 Ga0495585_0383548 3300046492 Bacteria 679
692 Ga0495594_0013772 3300046499 Bacteria 4226
693 Ga0495594_0038684 3300046499 Bacteria 2606
694 Ga0495594_0307169 3300046499 Bacteria 904
695 Ga0495606_0194227 3300046507 Bacteria 1161
696 Ga0495606_0295052 3300046507 Bacteria 881
697 Ga0495606_0301711 3300046507 Bacteria 868
698 Ga0495608_0005163 3300046511 Bacteria 9327
699 Ga0495608_0407807 3300046511 Bacteria 830
700 Ga0495608_0589439 3300046511 Bacteria 668
701 Ga0495618_0055282 3300046514 Bacteria 2513
702 Ga0495618_0082750 3300046514 Bacteria 2050
703 Ga0495620_0081714 3300046515 Bacteria 1306
704 Ga0495620_0269477 3300046515 Bacteria 648
705 Ga0495628_0027929 3300046516 Bacteria 4588
706 Ga0495628_0041356 3300046516 Bacteria 3679
707 Ga0495628_0785085 3300046516 Bacteria 667
708 Ga0495630_0008430 3300046517 Bacteria 7394
709 Ga0495631_0092953 3300046518 Bacteria 1298
710 Ga0495631_0429260 3300046518 Bacteria 563
711 Ga0495632_0080177 3300046519 Bacteria 1557
712 Ga0495644_0066798 3300046523 Bacteria 1351
713 Ga0495648_0049954 3300046524 Bacteria 2560
714 Ga0495666_0009748 3300046526 Bacteria 4800
715 Ga0495652_0002339 3300046529 Bacteria 19668
716 Ga0495652_0036756 3300046529 Bacteria 4254
717 Ga0495652_0073700 3300046529 Bacteria 2842
718 Ga0495652_0585551 3300046529 Bacteria 763
719 Ga0495654_0035071 3300046530 Bacteria 2529
720 Ga0495665_0011208 3300046531 Bacteria 4854
721 Ga0495640_0000826 3300046533 Bacteria 23573
722 Ga0495640_0020781 3300046533 Bacteria 4826
723 Ga0495586_0177428 3300046535 Bacteria 1205
724 Ga0495586_0265385 3300046535 Bacteria 981
725 Ga0495587_0033793 3300046536 Bacteria 3085
726 Ga0495587_0156726 3300046536 Bacteria 1297
727 Ga0495587_0273488 3300046536 Bacteria 947
728 Ga0495598_0074485 3300046537 Bacteria 1076
729 Ga0495621_0090957 3300046539 Bacteria 1150
730 Ga0495597_0098721 3300046542 Bacteria 1233
731 Ga0495597_0387661 3300046542 Bacteria 532
732 Ga0495645_0019281 3300046543 Bacteria 4911
733 Ga0495622_0008636 3300046557 Bacteria 4722
734 Ga0495622_0012865 3300046557 Bacteria 3880
735 Ga0495633_0039118 3300046558 Bacteria 2264
736 Ga0495633_0142997 3300046558 Bacteria 1106
737 Ga0495667_0001528 3300046559 Bacteria 15306
738 Ga0495667_0030123 3300046559 Bacteria 3649
739 Ga0495667_0400517 3300046559 Bacteria 864
740 Ga0495656_0016790 3300046615 Bacteria 2783
741 Ga0495656_0107122 3300046615 Bacteria 1302
742 Ga0495668_0611460 3300046616 Bacteria 602
743 Ga0495634_0000762 3300046642 Bacteria 31177
744 Ga0495634_0002573 3300046642 Bacteria 14976
745 Ga0495625_0234122 3300046660 Bacteria 1198
746 Ga0495625_0280239 3300046660 Bacteria 1073
747 Ga0495625_0431671 3300046660 Bacteria 817
748 Ga0495635_0000187 3300046663 Bacteria 39002
749 Ga0495635_0001091 3300046663 Bacteria 18022
750 Ga0495635_0704281 3300046663 Bacteria 654
751 Ga0495588_0001370 3300046674 Bacteria 10406
752 Ga0495588_0002045 3300046674 Bacteria 8625
753 Ga0495588_0189588 3300046674 Bacteria 1086
754 Ga0495657_0016934 3300046675 Bacteria 5297
755 Ga0495657_0023684 3300046675 Bacteria 4385
756 Ga0495599_0002320 3300046678 Bacteria 11052
757 Ga0495599_0210894 3300046678 Bacteria 1191
758 Ga0495623_0019613 3300046679 Bacteria 4370
759 Ga0495623_0027785 3300046679 Bacteria 3642
760 Ga0495646_0005680 3300046680 Bacteria 7901
761 Ga0495646_0039618 3300046680 Bacteria 2904
762 Ga0495646_0074198 3300046680 Bacteria 1997
763 Ga0495647_0000422 3300046681 Bacteria 12102
764 Ga0495658_0000047 3300046683 Bacteria 59626
765 Ga0495658_0502382 3300046683 Bacteria 776
766 Ga0495669_0172040 3300046684 Bacteria 1030
767 Ga0495669_0267039 3300046684 Bacteria 822
768 Ga0495613_0002415 3300046689 Bacteria 14130
769 Ga0495613_0023851 3300046689 Bacteria 4559
770 Ga0495624_0002051 3300046690 Bacteria 15345
771 Ga0495624_0873845 3300046690 Bacteria 530
772 Ga0495671_0106079 3300046692 Bacteria 1372
773 Ga0495671_0234800 3300046692 Bacteria 886
774 Ga0495649_0065974 3300046694 Bacteria 1943
775 Ga0495649_0472496 3300046694 Bacteria 625
776 Ga0495589_0050614 3300046794 Bacteria 2054
777 Ga0495600_0002218 3300046809 Bacteria 11048
778 Ga0495600_0011285 3300046809 Bacteria 5563
779 Ga0495600_0093163 3300046809 Bacteria 1964
780 Ga0495600_0223033 3300046809 Bacteria 1205
781 Ga0495581_0002021 3300047315 Bacteria 11404
782 Ga0495581_0016629 3300047315 Bacteria 4276
783 Ga0495581_0521516 3300047315 Bacteria 690
784 Ga0495604_0094508 3300047317 Bacteria 2210
785 Ga0495604_0154886 3300047317 Bacteria 1624
786 Ga0495604_0383164 3300047317 Bacteria 929
787 Ga0495604_0387183 3300047317 Bacteria 923
788 Ga0495604_0542484 3300047317 Bacteria 751
789 Ga0495604_0698727 3300047317 Bacteria 644
790 Ga0495636_0521797 3300047318 Bacteria 576
791 Ga0495674_0001402 3300047319 Bacteria 23571
792 Ga0495674_0030894 3300047319 Bacteria 4867
793 Ga0495674_0051843 3300047319 Bacteria 3615
794 Ga0495672_0010426 3300047320 Bacteria 6618
795 Ga0495672_0021570 3300047320 Bacteria 4199
796 Ga0495676_0005620 3300047321 Bacteria 11494
797 Ga0495676_0034176 3300047321 Bacteria 4269
798 Ga0495680_0005405 3300047322 Bacteria 12029
799 Ga0495680_0184568 3300047322 Bacteria 1503
800 Ga0495683_0284033 3300047323 Bacteria 715
801 Ga0495675_0038736 3300047444 Bacteria 3035
802 Ga0495675_0096848 3300047444 Bacteria 1849
803 Ga0495673_0029067 3300047469 Bacteria 2612
804 Ga0495681_0343729 3300047470 Bacteria 569
805 Ga0495684_0001482 3300047471 Bacteria 18783
806 Ga0495684_0093049 3300047471 Bacteria 2283
807 Ga0495684_0447688 3300047471 Bacteria 898
808 Ga0495686_0130279 3300047472 Bacteria 1492
809 Ga0495593_0000723 3300047673 Bacteria 19146
810 Ga0495593_0070853 3300047673 Bacteria 1811
811 Ga0495593_0077595 3300047673 Bacteria 1721
812 Ga0495602_0068925 3300048088 Bacteria 3035
813 Ga0495602_0093929 3300048088 Bacteria 2480
814 Ga0495602_0283596 3300048088 Bacteria 1219
815 Ga0495614_0286812 3300048089 Bacteria 759
816 Ga0495626_0058553 3300048091 Bacteria 1760
817 Ga0496100_0002635 3300048903 Bacteria 9149
818 Ga0496100_0139073 3300048903 Bacteria 1719
819 Ga0496100_0284502 3300048903 Bacteria 1234
820 Ga0496100_0793866 3300048903 Bacteria 742
821 Ga0496101_0011050 3300048904 Bacteria 5981
822 Ga0496101_0489136 3300048904 Bacteria 972
823 Ga0496101_0779701 3300048904 Bacteria 754
824 Ga0496101_1082972 3300048904 Bacteria 629
825 Ga0496102_0003268 3300048905 Bacteria 13736
826 Ga0496102_0126479 3300048905 Bacteria 2389
827 Ga0496102_0204326 3300048905 Bacteria 1862
828 Ga0496102_0406775 3300048905 Bacteria 1279
829 Ga0496102_0518107 3300048905 Bacteria 1115
830 Ga0496102_1157566 3300048905 Bacteria 693
831 Ga0496103_0011931 3300048906 Bacteria 5159
832 Ga0496103_0090433 3300048906 Bacteria 1931
833 Ga0496103_0241289 3300048906 Bacteria 1163
834 Ga0496104_0016540 3300048907 Bacteria 6702
835 Ga0496104_0028918 3300048907 Bacteria 5139
836 Ga0496104_0089038 3300048907 Bacteria 2949
837 Ga0496104_0736902 3300048907 Bacteria 893
838 Ga0496105_0027843 3300048908 Bacteria 4620
839 Ga0496105_0398587 3300048908 Bacteria 1093
840 Ga0496105_0412465 3300048908 Bacteria 1070
841 Ga0496106_0000477 3300048909 Bacteria 28442
842 Ga0496106_0027131 3300048909 Bacteria 4265
843 Ga0496106_0065167 3300048909 Bacteria 2773
844 Ga0496106_0374537 3300048909 Bacteria 1144
845 Ga0496106_0834121 3300048909 Bacteria 730
846 Ga0496106_0884873 3300048909 Bacteria 706
847 Ga0496106_1190084 3300048909 Bacteria 595
848 Ga0496107_0002282 3300048910 Bacteria 12380
849 Ga0496107_0105014 3300048910 Bacteria 2073
850 Ga0496108_0015096 3300048911 Bacteria 6304
851 Ga0496108_0371059 3300048911 Bacteria 1249
852 Ga0496108_0534520 3300048911 Bacteria 1023
853 Ga0496109_0032340 3300048912 Bacteria 4702
854 Ga0496109_0103827 3300048912 Bacteria 2638
855 Ga0496109_0360581 3300048912 Bacteria 1373
856 Ga0496110_0010493 3300048913 Bacteria 7539
857 Ga0496110_0079927 3300048913 Bacteria 2912
858 Ga0496110_0151390 3300048913 Bacteria 2101
859 Ga0496110_0571162 3300048913 Bacteria 1027
860 Ga0496110_1158866 3300048913 Bacteria 682
861 Ga0496111_0150239 3300048914 Bacteria 1728
862 Ga0496112_0023640 3300048915 Bacteria 5876
863 Ga0496112_0127846 3300048915 Bacteria 2512
864 Ga0496112_0155738 3300048915 Bacteria 2251
865 Ga0496112_0315846 3300048915 Bacteria 1507
866 Ga0496113_0012966 3300048916 Bacteria 5623
867 Ga0496113_0064609 3300048916 Bacteria 2767
868 Ga0496113_0856397 3300048916 Bacteria 720
869 Ga0496114_0020349 3300048917 Bacteria 5386
870 Ga0496114_0559037 3300048917 Bacteria 1010
871 Ga0496114_0843840 3300048917 Bacteria 796
872 Ga0496115_0001335 3300048918 Bacteria 17580
873 Ga0496115_0013365 3300048918 Bacteria 6211
874 Ga0496115_0065535 3300048918 Bacteria 2934
875 Ga0496117_0020387 3300048920 Bacteria 5405
876 Ga0496118_0004957 3300048921 Bacteria 15416
877 Ga0496119_0093097 3300048922 Bacteria 1708
878 Ga0496119_0126065 3300048922 Bacteria 1401
879 Ga0496121_0000456 3300048924 Bacteria 80536
880 Ga0496121_0011588 3300048924 Bacteria 9761
881 Ga0496121_0080209 3300048924 Bacteria 2588
882 Ga0496121_0093992 3300048924 Bacteria 2333
883 Ga0496121_0387200 3300048924 Bacteria 920
884 Ga0496124_0000685 3300048927 Bacteria 55748
885 Ga0496124_0231946 3300048927 Bacteria 1379
886 Ga0496125_0062506 3300048928 Bacteria 2977
887 Ga0496125_0234418 3300048928 Bacteria 1171
888 Ga0496125_0411712 3300048928 Bacteria 787
889 Ga0496126_0002820 3300048929 Bacteria 22789
890 Ga0496126_0007653 3300048929 Bacteria 11790
891 Ga0496126_0010701 3300048929 Bacteria 9583
892 Ga0496126_0111157 3300048929 Bacteria 2386
893 Ga0496126_0286451 3300048929 Bacteria 1363
894 Ga0496126_0294066 3300048929 Bacteria 1342
895 Ga0496126_0369571 3300048929 Bacteria 1170
896 Ga0501036_1577035 3300049572 Bacteria 530
897 Ga0501046_0145221 3300049580 Bacteria 1792
898 Ga0501067_0021493 3300049583 Bacteria 3571
899 Ga0501067_0149277 3300049583 Bacteria 1302
900 Ga0501070_0773034 3300049586 Bacteria 756
901 Ga0501076_0409288 3300049592 Bacteria 1116
902 Ga0501083_1031677 3300049744 Bacteria 535
903 Ga0501035_0193141 3300049822 Bacteria 1750
904 Ga0501045_0832842 3300049824 Bacteria 679
905 nmdc:mga03683_133759_c1 3300050489 Bacteria 1111
906 nmdc:mga03683_31439_c1 3300050489 Bacteria 2130
907 nmdc:mga03683_339833_c1 3300050489 Bacteria 709
908 nmdc:mga03n38_16168_c1 3300050490 Bacteria 2899
909 nmdc:mga03n38_27443_c1 3300050490 Bacteria 2362
910 nmdc:mga03n38_37121_c1 3300050490 Bacteria 2099
911 nmdc:mga00v17_22557_c1 3300050491 Bacteria 3633
912 nmdc:mga00v17_351141_c1 3300050491 Bacteria 959
913 nmdc:mga0yw44_1163403_c1 3300050492 Bacteria 521
914 nmdc:mga0yw44_320441_c1 3300050492 Bacteria 1041
915 nmdc:mga0yw44_332466_c1 3300050492 Bacteria 1021
916 nmdc:mga0yw44_34735_c1 3300050492 Bacteria 2957
917 nmdc:mga0yw44_528599_c1 3300050492 Bacteria 801
918 nmdc:mga0yw44_5923_c1 3300050492 Bacteria 5845
919 nmdc:mga0k408_103122_c1 3300050493 Bacteria 1683
920 nmdc:mga0k408_167258_c1 3300050493 Bacteria 1310
921 nmdc:mga0k408_334839_c1 3300050493 Bacteria 903
922 nmdc:mga0k408_511767_c1 3300050493 Bacteria 711
923 nmdc:mga06z11_118768_c1 3300050494 Bacteria 1473
924 nmdc:mga04h51_84363_c1 3300050495 Bacteria 1133
925 nmdc:mga07m45_421575_c1 3300050496 Bacteria 774
926 nmdc:mga07m45_55711_c1 3300050496 Bacteria 2235
927 nmdc:mga05p37_209207_c1 3300050507 Bacteria 2359
928 nmdc:mga0qj67_224802_c1 3300050509 Bacteria 1523
929 nmdc:mga08y16_228382_c1 3300050511 Bacteria 1925
930 nmdc:mga0rr50_628964_c1 3300050513 Bacteria 915
931 nmdc:mga0sz30_19314_c1 3300050516 Bacteria 2738
932 Ga0495601_0085005 3300053077 Bacteria 2032
933 Ga0495601_0119969 3300053077 Bacteria 1707
934 Ga0495601_0290864 3300053077 Bacteria 1065
935 Ga0495612_0108278 3300053078 Bacteria 1187
936 Ga0495612_0219544 3300053078 Bacteria 841
937 Ga0500635_0033304 3300053080 Bacteria 1680
938 Ga0495655_0144660 3300053083 Bacteria 743
939 Ga0495595_0006061 3300053084 Bacteria 4913
940 Ga0495595_0022229 3300053084 Bacteria 2782
941 Ga0495619_0002231 3300053085 Bacteria 12815
942 Ga0495619_0037434 3300053085 Bacteria 3161
943 Ga0495619_0190472 3300053085 Bacteria 1419
944 Ga0495619_0206880 3300053085 Bacteria 1359
945 Ga0495619_0491269 3300053085 Bacteria 844
946 Ga0500646_0145632 3300053090 Bacteria 781
947 Ga0500647_0018439 3300053091 Bacteria 3232
948 Ga0500647_0245693 3300053091 Bacteria 789
949 Ga0500583_0137708 3300053092 Bacteria 1212
950 Ga0500651_0189209 3300053093 Bacteria 1219
951 Ga0500566_0013410 3300053094 Bacteria 4826
952 Ga0500566_0285489 3300053094 Bacteria 784
953 Ga0500640_005820 3300053095 Bacteria 4643
954 Ga0500641_0011445 3300053096 Bacteria 3220
955 Ga0500641_0077801 3300053096 Bacteria 1404
956 Ga0500641_0174650 3300053096 Bacteria 924
957 Ga0500648_074567 3300053097 Bacteria 1916
958 Ga0500556_0061823 3300053104 Bacteria 1381
959 Ga0500562_052210 3300053108 Bacteria 1094
960 Ga0500572_000217 3300053111 Bacteria 20413
961 Ga0500582_190476 3300053114 Bacteria 694
962 Ga0500595_000438 3300053119 Bacteria 25956
963 Ga0500595_034504 3300053119 Bacteria 1673
964 Ga0500595_046627 3300053119 Bacteria 1361
965 Ga0500597_343811 3300053120 Bacteria 583
966 Ga0500608_002059 3300053122 Bacteria 7209
967 Ga0500614_001377 3300053123 Bacteria 5851
968 Ga0500642_0056964 3300053130 Bacteria 1743
969 Ga0500642_0512600 3300053130 Bacteria 504
970 Ga0500658_0069098 3300053134 Bacteria 1486
971 Ga0500658_0154435 3300053134 Bacteria 1036
972 Ga0500559_0008610 3300053136 Bacteria 4462
973 Ga0500559_0458831 3300053136 Bacteria 588
974 Ga0500568_0010219 3300053139 Bacteria 4408
975 Ga0500573_0069876 3300053140 Bacteria 2003
976 Ga0500588_0093026 3300053146 Bacteria 1028
977 Ga0500603_002023 3300053150 Bacteria 4490
978 Ga0500604_0023541 3300053151 Bacteria 1757
979 Ga0500630_000537 3300053159 Bacteria 17060
980 Ga0500634_0008812 3300053161 Bacteria 5063
981 Ga0500638_000078 3300053162 Bacteria 17252
982 Ga0500638_013999 3300053162 Bacteria 3647
983 Ga0500638_071658 3300053162 Bacteria 1656
984 Ga0500639_000001 3300053163 Bacteria 244795
985 Ga0500639_086000 3300053163 Bacteria 1575
986 Ga0500636_0093571 3300053177 Bacteria 1718
987 Ga0500637_0000088 3300053178 Bacteria 33146
988 Ga0500637_0094657 3300053178 Bacteria 1730
989 Ga0500637_0397258 3300053178 Bacteria 717
990 Ga0500576_061368 3300053725 Bacteria 1643
991 Ga0500609_036777 3300053731 Bacteria 676
992 Ga0500596_001084 3300053735 Bacteria 5478
993 Ga0500596_017423 3300053735 Bacteria 1077
994 Ga0500601_005309 3300053737 Bacteria 1410
995 Ga0500661_000025 3300055283 Bacteria 22926
996 Ga0501082_0218887 3300060353 Bacteria 1657
997 2513675889 2513237098 Bacteria 9902361
998 2513692589 2513237101 Bacteria 7952346
999 2524468938 2524023210 Bacteria 9029266
1000 2723845025 2721755755 Bacteria 8322773
1001 2793082108
1002 2874605259 2874604998 Bacteria 7834745
1003 2885386549 2885383462 Bacteria 9473874
1004 2889039777 2889033259 Bacteria 9099371
1005 2903774128 2903768456 Bacteria 9749579
1006 2922365418 2922361189 Bacteria 7436256
1007 2922391027 2922386360 Bacteria 7017218
1008 8006965805 8006964411 Bacteria 8966052
1009 8006986457 8006984368 Bacteria 9651211
1010 8006995974 8006994254 Bacteria 8309700
1011 8056673807 8056673599 Bacteria 7871253
1012 8056686711 8056681323 Bacteria 8472857
1013 Ga0105248_10238890
1014 JGI24750J21931_1028729
1015 JGI25406J46586_10167307
1016 JGI25153J46596_10001106
1017 rootH1_10049394
1018 rootL2_10062449
1019 JGI25404J52841_10052368
1020 Ga0065704_10666121
1021 Ga0065707_10250855
1022 Ga0070658_10247790
1023 Ga0070658_10358392
1024 Ga0070676_10246735
1025 Ga0070676_10247677
1026 Ga0070690_100418309
1027 Ga0070670_100206023
1028 Ga0070670_100562681
1029 Ga0070670_100592193
1030 Ga0068869_100102861
1031 Ga0068869_100198829
1032 Ga0068869_100298342
1033 Ga0070680_100028149
1034 Ga0070682_100163513
1035 Ga0070682_100182044
1036 Ga0070682_100876662
1037 Ga0070682_100932277
1038 Ga0070682_101746713
1039 Ga0068868_100007248
1040 Ga0068868_100034333
1041 Ga0068868_100281031
1042 Ga0068868_101266019
1043 Ga0070660_101493385
1044 Ga0070687_100835132
1045 Ga0070661_100064797
1046 Ga0070692_10167836
1047 Ga0070668_100169745
1048 Ga0070668_100667527
1049 Ga0070668_100740310
1050 Ga0070668_101129771
1051 Ga0070669_100054862
1052 Ga0070669_100484947
1053 Ga0070675_100298665
1054 Ga0070675_101212564
1055 Ga0070671_100160036
1056 Ga0070671_100200989
1057 Ga0070671_101333228
1058 Ga0070671_101493719
1059 Ga0070674_100038183
1060 Ga0070674_100595106
1061 Ga0070674_100822581
1062 Ga0070673_100600802
1063 Ga0070673_100871453
1064 Ga0070688_100110288
1065 Ga0070659_100013386
1066 Ga0070659_100029963
1067 Ga0070659_100120478
1068 Ga0070659_101504332
1069 Ga0070667_100062286
1070 Ga0070667_100082128
1071 Ga0070667_100542178
1072 Ga0070667_100576129
1073 Ga0070667_100589692
1074 Ga0070667_100634250
1075 Ga0070667_101078421
1076 Ga0070667_101906528
1077 Ga0070709_10087636
1078 Ga0070713_100123239
1079 Ga0070713_100194529
1080 Ga0070713_101682353
1081 Ga0070701_10182076
1082 Ga0070701_10443537
1083 Ga0070711_100833901
1084 Ga0070711_101402764
1085 Ga0070700_100083281
1086 Ga0070700_100128523
1087 Ga0070700_100331451
1088 Ga0070700_100629094
1089 Ga0070700_101214542
1090 Ga0070694_100199793
1091 Ga0070663_100031336
1092 Ga0070663_100054677
1093 Ga0070663_100054728
1094 Ga0070663_100078560
1095 Ga0070663_100102129
1096 Ga0070663_100208976
1097 Ga0070678_100016899
1098 Ga0070678_100129344
1099 Ga0070678_100135610
1100 Ga0070678_100169375
1101 Ga0070678_100336473
1102 Ga0070678_100338181
1103 Ga0070678_100405945
1104 Ga0070678_100617267
1105 Ga0070678_100714384
1106 Ga0070662_100028974
1107 Ga0070662_100115348
1108 Ga0070662_100688005
1109 Ga0070662_100877026
1110 Ga0070681_10133684
1111 Ga0068867_100060657
1112 Ga0068867_101353192
1113 Ga0070685_10677491
1114 Ga0070698_100112992
1115 Ga0070698_100725587
1116 Ga0070699_100083550
1117 Ga0070679_100020404
1118 Ga0070679_100083975
1119 Ga0070684_100095276
1120 Ga0070697_100077284
1121 Ga0070697_101276538
1122 Ga0068853_100084664
1123 Ga0068853_100508583
1124 Ga0068853_100714044
1125 Ga0068853_100814082
1126 Ga0068853_101227004
1127 Ga0070672_100304521
1128 Ga0070672_100519508
1129 Ga0070672_100842846
1130 Ga0070686_100166509
1131 Ga0070686_100195646
1132 Ga0070686_100196558
1133 Ga0070695_100269109
1134 Ga0070696_100392060
1135 Ga0070693_100052550
1136 Ga0070693_100128856
1137 Ga0070665_100052300
1138 Ga0070665_100160319
1139 Ga0070665_100312102
1140 Ga0070665_100382771
1141 Ga0068855_100017635
1142 Ga0068855_100029614
1143 Ga0068855_100277159
1144 Ga0068855_100429279
1145 Ga0068855_100438123
1146 Ga0068855_100629848
1147 Ga0068855_100703755
1148 Ga0070664_100932192
1149 Ga0070664_100936596
1150 Ga0070664_101795669
1151 Ga0068857_100054957
1152 Ga0068857_100758475
1153 Ga0068854_100117469
1154 Ga0068854_100613413
1155 Ga0068856_100044548
1156 Ga0068856_100050315
1157 Ga0068856_100153965
1158 Ga0068856_100396542
1159 Ga0068856_101834432
1160 Ga0070702_100032858
1161 Ga0068852_100056294
1162 Ga0068852_100112587
1163 Ga0068852_100130524
1164 Ga0068852_100140996
1165 Ga0068852_100312903
1166 Ga0068859_100226342
1167 Ga0068859_100395407
1168 Ga0068859_100404271
1169 Ga0068864_100025302
1170 Ga0068864_100080894
1171 Ga0068866_10040005
1172 Ga0068866_10043942
1173 Ga0068866_10242586
1174 Ga0068866_10949598
1175 Ga0068861_100057452
1176 Ga0068861_100060580
1177 Ga0068861_100081324
1178 Ga0068861_100201859
1179 Ga0068861_101168821
1180 Ga0068851_10244456
1181 Ga0068870_10115913
1182 Ga0068863_100285834
1183 Ga0068863_100317508
1184 Ga0068863_100652672
1185 Ga0068863_100727088
1186 Ga0068858_100121056
1187 Ga0068858_100177260
1188 Ga0068858_100618255
1189 Ga0068860_100000058
1190 Ga0068860_100251166
1191 Ga0068862_100053834
1192 Ga0068862_100106659
1193 Ga0068862_100140583
1194 Ga0068862_100253886
1195 Ga0068862_100365200
1196 Ga0068862_100437267
1197 Ga0068862_100466778
1198 Ga0068862_100818592
1199 Ga0081455_10002419
1200 Ga0081455_10097911
1201 Ga0081538_10124731
1202 Ga0081540_1002092
1203 Ga0081540_1004102
1204 Ga0081540_1009301
1205 Ga0081540_1016640
1206 Ga0081539_10026414
1207 Ga0070717_10005335
1208 Ga0070717_11513364
1209 Ga0075365_10005918
1210 Ga0075365_10033942
1211 Ga0075365_10096308
1212 Ga0075365_10322223
1213 Ga0075365_10417989
1214 Ga0075368_10050537
1215 Ga0075368_10142947
1216 Ga0075368_10261632
1217 Ga0075363_100010147
1218 Ga0075363_100039459
1219 Ga0075363_100138720
1220 Ga0075363_100162658
1221 Ga0075363_100197272
1222 Ga0075364_10064370
1223 Ga0075364_10590878
1224 Ga0070715_10110516
1225 Ga0070716_100127732
1226 Ga0070716_100822414
1227 Ga0070712_100048117
1228 Ga0075362_10038981
1229 Ga0075362_10132718
1230 Ga0075362_10199527
1231 Ga0075362_10349812
1232 Ga0075367_10067366
1233 Ga0075367_10070568
1234 Ga0075367_10079229
1235 Ga0075367_10144432
1236 Ga0075367_10237094
1237 Ga0075369_10015050
1238 Ga0075369_10112709
1239 Ga0075369_10180704
1240 Ga0075366_10114713
1241 Ga0075366_10130334
1242 Ga0075366_10230488
1243 Ga0075366_10240040
1244 Ga0075366_10287195
1245 Ga0097621_100083061
1246 Ga0097621_100194605
1247 Ga0097621_100406302
1248 Ga0097621_101410444
1249 Ga0075370_10017192
1250 Ga0075370_10119300
1251 Ga0075370_10287608
1252 Ga0068871_100339866
1253 Ga0068871_100372787
1254 Ga0068871_100582597
1255 Ga0068871_101010930
1256 Ga0075428_100174800
1257 Ga0075434_100931220
1258 Ga0068865_100054115
1259 Ga0068865_100111722
1260 Ga0068865_100198421
1261 Ga0097620_100226341
1262 Ga0097620_100395360
1263 Ga0097620_100404287
1264 Ga0099795_10005197
1265 Ga0099795_10131623
1266 Ga0099795_10216224
1267 Ga0105251_10267285
1268 Ga0105240_10050611
1269 Ga0105240_10567872
1270 Ga0105245_10356075
1271 Ga0105245_10709834
1272 Ga0105245_10803915
1273 Ga0105245_11405919
1274 Ga0105247_10016251
1275 Ga0105247_10036592
1276 Ga0105247_10271868
1277 Ga0105247_10491980
1278 Ga0105247_11351934
1279 Ga0114129_10064849
1280 Ga0105243_10324591
1281 Ga0105243_10427228
1282 Ga0105241_10041152
1283 Ga0105241_10099499
1284 Ga0105242_10402070
1285 Ga0105248_10033538
1286 Ga0105248_10223621
1287 Ga0105248_10478146
1288 Ga0105248_11467355
1289 Ga0105237_10090818
1290 Ga0105237_10250559
1291 Ga0105237_10318388
1292 Ga0105237_10475461
1293 Ga0105237_10587200
1294 Ga0105237_11061828
1295 Ga0105237_11104506
1296 Ga0105238_10205293
1297 Ga0105238_10297161
1298 Ga0105238_10650285
1299 Ga0105238_11123670
1300 Ga0105249_10237127
1301 Ga0105249_10241385
1302 Ga0105249_10278071
1303 Ga0105249_10584526
1304 Ga0105249_11301589
1305 Ga0105249_11793807
1306 Ga0099796_10016836
1307 Ga0099796_10017000
1308 Ga0099796_10046732
1309 Ga0099796_10161181
1310 Ga0099796_10267336
1311 Ga0105239_10272943
1312 Ga0105239_10440714
1313 Ga0105239_10518013
1314 Ga0105239_10528120
1315 Ga0105246_10096777
1316 Ga0105246_10170406
1317 Ga0105246_10207518
1318 Ga0105246_10379792
1319 Ga0105246_10451735
1320 Ga0105246_10642111
1321 Ga0157315_1017804
1322 Ga0157373_10161499
1323 Ga0157373_10318242
1324 Ga0157371_10103344
1325 Ga0157371_10663113
1326 Ga0157370_10083279
1327 Ga0157370_10162333
1328 Ga0157370_11245970
1329 Ga0157369_10609199
1330 Ga0157369_10712082
1331 Ga0157374_10636559
1332 Ga0157374_12207020
1333 Ga0157374_12260717
1334 Ga0157378_10052830
1335 Ga0157378_10397007
1336 Ga0163162_10003676
1337 Ga0163162_10635262
1338 Ga0163162_10684744
1339 Ga0163162_10920615
1340 Ga0163162_11196669
1341 Ga0157372_10221124
1342 Ga0157372_10688229
1343 Ga0157375_10581822
1344 Ga0157375_10806841
1345 Ga0157375_12720541
1346 Ga0163163_10274800
1347 Ga0163163_10381819
1348 Ga0163163_10494780
1349 Ga0163163_12233145
1350 Ga0157380_10571212
1351 Ga0157380_10659933
1352 Ga0157380_11171104
1353 Ga0157380_11713979
1354 Ga0157379_10075745
1355 Ga0157379_10085223
1356 Ga0157379_10554598
1357 Ga0157379_10620189
1358 Ga0157379_11217209
1359 Ga0157376_10013748
1360 Ga0157376_10437417
1361 Ga0157376_10627328
1362 Ga0157376_10895874
1363 Ga0163161_10012760
1364 Ga0163161_10219488
1365 Ga0163161_10850982
1366 Ga0213874_10014179
1367 Ga0213874_10177991
1368 Ga0209026_1015260
1369 Ga0209758_1032872
1370 Ga0207697_10090582
1371 Ga0207656_10243163
1372 Ga0207682_10236688
1373 Ga0207682_10266242
1374 Ga0207692_10293747
1375 Ga0207642_10193472
1376 Ga0207642_10196391
1377 Ga0207642_10383017
1378 Ga0207710_10030090
1379 Ga0207710_10040008
1380 Ga0207710_10167797
1381 Ga0207710_10253517
1382 Ga0207688_10037109
1383 Ga0207688_10457381
1384 Ga0207680_10074752
1385 Ga0207680_10774173
1386 Ga0207647_10052558
1387 Ga0207685_10166861
1388 Ga0207699_10034310
1389 Ga0207645_10104054
1390 Ga0207645_10524651
1391 Ga0207645_10567032
1392 Ga0207643_10037354
1393 Ga0207643_10048012
1394 Ga0207705_10128371
1395 Ga0207705_10137452
1396 Ga0207684_11286903
1397 Ga0207654_10011369
1398 Ga0207654_10208786
1399 Ga0207707_10154844
1400 Ga0207707_10155477
1401 Ga0207695_10341192
1402 Ga0207695_10399936
1403 Ga0207671_10078202
1404 Ga0207671_10156675
1405 Ga0207671_10158726
1406 Ga0207671_10787196
1407 Ga0207693_10022609
1408 Ga0207693_10029036
1409 Ga0207693_10096969
1410 Ga0207663_10566172
1411 Ga0207663_10647604
1412 Ga0207663_11491768
1413 Ga0207660_10027655
1414 Ga0207660_10158654
1415 Ga0207660_10350779
1416 Ga0207657_10007732
1417 Ga0207657_10135694
1418 Ga0207657_10705319
1419 Ga0207657_10975191
1420 Ga0207649_10071248
1421 Ga0207649_10499447
1422 Ga0207652_10071088
1423 Ga0207652_10278639
1424 Ga0207681_10509590
1425 Ga0207681_10849328
1426 Ga0207694_10310874
1427 Ga0207694_10587206
1428 Ga0207694_10830651
1429 Ga0207650_10699033
1430 Ga0207659_10091363
1431 Ga0207659_10276610
1432 Ga0207659_11071959
1433 Ga0207687_10031494
1434 Ga0207687_10620980
1435 Ga0207700_10031958
1436 Ga0207644_10242514
1437 Ga0207644_10369151
1438 Ga0207690_10025604
1439 Ga0207690_10153233
1440 Ga0207690_10827888
1441 Ga0207706_10069272
1442 Ga0207706_10091791
1443 Ga0207706_10303480
1444 Ga0207706_10767624
1445 Ga0207706_10845433
1446 Ga0207686_10191222
1447 Ga0207686_10691787
1448 Ga0207709_10047871
1449 Ga0207709_10282676
1450 Ga0207669_10149924
1451 Ga0207669_10356105
1452 Ga0207669_10393449
1453 Ga0207669_10431840
1454 Ga0207669_10443621
1455 Ga0207669_10594559
1456 Ga0207704_10131490
1457 Ga0207704_10569802
1458 Ga0207704_11659438
1459 Ga0207665_10240753
1460 Ga0207665_10574923
1461 Ga0207691_10215676
1462 Ga0207691_10373085
1463 Ga0207691_10445410
1464 Ga0207711_10032973
1465 Ga0207711_10135139
1466 Ga0207711_10547306
1467 Ga0207711_10841788
1468 Ga0207711_11454386
1469 Ga0207689_10016101
1470 Ga0207689_10150749
1471 Ga0207689_10514696
1472 Ga0207661_10056472
1473 Ga0207679_10103264
1474 Ga0207667_10124426
1475 Ga0207667_10602403
1476 Ga0207667_10705428
1477 Ga0207651_10920981
1478 Ga0207712_10061492
1479 Ga0207712_10143860
1480 Ga0207712_10302748
1481 Ga0207712_10355405
1482 Ga0207712_10409719
1483 Ga0207668_10014887
1484 Ga0207668_10060845
1485 Ga0207668_10083922
1486 Ga0207668_10212704
1487 Ga0207668_10325700
1488 Ga0207668_10608455
1489 Ga0207640_10016462
1490 Ga0207640_10108236
1491 Ga0207658_10075699
1492 Ga0207658_10565004
1493 Ga0207658_10729787
1494 Ga0207658_11069225
1495 Ga0207677_10175882
1496 Ga0207677_10383062
1497 Ga0207677_10562528
1498 Ga0207677_10590228
1499 Ga0207677_11181017
1500 Ga0207703_10025797
1501 Ga0207703_10884165
1502 Ga0207639_10306886
1503 Ga0207639_10308315
1504 Ga0207639_10482044
1505 Ga0207639_10503831
1506 Ga0207678_10019509
1507 Ga0207678_10026492
1508 Ga0207678_10028300
1509 Ga0207678_10037339
1510 Ga0207678_10113723
1511 Ga0207678_10253830
1512 Ga0207678_10366204
1513 Ga0207708_10044451
1514 Ga0207708_10531347
1515 Ga0207708_10840917
1516 Ga0207702_10089626
1517 Ga0207702_10666186
1518 Ga0207702_11000885
1519 Ga0207641_10567305
1520 Ga0207641_10570643
1521 Ga0207648_10016066
1522 Ga0207648_10464869
1523 Ga0207648_10915692
1524 Ga0207676_10689546
1525 Ga0207676_12123471
1526 Ga0207676_12436706
1527 Ga0207674_10004659
1528 Ga0207674_10165973
1529 Ga0207675_100018787
1530 Ga0207675_100262760
1531 Ga0207675_100291447
1532 Ga0207675_100462680
1533 Ga0207675_100639498
1534 Ga0207675_100820892
1535 Ga0207683_10016292
1536 Ga0207683_10082790
1537 Ga0207683_10083791
1538 Ga0207683_10096169
1539 Ga0207683_10328129
1540 Ga0207683_10670631
1541 Ga0207698_10069860
1542 Ga0207698_10504412
1543 Ga0207698_10966652
1544 Ga0209179_1009134
1545 Ga0209179_1035329
1546 Ga0209813_10088416
1547 Ga0207428_10344633
1548 Ga0268266_10002475
1549 Ga0268266_10004442
1550 Ga0268266_10126879
1551 Ga0268266_10209865
1552 Ga0268266_10361320
1553 Ga0268266_10429418
1554 Ga0268266_10955735
1555 Ga0268265_10094178
1556 Ga0268265_10129487
1557 Ga0268265_10205650
1558 Ga0268265_10280937
1559 Ga0268265_10328264
1560 Ga0268265_11001553
1561 Ga0268264_10000022
1562 Ga0268264_11452154
1563 Ga0268264_11642585
1564 Ga0265334_10039005
1565 Ga0307517_10436195
1566 Ga0307515_10007547
1567 Ga0307515_10190719
1568 Ga0307515_10629270
1569 Ga0307511_10026276
1570 Ga0307511_10056903
1571 Ga0307512_10272233
1572 Ga0265330_10015725
1573 Ga0265330_10466232
1574 Ga0265332_10029159
1575 Ga0265339_10210650
1576 Ga0307513_10166927
1577 Ga0307513_10412663
1578 Ga0307513_10639897
1579 Ga0307509_10075236
1580 Ga0307509_10111062
1581 Ga0307408_100465966
1582 Ga0307508_10000009
1583 Ga0307508_10047463
1584 Ga0307508_10226454
1585 Ga0307508_10447711
1586 Ga0307508_10586964
1587 Ga0307516_10058764
1588 Ga0307516_10087356
1589 Ga0307516_10101855
1590 Ga0307516_10254800
1591 Ga0307516_10379955
1592 Ga0307516_10579252
1593 Ga0307413_11228058
1594 Ga0307410_10273312
1595 Ga0307410_10436164
1596 Ga0307406_10422848
1597 Ga0307406_10679988
1598 Ga0307412_11044861
1599 Ga0307409_101161344
1600 Ga0307409_101208319
1601 Ga0307416_100371409
1602 Ga0307416_103072376
1603 Ga0307414_11126070
1604 Ga0307414_11380891
1605 Ga0307411_10480109
1606 Ga0307411_10514787
1607 Ga0307415_100044407
1608 Ga0307415_100107062
1609 Ga0307415_100139109
1610 Ga0307415_101357453
1611 Ga0307507_10188130
1612 Ga0307510_10041082
1613 Ga0373934_0017581
1614 Ga0373951_0049666
1615 Ga0373923_0002332
1616 Ga0373923_0275279
1617 Ga0373936_0011675
1618 Ga0373936_0026082
1619 Ga0373936_0042885
1620 Ga0373936_0211681
1621 Ga0373939_0079359
1622 Ga0373953_0000473
1623 Ga0373954_0000442
1624 Ga0373954_0010918
1625 Ga0373954_0386505
1626 Ga0373956_0001159
1627 Ga0373956_0058457
1628 Ga0373957_0000837
1629 Ga0373957_0082576
1630 Ga0373943_0006178
1631 Ga0373943_0469653
1632 Ga0373946_0007625
1633 Ga0373955_0000840
1634 Ga0373955_0019884
1635 Ga0373955_0111431
1636 Ga0373955_1008664
1637 Ga0373962_0045346
1638 Ga0373931_0015131
1639 Ga0373935_0001167
1640 Ga0373935_0130812
1641 Ga0373927_0001744
1642 Ga0373927_0010992
1643 Ga0373927_0319500
1644 Ga0373933_0012552
1645 Ga0373933_0214946
1646 Ga0373933_0543972
1647 Ga0373947_0005344
1648 Ga0373947_0265277
1649 Ga0373937_0014572
1650 Ga0373937_0330973
1651 Ga0373937_0751771
1652 Ga0373925_0013749
1653 Ga0373925_0188035
1654 Ga0373925_0795689
1655 Ga0395900_0071894
1656 Ga0395898_0333137
1657 Ga0436365_0157279
1658 Ga0436360_1070790
1659 Ga0436361_0402017
1660 Ga0436363_0312883
1661 Ga0436363_0872365
1662 Ga0451791_0639961
1663 Ga0451793_0200984
1664 Ga0451797_0987490
1665 Ga0451795_0725544
1666 Ga0451800_1010296
1667 Ga0451802_1555424
1668 Ga0451807_0582585
1669 Ga0451855_1946904
1670 Ga0466957_0388110
1671 Ga0466967_0110502
1672 Ga0495617_003836
1673 Ga0495592_0020075
1674 Ga0495592_0028166
1675 Ga0495592_0139266
1676 Ga0495603_0003551
1677 Ga0495603_0008022
1678 Ga0495603_0114512
1679 Ga0495590_0066570
1680 Ga0495629_0008864
1681 Ga0495629_0515483
1682 Ga0495638_0097415
1683 Ga0495641_0011704
1684 Ga0495651_0026680
1685 Ga0495651_0186619
1686 Ga0495651_0310249
1687 Ga0495653_0035279
1688 Ga0495653_0187734
1689 Ga0495580_0009095
1690 Ga0495582_0000739
1691 Ga0495582_0158839
1692 Ga0495605_0110145
1693 Ga0495605_0119536
1694 Ga0495639_0003522
1695 Ga0495639_0262691
1696 Ga0495662_0000437
1697 Ga0495662_0137983
1698 Ga0495664_0130686
1699 Ga0495664_0732720
1700 Ga0495584_0129036
1701 Ga0495584_0310847
1702 Ga0495585_0268401
1703 Ga0495585_0383548
1704 Ga0495594_0013772
1705 Ga0495594_0038684
1706 Ga0495594_0307169
1707 Ga0495606_0194227
1708 Ga0495606_0295052
1709 Ga0495606_0301711
1710 Ga0495608_0005163
1711 Ga0495608_0407807
1712 Ga0495608_0589439
1713 Ga0495618_0055282
1714 Ga0495618_0082750
1715 Ga0495620_0081714
1716 Ga0495620_0269477
1717 Ga0495628_0027929
1718 Ga0495628_0041356
1719 Ga0495628_0785085
1720 Ga0495630_0008430
1721 Ga0495631_0092953
1722 Ga0495631_0429260
1723 Ga0495632_0080177
1724 Ga0495644_0066798
1725 Ga0495648_0049954
1726 Ga0495666_0009748
1727 Ga0495652_0002339
1728 Ga0495652_0036756
1729 Ga0495652_0073700
1730 Ga0495652_0585551
1731 Ga0495654_0035071
1732 Ga0495665_0011208
1733 Ga0495640_0000826
1734 Ga0495640_0020781
1735 Ga0495586_0177428
1736 Ga0495586_0265385
1737 Ga0495587_0033793
1738 Ga0495587_0156726
1739 Ga0495587_0273488
1740 Ga0495598_0074485
1741 Ga0495621_0090957
1742 Ga0495597_0098721
1743 Ga0495597_0387661
1744 Ga0495645_0019281
1745 Ga0495622_0008636
1746 Ga0495622_0012865
1747 Ga0495633_0039118
1748 Ga0495633_0142997
1749 Ga0495667_0001528
1750 Ga0495667_0030123
1751 Ga0495667_0400517
1752 Ga0495656_0016790
1753 Ga0495656_0107122
1754 Ga0495668_0611460
1755 Ga0495634_0000762
1756 Ga0495634_0002573
1757 Ga0495625_0234122
1758 Ga0495625_0280239
1759 Ga0495625_0431671
1760 Ga0495635_0000187
1761 Ga0495635_0001091
1762 Ga0495635_0704281
1763 Ga0495588_0001370
1764 Ga0495588_0002045
1765 Ga0495588_0189588
1766 Ga0495657_0016934
1767 Ga0495657_0023684
1768 Ga0495599_0002320
1769 Ga0495599_0210894
1770 Ga0495623_0019613
1771 Ga0495623_0027785
1772 Ga0495646_0005680
1773 Ga0495646_0039618
1774 Ga0495646_0074198
1775 Ga0495647_0000422
1776 Ga0495658_0000047
1777 Ga0495658_0502382
1778 Ga0495669_0172040
1779 Ga0495669_0267039
1780 Ga0495613_0002415
1781 Ga0495613_0023851
1782 Ga0495624_0002051
1783 Ga0495624_0873845
1784 Ga0495671_0106079
1785 Ga0495671_0234800
1786 Ga0495649_0065974
1787 Ga0495649_0472496
1788 Ga0495589_0050614
1789 Ga0495600_0002218
1790 Ga0495600_0011285
1791 Ga0495600_0093163
1792 Ga0495600_0223033
1793 Ga0495581_0002021
1794 Ga0495581_0016629
1795 Ga0495581_0521516
1796 Ga0495604_0094508
1797 Ga0495604_0154886
1798 Ga0495604_0383164
1799 Ga0495604_0387183
1800 Ga0495604_0542484
1801 Ga0495604_0698727
1802 Ga0495636_0521797
1803 Ga0495674_0001402
1804 Ga0495674_0030894
1805 Ga0495674_0051843
1806 Ga0495672_0010426
1807 Ga0495672_0021570
1808 Ga0495676_0005620
1809 Ga0495676_0034176
1810 Ga0495680_0005405
1811 Ga0495680_0184568
1812 Ga0495683_0284033
1813 Ga0495675_0038736
1814 Ga0495675_0096848
1815 Ga0495673_0029067
1816 Ga0495681_0343729
1817 Ga0495684_0001482
1818 Ga0495684_0093049
1819 Ga0495684_0447688
1820 Ga0495686_0130279
1821 Ga0495593_0000723
1822 Ga0495593_0070853
1823 Ga0495593_0077595
1824 Ga0495602_0068925
1825 Ga0495602_0093929
1826 Ga0495602_0283596
1827 Ga0495614_0286812
1828 Ga0495626_0058553
1829 Ga0496100_0002635
1830 Ga0496100_0139073
1831 Ga0496100_0284502
1832 Ga0496100_0793866
1833 Ga0496101_0011050
1834 Ga0496101_0489136
1835 Ga0496101_0779701
1836 Ga0496101_1082972
1837 Ga0496102_0003268
1838 Ga0496102_0126479
1839 Ga0496102_0204326
1840 Ga0496102_0406775
1841 Ga0496102_0518107
1842 Ga0496102_1157566
1843 Ga0496103_0011931
1844 Ga0496103_0090433
1845 Ga0496103_0241289
1846 Ga0496104_0016540
1847 Ga0496104_0028918
1848 Ga0496104_0089038
1849 Ga0496104_0736902
1850 Ga0496105_0027843
1851 Ga0496105_0398587
1852 Ga0496105_0412465
1853 Ga0496106_0000477
1854 Ga0496106_0027131
1855 Ga0496106_0065167
1856 Ga0496106_0374537
1857 Ga0496106_0834121
1858 Ga0496106_0884873
1859 Ga0496106_1190084
1860 Ga0496107_0002282
1861 Ga0496107_0105014
1862 Ga0496108_0015096
1863 Ga0496108_0371059
1864 Ga0496108_0534520
1865 Ga0496109_0032340
1866 Ga0496109_0103827
1867 Ga0496109_0360581
1868 Ga0496110_0010493
1869 Ga0496110_0079927
1870 Ga0496110_0151390
1871 Ga0496110_0571162
1872 Ga0496110_1158866
1873 Ga0496111_0150239
1874 Ga0496112_0023640
1875 Ga0496112_0127846
1876 Ga0496112_0155738
1877 Ga0496112_0315846
1878 Ga0496113_0012966
1879 Ga0496113_0064609
1880 Ga0496113_0856397
1881 Ga0496114_0020349
1882 Ga0496114_0559037
1883 Ga0496114_0843840
1884 Ga0496115_0001335
1885 Ga0496115_0013365
1886 Ga0496115_0065535
1887 Ga0496117_0020387
1888 Ga0496118_0004957
1889 Ga0496119_0093097
1890 Ga0496119_0126065
1891 Ga0496121_0000456
1892 Ga0496121_0011588
1893 Ga0496121_0080209
1894 Ga0496121_0093992
1895 Ga0496121_0387200
1896 Ga0496124_0000685
1897 Ga0496124_0231946
1898 Ga0496125_0062506
1899 Ga0496125_0234418
1900 Ga0496125_0411712
1901 Ga0496126_0002820
1902 Ga0496126_0007653
1903 Ga0496126_0010701
1904 Ga0496126_0111157
1905 Ga0496126_0286451
1906 Ga0496126_0294066
1907 Ga0496126_0369571
1908 Ga0501036_1577035
1909 Ga0501046_0145221
1910 Ga0501067_0021493
1911 Ga0501067_0149277
1912 Ga0501070_0773034
1913 Ga0501076_0409288
1914 Ga0501083_1031677
1915 Ga0501035_0193141
1916 Ga0501045_0832842
1917 nmdc:mga03683_133759_c1
1918 nmdc:mga03683_31439_c1
1919 nmdc:mga03683_339833_c1
1920 nmdc:mga03n38_16168_c1
1921 nmdc:mga03n38_27443_c1
1922 nmdc:mga03n38_37121_c1
1923 nmdc:mga00v17_22557_c1
1924 nmdc:mga00v17_351141_c1
1925 nmdc:mga0yw44_1163403_c1
1926 nmdc:mga0yw44_320441_c1
1927 nmdc:mga0yw44_332466_c1
1928 nmdc:mga0yw44_34735_c1
1929 nmdc:mga0yw44_528599_c1
1930 nmdc:mga0yw44_5923_c1
1931 nmdc:mga0k408_103122_c1
1932 nmdc:mga0k408_167258_c1
1933 nmdc:mga0k408_334839_c1
1934 nmdc:mga0k408_511767_c1
1935 nmdc:mga06z11_118768_c1
1936 nmdc:mga04h51_84363_c1
1937 nmdc:mga07m45_421575_c1
1938 nmdc:mga07m45_55711_c1
1939 nmdc:mga05p37_209207_c1
1940 nmdc:mga0qj67_224802_c1
1941 nmdc:mga08y16_228382_c1
1942 nmdc:mga0rr50_628964_c1
1943 nmdc:mga0sz30_19314_c1
1944 Ga0495601_0085005
1945 Ga0495601_0119969
1946 Ga0495601_0290864
1947 Ga0495612_0108278
1948 Ga0495612_0219544
1949 Ga0500635_0033304
1950 Ga0495655_0144660
1951 Ga0495595_0006061
1952 Ga0495595_0022229
1953 Ga0495619_0002231
1954 Ga0495619_0037434
1955 Ga0495619_0190472
1956 Ga0495619_0206880
1957 Ga0495619_0491269
1958 Ga0500646_0145632
1959 Ga0500647_0018439
1960 Ga0500647_0245693
1961 Ga0500583_0137708
1962 Ga0500651_0189209
1963 Ga0500566_0013410
1964 Ga0500566_0285489
1965 Ga0500640_005820
1966 Ga0500641_0011445
1967 Ga0500641_0077801
1968 Ga0500641_0174650
1969 Ga0500648_074567
1970 Ga0500556_0061823
1971 Ga0500562_052210
1972 Ga0500572_000217
1973 Ga0500582_190476
1974 Ga0500595_000438
1975 Ga0500595_034504
1976 Ga0500595_046627
1977 Ga0500597_343811
1978 Ga0500608_002059
1979 Ga0500614_001377
1980 Ga0500642_0056964
1981 Ga0500642_0512600
1982 Ga0500658_0069098
1983 Ga0500658_0154435
1984 Ga0500559_0008610
1985 Ga0500559_0458831
1986 Ga0500568_0010219
1987 Ga0500573_0069876
1988 Ga0500588_0093026
1989 Ga0500603_002023
1990 Ga0500604_0023541
1991 Ga0500630_000537
1992 Ga0500634_0008812
1993 Ga0500638_000078
1994 Ga0500638_013999
1995 Ga0500638_071658
1996 Ga0500639_000001
1997 Ga0500639_086000
1998 Ga0500636_0093571
1999 Ga0500637_0000088
2000 Ga0500637_0094657
2001 Ga0500637_0397258
2002 Ga0500576_061368
2003 Ga0500609_036777
2004 Ga0500596_001084
2005 Ga0500596_017423
2006 Ga0500601_005309
2007 Ga0500661_000025
2008 Ga0501082_0218887
2009 2513675889
2010 2513692589
2011 2524468938
2012 2723845025
2013 2793082108
2014 2874605259
2015 2885386549
2016 2889039777
2017 2903774128
2018 2922365418
2019 2922391027
2020 8006965805
2021 8006986457
2022 8006995974
2023 8056673807
2024 8056686711

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02077

SURF4

SURF4 family

83

168

0.89

PF07681

DoxX

DoxX

30

130

0.79

PF05514

HR_lesion

HR-like lesion-inducing

27

161

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
7a0g-assembly1.cif.gz_EEE structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. 0.4833 6 135
7a0g-assembly1.cif.gz_FFF structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. 0.4695 6 136
5szk-assembly1.cif.gz_A structure of human n-terminally engineered rab1b in complex with the bmerb domain of mical-cl 0.4465 7 135
6o3e-assembly1.cif.gz_B mouse ae-catenin 82-883 0.4444 13 132
5szi-assembly1.cif.gz_B structure of human rab8a in complex with the bmerb domain of mical-cl 0.4414 7 135
ID Description Score Start End Superfamily
5jdlA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.6163 6 91 6.10.280.80
af_Q19983_1_107_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.592 5 81 1.20.5.780
5jdlA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.56 6 91 6.10.280.80
af_Q6AYR9_1_113_1.20.5.780 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Single helix bin 0.5226 3 97 1.20.5.780
af_A0A2R8QPH7_1_107_1.20.5.110 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces; 0.4932 3 102 1.20.5.110
ID Description Score Start End GO Terms
AF-A0A431NXQ7-F1-model_v4 deleted 0.6744 1 117
AF-A0A431NXQ7-F1-model_v4 deleted 0.6633 1 117
AF-A0A1J5PBD5-F1-model_v4 Inner membrane protein YphA 0.605 60 147 GO:0016020
AF-A0A1J5PBD5-F1-model_v4 Inner membrane protein YphA 0.5797 60 147 GO:0016020
AF-A0A533J396-F1-model_v4 deleted 0.5756 1 129

Map