F488175
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1012 | 400 | 2024 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0034467|Ga0466963_0034467_1316_2086 |
| Length | 256 |
| Sequence | LKIAIDGLSSSAPVDDPVFTGVAMYQRAIVYWMPACAGHEQSEEGGGAVIKIWGRNTSSNVQKVMWAVGEMGLPHQRIDIGGPFGKNREPAYLAMNPNGLVPTLEEADGFLLWESNSIVRYLAAKHKSAELEPPDPHARGRASQWMDWQLSVCGPAITPVFWGLIRTPPEKRDHAAIEAGKKNTTAAMLMVDEQLAKTAYLAGDAFSYGDIPVGIMAYRYRQLVPERPALKNFERWYAAISGRQAFKDQVGAVPLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 137 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 211 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 220 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 221 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 222 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 224 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 226 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 248 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 249 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 250 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 251 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 257 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 258 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 259 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 260 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 261 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 262 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 263 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 264 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 265 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 373 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 375 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 376 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 377 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 387 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 393 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 394 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 395 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 396 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 397 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.35 |
| Nodule | 0 |
| Rhizoplane | 9.88 |
| Rhizosphere | 83.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466963_0034467 | 3300044694 | Bacteria | 3293 |
| 2 | JGI24737J22298_10023897 | 3300001990 | Bacteria | 1937 |
| 3 | JGI24743J22301_10000589 | 3300001991 | Bacteria | 4389 |
| 4 | JGI24738J21930_10011323 | 3300002075 | Bacteria | 1963 |
| 5 | JGI24742J22300_10000606 | 3300002244 | Bacteria | 5393 |
| 6 | JGI25404J52841_10004866 | 3300003659 | Bacteria | 2754 |
| 7 | Ga0058862_12191086 | 3300004803 | Bacteria | 762 |
| 8 | Ga0065707_10160974 | 3300005295 | Bacteria | 1563 |
| 9 | Ga0070658_10120406 | 3300005327 | Bacteria | 2181 |
| 10 | Ga0070658_10210450 | 3300005327 | Bacteria | 1642 |
| 11 | Ga0070658_10485900 | 3300005327 | Bacteria | 1066 |
| 12 | Ga0070683_100011408 | 3300005329 | Bacteria | 7681 |
| 13 | Ga0070683_100040594 | 3300005329 | Bacteria | 4280 |
| 14 | Ga0070683_100311639 | 3300005329 | Bacteria | 1497 |
| 15 | Ga0070690_100015826 | 3300005330 | Bacteria | 4506 |
| 16 | Ga0070690_100556198 | 3300005330 | Bacteria | 866 |
| 17 | Ga0070670_100028487 | 3300005331 | Bacteria | 4807 |
| 18 | Ga0070670_100071135 | 3300005331 | Bacteria | 2986 |
| 19 | Ga0068869_100216323 | 3300005334 | Bacteria | 1517 |
| 20 | Ga0070666_10088544 | 3300005335 | Bacteria | 2124 |
| 21 | Ga0070666_10398149 | 3300005335 | Bacteria | 990 |
| 22 | Ga0070680_100001118 | 3300005336 | Bacteria | 19276 |
| 23 | Ga0070680_100109890 | 3300005336 | Bacteria | 2294 |
| 24 | Ga0070682_100022863 | 3300005337 | Bacteria | 3708 |
| 25 | Ga0070682_100605448 | 3300005337 | Bacteria | 866 |
| 26 | Ga0068868_100009632 | 3300005338 | Bacteria | 6968 |
| 27 | Ga0068868_100353123 | 3300005338 | Bacteria | 1260 |
| 28 | Ga0070660_100195675 | 3300005339 | Bacteria | 1639 |
| 29 | Ga0070660_100478208 | 3300005339 | Bacteria | 1035 |
| 30 | Ga0070660_100522540 | 3300005339 | Bacteria | 989 |
| 31 | Ga0070689_100001113 | 3300005340 | Bacteria | 16894 |
| 32 | Ga0070689_100194769 | 3300005340 | Bacteria | 1652 |
| 33 | Ga0070691_10005401 | 3300005341 | Bacteria | 5812 |
| 34 | Ga0070687_100199493 | 3300005343 | Bacteria | 1211 |
| 35 | Ga0070687_100211035 | 3300005343 | Bacteria | 1183 |
| 36 | Ga0070661_100135873 | 3300005344 | Bacteria | 1850 |
| 37 | Ga0070661_100881023 | 3300005344 | Unclassified | 738 |
| 38 | Ga0070692_10022160 | 3300005345 | Bacteria | 3101 |
| 39 | Ga0070668_100113320 | 3300005347 | Bacteria | 2160 |
| 40 | Ga0070669_100140181 | 3300005353 | Unclassified | 1863 |
| 41 | Ga0070669_100206839 | 3300005353 | Bacteria | 1547 |
| 42 | Ga0070675_100018009 | 3300005354 | Bacteria | 5622 |
| 43 | Ga0070675_100445561 | 3300005354 | Bacteria | 1161 |
| 44 | Ga0070671_100010831 | 3300005355 | Bacteria | 7316 |
| 45 | Ga0070674_100018571 | 3300005356 | Bacteria | 4400 |
| 46 | Ga0070674_100026532 | 3300005356 | Bacteria | 3786 |
| 47 | Ga0070673_100003804 | 3300005364 | Bacteria | 9468 |
| 48 | Ga0070673_100227319 | 3300005364 | Bacteria | 1617 |
| 49 | Ga0070673_100520815 | 3300005364 | Bacteria | 1078 |
| 50 | Ga0070673_100954090 | 3300005364 | Bacteria | 797 |
| 51 | Ga0070688_100005939 | 3300005365 | Bacteria | 6468 |
| 52 | Ga0070688_100028550 | 3300005365 | Bacteria | 3332 |
| 53 | Ga0070688_100051339 | 3300005365 | Bacteria | 2572 |
| 54 | Ga0070659_100124649 | 3300005366 | Bacteria | 2090 |
| 55 | Ga0070659_100410292 | 3300005366 | Bacteria | 1144 |
| 56 | Ga0070659_100994151 | 3300005366 | Bacteria | 736 |
| 57 | Ga0070667_100029214 | 3300005367 | Bacteria | 4593 |
| 58 | Ga0070703_10010838 | 3300005406 | Bacteria | 2572 |
| 59 | Ga0070709_10011931 | 3300005434 | Bacteria | 4854 |
| 60 | Ga0070709_10159441 | 3300005434 | Bacteria | 1567 |
| 61 | Ga0070709_10935785 | 3300005434 | Bacteria | 687 |
| 62 | Ga0070714_100003288 | 3300005435 | Bacteria | 12043 |
| 63 | Ga0070714_100058344 | 3300005435 | Bacteria | 3306 |
| 64 | Ga0070714_100206856 | 3300005435 | Bacteria | 1797 |
| 65 | Ga0070714_100309305 | 3300005435 | Bacteria | 1475 |
| 66 | Ga0070714_100665610 | 3300005435 | Bacteria | 1003 |
| 67 | Ga0070713_100022225 | 3300005436 | Bacteria | 4898 |
| 68 | Ga0070713_100108922 | 3300005436 | Bacteria | 2412 |
| 69 | Ga0070713_100125140 | 3300005436 | Bacteria | 2260 |
| 70 | Ga0070713_100586417 | 3300005436 | Bacteria | 1058 |
| 71 | Ga0070710_10047384 | 3300005437 | Bacteria | 2397 |
| 72 | Ga0070711_100028231 | 3300005439 | Bacteria | 3691 |
| 73 | Ga0070711_100036765 | 3300005439 | Bacteria | 3282 |
| 74 | Ga0070711_100080849 | 3300005439 | Bacteria | 2315 |
| 75 | Ga0070711_100142841 | 3300005439 | Bacteria | 1796 |
| 76 | Ga0070705_100054251 | 3300005440 | Bacteria | 2350 |
| 77 | Ga0070705_100189603 | 3300005440 | Bacteria | 1400 |
| 78 | Ga0070700_100066485 | 3300005441 | Bacteria | 2288 |
| 79 | Ga0070700_100712784 | 3300005441 | Bacteria | 799 |
| 80 | Ga0070694_100074074 | 3300005444 | Bacteria | 2353 |
| 81 | Ga0070694_100585525 | 3300005444 | Bacteria | 897 |
| 82 | Ga0070708_100218484 | 3300005445 | Bacteria | 1787 |
| 83 | Ga0070663_100086303 | 3300005455 | Bacteria | 2317 |
| 84 | Ga0070663_100358866 | 3300005455 | Bacteria | 1182 |
| 85 | Ga0070678_100025730 | 3300005456 | Bacteria | 3966 |
| 86 | Ga0070678_100033430 | 3300005456 | Bacteria | 3571 |
| 87 | Ga0070678_100376024 | 3300005456 | Bacteria | 1228 |
| 88 | Ga0070662_100019278 | 3300005457 | Bacteria | 4630 |
| 89 | Ga0070681_10523966 | 3300005458 | Bacteria | 1098 |
| 90 | Ga0070681_11030727 | 3300005458 | Bacteria | 743 |
| 91 | Ga0068867_100019113 | 3300005459 | Bacteria | 4879 |
| 92 | Ga0068867_100725869 | 3300005459 | Bacteria | 879 |
| 93 | Ga0068867_100886910 | 3300005459 | Bacteria | 802 |
| 94 | Ga0070685_10008870 | 3300005466 | Bacteria | 5185 |
| 95 | Ga0070707_100101717 | 3300005468 | Bacteria | 2785 |
| 96 | Ga0070698_100012347 | 3300005471 | Bacteria | 9045 |
| 97 | Ga0070698_100807164 | 3300005471 | Bacteria | 882 |
| 98 | Ga0070699_100123881 | 3300005518 | Bacteria | 2274 |
| 99 | Ga0070699_100573922 | 3300005518 | Bacteria | 1027 |
| 100 | Ga0070699_101090168 | 3300005518 | Bacteria | 732 |
| 101 | Ga0070679_100023849 | 3300005530 | Bacteria | 5994 |
| 102 | Ga0070684_100004629 | 3300005535 | Bacteria | 10494 |
| 103 | Ga0070684_100110848 | 3300005535 | Bacteria | 2460 |
| 104 | Ga0070684_100165021 | 3300005535 | Bacteria | 2010 |
| 105 | Ga0070684_100436286 | 3300005535 | Bacteria | 1210 |
| 106 | Ga0070697_100036459 | 3300005536 | Bacteria | 3973 |
| 107 | Ga0070697_100140324 | 3300005536 | Unclassified | 2032 |
| 108 | Ga0070697_100666805 | 3300005536 | Bacteria | 916 |
| 109 | Ga0068853_100328104 | 3300005539 | Bacteria | 1420 |
| 110 | Ga0070672_100014289 | 3300005543 | Bacteria | 5624 |
| 111 | Ga0070686_100015033 | 3300005544 | Bacteria | 4474 |
| 112 | Ga0070686_100122087 | 3300005544 | Bacteria | 1790 |
| 113 | Ga0070686_100489299 | 3300005544 | Bacteria | 953 |
| 114 | Ga0070695_100052568 | 3300005545 | Bacteria | 2618 |
| 115 | Ga0070695_100545741 | 3300005545 | Bacteria | 903 |
| 116 | Ga0070693_100359509 | 3300005547 | Bacteria | 999 |
| 117 | Ga0070665_100176983 | 3300005548 | Bacteria | 2134 |
| 118 | Ga0070665_100295067 | 3300005548 | Bacteria | 1624 |
| 119 | Ga0070665_100374217 | 3300005548 | Bacteria | 1431 |
| 120 | Ga0070665_100525754 | 3300005548 | Bacteria | 1195 |
| 121 | Ga0070665_100681923 | 3300005548 | Bacteria | 1041 |
| 122 | Ga0070665_100836225 | 3300005548 | Bacteria | 934 |
| 123 | Ga0070704_100001250 | 3300005549 | Bacteria | 13398 |
| 124 | Ga0070704_100377119 | 3300005549 | Bacteria | 1204 |
| 125 | Ga0070704_100543519 | 3300005549 | Bacteria | 1014 |
| 126 | Ga0070704_100807306 | 3300005549 | Bacteria | 839 |
| 127 | Ga0068855_100126004 | 3300005563 | Bacteria | 2928 |
| 128 | Ga0068855_100472019 | 3300005563 | Bacteria | 1367 |
| 129 | Ga0068855_100762977 | 3300005563 | Bacteria | 1031 |
| 130 | Ga0070664_100024037 | 3300005564 | Bacteria | 5037 |
| 131 | Ga0070664_100118550 | 3300005564 | Bacteria | 2315 |
| 132 | Ga0070664_100171265 | 3300005564 | Bacteria | 1926 |
| 133 | Ga0068854_100016650 | 3300005578 | Bacteria | 4905 |
| 134 | Ga0068856_100001606 | 3300005614 | Bacteria | 23628 |
| 135 | Ga0068856_100016444 | 3300005614 | Bacteria | 7159 |
| 136 | Ga0068856_100210294 | 3300005614 | Bacteria | 1960 |
| 137 | Ga0068856_100502094 | 3300005614 | Bacteria | 1234 |
| 138 | Ga0070702_100008194 | 3300005615 | Bacteria | 5047 |
| 139 | Ga0068852_100001045 | 3300005616 | Bacteria | 18230 |
| 140 | Ga0068859_100025009 | 3300005617 | Bacteria | 5993 |
| 141 | Ga0068859_100335208 | 3300005617 | Bacteria | 1607 |
| 142 | Ga0068859_100792025 | 3300005617 | Bacteria | 1036 |
| 143 | Ga0068864_100001978 | 3300005618 | Bacteria | 16866 |
| 144 | Ga0068866_10011518 | 3300005718 | Bacteria | 3828 |
| 145 | Ga0068851_10025091 | 3300005834 | Bacteria | 2922 |
| 146 | Ga0068870_10014577 | 3300005840 | Bacteria | 3714 |
| 147 | Ga0068863_100019233 | 3300005841 | Bacteria | 6535 |
| 148 | Ga0068858_100022418 | 3300005842 | Bacteria | 5894 |
| 149 | Ga0068858_100116932 | 3300005842 | Bacteria | 2492 |
| 150 | Ga0068858_100184675 | 3300005842 | Bacteria | 1969 |
| 151 | Ga0068860_100054877 | 3300005843 | Bacteria | 3787 |
| 152 | Ga0068860_101087720 | 3300005843 | Bacteria | 819 |
| 153 | Ga0068862_100024602 | 3300005844 | Bacteria | 5054 |
| 154 | Ga0068862_100059517 | 3300005844 | Bacteria | 3280 |
| 155 | Ga0068862_100283175 | 3300005844 | Bacteria | 1520 |
| 156 | Ga0068862_100617918 | 3300005844 | Bacteria | 1042 |
| 157 | Ga0081455_10001354 | 3300005937 | Bacteria | 30285 |
| 158 | Ga0081455_10300774 | 3300005937 | Bacteria | 1151 |
| 159 | Ga0081538_10034525 | 3300005981 | Bacteria | 3342 |
| 160 | Ga0081538_10150658 | 3300005981 | Bacteria | 1054 |
| 161 | Ga0081540_1001046 | 3300005983 | Bacteria | 24692 |
| 162 | Ga0081540_1002282 | 3300005983 | Bacteria | 15746 |
| 163 | Ga0081540_1003104 | 3300005983 | Bacteria | 13307 |
| 164 | Ga0081540_1100145 | 3300005983 | Bacteria | 1250 |
| 165 | Ga0081539_10003208 | 3300005985 | Bacteria | 20654 |
| 166 | Ga0070717_10247489 | 3300006028 | Bacteria | 1574 |
| 167 | Ga0070717_10349049 | 3300006028 | Bacteria | 1323 |
| 168 | Ga0075365_10004171 | 3300006038 | Bacteria | 7608 |
| 169 | Ga0075365_10009965 | 3300006038 | Bacteria | 5502 |
| 170 | Ga0075365_10011665 | 3300006038 | Bacteria | 5178 |
| 171 | Ga0075365_10208576 | 3300006038 | Bacteria | 1370 |
| 172 | Ga0075365_10247488 | 3300006038 | Bacteria | 1252 |
| 173 | Ga0075365_10352560 | 3300006038 | Bacteria | 1037 |
| 174 | Ga0075365_10572926 | 3300006038 | Bacteria | 798 |
| 175 | Ga0075368_10012897 | 3300006042 | Bacteria | 3061 |
| 176 | Ga0075368_10018094 | 3300006042 | Bacteria | 2644 |
| 177 | Ga0075368_10086403 | 3300006042 | Bacteria | 1280 |
| 178 | Ga0075363_100009278 | 3300006048 | Bacteria | 4621 |
| 179 | Ga0075363_100025914 | 3300006048 | Bacteria | 2995 |
| 180 | Ga0075364_10100398 | 3300006051 | Bacteria | 1926 |
| 181 | Ga0075364_10124588 | 3300006051 | Bacteria | 1726 |
| 182 | Ga0075364_10260995 | 3300006051 | Bacteria | 1178 |
| 183 | Ga0070715_10005759 | 3300006163 | Bacteria | 4163 |
| 184 | Ga0070716_100016606 | 3300006173 | Bacteria | 3803 |
| 185 | Ga0070712_100052161 | 3300006175 | Bacteria | 2851 |
| 186 | Ga0070712_100076048 | 3300006175 | Bacteria | 2417 |
| 187 | Ga0070712_100579723 | 3300006175 | Bacteria | 948 |
| 188 | Ga0075362_10003444 | 3300006177 | Bacteria | 5528 |
| 189 | Ga0075367_10002008 | 3300006178 | Bacteria | 9074 |
| 190 | Ga0075367_10013529 | 3300006178 | Bacteria | 4390 |
| 191 | Ga0075367_10039306 | 3300006178 | Bacteria | 2758 |
| 192 | Ga0075367_10312623 | 3300006178 | Bacteria | 989 |
| 193 | Ga0097621_100020748 | 3300006237 | Bacteria | 5068 |
| 194 | Ga0075370_10038028 | 3300006353 | Bacteria | 2708 |
| 195 | Ga0075370_10108901 | 3300006353 | Bacteria | 1608 |
| 196 | Ga0068871_100016774 | 3300006358 | Bacteria | 5527 |
| 197 | Ga0068871_100892732 | 3300006358 | Bacteria | 823 |
| 198 | Ga0075428_100000617 | 3300006844 | Bacteria | 36390 |
| 199 | Ga0075428_100062074 | 3300006844 | Bacteria | 4092 |
| 200 | Ga0075428_100082995 | 3300006844 | Bacteria | 3496 |
| 201 | Ga0075428_100194841 | 3300006844 | Bacteria | 2191 |
| 202 | Ga0075428_100378884 | 3300006844 | Bacteria | 1517 |
| 203 | Ga0075428_100532816 | 3300006844 | Bacteria | 1256 |
| 204 | Ga0075428_100578115 | 3300006844 | Bacteria | 1201 |
| 205 | Ga0075430_100045690 | 3300006846 | Bacteria | 3699 |
| 206 | Ga0075431_100073995 | 3300006847 | Bacteria | 3515 |
| 207 | Ga0075431_100108855 | 3300006847 | Bacteria | 2860 |
| 208 | Ga0075431_100171298 | 3300006847 | Bacteria | 2230 |
| 209 | Ga0075431_100820232 | 3300006847 | Bacteria | 903 |
| 210 | Ga0075431_100883641 | 3300006847 | Bacteria | 864 |
| 211 | Ga0075433_10043573 | 3300006852 | Bacteria | 3896 |
| 212 | Ga0075433_10622550 | 3300006852 | Bacteria | 947 |
| 213 | Ga0075434_100070901 | 3300006871 | Bacteria | 3475 |
| 214 | Ga0075434_100103915 | 3300006871 | Bacteria | 2850 |
| 215 | Ga0075434_100131094 | 3300006871 | Bacteria | 2526 |
| 216 | Ga0075434_100540835 | 3300006871 | Bacteria | 1185 |
| 217 | Ga0075434_100622901 | 3300006871 | Bacteria | 1098 |
| 218 | Ga0075434_100811838 | 3300006871 | Bacteria | 951 |
| 219 | Ga0075434_100992981 | 3300006871 | Bacteria | 853 |
| 220 | Ga0075434_101018597 | 3300006871 | Bacteria | 842 |
| 221 | Ga0075429_100000081 | 3300006880 | Bacteria | 49207 |
| 222 | Ga0075429_100271902 | 3300006880 | Bacteria | 1484 |
| 223 | Ga0075429_100430352 | 3300006880 | Bacteria | 1156 |
| 224 | Ga0068865_100174258 | 3300006881 | Bacteria | 1652 |
| 225 | Ga0075436_100004004 | 3300006914 | Bacteria | 10108 |
| 226 | Ga0075436_100004115 | 3300006914 | Bacteria | 9977 |
| 227 | Ga0075436_100090088 | 3300006914 | Bacteria | 2132 |
| 228 | Ga0075436_100129957 | 3300006914 | Bacteria | 1766 |
| 229 | Ga0097620_100025009 | 3300006931 | Bacteria | 5993 |
| 230 | Ga0097620_100335219 | 3300006931 | Bacteria | 1607 |
| 231 | Ga0097620_100792112 | 3300006931 | Bacteria | 1036 |
| 232 | Ga0075435_100275497 | 3300007076 | Bacteria | 1436 |
| 233 | Ga0075435_100316413 | 3300007076 | Bacteria | 1336 |
| 234 | Ga0075435_100667463 | 3300007076 | Bacteria | 903 |
| 235 | Ga0075435_100694013 | 3300007076 | Bacteria | 885 |
| 236 | Ga0099794_10011365 | 3300007265 | Bacteria | 3809 |
| 237 | Ga0099794_10017902 | 3300007265 | Bacteria | 3167 |
| 238 | Ga0099794_10019828 | 3300007265 | Bacteria | 3036 |
| 239 | Ga0099795_10059973 | 3300007788 | Bacteria | 1409 |
| 240 | Ga0105251_10019995 | 3300009011 | Bacteria | 3524 |
| 241 | Ga0105250_10036971 | 3300009092 | Bacteria | 1959 |
| 242 | Ga0105240_10012327 | 3300009093 | Bacteria | 11807 |
| 243 | Ga0105240_10215904 | 3300009093 | Bacteria | 2238 |
| 244 | Ga0105240_10744984 | 3300009093 | Bacteria | 1066 |
| 245 | Ga0111539_10089724 | 3300009094 | Bacteria | 3612 |
| 246 | Ga0111539_10109039 | 3300009094 | Bacteria | 3249 |
| 247 | Ga0111539_10150665 | 3300009094 | Bacteria | 2722 |
| 248 | Ga0111539_10229442 | 3300009094 | Bacteria | 2162 |
| 249 | Ga0111539_10286824 | 3300009094 | Bacteria | 1916 |
| 250 | Ga0111539_10565452 | 3300009094 | Bacteria | 1324 |
| 251 | Ga0111539_10577925 | 3300009094 | Bacteria | 1309 |
| 252 | Ga0111539_10578423 | 3300009094 | Bacteria | 1308 |
| 253 | Ga0111539_11212562 | 3300009094 | Bacteria | 876 |
| 254 | Ga0105245_10051077 | 3300009098 | Bacteria | 3707 |
| 255 | Ga0105245_10231631 | 3300009098 | Bacteria | 1787 |
| 256 | Ga0105245_11406078 | 3300009098 | Bacteria | 748 |
| 257 | Ga0114129_10002113 | 3300009147 | Bacteria | 27369 |
| 258 | Ga0114129_10011617 | 3300009147 | Bacteria | 12537 |
| 259 | Ga0114129_10048513 | 3300009147 | Bacteria | 5966 |
| 260 | Ga0114129_10221243 | 3300009147 | Bacteria | 2554 |
| 261 | Ga0114129_10349571 | 3300009147 | Bacteria | 1959 |
| 262 | Ga0114129_11039546 | 3300009147 | Bacteria | 1029 |
| 263 | Ga0114129_11487948 | 3300009147 | Bacteria | 832 |
| 264 | Ga0114129_11489605 | 3300009147 | Bacteria | 832 |
| 265 | Ga0114129_11987904 | 3300009147 | Bacteria | 703 |
| 266 | Ga0105243_10440664 | 3300009148 | Bacteria | 1220 |
| 267 | Ga0105243_10605780 | 3300009148 | Bacteria | 1055 |
| 268 | Ga0105243_11436345 | 3300009148 | Bacteria | 711 |
| 269 | Ga0105241_10521919 | 3300009174 | Bacteria | 1062 |
| 270 | Ga0105242_10028336 | 3300009176 | Bacteria | 4458 |
| 271 | Ga0105242_10349934 | 3300009176 | Bacteria | 1364 |
| 272 | Ga0105248_10623085 | 3300009177 | Bacteria | 1217 |
| 273 | Ga0105237_10028064 | 3300009545 | Bacteria | 5734 |
| 274 | Ga0105237_10141603 | 3300009545 | Bacteria | 2399 |
| 275 | Ga0105238_10037417 | 3300009551 | Bacteria | 4933 |
| 276 | Ga0105238_10154909 | 3300009551 | Bacteria | 2267 |
| 277 | Ga0105238_10160965 | 3300009551 | Bacteria | 2220 |
| 278 | Ga0105238_10345146 | 3300009551 | Bacteria | 1477 |
| 279 | Ga0105238_10459267 | 3300009551 | Bacteria | 1271 |
| 280 | Ga0105238_10563447 | 3300009551 | Unclassified | 1144 |
| 281 | Ga0105249_10015086 | 3300009553 | Bacteria | 6835 |
| 282 | Ga0105249_10579958 | 3300009553 | Bacteria | 1175 |
| 283 | Ga0105249_10672243 | 3300009553 | Bacteria | 1094 |
| 284 | Ga0099796_10010230 | 3300010159 | Bacteria | 2572 |
| 285 | Ga0099796_10023258 | 3300010159 | Bacteria | 1933 |
| 286 | Ga0105239_10031952 | 3300010375 | Bacteria | 5784 |
| 287 | Ga0105239_10188702 | 3300010375 | Bacteria | 2307 |
| 288 | Ga0105239_10308693 | 3300010375 | Bacteria | 1783 |
| 289 | Ga0105239_10522002 | 3300010375 | Bacteria | 1351 |
| 290 | Ga0105239_11216837 | 3300010375 | Bacteria | 868 |
| 291 | Ga0157373_10093120 | 3300013100 | Bacteria | 2122 |
| 292 | Ga0157370_10980725 | 3300013104 | Bacteria | 765 |
| 293 | Ga0157369_10011724 | 3300013105 | Bacteria | 9953 |
| 294 | Ga0157369_10158993 | 3300013105 | Bacteria | 2386 |
| 295 | Ga0157369_10541407 | 3300013105 | Bacteria | 1204 |
| 296 | Ga0157374_10083923 | 3300013296 | Bacteria | 3027 |
| 297 | Ga0157374_10298170 | 3300013296 | Bacteria | 1594 |
| 298 | Ga0157374_10369049 | 3300013296 | Bacteria | 1428 |
| 299 | Ga0157374_10720035 | 3300013296 | Bacteria | 1012 |
| 300 | Ga0157372_10018682 | 3300013307 | Bacteria | 7458 |
| 301 | Ga0157372_10088796 | 3300013307 | Bacteria | 3510 |
| 302 | Ga0157372_10245304 | 3300013307 | Bacteria | 2079 |
| 303 | Ga0157372_10277978 | 3300013307 | Bacteria | 1947 |
| 304 | Ga0157375_10009835 | 3300013308 | Bacteria | 8410 |
| 305 | Ga0157375_10796818 | 3300013308 | Bacteria | 1094 |
| 306 | Ga0163163_10303939 | 3300014325 | Bacteria | 1648 |
| 307 | Ga0163163_10372967 | 3300014325 | Bacteria | 1484 |
| 308 | Ga0163163_10390837 | 3300014325 | Bacteria | 1449 |
| 309 | Ga0157380_10405511 | 3300014326 | Bacteria | 1295 |
| 310 | Ga0157380_10710931 | 3300014326 | Bacteria | 1011 |
| 311 | Ga0157380_11157619 | 3300014326 | Bacteria | 815 |
| 312 | Ga0157377_10004874 | 3300014745 | Bacteria | 6241 |
| 313 | Ga0157379_10027886 | 3300014968 | Bacteria | 5026 |
| 314 | Ga0157379_10659050 | 3300014968 | Bacteria | 980 |
| 315 | Ga0157376_10135733 | 3300014969 | Bacteria | 2201 |
| 316 | Ga0163161_10120185 | 3300017792 | Bacteria | 1973 |
| 317 | Ga0163161_10780922 | 3300017792 | Bacteria | 801 |
| 318 | Ga0213872_10021062 | 3300021361 | Bacteria | 3002 |
| 319 | Ga0213876_10077341 | 3300021384 | Bacteria | 1758 |
| 320 | Ga0213876_10099408 | 3300021384 | Bacteria | 1542 |
| 321 | Ga0213876_10101010 | 3300021384 | Bacteria | 1529 |
| 322 | Ga0213875_10000053 | 3300021388 | Bacteria | 141791 |
| 323 | Ga0213875_10158083 | 3300021388 | Bacteria | 1063 |
| 324 | Ga0224572_1004891 | 3300024225 | Bacteria | 2363 |
| 325 | Ga0228598_1000876 | 3300024227 | Bacteria | 6507 |
| 326 | Ga0228598_1020313 | 3300024227 | Bacteria | 1308 |
| 327 | Ga0207426_1013129 | 3300025302 | Bacteria | 3084 |
| 328 | Ga0207426_1056002 | 3300025302 | Bacteria | 1152 |
| 329 | Ga0207697_10030261 | 3300025315 | Bacteria | 2215 |
| 330 | Ga0207697_10032524 | 3300025315 | Bacteria | 2135 |
| 331 | Ga0207656_10016209 | 3300025321 | Bacteria | 2899 |
| 332 | Ga0207656_10247897 | 3300025321 | Bacteria | 872 |
| 333 | Ga0207692_10226083 | 3300025898 | Bacteria | 1111 |
| 334 | Ga0207642_10013018 | 3300025899 | Bacteria | 3021 |
| 335 | Ga0207688_10003415 | 3300025901 | Bacteria | 8665 |
| 336 | Ga0207680_10008657 | 3300025903 | Bacteria | 5010 |
| 337 | Ga0207680_10402985 | 3300025903 | Bacteria | 967 |
| 338 | Ga0207647_10064910 | 3300025904 | Bacteria | 2217 |
| 339 | Ga0207685_10031288 | 3300025905 | Bacteria | 1904 |
| 340 | Ga0207685_10102199 | 3300025905 | Bacteria | 1227 |
| 341 | Ga0207699_10014408 | 3300025906 | Bacteria | 4075 |
| 342 | Ga0207699_10316086 | 3300025906 | Bacteria | 1094 |
| 343 | Ga0207645_10048865 | 3300025907 | Bacteria | 2702 |
| 344 | Ga0207645_10049992 | 3300025907 | Bacteria | 2670 |
| 345 | Ga0207645_10398827 | 3300025907 | Bacteria | 925 |
| 346 | Ga0207643_10005672 | 3300025908 | Bacteria | 6678 |
| 347 | Ga0207705_10213428 | 3300025909 | Bacteria | 1464 |
| 348 | Ga0207705_10241045 | 3300025909 | Unclassified | 1377 |
| 349 | Ga0207684_10096437 | 3300025910 | Bacteria | 2524 |
| 350 | Ga0207707_10004277 | 3300025912 | Bacteria | 12633 |
| 351 | Ga0207707_10379776 | 3300025912 | Bacteria | 1215 |
| 352 | Ga0207707_10490182 | 3300025912 | Bacteria | 1049 |
| 353 | Ga0207695_10026716 | 3300025913 | Bacteria | 6440 |
| 354 | Ga0207695_11051143 | 3300025913 | Bacteria | 694 |
| 355 | Ga0207671_10077285 | 3300025914 | Bacteria | 2492 |
| 356 | Ga0207671_10214673 | 3300025914 | Bacteria | 1506 |
| 357 | Ga0207693_10002485 | 3300025915 | Bacteria | 16030 |
| 358 | Ga0207693_10041146 | 3300025915 | Bacteria | 3639 |
| 359 | Ga0207693_10063092 | 3300025915 | Bacteria | 2903 |
| 360 | Ga0207693_10185616 | 3300025915 | Bacteria | 1637 |
| 361 | Ga0207693_10226341 | 3300025915 | Bacteria | 1469 |
| 362 | Ga0207693_10284764 | 3300025915 | Bacteria | 1295 |
| 363 | Ga0207693_10458723 | 3300025915 | Unclassified | 996 |
| 364 | Ga0207663_10045292 | 3300025916 | Bacteria | 2705 |
| 365 | Ga0207663_10080623 | 3300025916 | Bacteria | 2129 |
| 366 | Ga0207663_10118085 | 3300025916 | Bacteria | 1811 |
| 367 | Ga0207660_10008666 | 3300025917 | Bacteria | 6579 |
| 368 | Ga0207660_10328117 | 3300025917 | Bacteria | 1223 |
| 369 | Ga0207662_10290993 | 3300025918 | Bacteria | 1083 |
| 370 | Ga0207662_10313530 | 3300025918 | Bacteria | 1046 |
| 371 | Ga0207657_10100027 | 3300025919 | Bacteria | 2408 |
| 372 | Ga0207657_10554022 | 3300025919 | Bacteria | 899 |
| 373 | Ga0207649_10007883 | 3300025920 | Bacteria | 5794 |
| 374 | Ga0207649_10189617 | 3300025920 | Bacteria | 1445 |
| 375 | Ga0207652_10083726 | 3300025921 | Bacteria | 2793 |
| 376 | Ga0207652_10648679 | 3300025921 | Unclassified | 944 |
| 377 | Ga0207652_10655105 | 3300025921 | Bacteria | 939 |
| 378 | Ga0207646_10268358 | 3300025922 | Bacteria | 1542 |
| 379 | Ga0207681_10118776 | 3300025923 | Unclassified | 1936 |
| 380 | Ga0207694_10129583 | 3300025924 | Bacteria | 2021 |
| 381 | Ga0207694_10290493 | 3300025924 | Bacteria | 1344 |
| 382 | Ga0207694_10499360 | 3300025924 | Bacteria | 1019 |
| 383 | Ga0207650_10031312 | 3300025925 | Bacteria | 3840 |
| 384 | Ga0207650_10071529 | 3300025925 | Bacteria | 2609 |
| 385 | Ga0207650_10149991 | 3300025925 | Bacteria | 1839 |
| 386 | Ga0207659_10298422 | 3300025926 | Bacteria | 1322 |
| 387 | Ga0207659_10309531 | 3300025926 | Bacteria | 1300 |
| 388 | Ga0207659_10552690 | 3300025926 | Bacteria | 979 |
| 389 | Ga0207687_10006331 | 3300025927 | Bacteria | 7824 |
| 390 | Ga0207687_10067357 | 3300025927 | Bacteria | 2547 |
| 391 | Ga0207687_10263202 | 3300025927 | Bacteria | 1376 |
| 392 | Ga0207700_10013689 | 3300025928 | Bacteria | 5289 |
| 393 | Ga0207700_10078066 | 3300025928 | Bacteria | 2574 |
| 394 | Ga0207700_10153148 | 3300025928 | Bacteria | 1907 |
| 395 | Ga0207700_10178347 | 3300025928 | Bacteria | 1777 |
| 396 | Ga0207700_10225900 | 3300025928 | Bacteria | 1589 |
| 397 | Ga0207700_10308481 | 3300025928 | Bacteria | 1368 |
| 398 | Ga0207700_10334744 | 3300025928 | Bacteria | 1315 |
| 399 | Ga0207664_10033479 | 3300025929 | Bacteria | 3948 |
| 400 | Ga0207664_10333892 | 3300025929 | Bacteria | 1339 |
| 401 | Ga0207664_10456388 | 3300025929 | Bacteria | 1141 |
| 402 | Ga0207644_10016623 | 3300025931 | Bacteria | 4953 |
| 403 | Ga0207644_10023230 | 3300025931 | Bacteria | 4244 |
| 404 | Ga0207644_10038217 | 3300025931 | Bacteria | 3380 |
| 405 | Ga0207644_10525956 | 3300025931 | Bacteria | 977 |
| 406 | Ga0207690_10018700 | 3300025932 | Bacteria | 4251 |
| 407 | Ga0207690_10104102 | 3300025932 | Bacteria | 2033 |
| 408 | Ga0207706_10038206 | 3300025933 | Bacteria | 4258 |
| 409 | Ga0207670_10017680 | 3300025936 | Bacteria | 4313 |
| 410 | Ga0207670_10020641 | 3300025936 | Bacteria | 4052 |
| 411 | Ga0207669_10005520 | 3300025937 | Bacteria | 5683 |
| 412 | Ga0207669_10286357 | 3300025937 | Bacteria | 1245 |
| 413 | Ga0207669_10471956 | 3300025937 | Bacteria | 998 |
| 414 | Ga0207669_10740924 | 3300025937 | Bacteria | 811 |
| 415 | Ga0207665_10004102 | 3300025939 | Bacteria | 9717 |
| 416 | Ga0207665_10067219 | 3300025939 | Bacteria | 2440 |
| 417 | Ga0207665_10097939 | 3300025939 | Bacteria | 2042 |
| 418 | Ga0207665_10855171 | 3300025939 | Bacteria | 720 |
| 419 | Ga0207691_10001627 | 3300025940 | Bacteria | 22294 |
| 420 | Ga0207691_10250595 | 3300025940 | Bacteria | 1528 |
| 421 | Ga0207711_10101018 | 3300025941 | Bacteria | 2552 |
| 422 | Ga0207711_10227872 | 3300025941 | Bacteria | 1706 |
| 423 | Ga0207711_10472488 | 3300025941 | Bacteria | 1168 |
| 424 | Ga0207689_10007012 | 3300025942 | Bacteria | 9907 |
| 425 | Ga0207661_10026523 | 3300025944 | Bacteria | 4415 |
| 426 | Ga0207661_10106947 | 3300025944 | Bacteria | 2359 |
| 427 | Ga0207679_10015638 | 3300025945 | Bacteria | 5020 |
| 428 | Ga0207679_10081985 | 3300025945 | Bacteria | 2468 |
| 429 | Ga0207679_10230954 | 3300025945 | Bacteria | 1562 |
| 430 | Ga0207667_10055984 | 3300025949 | Bacteria | 4144 |
| 431 | Ga0207667_10062848 | 3300025949 | Bacteria | 3881 |
| 432 | Ga0207667_10118214 | 3300025949 | Bacteria | 2732 |
| 433 | Ga0207667_10744060 | 3300025949 | Bacteria | 980 |
| 434 | Ga0207651_10135996 | 3300025960 | Bacteria | 1890 |
| 435 | Ga0207651_10269391 | 3300025960 | Bacteria | 1402 |
| 436 | Ga0207712_10234008 | 3300025961 | Bacteria | 1476 |
| 437 | Ga0207668_10007545 | 3300025972 | Bacteria | 6475 |
| 438 | Ga0207640_10019201 | 3300025981 | Bacteria | 4034 |
| 439 | Ga0207640_10341830 | 3300025981 | Bacteria | 1199 |
| 440 | Ga0207640_10529856 | 3300025981 | Bacteria | 986 |
| 441 | Ga0207658_10096845 | 3300025986 | Bacteria | 2302 |
| 442 | Ga0207658_10802301 | 3300025986 | Bacteria | 855 |
| 443 | Ga0207677_10126300 | 3300026023 | Bacteria | 1934 |
| 444 | Ga0207677_10391944 | 3300026023 | Bacteria | 1175 |
| 445 | Ga0207677_10667069 | 3300026023 | Bacteria | 919 |
| 446 | Ga0207703_10167640 | 3300026035 | Bacteria | 1929 |
| 447 | Ga0207703_10525085 | 3300026035 | Bacteria | 1114 |
| 448 | Ga0207703_10686420 | 3300026035 | Bacteria | 973 |
| 449 | Ga0207639_10158101 | 3300026041 | Bacteria | 1906 |
| 450 | Ga0207678_10020051 | 3300026067 | Bacteria | 5874 |
| 451 | Ga0207678_10334683 | 3300026067 | Bacteria | 1304 |
| 452 | Ga0207678_10370403 | 3300026067 | Bacteria | 1237 |
| 453 | Ga0207708_10001502 | 3300026075 | Bacteria | 17383 |
| 454 | Ga0207708_10152108 | 3300026075 | Bacteria | 1823 |
| 455 | Ga0207708_10896307 | 3300026075 | Bacteria | 767 |
| 456 | Ga0207702_10064733 | 3300026078 | Bacteria | 3129 |
| 457 | Ga0207702_11400396 | 3300026078 | Bacteria | 693 |
| 458 | Ga0207648_10006668 | 3300026089 | Bacteria | 11454 |
| 459 | Ga0207648_10074077 | 3300026089 | Bacteria | 2967 |
| 460 | Ga0207648_10278555 | 3300026089 | Bacteria | 1495 |
| 461 | Ga0207648_10710169 | 3300026089 | Bacteria | 932 |
| 462 | Ga0207676_10018586 | 3300026095 | Bacteria | 5056 |
| 463 | Ga0207675_100013475 | 3300026118 | Bacteria | 7630 |
| 464 | Ga0207675_100260100 | 3300026118 | Bacteria | 1682 |
| 465 | Ga0207683_10012333 | 3300026121 | Bacteria | 7294 |
| 466 | Ga0207683_10076816 | 3300026121 | Bacteria | 2957 |
| 467 | Ga0207683_10547128 | 3300026121 | Bacteria | 1070 |
| 468 | Ga0207698_10127091 | 3300026142 | Bacteria | 2170 |
| 469 | Ga0207698_10678084 | 3300026142 | Bacteria | 1024 |
| 470 | Ga0209179_1011531 | 3300027512 | Bacteria | 1568 |
| 471 | Ga0209588_1010903 | 3300027671 | Bacteria | 2738 |
| 472 | Ga0209588_1027516 | 3300027671 | Bacteria | 1809 |
| 473 | Ga0209813_10003719 | 3300027866 | Bacteria | 3594 |
| 474 | Ga0207428_10049012 | 3300027907 | Bacteria | 3386 |
| 475 | Ga0268266_10095158 | 3300028379 | Bacteria | 2616 |
| 476 | Ga0268266_10286712 | 3300028379 | Bacteria | 1532 |
| 477 | Ga0268266_10449037 | 3300028379 | Bacteria | 1225 |
| 478 | Ga0268266_10494120 | 3300028379 | Bacteria | 1168 |
| 479 | Ga0268266_10760726 | 3300028379 | Bacteria | 935 |
| 480 | Ga0268265_10011597 | 3300028380 | Bacteria | 5959 |
| 481 | Ga0268265_10597576 | 3300028380 | Bacteria | 1054 |
| 482 | Ga0268264_10858049 | 3300028381 | Bacteria | 910 |
| 483 | Ga0265334_10012318 | 3300028573 | Bacteria | 3595 |
| 484 | Ga0265338_10151314 | 3300028800 | Bacteria | 1802 |
| 485 | Ga0265763_1007016 | 3300030763 | Bacteria | 980 |
| 486 | Ga0265763_1008412 | 3300030763 | Bacteria | 921 |
| 487 | Ga0265773_1006882 | 3300031018 | Bacteria | 872 |
| 488 | Ga0265332_10006574 | 3300031238 | Bacteria | 5271 |
| 489 | Ga0265325_10002317 | 3300031241 | Bacteria | 12919 |
| 490 | Ga0265329_10070499 | 3300031242 | Bacteria | 1106 |
| 491 | Ga0265340_10015062 | 3300031247 | Bacteria | 4025 |
| 492 | Ga0265339_10000078 | 3300031249 | Bacteria | 83767 |
| 493 | Ga0265339_10019601 | 3300031249 | Bacteria | 3968 |
| 494 | Ga0265331_10154151 | 3300031250 | Bacteria | 1043 |
| 495 | Ga0265316_10228627 | 3300031344 | Bacteria | 1370 |
| 496 | Ga0265313_10003528 | 3300031595 | Bacteria | 12614 |
| 497 | Ga0265314_10022239 | 3300031711 | Bacteria | 4859 |
| 498 | Ga0265342_10002635 | 3300031712 | Bacteria | 15340 |
| 499 | Ga0316578_10268499 | 3300031728 | Bacteria | 1022 |
| 500 | Ga0373926_0022219 | 3300035083 | Bacteria | 2201 |
| 501 | Ga0373929_0111511 | 3300035085 | Bacteria | 700 |
| 502 | Ga0373944_0024358 | 3300035089 | Bacteria | 1773 |
| 503 | Ga0373952_0114059 | 3300035092 | Bacteria | 726 |
| 504 | Ga0373923_0002771 | 3300035111 | Bacteria | 5477 |
| 505 | Ga0373923_0078977 | 3300035111 | Bacteria | 1425 |
| 506 | Ga0373936_0003979 | 3300035113 | Bacteria | 5569 |
| 507 | Ga0373936_0010496 | 3300035113 | Bacteria | 3495 |
| 508 | Ga0373936_0104241 | 3300035113 | Bacteria | 1199 |
| 509 | Ga0373939_0069327 | 3300035114 | Bacteria | 1144 |
| 510 | Ga0373945_0001064 | 3300035116 | Bacteria | 8252 |
| 511 | Ga0373945_0005949 | 3300035116 | Bacteria | 3917 |
| 512 | Ga0373953_0004294 | 3300035117 | Bacteria | 4530 |
| 513 | Ga0373954_0000906 | 3300035118 | Bacteria | 11525 |
| 514 | Ga0373954_0002609 | 3300035118 | Bacteria | 7586 |
| 515 | Ga0373954_0058587 | 3300035118 | Bacteria | 1814 |
| 516 | Ga0373956_0000029 | 3300035119 | Bacteria | 45843 |
| 517 | Ga0373956_0033037 | 3300035119 | Bacteria | 2273 |
| 518 | Ga0373956_0339949 | 3300035119 | Bacteria | 715 |
| 519 | Ga0373957_0010530 | 3300035120 | Bacteria | 3060 |
| 520 | Ga0373957_0015261 | 3300035120 | Bacteria | 2641 |
| 521 | Ga0373960_0014720 | 3300035121 | Bacteria | 1986 |
| 522 | Ga0373943_0000208 | 3300035170 | Bacteria | 24045 |
| 523 | Ga0373943_0003827 | 3300035170 | Bacteria | 6840 |
| 524 | Ga0373943_0032102 | 3300035170 | Bacteria | 2494 |
| 525 | Ga0373943_0058368 | 3300035170 | Bacteria | 1921 |
| 526 | Ga0373946_0001814 | 3300035171 | Bacteria | 7457 |
| 527 | Ga0373946_0006567 | 3300035171 | Bacteria | 4221 |
| 528 | Ga0373946_0020608 | 3300035171 | Bacteria | 2549 |
| 529 | Ga0373955_0000201 | 3300035172 | Bacteria | 24761 |
| 530 | Ga0373955_0003420 | 3300035172 | Bacteria | 6976 |
| 531 | Ga0373942_0088537 | 3300035207 | Bacteria | 930 |
| 532 | Ga0373942_0185417 | 3300035207 | Unclassified | 683 |
| 533 | Ga0373961_0108448 | 3300035241 | Bacteria | 907 |
| 534 | Ga0373924_0062256 | 3300035410 | Bacteria | 1562 |
| 535 | Ga0373931_0024776 | 3300035691 | Bacteria | 3043 |
| 536 | Ga0373931_0049908 | 3300035691 | Bacteria | 2225 |
| 537 | Ga0373931_0177648 | 3300035691 | Bacteria | 1259 |
| 538 | Ga0373935_0000068 | 3300035692 | Bacteria | 43997 |
| 539 | Ga0373935_0048992 | 3300035692 | Bacteria | 2677 |
| 540 | Ga0373935_0213117 | 3300035692 | Bacteria | 1339 |
| 541 | Ga0373935_0431288 | 3300035692 | Bacteria | 950 |
| 542 | Ga0373927_0005387 | 3300035695 | Bacteria | 8840 |
| 543 | Ga0373927_0006191 | 3300035695 | Bacteria | 8171 |
| 544 | Ga0373927_0026505 | 3300035695 | Bacteria | 3788 |
| 545 | Ga0373927_0028489 | 3300035695 | Bacteria | 3643 |
| 546 | Ga0373927_0039331 | 3300035695 | Bacteria | 3069 |
| 547 | Ga0373927_0067847 | 3300035695 | Bacteria | 2308 |
| 548 | Ga0373927_0179490 | 3300035695 | Bacteria | 1389 |
| 549 | Ga0373927_0331838 | 3300035695 | Bacteria | 1002 |
| 550 | Ga0373933_0002902 | 3300035724 | Bacteria | 9577 |
| 551 | Ga0373933_0003207 | 3300035724 | Bacteria | 9130 |
| 552 | Ga0373933_0534282 | 3300035724 | Bacteria | 769 |
| 553 | Ga0373933_0647813 | 3300035724 | Bacteria | 694 |
| 554 | Ga0373947_0000178 | 3300035725 | Bacteria | 34953 |
| 555 | Ga0373947_0002537 | 3300035725 | Bacteria | 10978 |
| 556 | Ga0373947_0023662 | 3300035725 | Bacteria | 3575 |
| 557 | Ga0373947_0064449 | 3300035725 | Bacteria | 2234 |
| 558 | Ga0373947_0102805 | 3300035725 | Bacteria | 1797 |
| 559 | Ga0373947_0125390 | 3300035725 | Bacteria | 1635 |
| 560 | Ga0373947_0180047 | 3300035725 | Bacteria | 1375 |
| 561 | Ga0373937_0000347 | 3300036401 | Bacteria | 43749 |
| 562 | Ga0373937_0000441 | 3300036401 | Bacteria | 38394 |
| 563 | Ga0373937_0045533 | 3300036401 | Bacteria | 4010 |
| 564 | Ga0373937_0179799 | 3300036401 | Bacteria | 1986 |
| 565 | Ga0373937_0194899 | 3300036401 | Bacteria | 1904 |
| 566 | Ga0373937_0250597 | 3300036401 | Bacteria | 1669 |
| 567 | Ga0316582_0245053 | 3300036647 | Bacteria | 1228 |
| 568 | Ga0373925_0000081 | 3300037068 | Bacteria | 102407 |
| 569 | Ga0373925_0001482 | 3300037068 | Bacteria | 20154 |
| 570 | Ga0373925_0044829 | 3300037068 | Bacteria | 3284 |
| 571 | Ga0373925_0250494 | 3300037068 | Bacteria | 1420 |
| 572 | Ga0373925_0302993 | 3300037068 | Bacteria | 1290 |
| 573 | Ga0373925_0324306 | 3300037068 | Bacteria | 1247 |
| 574 | Ga0373925_0454820 | 3300037068 | Bacteria | 1049 |
| 575 | Ga0373925_0638458 | 3300037068 | Bacteria | 877 |
| 576 | Ga0395899_0014903 | 3300037312 | Bacteria | 5930 |
| 577 | Ga0395899_0096464 | 3300037312 | Bacteria | 2138 |
| 578 | Ga0395900_0008428 | 3300037418 | Bacteria | 10605 |
| 579 | Ga0395900_0011461 | 3300037418 | Bacteria | 9075 |
| 580 | Ga0395900_0143324 | 3300037418 | Bacteria | 2445 |
| 581 | Ga0395900_1067436 | 3300037418 | Bacteria | 726 |
| 582 | Ga0395898_0082166 | 3300037466 | Bacteria | 3106 |
| 583 | Ga0395898_0138981 | 3300037466 | Bacteria | 2325 |
| 584 | Ga0395898_0331558 | 3300037466 | Bacteria | 1451 |
| 585 | Ga0395905_0500874 | 3300037471 | Bacteria | 1115 |
| 586 | Ga0436364_0664195 | 3300037853 | Bacteria | 2975 |
| 587 | Ga0436364_0716542 | 3300037853 | Bacteria | 2780 |
| 588 | Ga0436364_0951864 | 3300037853 | Bacteria | 9370 |
| 589 | Ga0395901_0009788 | 3300038443 | Bacteria | 9721 |
| 590 | Ga0395901_0018877 | 3300038443 | Bacteria | 7049 |
| 591 | Ga0395901_0137101 | 3300038443 | Bacteria | 2571 |
| 592 | Ga0395901_0215568 | 3300038443 | Bacteria | 2008 |
| 593 | Ga0395901_0564087 | 3300038443 | Bacteria | 1152 |
| 594 | Ga0436365_0042743 | 3300039437 | Bacteria | 2739 |
| 595 | Ga0436365_0291537 | 3300039437 | Bacteria | 629 |
| 596 | Ga0436365_1099387 | 3300039437 | Bacteria | 3202 |
| 597 | Ga0436365_1251077 | 3300039437 | Bacteria | 937 |
| 598 | Ga0436365_1336443 | 3300039437 | Bacteria | 3131 |
| 599 | Ga0436365_1383206 | 3300039437 | Bacteria | 1820 |
| 600 | Ga0436360_0291491 | 3300039438 | Bacteria | 2024 |
| 601 | Ga0436360_0775077 | 3300039438 | Bacteria | 2194 |
| 602 | Ga0436360_1307075 | 3300039438 | Bacteria | 1174 |
| 603 | Ga0436361_0424457 | 3300039447 | Bacteria | 3406 |
| 604 | Ga0436361_0687582 | 3300039447 | Bacteria | 1439 |
| 605 | Ga0436361_0914825 | 3300039447 | Bacteria | 917 |
| 606 | Ga0436363_0235431 | 3300039450 | Bacteria | 801 |
| 607 | Ga0436363_0753578 | 3300039450 | Bacteria | 884 |
| 608 | Ga0436363_1012681 | 3300039450 | Bacteria | 2233 |
| 609 | Ga0436363_1455596 | 3300039450 | Bacteria | 957 |
| 610 | Ga0439453_0015398 | 3300041408 | Bacteria | 1322 |
| 611 | Ga0451853_1512202 | 3300041512 | Bacteria | 1297 |
| 612 | Ga0439464_0034921 | 3300042439 | Bacteria | 1419 |
| 613 | Ga0451577_0277536 | 3300042876 | Bacteria | 1518 |
| 614 | Ga0466966_0306725 | 3300044684 | Bacteria | 954 |
| 615 | Ga0466961_0158392 | 3300044693 | Bacteria | 1412 |
| 616 | Ga0466963_0018448 | 3300044694 | Bacteria | 4363 |
| 617 | Ga0466963_0025164 | 3300044694 | Bacteria | 3794 |
| 618 | Ga0466957_0125405 | 3300044842 | Bacteria | 1640 |
| 619 | Ga0466959_0034418 | 3300045049 | Bacteria | 3747 |
| 620 | Ga0466959_0036016 | 3300045049 | Bacteria | 3657 |
| 621 | Ga0451576_0295185 | 3300045051 | Bacteria | 1695 |
| 622 | Ga0451576_0599338 | 3300045051 | Bacteria | 1158 |
| 623 | Ga0466958_0014631 | 3300045836 | Bacteria | 4480 |
| 624 | Ga0466958_0067079 | 3300045836 | Bacteria | 2191 |
| 625 | Ga0466967_0091388 | 3300045976 | Bacteria | 2766 |
| 626 | Ga0466967_0320079 | 3300045976 | Bacteria | 1495 |
| 627 | Ga0466967_0611955 | 3300045976 | Bacteria | 1076 |
| 628 | Ga0495617_118481 | 3300046452 | Bacteria | 854 |
| 629 | Ga0495592_0000196 | 3300046454 | Bacteria | 51625 |
| 630 | Ga0495592_0022021 | 3300046454 | Bacteria | 4848 |
| 631 | Ga0495592_0287452 | 3300046454 | Bacteria | 1073 |
| 632 | Ga0495603_0165172 | 3300046455 | Bacteria | 1283 |
| 633 | Ga0495590_0087493 | 3300046457 | Bacteria | 1101 |
| 634 | Ga0495591_045515 | 3300046458 | Bacteria | 1223 |
| 635 | Ga0495629_0003904 | 3300046459 | Bacteria | 11215 |
| 636 | Ga0495651_0000356 | 3300046462 | Bacteria | 35210 |
| 637 | Ga0495651_0000977 | 3300046462 | Bacteria | 22167 |
| 638 | Ga0495651_0062022 | 3300046462 | Bacteria | 2861 |
| 639 | Ga0495651_0088854 | 3300046462 | Bacteria | 2321 |
| 640 | Ga0495653_0000193 | 3300046463 | Bacteria | 49516 |
| 641 | Ga0495653_0125711 | 3300046463 | Bacteria | 1821 |
| 642 | Ga0495653_0367836 | 3300046463 | Bacteria | 921 |
| 643 | Ga0495580_0091021 | 3300046472 | Bacteria | 2123 |
| 644 | Ga0495582_0022901 | 3300046473 | Bacteria | 3417 |
| 645 | Ga0495582_0034182 | 3300046473 | Bacteria | 2795 |
| 646 | Ga0495582_0212729 | 3300046473 | Bacteria | 1105 |
| 647 | Ga0495639_0045107 | 3300046475 | Bacteria | 1994 |
| 648 | Ga0495662_0060059 | 3300046476 | Bacteria | 1836 |
| 649 | Ga0495662_0080447 | 3300046476 | Bacteria | 1584 |
| 650 | Ga0495662_0142170 | 3300046476 | Bacteria | 1181 |
| 651 | Ga0495662_0242024 | 3300046476 | Bacteria | 889 |
| 652 | Ga0495664_0000016 | 3300046477 | Bacteria | 175933 |
| 653 | Ga0495664_0015488 | 3300046477 | Bacteria | 4334 |
| 654 | Ga0495584_0139415 | 3300046491 | Bacteria | 1231 |
| 655 | Ga0495594_0266148 | 3300046499 | Bacteria | 976 |
| 656 | Ga0495607_0119698 | 3300046501 | Bacteria | 1384 |
| 657 | Ga0495608_0000121 | 3300046511 | Bacteria | 56189 |
| 658 | Ga0495608_0279154 | 3300046511 | Bacteria | 1037 |
| 659 | Ga0495616_0056321 | 3300046513 | Bacteria | 1942 |
| 660 | Ga0495618_0000124 | 3300046514 | Bacteria | 56215 |
| 661 | Ga0495618_0041757 | 3300046514 | Bacteria | 2889 |
| 662 | Ga0495618_0091385 | 3300046514 | Bacteria | 1946 |
| 663 | Ga0495628_0000018 | 3300046516 | Bacteria | 169916 |
| 664 | Ga0495628_0015254 | 3300046516 | Bacteria | 6417 |
| 665 | Ga0495628_0101785 | 3300046516 | Bacteria | 2216 |
| 666 | Ga0495628_0139904 | 3300046516 | Bacteria | 1847 |
| 667 | Ga0495630_0002180 | 3300046517 | Bacteria | 13643 |
| 668 | Ga0495630_0088692 | 3300046517 | Bacteria | 2336 |
| 669 | Ga0495630_0269636 | 3300046517 | Bacteria | 1300 |
| 670 | Ga0495630_0432671 | 3300046517 | Bacteria | 1008 |
| 671 | Ga0495644_0015905 | 3300046523 | Bacteria | 2883 |
| 672 | Ga0495666_0057585 | 3300046526 | Bacteria | 1860 |
| 673 | Ga0495666_0124149 | 3300046526 | Bacteria | 1208 |
| 674 | Ga0495652_0000005 | 3300046529 | Bacteria | 524368 |
| 675 | Ga0495652_0006146 | 3300046529 | Bacteria | 11223 |
| 676 | Ga0495652_0044867 | 3300046529 | Bacteria | 3805 |
| 677 | Ga0495652_0173262 | 3300046529 | Bacteria | 1663 |
| 678 | Ga0495665_0022710 | 3300046531 | Bacteria | 3370 |
| 679 | Ga0495665_0062082 | 3300046531 | Bacteria | 1973 |
| 680 | Ga0495665_0111401 | 3300046531 | Bacteria | 1435 |
| 681 | Ga0495640_0000063 | 3300046533 | Bacteria | 60255 |
| 682 | Ga0495640_0186408 | 3300046533 | Bacteria | 1320 |
| 683 | Ga0495640_0192449 | 3300046533 | Bacteria | 1296 |
| 684 | Ga0495640_0261916 | 3300046533 | Bacteria | 1080 |
| 685 | Ga0495586_0027423 | 3300046535 | Bacteria | 3048 |
| 686 | Ga0495587_0000134 | 3300046536 | Bacteria | 56076 |
| 687 | Ga0495587_0063866 | 3300046536 | Bacteria | 2152 |
| 688 | Ga0495587_0289664 | 3300046536 | Bacteria | 917 |
| 689 | Ga0495598_0000513 | 3300046537 | Bacteria | 7181 |
| 690 | Ga0495598_0085309 | 3300046537 | Bacteria | 1020 |
| 691 | Ga0495621_0066992 | 3300046539 | Bacteria | 1315 |
| 692 | Ga0495645_0000070 | 3300046543 | Bacteria | 71823 |
| 693 | Ga0495645_0006688 | 3300046543 | Bacteria | 8009 |
| 694 | Ga0495645_0042265 | 3300046543 | Bacteria | 3323 |
| 695 | Ga0495645_0225337 | 3300046543 | Bacteria | 1258 |
| 696 | Ga0495633_0126843 | 3300046558 | Bacteria | 1181 |
| 697 | Ga0495667_0000023 | 3300046559 | Bacteria | 169343 |
| 698 | Ga0495667_0258536 | 3300046559 | Bacteria | 1108 |
| 699 | Ga0495667_0321339 | 3300046559 | Bacteria | 979 |
| 700 | Ga0495668_0106349 | 3300046616 | Bacteria | 1535 |
| 701 | Ga0495668_0232391 | 3300046616 | Bacteria | 1010 |
| 702 | Ga0495634_0000241 | 3300046642 | Bacteria | 51268 |
| 703 | Ga0495634_0006515 | 3300046642 | Bacteria | 8866 |
| 704 | Ga0495634_0007380 | 3300046642 | Bacteria | 8271 |
| 705 | Ga0495634_0023797 | 3300046642 | Bacteria | 4303 |
| 706 | Ga0495634_0131184 | 3300046642 | Bacteria | 1597 |
| 707 | Ga0495635_0000045 | 3300046663 | Bacteria | 82266 |
| 708 | Ga0495635_0007866 | 3300046663 | Bacteria | 7445 |
| 709 | Ga0495635_0474966 | 3300046663 | Unclassified | 825 |
| 710 | Ga0495659_0046419 | 3300046664 | Bacteria | 1568 |
| 711 | Ga0495657_0001202 | 3300046675 | Bacteria | 22674 |
| 712 | Ga0495657_0054030 | 3300046675 | Bacteria | 2685 |
| 713 | Ga0495657_0227561 | 3300046675 | Bacteria | 1129 |
| 714 | Ga0495657_0297955 | 3300046675 | Bacteria | 962 |
| 715 | Ga0495599_0000107 | 3300046678 | Bacteria | 56178 |
| 716 | Ga0495599_0016176 | 3300046678 | Bacteria | 4630 |
| 717 | Ga0495599_0271096 | 3300046678 | Bacteria | 1030 |
| 718 | Ga0495623_0000180 | 3300046679 | Bacteria | 39869 |
| 719 | Ga0495623_0290852 | 3300046679 | Bacteria | 906 |
| 720 | Ga0495646_0000027 | 3300046680 | Bacteria | 97629 |
| 721 | Ga0495646_0009489 | 3300046680 | Bacteria | 6177 |
| 722 | Ga0495646_0086248 | 3300046680 | Bacteria | 1821 |
| 723 | Ga0495647_0017526 | 3300046681 | Bacteria | 2536 |
| 724 | Ga0495647_0133894 | 3300046681 | Bacteria | 1052 |
| 725 | Ga0495658_0020639 | 3300046683 | Bacteria | 3461 |
| 726 | Ga0495658_0088488 | 3300046683 | Bacteria | 1830 |
| 727 | Ga0495658_0782518 | 3300046683 | Bacteria | 611 |
| 728 | Ga0495613_0028287 | 3300046689 | Bacteria | 4169 |
| 729 | Ga0495613_0055243 | 3300046689 | Bacteria | 2918 |
| 730 | Ga0495613_0056616 | 3300046689 | Bacteria | 2879 |
| 731 | Ga0495613_0070264 | 3300046689 | Bacteria | 2553 |
| 732 | Ga0495613_0103178 | 3300046689 | Bacteria | 2059 |
| 733 | Ga0495624_0052660 | 3300046690 | Bacteria | 2571 |
| 734 | Ga0495624_0093253 | 3300046690 | Bacteria | 1857 |
| 735 | Ga0495670_0004845 | 3300046691 | Bacteria | 6606 |
| 736 | Ga0495671_0025808 | 3300046692 | Bacteria | 3051 |
| 737 | Ga0495600_0000062 | 3300046809 | Bacteria | 61420 |
| 738 | Ga0495600_0028026 | 3300046809 | Bacteria | 3643 |
| 739 | Ga0495581_0050844 | 3300047315 | Bacteria | 2394 |
| 740 | Ga0495581_0164637 | 3300047315 | Bacteria | 1297 |
| 741 | Ga0495581_0251664 | 3300047315 | Bacteria | 1033 |
| 742 | Ga0495604_0000014 | 3300047317 | Bacteria | 205481 |
| 743 | Ga0495674_0000014 | 3300047319 | Bacteria | 241211 |
| 744 | Ga0495674_0146874 | 3300047319 | Bacteria | 1979 |
| 745 | Ga0495674_0452055 | 3300047319 | Bacteria | 1032 |
| 746 | Ga0495672_0091047 | 3300047320 | Bacteria | 1675 |
| 747 | Ga0495676_0021834 | 3300047321 | Bacteria | 5581 |
| 748 | Ga0495676_0072883 | 3300047321 | Bacteria | 2635 |
| 749 | Ga0495676_0542368 | 3300047321 | Bacteria | 761 |
| 750 | Ga0495680_0000779 | 3300047322 | Bacteria | 35728 |
| 751 | Ga0495680_0199616 | 3300047322 | Bacteria | 1435 |
| 752 | Ga0495680_0274377 | 3300047322 | Bacteria | 1190 |
| 753 | Ga0495680_0326915 | 3300047322 | Bacteria | 1072 |
| 754 | Ga0495675_0000058 | 3300047444 | Bacteria | 77587 |
| 755 | Ga0495675_0074564 | 3300047444 | Bacteria | 2138 |
| 756 | Ga0495675_0222744 | 3300047444 | Bacteria | 1141 |
| 757 | Ga0495684_0000059 | 3300047471 | Bacteria | 77947 |
| 758 | Ga0495684_0023040 | 3300047471 | Bacteria | 4790 |
| 759 | Ga0495684_0032711 | 3300047471 | Bacteria | 3994 |
| 760 | Ga0495593_0005129 | 3300047673 | Bacteria | 7741 |
| 761 | Ga0495593_0006926 | 3300047673 | Bacteria | 6638 |
| 762 | Ga0495593_0092976 | 3300047673 | Bacteria | 1552 |
| 763 | Ga0495593_0249251 | 3300047673 | Bacteria | 889 |
| 764 | Ga0495602_0000017 | 3300048088 | Bacteria | 184180 |
| 765 | Ga0495602_0281844 | 3300048088 | Bacteria | 1224 |
| 766 | Ga0495602_0842122 | 3300048088 | Bacteria | 613 |
| 767 | Ga0496100_0006029 | 3300048903 | Bacteria | 6579 |
| 768 | Ga0496100_0007617 | 3300048903 | Bacteria | 5988 |
| 769 | Ga0496100_0221282 | 3300048903 | Bacteria | 1389 |
| 770 | Ga0496100_0577318 | 3300048903 | Bacteria | 871 |
| 771 | Ga0496100_0704446 | 3300048903 | Bacteria | 788 |
| 772 | Ga0496101_0000879 | 3300048904 | Bacteria | 17685 |
| 773 | Ga0496101_0003104 | 3300048904 | Bacteria | 10272 |
| 774 | Ga0496101_0011363 | 3300048904 | Bacteria | 5905 |
| 775 | Ga0496101_0018180 | 3300048904 | Bacteria | 4776 |
| 776 | Ga0496101_0153974 | 3300048904 | Bacteria | 1760 |
| 777 | Ga0496101_0340027 | 3300048904 | Bacteria | 1179 |
| 778 | Ga0496101_0344962 | 3300048904 | Bacteria | 1170 |
| 779 | Ga0496101_0608082 | 3300048904 | Bacteria | 864 |
| 780 | Ga0496101_0629180 | 3300048904 | Bacteria | 848 |
| 781 | Ga0496102_0008462 | 3300048905 | Bacteria | 8821 |
| 782 | Ga0496102_0011826 | 3300048905 | Bacteria | 7533 |
| 783 | Ga0496102_0024214 | 3300048905 | Bacteria | 5396 |
| 784 | Ga0496102_0037021 | 3300048905 | Bacteria | 4400 |
| 785 | Ga0496102_0069866 | 3300048905 | Bacteria | 3224 |
| 786 | Ga0496102_0576835 | 3300048905 | Bacteria | 1048 |
| 787 | Ga0496102_0717283 | 3300048905 | Bacteria | 923 |
| 788 | Ga0496102_0902813 | 3300048905 | Bacteria | 805 |
| 789 | Ga0496103_0007237 | 3300048906 | Bacteria | 6615 |
| 790 | Ga0496103_0048800 | 3300048906 | Bacteria | 2617 |
| 791 | Ga0496103_0102030 | 3300048906 | Bacteria | 1817 |
| 792 | Ga0496103_0243198 | 3300048906 | Bacteria | 1158 |
| 793 | Ga0496104_0001978 | 3300048907 | Bacteria | 17751 |
| 794 | Ga0496104_0004384 | 3300048907 | Bacteria | 12293 |
| 795 | Ga0496104_0006107 | 3300048907 | Bacteria | 10574 |
| 796 | Ga0496104_0017059 | 3300048907 | Bacteria | 6607 |
| 797 | Ga0496104_0195705 | 3300048907 | Bacteria | 1934 |
| 798 | Ga0496104_0374083 | 3300048907 | Bacteria | 1337 |
| 799 | Ga0496104_0468513 | 3300048907 | Bacteria | 1171 |
| 800 | Ga0496104_0848001 | 3300048907 | Bacteria | 819 |
| 801 | Ga0496104_0990057 | 3300048907 | Bacteria | 745 |
| 802 | Ga0496105_0001999 | 3300048908 | Bacteria | 14708 |
| 803 | Ga0496105_0005181 | 3300048908 | Bacteria | 9880 |
| 804 | Ga0496105_0015753 | 3300048908 | Bacteria | 6033 |
| 805 | Ga0496105_0061405 | 3300048908 | Bacteria | 3101 |
| 806 | Ga0496105_0061711 | 3300048908 | Bacteria | 3094 |
| 807 | Ga0496105_0098553 | 3300048908 | Bacteria | 2413 |
| 808 | Ga0496105_0454318 | 3300048908 | Bacteria | 1011 |
| 809 | Ga0496106_0003496 | 3300048909 | Bacteria | 11703 |
| 810 | Ga0496106_0011510 | 3300048909 | Bacteria | 6542 |
| 811 | Ga0496106_0016650 | 3300048909 | Bacteria | 5438 |
| 812 | Ga0496106_0317869 | 3300048909 | Bacteria | 1250 |
| 813 | Ga0496106_0917103 | 3300048909 | Unclassified | 691 |
| 814 | Ga0496107_0008551 | 3300048910 | Bacteria | 7083 |
| 815 | Ga0496107_0028396 | 3300048910 | Bacteria | 3975 |
| 816 | Ga0496107_0062820 | 3300048910 | Bacteria | 2690 |
| 817 | Ga0496107_0181280 | 3300048910 | Bacteria | 1564 |
| 818 | Ga0496107_0318195 | 3300048910 | Bacteria | 1158 |
| 819 | Ga0496108_0000347 | 3300048911 | Bacteria | 39108 |
| 820 | Ga0496108_0005996 | 3300048911 | Bacteria | 9840 |
| 821 | Ga0496108_0013218 | 3300048911 | Bacteria | 6727 |
| 822 | Ga0496108_0018394 | 3300048911 | Bacteria | 5720 |
| 823 | Ga0496108_0032557 | 3300048911 | Bacteria | 4330 |
| 824 | Ga0496108_0077240 | 3300048911 | Bacteria | 2816 |
| 825 | Ga0496109_0005863 | 3300048912 | Bacteria | 10300 |
| 826 | Ga0496109_0022511 | 3300048912 | Bacteria | 5583 |
| 827 | Ga0496109_0032495 | 3300048912 | Bacteria | 4691 |
| 828 | Ga0496109_0045633 | 3300048912 | Bacteria | 3977 |
| 829 | Ga0496109_0313055 | 3300048912 | Bacteria | 1481 |
| 830 | Ga0496109_0498994 | 3300048912 | Bacteria | 1149 |
| 831 | Ga0496109_0586258 | 3300048912 | Bacteria | 1051 |
| 832 | Ga0496110_0000339 | 3300048913 | Bacteria | 31235 |
| 833 | Ga0496110_0003146 | 3300048913 | Bacteria | 12548 |
| 834 | Ga0496110_0012105 | 3300048913 | Bacteria | 7086 |
| 835 | Ga0496110_0029719 | 3300048913 | Bacteria | 4706 |
| 836 | Ga0496110_0074428 | 3300048913 | Bacteria | 3016 |
| 837 | Ga0496110_0170611 | 3300048913 | Bacteria | 1974 |
| 838 | Ga0496110_0264085 | 3300048913 | Bacteria | 1567 |
| 839 | Ga0496110_0323362 | 3300048913 | Bacteria | 1405 |
| 840 | Ga0496110_0625564 | 3300048913 | Bacteria | 975 |
| 841 | Ga0496111_0001676 | 3300048914 | Bacteria | 12899 |
| 842 | Ga0496111_0009006 | 3300048914 | Bacteria | 6640 |
| 843 | Ga0496111_0017366 | 3300048914 | Bacteria | 4975 |
| 844 | Ga0496111_0021601 | 3300048914 | Bacteria | 4497 |
| 845 | Ga0496111_0720866 | 3300048914 | Bacteria | 725 |
| 846 | Ga0496112_0002294 | 3300048915 | Bacteria | 15311 |
| 847 | Ga0496112_0003807 | 3300048915 | Bacteria | 12611 |
| 848 | Ga0496112_0004698 | 3300048915 | Bacteria | 11628 |
| 849 | Ga0496112_0006289 | 3300048915 | Bacteria | 10415 |
| 850 | Ga0496112_0129178 | 3300048915 | Bacteria | 2498 |
| 851 | Ga0496112_0233439 | 3300048915 | Bacteria | 1794 |
| 852 | Ga0496112_0618357 | 3300048915 | Bacteria | 1014 |
| 853 | Ga0496112_0648060 | 3300048915 | Bacteria | 986 |
| 854 | Ga0496112_0917495 | 3300048915 | Bacteria | 797 |
| 855 | Ga0496113_0069726 | 3300048916 | Bacteria | 2671 |
| 856 | Ga0496113_0075665 | 3300048916 | Bacteria | 2570 |
| 857 | Ga0496113_0114824 | 3300048916 | Bacteria | 2100 |
| 858 | Ga0496113_0132092 | 3300048916 | Bacteria | 1960 |
| 859 | Ga0496113_0280044 | 3300048916 | Bacteria | 1333 |
| 860 | Ga0496114_0110149 | 3300048917 | Bacteria | 2358 |
| 861 | Ga0496115_0018524 | 3300048918 | Bacteria | 5348 |
| 862 | Ga0496115_0055975 | 3300048918 | Bacteria | 3169 |
| 863 | Ga0496115_0060795 | 3300048918 | Bacteria | 3045 |
| 864 | Ga0496115_0257531 | 3300048918 | Bacteria | 1435 |
| 865 | Ga0496115_0316815 | 3300048918 | Bacteria | 1276 |
| 866 | Ga0496115_0826093 | 3300048918 | Bacteria | 719 |
| 867 | Ga0501031_0023742 | 3300049568 | Bacteria | 3997 |
| 868 | Ga0501032_0175050 | 3300049569 | Bacteria | 1406 |
| 869 | Ga0501033_0058028 | 3300049570 | Bacteria | 2860 |
| 870 | Ga0501034_0000891 | 3300049571 | Bacteria | 43738 |
| 871 | Ga0501034_0011745 | 3300049571 | Bacteria | 9060 |
| 872 | Ga0501034_0021303 | 3300049571 | Bacteria | 6609 |
| 873 | Ga0501034_0234213 | 3300049571 | Bacteria | 1784 |
| 874 | Ga0501036_0171303 | 3300049572 | Unclassified | 1829 |
| 875 | Ga0501038_0580131 | 3300049574 | Bacteria | 850 |
| 876 | Ga0501039_0008570 | 3300049575 | Bacteria | 7798 |
| 877 | Ga0501040_0015963 | 3300049576 | Bacteria | 4966 |
| 878 | Ga0501040_0725460 | 3300049576 | Bacteria | 719 |
| 879 | Ga0501041_0033918 | 3300049577 | Bacteria | 3089 |
| 880 | Ga0501042_0006103 | 3300049578 | Bacteria | 7807 |
| 881 | Ga0501042_0291971 | 3300049578 | Bacteria | 1178 |
| 882 | Ga0501043_0016253 | 3300049579 | Bacteria | 5837 |
| 883 | Ga0501043_0059010 | 3300049579 | Bacteria | 3011 |
| 884 | Ga0501046_0124912 | 3300049580 | Unclassified | 1955 |
| 885 | Ga0501046_0266063 | 3300049580 | Bacteria | 1258 |
| 886 | Ga0501047_0610694 | 3300049581 | Bacteria | 912 |
| 887 | Ga0501048_0011307 | 3300049582 | Bacteria | 6655 |
| 888 | Ga0501048_0331171 | 3300049582 | Bacteria | 1085 |
| 889 | Ga0501068_0012440 | 3300049584 | Bacteria | 4826 |
| 890 | Ga0501068_0017211 | 3300049584 | Bacteria | 4177 |
| 891 | Ga0501068_0562319 | 3300049584 | Unclassified | 742 |
| 892 | Ga0501069_0041972 | 3300049585 | Bacteria | 2529 |
| 893 | Ga0501069_0047991 | 3300049585 | Bacteria | 2371 |
| 894 | Ga0501070_0003987 | 3300049586 | Bacteria | 12699 |
| 895 | Ga0501070_0185817 | 3300049586 | Bacteria | 1709 |
| 896 | Ga0501070_0787475 | 3300049586 | Bacteria | 747 |
| 897 | Ga0501071_0007220 | 3300049587 | Bacteria | 7269 |
| 898 | Ga0501071_0671147 | 3300049587 | Bacteria | 798 |
| 899 | Ga0501073_0400560 | 3300049589 | Bacteria | 948 |
| 900 | Ga0501074_0001669 | 3300049590 | Bacteria | 15112 |
| 901 | Ga0501074_0116108 | 3300049590 | Bacteria | 1915 |
| 902 | Ga0501075_0038416 | 3300049591 | Bacteria | 3579 |
| 903 | Ga0501075_0164115 | 3300049591 | Bacteria | 1695 |
| 904 | Ga0501075_0248755 | 3300049591 | Bacteria | 1355 |
| 905 | Ga0501075_0412224 | 3300049591 | Bacteria | 1030 |
| 906 | Ga0501075_0451005 | 3300049591 | Bacteria | 981 |
| 907 | Ga0501076_0019950 | 3300049592 | Bacteria | 5128 |
| 908 | Ga0501076_0166618 | 3300049592 | Bacteria | 1796 |
| 909 | Ga0501077_0038035 | 3300049593 | Bacteria | 3063 |
| 910 | Ga0501079_0142427 | 3300049741 | Bacteria | 1867 |
| 911 | Ga0501079_0299090 | 3300049741 | Bacteria | 1259 |
| 912 | Ga0501080_0049205 | 3300049742 | Bacteria | 3924 |
| 913 | Ga0501080_0306962 | 3300049742 | Bacteria | 1438 |
| 914 | Ga0501081_0533014 | 3300049743 | Bacteria | 876 |
| 915 | Ga0501083_0278715 | 3300049744 | Bacteria | 1088 |
| 916 | Ga0501035_0102447 | 3300049822 | Bacteria | 2511 |
| 917 | Ga0501044_0058411 | 3300049823 | Bacteria | 3956 |
| 918 | Ga0501044_0435136 | 3300049823 | Bacteria | 1220 |
| 919 | Ga0501045_0007001 | 3300049824 | Bacteria | 7821 |
| 920 | nmdc:mga03n38_3932_c1 | 3300050490 | Bacteria | 4844 |
| 921 | nmdc:mga03n38_523875_c1 | 3300050490 | Unclassified | 668 |
| 922 | nmdc:mga0yw44_14371_c1 | 3300050492 | Bacteria | 4203 |
| 923 | nmdc:mga0yw44_155796_c1 | 3300050492 | Bacteria | 1493 |
| 924 | nmdc:mga0yw44_176483_c1 | 3300050492 | Bacteria | 1405 |
| 925 | nmdc:mga0yw44_70420_c1 | 3300050492 | Bacteria | 2168 |
| 926 | nmdc:mga0k408_347576_c1 | 3300050493 | Bacteria | 884 |
| 927 | nmdc:mga06z11_39475_c1 | 3300050494 | Bacteria | 2349 |
| 928 | nmdc:mga06z11_790_c1 | 3300050494 | Bacteria | 11561 |
| 929 | nmdc:mga06z11_9739_c1 | 3300050494 | Bacteria | 4060 |
| 930 | nmdc:mga04h51_7974_c1 | 3300050495 | Bacteria | 2818 |
| 931 | nmdc:mga05p37_13689_c1 | 3300050507 | Bacteria | 9722 |
| 932 | nmdc:mga05p37_182270_c1 | 3300050507 | Bacteria | 2554 |
| 933 | nmdc:mga05p37_463312_c1 | 3300050507 | Bacteria | 1464 |
| 934 | nmdc:mga05p37_51539_c1 | 3300050507 | Bacteria | 5061 |
| 935 | nmdc:mga09592_26_c1 | 3300050508 | Bacteria | 84260 |
| 936 | nmdc:mga09592_276302_c1 | 3300050508 | Bacteria | 1457 |
| 937 | nmdc:mga09592_351191_c1 | 3300050508 | Bacteria | 1276 |
| 938 | nmdc:mga09592_452835_c1 | 3300050508 | Bacteria | 1107 |
| 939 | nmdc:mga09592_551382_c1 | 3300050508 | Bacteria | 990 |
| 940 | nmdc:mga0qj67_69955_c1 | 3300050509 | Bacteria | 2799 |
| 941 | nmdc:mga0qj67_72478_c1 | 3300050509 | Bacteria | 2750 |
| 942 | nmdc:mga06r32_118534_c1 | 3300050510 | Bacteria | 2609 |
| 943 | nmdc:mga06r32_134422_c1 | 3300050510 | Bacteria | 2447 |
| 944 | nmdc:mga06r32_274046_c1 | 3300050510 | Bacteria | 1675 |
| 945 | nmdc:mga06r32_5683_c1 | 3300050510 | Bacteria | 11226 |
| 946 | nmdc:mga06r32_898206_c1 | 3300050510 | Bacteria | 842 |
| 947 | nmdc:mga06r32_899039_c1 | 3300050510 | Bacteria | 842 |
| 948 | nmdc:mga08y16_147315_c1 | 3300050511 | Bacteria | 2447 |
| 949 | nmdc:mga08y16_496710_c1 | 3300050511 | Bacteria | 1240 |
| 950 | nmdc:mga08y16_627756_c1 | 3300050511 | Bacteria | 1081 |
| 951 | nmdc:mga08y16_66523_c1 | 3300050511 | Bacteria | 3761 |
| 952 | nmdc:mga0n895_155498_c1 | 3300050512 | Bacteria | 2317 |
| 953 | nmdc:mga0n895_454272_c1 | 3300050512 | Bacteria | 1293 |
| 954 | nmdc:mga0n895_459658_c1 | 3300050512 | Bacteria | 1285 |
| 955 | nmdc:mga0n895_4873_c1 | 3300050512 | Bacteria | 11115 |
| 956 | nmdc:mga0n895_809489_c1 | 3300050512 | Bacteria | 927 |
| 957 | nmdc:mga0n895_84596_c1 | 3300050512 | Bacteria | 3165 |
| 958 | nmdc:mga0n895_938110_c1 | 3300050512 | Bacteria | 849 |
| 959 | nmdc:mga0n895_98294_c1 | 3300050512 | Bacteria | 2934 |
| 960 | nmdc:mga0rr50_137244_c1 | 3300050513 | Bacteria | 1964 |
| 961 | nmdc:mga0rr50_201279_c1 | 3300050513 | Bacteria | 1636 |
| 962 | nmdc:mga0rr50_294262_c1 | 3300050513 | Bacteria | 1357 |
| 963 | nmdc:mga0rr50_929405_c1 | 3300050513 | Bacteria | 741 |
| 964 | nmdc:mga0rr50_95527_c1 | 3300050513 | Bacteria | 2323 |
| 965 | nmdc:mga08x19_127143_c1 | 3300050514 | Bacteria | 1712 |
| 966 | nmdc:mga08x19_3673_c1 | 3300050514 | Bacteria | 9135 |
| 967 | nmdc:mga08x19_40687_c1 | 3300050514 | Bacteria | 2959 |
| 968 | nmdc:mga08x19_483147_c1 | 3300050514 | Bacteria | 873 |
| 969 | nmdc:mga0a205_25016_c1 | 3300050515 | Bacteria | 5684 |
| 970 | nmdc:mga0a205_342822_c1 | 3300050515 | Bacteria | 1362 |
| 971 | nmdc:mga0a205_394674_c1 | 3300050515 | Bacteria | 1247 |
| 972 | nmdc:mga0a205_534460_c1 | 3300050515 | Bacteria | 1028 |
| 973 | nmdc:mga0sz30_5978_c1 | 3300050516 | Bacteria | 3448 |
| 974 | Ga0495601_0000016 | 3300053077 | Bacteria | 207486 |
| 975 | Ga0495601_0006967 | 3300053077 | Bacteria | 6619 |
| 976 | Ga0495601_0011070 | 3300053077 | Bacteria | 5390 |
| 977 | Ga0495601_0017716 | 3300053077 | Bacteria | 4327 |
| 978 | Ga0495601_0043988 | 3300053077 | Bacteria | 2806 |
| 979 | Ga0495601_0095332 | 3300053077 | Bacteria | 1918 |
| 980 | Ga0495601_0259457 | 3300053077 | Bacteria | 1134 |
| 981 | Ga0495601_0343242 | 3300053077 | Bacteria | 971 |
| 982 | Ga0495612_0000041 | 3300053078 | Bacteria | 62752 |
| 983 | Ga0495612_0008712 | 3300053078 | Bacteria | 4114 |
| 984 | Ga0495612_0097294 | 3300053078 | Bacteria | 1251 |
| 985 | Ga0495612_0222672 | 3300053078 | Bacteria | 835 |
| 986 | Ga0495612_0237305 | 3300053078 | Bacteria | 809 |
| 987 | Ga0495655_0000981 | 3300053083 | Bacteria | 4424 |
| 988 | Ga0495595_0000048 | 3300053084 | Bacteria | 60581 |
| 989 | Ga0495595_0001522 | 3300053084 | Bacteria | 9051 |
| 990 | Ga0495595_0143601 | 3300053084 | Bacteria | 1172 |
| 991 | Ga0495619_0000050 | 3300053085 | Bacteria | 101361 |
| 992 | Ga0495619_0002388 | 3300053085 | Bacteria | 12328 |
| 993 | Ga0495619_0041669 | 3300053085 | Bacteria | 3004 |
| 994 | Ga0495619_0088079 | 3300053085 | Bacteria | 2100 |
| 995 | Ga0495619_0118435 | 3300053085 | Bacteria | 1814 |
| 996 | Ga0495619_0313965 | 3300053085 | Bacteria | 1085 |
| 997 | Ga0495619_0391363 | 3300053085 | Bacteria | 960 |
| 998 | Ga0500566_0112346 | 3300053094 | Bacteria | 1480 |
| 999 | Ga0500641_0000747 | 3300053096 | Bacteria | 11773 |
| 1000 | Ga0500650_0089514 | 3300053098 | Bacteria | 1440 |
| 1001 | Ga0500568_0052584 | 3300053139 | Bacteria | 1599 |
| 1002 | Ga0500616_0004736 | 3300053153 | Bacteria | 9570 |
| 1003 | Ga0500616_0036435 | 3300053153 | Bacteria | 2670 |
| 1004 | Ga0500645_051596 | 3300053730 | Bacteria | 1200 |
| 1005 | Ga0501084_0023539 | 3300054114 | Bacteria | 5138 |
| 1006 | Ga0501084_0370131 | 3300054114 | Bacteria | 1211 |
| 1007 | Ga0501084_0880187 | 3300054114 | Bacteria | 753 |
| 1008 | Ga0501082_0026550 | 3300060353 | Bacteria | 4992 |
| 1009 | Ga0501082_0349555 | 3300060353 | Bacteria | 1289 |
| 1010 | Ga0501082_0568735 | 3300060353 | Bacteria | 992 |
| 1011 | Ga0466962_0160303 | 3300061719 | Bacteria | 1093 |
| 1012 | Ga0466962_0380322 | 3300061719 | Bacteria | 705 |
| 1013 | Ga0466963_0034467 | |||
| 1014 | JGI24737J22298_10023897 | |||
| 1015 | JGI24743J22301_10000589 | |||
| 1016 | JGI24738J21930_10011323 | |||
| 1017 | JGI24742J22300_10000606 | |||
| 1018 | JGI25404J52841_10004866 | |||
| 1019 | Ga0058862_12191086 | |||
| 1020 | Ga0065707_10160974 | |||
| 1021 | Ga0070658_10120406 | |||
| 1022 | Ga0070658_10210450 | |||
| 1023 | Ga0070658_10485900 | |||
| 1024 | Ga0070683_100011408 | |||
| 1025 | Ga0070683_100040594 | |||
| 1026 | Ga0070683_100311639 | |||
| 1027 | Ga0070690_100015826 | |||
| 1028 | Ga0070690_100556198 | |||
| 1029 | Ga0070670_100028487 | |||
| 1030 | Ga0070670_100071135 | |||
| 1031 | Ga0068869_100216323 | |||
| 1032 | Ga0070666_10088544 | |||
| 1033 | Ga0070666_10398149 | |||
| 1034 | Ga0070680_100001118 | |||
| 1035 | Ga0070680_100109890 | |||
| 1036 | Ga0070682_100022863 | |||
| 1037 | Ga0070682_100605448 | |||
| 1038 | Ga0068868_100009632 | |||
| 1039 | Ga0068868_100353123 | |||
| 1040 | Ga0070660_100195675 | |||
| 1041 | Ga0070660_100478208 | |||
| 1042 | Ga0070660_100522540 | |||
| 1043 | Ga0070689_100001113 | |||
| 1044 | Ga0070689_100194769 | |||
| 1045 | Ga0070691_10005401 | |||
| 1046 | Ga0070687_100199493 | |||
| 1047 | Ga0070687_100211035 | |||
| 1048 | Ga0070661_100135873 | |||
| 1049 | Ga0070661_100881023 | |||
| 1050 | Ga0070692_10022160 | |||
| 1051 | Ga0070668_100113320 | |||
| 1052 | Ga0070669_100140181 | |||
| 1053 | Ga0070669_100206839 | |||
| 1054 | Ga0070675_100018009 | |||
| 1055 | Ga0070675_100445561 | |||
| 1056 | Ga0070671_100010831 | |||
| 1057 | Ga0070674_100018571 | |||
| 1058 | Ga0070674_100026532 | |||
| 1059 | Ga0070673_100003804 | |||
| 1060 | Ga0070673_100227319 | |||
| 1061 | Ga0070673_100520815 | |||
| 1062 | Ga0070673_100954090 | |||
| 1063 | Ga0070688_100005939 | |||
| 1064 | Ga0070688_100028550 | |||
| 1065 | Ga0070688_100051339 | |||
| 1066 | Ga0070659_100124649 | |||
| 1067 | Ga0070659_100410292 | |||
| 1068 | Ga0070659_100994151 | |||
| 1069 | Ga0070667_100029214 | |||
| 1070 | Ga0070703_10010838 | |||
| 1071 | Ga0070709_10011931 | |||
| 1072 | Ga0070709_10159441 | |||
| 1073 | Ga0070709_10935785 | |||
| 1074 | Ga0070714_100003288 | |||
| 1075 | Ga0070714_100058344 | |||
| 1076 | Ga0070714_100206856 | |||
| 1077 | Ga0070714_100309305 | |||
| 1078 | Ga0070714_100665610 | |||
| 1079 | Ga0070713_100022225 | |||
| 1080 | Ga0070713_100108922 | |||
| 1081 | Ga0070713_100125140 | |||
| 1082 | Ga0070713_100586417 | |||
| 1083 | Ga0070710_10047384 | |||
| 1084 | Ga0070711_100028231 | |||
| 1085 | Ga0070711_100036765 | |||
| 1086 | Ga0070711_100080849 | |||
| 1087 | Ga0070711_100142841 | |||
| 1088 | Ga0070705_100054251 | |||
| 1089 | Ga0070705_100189603 | |||
| 1090 | Ga0070700_100066485 | |||
| 1091 | Ga0070700_100712784 | |||
| 1092 | Ga0070694_100074074 | |||
| 1093 | Ga0070694_100585525 | |||
| 1094 | Ga0070708_100218484 | |||
| 1095 | Ga0070663_100086303 | |||
| 1096 | Ga0070663_100358866 | |||
| 1097 | Ga0070678_100025730 | |||
| 1098 | Ga0070678_100033430 | |||
| 1099 | Ga0070678_100376024 | |||
| 1100 | Ga0070662_100019278 | |||
| 1101 | Ga0070681_10523966 | |||
| 1102 | Ga0070681_11030727 | |||
| 1103 | Ga0068867_100019113 | |||
| 1104 | Ga0068867_100725869 | |||
| 1105 | Ga0068867_100886910 | |||
| 1106 | Ga0070685_10008870 | |||
| 1107 | Ga0070707_100101717 | |||
| 1108 | Ga0070698_100012347 | |||
| 1109 | Ga0070698_100807164 | |||
| 1110 | Ga0070699_100123881 | |||
| 1111 | Ga0070699_100573922 | |||
| 1112 | Ga0070699_101090168 | |||
| 1113 | Ga0070679_100023849 | |||
| 1114 | Ga0070684_100004629 | |||
| 1115 | Ga0070684_100110848 | |||
| 1116 | Ga0070684_100165021 | |||
| 1117 | Ga0070684_100436286 | |||
| 1118 | Ga0070697_100036459 | |||
| 1119 | Ga0070697_100140324 | |||
| 1120 | Ga0070697_100666805 | |||
| 1121 | Ga0068853_100328104 | |||
| 1122 | Ga0070672_100014289 | |||
| 1123 | Ga0070686_100015033 | |||
| 1124 | Ga0070686_100122087 | |||
| 1125 | Ga0070686_100489299 | |||
| 1126 | Ga0070695_100052568 | |||
| 1127 | Ga0070695_100545741 | |||
| 1128 | Ga0070693_100359509 | |||
| 1129 | Ga0070665_100176983 | |||
| 1130 | Ga0070665_100295067 | |||
| 1131 | Ga0070665_100374217 | |||
| 1132 | Ga0070665_100525754 | |||
| 1133 | Ga0070665_100681923 | |||
| 1134 | Ga0070665_100836225 | |||
| 1135 | Ga0070704_100001250 | |||
| 1136 | Ga0070704_100377119 | |||
| 1137 | Ga0070704_100543519 | |||
| 1138 | Ga0070704_100807306 | |||
| 1139 | Ga0068855_100126004 | |||
| 1140 | Ga0068855_100472019 | |||
| 1141 | Ga0068855_100762977 | |||
| 1142 | Ga0070664_100024037 | |||
| 1143 | Ga0070664_100118550 | |||
| 1144 | Ga0070664_100171265 | |||
| 1145 | Ga0068854_100016650 | |||
| 1146 | Ga0068856_100001606 | |||
| 1147 | Ga0068856_100016444 | |||
| 1148 | Ga0068856_100210294 | |||
| 1149 | Ga0068856_100502094 | |||
| 1150 | Ga0070702_100008194 | |||
| 1151 | Ga0068852_100001045 | |||
| 1152 | Ga0068859_100025009 | |||
| 1153 | Ga0068859_100335208 | |||
| 1154 | Ga0068859_100792025 | |||
| 1155 | Ga0068864_100001978 | |||
| 1156 | Ga0068866_10011518 | |||
| 1157 | Ga0068851_10025091 | |||
| 1158 | Ga0068870_10014577 | |||
| 1159 | Ga0068863_100019233 | |||
| 1160 | Ga0068858_100022418 | |||
| 1161 | Ga0068858_100116932 | |||
| 1162 | Ga0068858_100184675 | |||
| 1163 | Ga0068860_100054877 | |||
| 1164 | Ga0068860_101087720 | |||
| 1165 | Ga0068862_100024602 | |||
| 1166 | Ga0068862_100059517 | |||
| 1167 | Ga0068862_100283175 | |||
| 1168 | Ga0068862_100617918 | |||
| 1169 | Ga0081455_10001354 | |||
| 1170 | Ga0081455_10300774 | |||
| 1171 | Ga0081538_10034525 | |||
| 1172 | Ga0081538_10150658 | |||
| 1173 | Ga0081540_1001046 | |||
| 1174 | Ga0081540_1002282 | |||
| 1175 | Ga0081540_1003104 | |||
| 1176 | Ga0081540_1100145 | |||
| 1177 | Ga0081539_10003208 | |||
| 1178 | Ga0070717_10247489 | |||
| 1179 | Ga0070717_10349049 | |||
| 1180 | Ga0075365_10004171 | |||
| 1181 | Ga0075365_10009965 | |||
| 1182 | Ga0075365_10011665 | |||
| 1183 | Ga0075365_10208576 | |||
| 1184 | Ga0075365_10247488 | |||
| 1185 | Ga0075365_10352560 | |||
| 1186 | Ga0075365_10572926 | |||
| 1187 | Ga0075368_10012897 | |||
| 1188 | Ga0075368_10018094 | |||
| 1189 | Ga0075368_10086403 | |||
| 1190 | Ga0075363_100009278 | |||
| 1191 | Ga0075363_100025914 | |||
| 1192 | Ga0075364_10100398 | |||
| 1193 | Ga0075364_10124588 | |||
| 1194 | Ga0075364_10260995 | |||
| 1195 | Ga0070715_10005759 | |||
| 1196 | Ga0070716_100016606 | |||
| 1197 | Ga0070712_100052161 | |||
| 1198 | Ga0070712_100076048 | |||
| 1199 | Ga0070712_100579723 | |||
| 1200 | Ga0075362_10003444 | |||
| 1201 | Ga0075367_10002008 | |||
| 1202 | Ga0075367_10013529 | |||
| 1203 | Ga0075367_10039306 | |||
| 1204 | Ga0075367_10312623 | |||
| 1205 | Ga0097621_100020748 | |||
| 1206 | Ga0075370_10038028 | |||
| 1207 | Ga0075370_10108901 | |||
| 1208 | Ga0068871_100016774 | |||
| 1209 | Ga0068871_100892732 | |||
| 1210 | Ga0075428_100000617 | |||
| 1211 | Ga0075428_100062074 | |||
| 1212 | Ga0075428_100082995 | |||
| 1213 | Ga0075428_100194841 | |||
| 1214 | Ga0075428_100378884 | |||
| 1215 | Ga0075428_100532816 | |||
| 1216 | Ga0075428_100578115 | |||
| 1217 | Ga0075430_100045690 | |||
| 1218 | Ga0075431_100073995 | |||
| 1219 | Ga0075431_100108855 | |||
| 1220 | Ga0075431_100171298 | |||
| 1221 | Ga0075431_100820232 | |||
| 1222 | Ga0075431_100883641 | |||
| 1223 | Ga0075433_10043573 | |||
| 1224 | Ga0075433_10622550 | |||
| 1225 | Ga0075434_100070901 | |||
| 1226 | Ga0075434_100103915 | |||
| 1227 | Ga0075434_100131094 | |||
| 1228 | Ga0075434_100540835 | |||
| 1229 | Ga0075434_100622901 | |||
| 1230 | Ga0075434_100811838 | |||
| 1231 | Ga0075434_100992981 | |||
| 1232 | Ga0075434_101018597 | |||
| 1233 | Ga0075429_100000081 | |||
| 1234 | Ga0075429_100271902 | |||
| 1235 | Ga0075429_100430352 | |||
| 1236 | Ga0068865_100174258 | |||
| 1237 | Ga0075436_100004004 | |||
| 1238 | Ga0075436_100004115 | |||
| 1239 | Ga0075436_100090088 | |||
| 1240 | Ga0075436_100129957 | |||
| 1241 | Ga0097620_100025009 | |||
| 1242 | Ga0097620_100335219 | |||
| 1243 | Ga0097620_100792112 | |||
| 1244 | Ga0075435_100275497 | |||
| 1245 | Ga0075435_100316413 | |||
| 1246 | Ga0075435_100667463 | |||
| 1247 | Ga0075435_100694013 | |||
| 1248 | Ga0099794_10011365 | |||
| 1249 | Ga0099794_10017902 | |||
| 1250 | Ga0099794_10019828 | |||
| 1251 | Ga0099795_10059973 | |||
| 1252 | Ga0105251_10019995 | |||
| 1253 | Ga0105250_10036971 | |||
| 1254 | Ga0105240_10012327 | |||
| 1255 | Ga0105240_10215904 | |||
| 1256 | Ga0105240_10744984 | |||
| 1257 | Ga0111539_10089724 | |||
| 1258 | Ga0111539_10109039 | |||
| 1259 | Ga0111539_10150665 | |||
| 1260 | Ga0111539_10229442 | |||
| 1261 | Ga0111539_10286824 | |||
| 1262 | Ga0111539_10565452 | |||
| 1263 | Ga0111539_10577925 | |||
| 1264 | Ga0111539_10578423 | |||
| 1265 | Ga0111539_11212562 | |||
| 1266 | Ga0105245_10051077 | |||
| 1267 | Ga0105245_10231631 | |||
| 1268 | Ga0105245_11406078 | |||
| 1269 | Ga0114129_10002113 | |||
| 1270 | Ga0114129_10011617 | |||
| 1271 | Ga0114129_10048513 | |||
| 1272 | Ga0114129_10221243 | |||
| 1273 | Ga0114129_10349571 | |||
| 1274 | Ga0114129_11039546 | |||
| 1275 | Ga0114129_11487948 | |||
| 1276 | Ga0114129_11489605 | |||
| 1277 | Ga0114129_11987904 | |||
| 1278 | Ga0105243_10440664 | |||
| 1279 | Ga0105243_10605780 | |||
| 1280 | Ga0105243_11436345 | |||
| 1281 | Ga0105241_10521919 | |||
| 1282 | Ga0105242_10028336 | |||
| 1283 | Ga0105242_10349934 | |||
| 1284 | Ga0105248_10623085 | |||
| 1285 | Ga0105237_10028064 | |||
| 1286 | Ga0105237_10141603 | |||
| 1287 | Ga0105238_10037417 | |||
| 1288 | Ga0105238_10154909 | |||
| 1289 | Ga0105238_10160965 | |||
| 1290 | Ga0105238_10345146 | |||
| 1291 | Ga0105238_10459267 | |||
| 1292 | Ga0105238_10563447 | |||
| 1293 | Ga0105249_10015086 | |||
| 1294 | Ga0105249_10579958 | |||
| 1295 | Ga0105249_10672243 | |||
| 1296 | Ga0099796_10010230 | |||
| 1297 | Ga0099796_10023258 | |||
| 1298 | Ga0105239_10031952 | |||
| 1299 | Ga0105239_10188702 | |||
| 1300 | Ga0105239_10308693 | |||
| 1301 | Ga0105239_10522002 | |||
| 1302 | Ga0105239_11216837 | |||
| 1303 | Ga0157373_10093120 | |||
| 1304 | Ga0157370_10980725 | |||
| 1305 | Ga0157369_10011724 | |||
| 1306 | Ga0157369_10158993 | |||
| 1307 | Ga0157369_10541407 | |||
| 1308 | Ga0157374_10083923 | |||
| 1309 | Ga0157374_10298170 | |||
| 1310 | Ga0157374_10369049 | |||
| 1311 | Ga0157374_10720035 | |||
| 1312 | Ga0157372_10018682 | |||
| 1313 | Ga0157372_10088796 | |||
| 1314 | Ga0157372_10245304 | |||
| 1315 | Ga0157372_10277978 | |||
| 1316 | Ga0157375_10009835 | |||
| 1317 | Ga0157375_10796818 | |||
| 1318 | Ga0163163_10303939 | |||
| 1319 | Ga0163163_10372967 | |||
| 1320 | Ga0163163_10390837 | |||
| 1321 | Ga0157380_10405511 | |||
| 1322 | Ga0157380_10710931 | |||
| 1323 | Ga0157380_11157619 | |||
| 1324 | Ga0157377_10004874 | |||
| 1325 | Ga0157379_10027886 | |||
| 1326 | Ga0157379_10659050 | |||
| 1327 | Ga0157376_10135733 | |||
| 1328 | Ga0163161_10120185 | |||
| 1329 | Ga0163161_10780922 | |||
| 1330 | Ga0213872_10021062 | |||
| 1331 | Ga0213876_10077341 | |||
| 1332 | Ga0213876_10099408 | |||
| 1333 | Ga0213876_10101010 | |||
| 1334 | Ga0213875_10000053 | |||
| 1335 | Ga0213875_10158083 | |||
| 1336 | Ga0224572_1004891 | |||
| 1337 | Ga0228598_1000876 | |||
| 1338 | Ga0228598_1020313 | |||
| 1339 | Ga0207426_1013129 | |||
| 1340 | Ga0207426_1056002 | |||
| 1341 | Ga0207697_10030261 | |||
| 1342 | Ga0207697_10032524 | |||
| 1343 | Ga0207656_10016209 | |||
| 1344 | Ga0207656_10247897 | |||
| 1345 | Ga0207692_10226083 | |||
| 1346 | Ga0207642_10013018 | |||
| 1347 | Ga0207688_10003415 | |||
| 1348 | Ga0207680_10008657 | |||
| 1349 | Ga0207680_10402985 | |||
| 1350 | Ga0207647_10064910 | |||
| 1351 | Ga0207685_10031288 | |||
| 1352 | Ga0207685_10102199 | |||
| 1353 | Ga0207699_10014408 | |||
| 1354 | Ga0207699_10316086 | |||
| 1355 | Ga0207645_10048865 | |||
| 1356 | Ga0207645_10049992 | |||
| 1357 | Ga0207645_10398827 | |||
| 1358 | Ga0207643_10005672 | |||
| 1359 | Ga0207705_10213428 | |||
| 1360 | Ga0207705_10241045 | |||
| 1361 | Ga0207684_10096437 | |||
| 1362 | Ga0207707_10004277 | |||
| 1363 | Ga0207707_10379776 | |||
| 1364 | Ga0207707_10490182 | |||
| 1365 | Ga0207695_10026716 | |||
| 1366 | Ga0207695_11051143 | |||
| 1367 | Ga0207671_10077285 | |||
| 1368 | Ga0207671_10214673 | |||
| 1369 | Ga0207693_10002485 | |||
| 1370 | Ga0207693_10041146 | |||
| 1371 | Ga0207693_10063092 | |||
| 1372 | Ga0207693_10185616 | |||
| 1373 | Ga0207693_10226341 | |||
| 1374 | Ga0207693_10284764 | |||
| 1375 | Ga0207693_10458723 | |||
| 1376 | Ga0207663_10045292 | |||
| 1377 | Ga0207663_10080623 | |||
| 1378 | Ga0207663_10118085 | |||
| 1379 | Ga0207660_10008666 | |||
| 1380 | Ga0207660_10328117 | |||
| 1381 | Ga0207662_10290993 | |||
| 1382 | Ga0207662_10313530 | |||
| 1383 | Ga0207657_10100027 | |||
| 1384 | Ga0207657_10554022 | |||
| 1385 | Ga0207649_10007883 | |||
| 1386 | Ga0207649_10189617 | |||
| 1387 | Ga0207652_10083726 | |||
| 1388 | Ga0207652_10648679 | |||
| 1389 | Ga0207652_10655105 | |||
| 1390 | Ga0207646_10268358 | |||
| 1391 | Ga0207681_10118776 | |||
| 1392 | Ga0207694_10129583 | |||
| 1393 | Ga0207694_10290493 | |||
| 1394 | Ga0207694_10499360 | |||
| 1395 | Ga0207650_10031312 | |||
| 1396 | Ga0207650_10071529 | |||
| 1397 | Ga0207650_10149991 | |||
| 1398 | Ga0207659_10298422 | |||
| 1399 | Ga0207659_10309531 | |||
| 1400 | Ga0207659_10552690 | |||
| 1401 | Ga0207687_10006331 | |||
| 1402 | Ga0207687_10067357 | |||
| 1403 | Ga0207687_10263202 | |||
| 1404 | Ga0207700_10013689 | |||
| 1405 | Ga0207700_10078066 | |||
| 1406 | Ga0207700_10153148 | |||
| 1407 | Ga0207700_10178347 | |||
| 1408 | Ga0207700_10225900 | |||
| 1409 | Ga0207700_10308481 | |||
| 1410 | Ga0207700_10334744 | |||
| 1411 | Ga0207664_10033479 | |||
| 1412 | Ga0207664_10333892 | |||
| 1413 | Ga0207664_10456388 | |||
| 1414 | Ga0207644_10016623 | |||
| 1415 | Ga0207644_10023230 | |||
| 1416 | Ga0207644_10038217 | |||
| 1417 | Ga0207644_10525956 | |||
| 1418 | Ga0207690_10018700 | |||
| 1419 | Ga0207690_10104102 | |||
| 1420 | Ga0207706_10038206 | |||
| 1421 | Ga0207670_10017680 | |||
| 1422 | Ga0207670_10020641 | |||
| 1423 | Ga0207669_10005520 | |||
| 1424 | Ga0207669_10286357 | |||
| 1425 | Ga0207669_10471956 | |||
| 1426 | Ga0207669_10740924 | |||
| 1427 | Ga0207665_10004102 | |||
| 1428 | Ga0207665_10067219 | |||
| 1429 | Ga0207665_10097939 | |||
| 1430 | Ga0207665_10855171 | |||
| 1431 | Ga0207691_10001627 | |||
| 1432 | Ga0207691_10250595 | |||
| 1433 | Ga0207711_10101018 | |||
| 1434 | Ga0207711_10227872 | |||
| 1435 | Ga0207711_10472488 | |||
| 1436 | Ga0207689_10007012 | |||
| 1437 | Ga0207661_10026523 | |||
| 1438 | Ga0207661_10106947 | |||
| 1439 | Ga0207679_10015638 | |||
| 1440 | Ga0207679_10081985 | |||
| 1441 | Ga0207679_10230954 | |||
| 1442 | Ga0207667_10055984 | |||
| 1443 | Ga0207667_10062848 | |||
| 1444 | Ga0207667_10118214 | |||
| 1445 | Ga0207667_10744060 | |||
| 1446 | Ga0207651_10135996 | |||
| 1447 | Ga0207651_10269391 | |||
| 1448 | Ga0207712_10234008 | |||
| 1449 | Ga0207668_10007545 | |||
| 1450 | Ga0207640_10019201 | |||
| 1451 | Ga0207640_10341830 | |||
| 1452 | Ga0207640_10529856 | |||
| 1453 | Ga0207658_10096845 | |||
| 1454 | Ga0207658_10802301 | |||
| 1455 | Ga0207677_10126300 | |||
| 1456 | Ga0207677_10391944 | |||
| 1457 | Ga0207677_10667069 | |||
| 1458 | Ga0207703_10167640 | |||
| 1459 | Ga0207703_10525085 | |||
| 1460 | Ga0207703_10686420 | |||
| 1461 | Ga0207639_10158101 | |||
| 1462 | Ga0207678_10020051 | |||
| 1463 | Ga0207678_10334683 | |||
| 1464 | Ga0207678_10370403 | |||
| 1465 | Ga0207708_10001502 | |||
| 1466 | Ga0207708_10152108 | |||
| 1467 | Ga0207708_10896307 | |||
| 1468 | Ga0207702_10064733 | |||
| 1469 | Ga0207702_11400396 | |||
| 1470 | Ga0207648_10006668 | |||
| 1471 | Ga0207648_10074077 | |||
| 1472 | Ga0207648_10278555 | |||
| 1473 | Ga0207648_10710169 | |||
| 1474 | Ga0207676_10018586 | |||
| 1475 | Ga0207675_100013475 | |||
| 1476 | Ga0207675_100260100 | |||
| 1477 | Ga0207683_10012333 | |||
| 1478 | Ga0207683_10076816 | |||
| 1479 | Ga0207683_10547128 | |||
| 1480 | Ga0207698_10127091 | |||
| 1481 | Ga0207698_10678084 | |||
| 1482 | Ga0209179_1011531 | |||
| 1483 | Ga0209588_1010903 | |||
| 1484 | Ga0209588_1027516 | |||
| 1485 | Ga0209813_10003719 | |||
| 1486 | Ga0207428_10049012 | |||
| 1487 | Ga0268266_10095158 | |||
| 1488 | Ga0268266_10286712 | |||
| 1489 | Ga0268266_10449037 | |||
| 1490 | Ga0268266_10494120 | |||
| 1491 | Ga0268266_10760726 | |||
| 1492 | Ga0268265_10011597 | |||
| 1493 | Ga0268265_10597576 | |||
| 1494 | Ga0268264_10858049 | |||
| 1495 | Ga0265334_10012318 | |||
| 1496 | Ga0265338_10151314 | |||
| 1497 | Ga0265763_1007016 | |||
| 1498 | Ga0265763_1008412 | |||
| 1499 | Ga0265773_1006882 | |||
| 1500 | Ga0265332_10006574 | |||
| 1501 | Ga0265325_10002317 | |||
| 1502 | Ga0265329_10070499 | |||
| 1503 | Ga0265340_10015062 | |||
| 1504 | Ga0265339_10000078 | |||
| 1505 | Ga0265339_10019601 | |||
| 1506 | Ga0265331_10154151 | |||
| 1507 | Ga0265316_10228627 | |||
| 1508 | Ga0265313_10003528 | |||
| 1509 | Ga0265314_10022239 | |||
| 1510 | Ga0265342_10002635 | |||
| 1511 | Ga0316578_10268499 | |||
| 1512 | Ga0373926_0022219 | |||
| 1513 | Ga0373929_0111511 | |||
| 1514 | Ga0373944_0024358 | |||
| 1515 | Ga0373952_0114059 | |||
| 1516 | Ga0373923_0002771 | |||
| 1517 | Ga0373923_0078977 | |||
| 1518 | Ga0373936_0003979 | |||
| 1519 | Ga0373936_0010496 | |||
| 1520 | Ga0373936_0104241 | |||
| 1521 | Ga0373939_0069327 | |||
| 1522 | Ga0373945_0001064 | |||
| 1523 | Ga0373945_0005949 | |||
| 1524 | Ga0373953_0004294 | |||
| 1525 | Ga0373954_0000906 | |||
| 1526 | Ga0373954_0002609 | |||
| 1527 | Ga0373954_0058587 | |||
| 1528 | Ga0373956_0000029 | |||
| 1529 | Ga0373956_0033037 | |||
| 1530 | Ga0373956_0339949 | |||
| 1531 | Ga0373957_0010530 | |||
| 1532 | Ga0373957_0015261 | |||
| 1533 | Ga0373960_0014720 | |||
| 1534 | Ga0373943_0000208 | |||
| 1535 | Ga0373943_0003827 | |||
| 1536 | Ga0373943_0032102 | |||
| 1537 | Ga0373943_0058368 | |||
| 1538 | Ga0373946_0001814 | |||
| 1539 | Ga0373946_0006567 | |||
| 1540 | Ga0373946_0020608 | |||
| 1541 | Ga0373955_0000201 | |||
| 1542 | Ga0373955_0003420 | |||
| 1543 | Ga0373942_0088537 | |||
| 1544 | Ga0373942_0185417 | |||
| 1545 | Ga0373961_0108448 | |||
| 1546 | Ga0373924_0062256 | |||
| 1547 | Ga0373931_0024776 | |||
| 1548 | Ga0373931_0049908 | |||
| 1549 | Ga0373931_0177648 | |||
| 1550 | Ga0373935_0000068 | |||
| 1551 | Ga0373935_0048992 | |||
| 1552 | Ga0373935_0213117 | |||
| 1553 | Ga0373935_0431288 | |||
| 1554 | Ga0373927_0005387 | |||
| 1555 | Ga0373927_0006191 | |||
| 1556 | Ga0373927_0026505 | |||
| 1557 | Ga0373927_0028489 | |||
| 1558 | Ga0373927_0039331 | |||
| 1559 | Ga0373927_0067847 | |||
| 1560 | Ga0373927_0179490 | |||
| 1561 | Ga0373927_0331838 | |||
| 1562 | Ga0373933_0002902 | |||
| 1563 | Ga0373933_0003207 | |||
| 1564 | Ga0373933_0534282 | |||
| 1565 | Ga0373933_0647813 | |||
| 1566 | Ga0373947_0000178 | |||
| 1567 | Ga0373947_0002537 | |||
| 1568 | Ga0373947_0023662 | |||
| 1569 | Ga0373947_0064449 | |||
| 1570 | Ga0373947_0102805 | |||
| 1571 | Ga0373947_0125390 | |||
| 1572 | Ga0373947_0180047 | |||
| 1573 | Ga0373937_0000347 | |||
| 1574 | Ga0373937_0000441 | |||
| 1575 | Ga0373937_0045533 | |||
| 1576 | Ga0373937_0179799 | |||
| 1577 | Ga0373937_0194899 | |||
| 1578 | Ga0373937_0250597 | |||
| 1579 | Ga0316582_0245053 | |||
| 1580 | Ga0373925_0000081 | |||
| 1581 | Ga0373925_0001482 | |||
| 1582 | Ga0373925_0044829 | |||
| 1583 | Ga0373925_0250494 | |||
| 1584 | Ga0373925_0302993 | |||
| 1585 | Ga0373925_0324306 | |||
| 1586 | Ga0373925_0454820 | |||
| 1587 | Ga0373925_0638458 | |||
| 1588 | Ga0395899_0014903 | |||
| 1589 | Ga0395899_0096464 | |||
| 1590 | Ga0395900_0008428 | |||
| 1591 | Ga0395900_0011461 | |||
| 1592 | Ga0395900_0143324 | |||
| 1593 | Ga0395900_1067436 | |||
| 1594 | Ga0395898_0082166 | |||
| 1595 | Ga0395898_0138981 | |||
| 1596 | Ga0395898_0331558 | |||
| 1597 | Ga0395905_0500874 | |||
| 1598 | Ga0436364_0664195 | |||
| 1599 | Ga0436364_0716542 | |||
| 1600 | Ga0436364_0951864 | |||
| 1601 | Ga0395901_0009788 | |||
| 1602 | Ga0395901_0018877 | |||
| 1603 | Ga0395901_0137101 | |||
| 1604 | Ga0395901_0215568 | |||
| 1605 | Ga0395901_0564087 | |||
| 1606 | Ga0436365_0042743 | |||
| 1607 | Ga0436365_0291537 | |||
| 1608 | Ga0436365_1099387 | |||
| 1609 | Ga0436365_1251077 | |||
| 1610 | Ga0436365_1336443 | |||
| 1611 | Ga0436365_1383206 | |||
| 1612 | Ga0436360_0291491 | |||
| 1613 | Ga0436360_0775077 | |||
| 1614 | Ga0436360_1307075 | |||
| 1615 | Ga0436361_0424457 | |||
| 1616 | Ga0436361_0687582 | |||
| 1617 | Ga0436361_0914825 | |||
| 1618 | Ga0436363_0235431 | |||
| 1619 | Ga0436363_0753578 | |||
| 1620 | Ga0436363_1012681 | |||
| 1621 | Ga0436363_1455596 | |||
| 1622 | Ga0439453_0015398 | |||
| 1623 | Ga0451853_1512202 | |||
| 1624 | Ga0439464_0034921 | |||
| 1625 | Ga0451577_0277536 | |||
| 1626 | Ga0466966_0306725 | |||
| 1627 | Ga0466961_0158392 | |||
| 1628 | Ga0466963_0018448 | |||
| 1629 | Ga0466963_0025164 | |||
| 1630 | Ga0466957_0125405 | |||
| 1631 | Ga0466959_0034418 | |||
| 1632 | Ga0466959_0036016 | |||
| 1633 | Ga0451576_0295185 | |||
| 1634 | Ga0451576_0599338 | |||
| 1635 | Ga0466958_0014631 | |||
| 1636 | Ga0466958_0067079 | |||
| 1637 | Ga0466967_0091388 | |||
| 1638 | Ga0466967_0320079 | |||
| 1639 | Ga0466967_0611955 | |||
| 1640 | Ga0495617_118481 | |||
| 1641 | Ga0495592_0000196 | |||
| 1642 | Ga0495592_0022021 | |||
| 1643 | Ga0495592_0287452 | |||
| 1644 | Ga0495603_0165172 | |||
| 1645 | Ga0495590_0087493 | |||
| 1646 | Ga0495591_045515 | |||
| 1647 | Ga0495629_0003904 | |||
| 1648 | Ga0495651_0000356 | |||
| 1649 | Ga0495651_0000977 | |||
| 1650 | Ga0495651_0062022 | |||
| 1651 | Ga0495651_0088854 | |||
| 1652 | Ga0495653_0000193 | |||
| 1653 | Ga0495653_0125711 | |||
| 1654 | Ga0495653_0367836 | |||
| 1655 | Ga0495580_0091021 | |||
| 1656 | Ga0495582_0022901 | |||
| 1657 | Ga0495582_0034182 | |||
| 1658 | Ga0495582_0212729 | |||
| 1659 | Ga0495639_0045107 | |||
| 1660 | Ga0495662_0060059 | |||
| 1661 | Ga0495662_0080447 | |||
| 1662 | Ga0495662_0142170 | |||
| 1663 | Ga0495662_0242024 | |||
| 1664 | Ga0495664_0000016 | |||
| 1665 | Ga0495664_0015488 | |||
| 1666 | Ga0495584_0139415 | |||
| 1667 | Ga0495594_0266148 | |||
| 1668 | Ga0495607_0119698 | |||
| 1669 | Ga0495608_0000121 | |||
| 1670 | Ga0495608_0279154 | |||
| 1671 | Ga0495616_0056321 | |||
| 1672 | Ga0495618_0000124 | |||
| 1673 | Ga0495618_0041757 | |||
| 1674 | Ga0495618_0091385 | |||
| 1675 | Ga0495628_0000018 | |||
| 1676 | Ga0495628_0015254 | |||
| 1677 | Ga0495628_0101785 | |||
| 1678 | Ga0495628_0139904 | |||
| 1679 | Ga0495630_0002180 | |||
| 1680 | Ga0495630_0088692 | |||
| 1681 | Ga0495630_0269636 | |||
| 1682 | Ga0495630_0432671 | |||
| 1683 | Ga0495644_0015905 | |||
| 1684 | Ga0495666_0057585 | |||
| 1685 | Ga0495666_0124149 | |||
| 1686 | Ga0495652_0000005 | |||
| 1687 | Ga0495652_0006146 | |||
| 1688 | Ga0495652_0044867 | |||
| 1689 | Ga0495652_0173262 | |||
| 1690 | Ga0495665_0022710 | |||
| 1691 | Ga0495665_0062082 | |||
| 1692 | Ga0495665_0111401 | |||
| 1693 | Ga0495640_0000063 | |||
| 1694 | Ga0495640_0186408 | |||
| 1695 | Ga0495640_0192449 | |||
| 1696 | Ga0495640_0261916 | |||
| 1697 | Ga0495586_0027423 | |||
| 1698 | Ga0495587_0000134 | |||
| 1699 | Ga0495587_0063866 | |||
| 1700 | Ga0495587_0289664 | |||
| 1701 | Ga0495598_0000513 | |||
| 1702 | Ga0495598_0085309 | |||
| 1703 | Ga0495621_0066992 | |||
| 1704 | Ga0495645_0000070 | |||
| 1705 | Ga0495645_0006688 | |||
| 1706 | Ga0495645_0042265 | |||
| 1707 | Ga0495645_0225337 | |||
| 1708 | Ga0495633_0126843 | |||
| 1709 | Ga0495667_0000023 | |||
| 1710 | Ga0495667_0258536 | |||
| 1711 | Ga0495667_0321339 | |||
| 1712 | Ga0495668_0106349 | |||
| 1713 | Ga0495668_0232391 | |||
| 1714 | Ga0495634_0000241 | |||
| 1715 | Ga0495634_0006515 | |||
| 1716 | Ga0495634_0007380 | |||
| 1717 | Ga0495634_0023797 | |||
| 1718 | Ga0495634_0131184 | |||
| 1719 | Ga0495635_0000045 | |||
| 1720 | Ga0495635_0007866 | |||
| 1721 | Ga0495635_0474966 | |||
| 1722 | Ga0495659_0046419 | |||
| 1723 | Ga0495657_0001202 | |||
| 1724 | Ga0495657_0054030 | |||
| 1725 | Ga0495657_0227561 | |||
| 1726 | Ga0495657_0297955 | |||
| 1727 | Ga0495599_0000107 | |||
| 1728 | Ga0495599_0016176 | |||
| 1729 | Ga0495599_0271096 | |||
| 1730 | Ga0495623_0000180 | |||
| 1731 | Ga0495623_0290852 | |||
| 1732 | Ga0495646_0000027 | |||
| 1733 | Ga0495646_0009489 | |||
| 1734 | Ga0495646_0086248 | |||
| 1735 | Ga0495647_0017526 | |||
| 1736 | Ga0495647_0133894 | |||
| 1737 | Ga0495658_0020639 | |||
| 1738 | Ga0495658_0088488 | |||
| 1739 | Ga0495658_0782518 | |||
| 1740 | Ga0495613_0028287 | |||
| 1741 | Ga0495613_0055243 | |||
| 1742 | Ga0495613_0056616 | |||
| 1743 | Ga0495613_0070264 | |||
| 1744 | Ga0495613_0103178 | |||
| 1745 | Ga0495624_0052660 | |||
| 1746 | Ga0495624_0093253 | |||
| 1747 | Ga0495670_0004845 | |||
| 1748 | Ga0495671_0025808 | |||
| 1749 | Ga0495600_0000062 | |||
| 1750 | Ga0495600_0028026 | |||
| 1751 | Ga0495581_0050844 | |||
| 1752 | Ga0495581_0164637 | |||
| 1753 | Ga0495581_0251664 | |||
| 1754 | Ga0495604_0000014 | |||
| 1755 | Ga0495674_0000014 | |||
| 1756 | Ga0495674_0146874 | |||
| 1757 | Ga0495674_0452055 | |||
| 1758 | Ga0495672_0091047 | |||
| 1759 | Ga0495676_0021834 | |||
| 1760 | Ga0495676_0072883 | |||
| 1761 | Ga0495676_0542368 | |||
| 1762 | Ga0495680_0000779 | |||
| 1763 | Ga0495680_0199616 | |||
| 1764 | Ga0495680_0274377 | |||
| 1765 | Ga0495680_0326915 | |||
| 1766 | Ga0495675_0000058 | |||
| 1767 | Ga0495675_0074564 | |||
| 1768 | Ga0495675_0222744 | |||
| 1769 | Ga0495684_0000059 | |||
| 1770 | Ga0495684_0023040 | |||
| 1771 | Ga0495684_0032711 | |||
| 1772 | Ga0495593_0005129 | |||
| 1773 | Ga0495593_0006926 | |||
| 1774 | Ga0495593_0092976 | |||
| 1775 | Ga0495593_0249251 | |||
| 1776 | Ga0495602_0000017 | |||
| 1777 | Ga0495602_0281844 | |||
| 1778 | Ga0495602_0842122 | |||
| 1779 | Ga0496100_0006029 | |||
| 1780 | Ga0496100_0007617 | |||
| 1781 | Ga0496100_0221282 | |||
| 1782 | Ga0496100_0577318 | |||
| 1783 | Ga0496100_0704446 | |||
| 1784 | Ga0496101_0000879 | |||
| 1785 | Ga0496101_0003104 | |||
| 1786 | Ga0496101_0011363 | |||
| 1787 | Ga0496101_0018180 | |||
| 1788 | Ga0496101_0153974 | |||
| 1789 | Ga0496101_0340027 | |||
| 1790 | Ga0496101_0344962 | |||
| 1791 | Ga0496101_0608082 | |||
| 1792 | Ga0496101_0629180 | |||
| 1793 | Ga0496102_0008462 | |||
| 1794 | Ga0496102_0011826 | |||
| 1795 | Ga0496102_0024214 | |||
| 1796 | Ga0496102_0037021 | |||
| 1797 | Ga0496102_0069866 | |||
| 1798 | Ga0496102_0576835 | |||
| 1799 | Ga0496102_0717283 | |||
| 1800 | Ga0496102_0902813 | |||
| 1801 | Ga0496103_0007237 | |||
| 1802 | Ga0496103_0048800 | |||
| 1803 | Ga0496103_0102030 | |||
| 1804 | Ga0496103_0243198 | |||
| 1805 | Ga0496104_0001978 | |||
| 1806 | Ga0496104_0004384 | |||
| 1807 | Ga0496104_0006107 | |||
| 1808 | Ga0496104_0017059 | |||
| 1809 | Ga0496104_0195705 | |||
| 1810 | Ga0496104_0374083 | |||
| 1811 | Ga0496104_0468513 | |||
| 1812 | Ga0496104_0848001 | |||
| 1813 | Ga0496104_0990057 | |||
| 1814 | Ga0496105_0001999 | |||
| 1815 | Ga0496105_0005181 | |||
| 1816 | Ga0496105_0015753 | |||
| 1817 | Ga0496105_0061405 | |||
| 1818 | Ga0496105_0061711 | |||
| 1819 | Ga0496105_0098553 | |||
| 1820 | Ga0496105_0454318 | |||
| 1821 | Ga0496106_0003496 | |||
| 1822 | Ga0496106_0011510 | |||
| 1823 | Ga0496106_0016650 | |||
| 1824 | Ga0496106_0317869 | |||
| 1825 | Ga0496106_0917103 | |||
| 1826 | Ga0496107_0008551 | |||
| 1827 | Ga0496107_0028396 | |||
| 1828 | Ga0496107_0062820 | |||
| 1829 | Ga0496107_0181280 | |||
| 1830 | Ga0496107_0318195 | |||
| 1831 | Ga0496108_0000347 | |||
| 1832 | Ga0496108_0005996 | |||
| 1833 | Ga0496108_0013218 | |||
| 1834 | Ga0496108_0018394 | |||
| 1835 | Ga0496108_0032557 | |||
| 1836 | Ga0496108_0077240 | |||
| 1837 | Ga0496109_0005863 | |||
| 1838 | Ga0496109_0022511 | |||
| 1839 | Ga0496109_0032495 | |||
| 1840 | Ga0496109_0045633 | |||
| 1841 | Ga0496109_0313055 | |||
| 1842 | Ga0496109_0498994 | |||
| 1843 | Ga0496109_0586258 | |||
| 1844 | Ga0496110_0000339 | |||
| 1845 | Ga0496110_0003146 | |||
| 1846 | Ga0496110_0012105 | |||
| 1847 | Ga0496110_0029719 | |||
| 1848 | Ga0496110_0074428 | |||
| 1849 | Ga0496110_0170611 | |||
| 1850 | Ga0496110_0264085 | |||
| 1851 | Ga0496110_0323362 | |||
| 1852 | Ga0496110_0625564 | |||
| 1853 | Ga0496111_0001676 | |||
| 1854 | Ga0496111_0009006 | |||
| 1855 | Ga0496111_0017366 | |||
| 1856 | Ga0496111_0021601 | |||
| 1857 | Ga0496111_0720866 | |||
| 1858 | Ga0496112_0002294 | |||
| 1859 | Ga0496112_0003807 | |||
| 1860 | Ga0496112_0004698 | |||
| 1861 | Ga0496112_0006289 | |||
| 1862 | Ga0496112_0129178 | |||
| 1863 | Ga0496112_0233439 | |||
| 1864 | Ga0496112_0618357 | |||
| 1865 | Ga0496112_0648060 | |||
| 1866 | Ga0496112_0917495 | |||
| 1867 | Ga0496113_0069726 | |||
| 1868 | Ga0496113_0075665 | |||
| 1869 | Ga0496113_0114824 | |||
| 1870 | Ga0496113_0132092 | |||
| 1871 | Ga0496113_0280044 | |||
| 1872 | Ga0496114_0110149 | |||
| 1873 | Ga0496115_0018524 | |||
| 1874 | Ga0496115_0055975 | |||
| 1875 | Ga0496115_0060795 | |||
| 1876 | Ga0496115_0257531 | |||
| 1877 | Ga0496115_0316815 | |||
| 1878 | Ga0496115_0826093 | |||
| 1879 | Ga0501031_0023742 | |||
| 1880 | Ga0501032_0175050 | |||
| 1881 | Ga0501033_0058028 | |||
| 1882 | Ga0501034_0000891 | |||
| 1883 | Ga0501034_0011745 | |||
| 1884 | Ga0501034_0021303 | |||
| 1885 | Ga0501034_0234213 | |||
| 1886 | Ga0501036_0171303 | |||
| 1887 | Ga0501038_0580131 | |||
| 1888 | Ga0501039_0008570 | |||
| 1889 | Ga0501040_0015963 | |||
| 1890 | Ga0501040_0725460 | |||
| 1891 | Ga0501041_0033918 | |||
| 1892 | Ga0501042_0006103 | |||
| 1893 | Ga0501042_0291971 | |||
| 1894 | Ga0501043_0016253 | |||
| 1895 | Ga0501043_0059010 | |||
| 1896 | Ga0501046_0124912 | |||
| 1897 | Ga0501046_0266063 | |||
| 1898 | Ga0501047_0610694 | |||
| 1899 | Ga0501048_0011307 | |||
| 1900 | Ga0501048_0331171 | |||
| 1901 | Ga0501068_0012440 | |||
| 1902 | Ga0501068_0017211 | |||
| 1903 | Ga0501068_0562319 | |||
| 1904 | Ga0501069_0041972 | |||
| 1905 | Ga0501069_0047991 | |||
| 1906 | Ga0501070_0003987 | |||
| 1907 | Ga0501070_0185817 | |||
| 1908 | Ga0501070_0787475 | |||
| 1909 | Ga0501071_0007220 | |||
| 1910 | Ga0501071_0671147 | |||
| 1911 | Ga0501073_0400560 | |||
| 1912 | Ga0501074_0001669 | |||
| 1913 | Ga0501074_0116108 | |||
| 1914 | Ga0501075_0038416 | |||
| 1915 | Ga0501075_0164115 | |||
| 1916 | Ga0501075_0248755 | |||
| 1917 | Ga0501075_0412224 | |||
| 1918 | Ga0501075_0451005 | |||
| 1919 | Ga0501076_0019950 | |||
| 1920 | Ga0501076_0166618 | |||
| 1921 | Ga0501077_0038035 | |||
| 1922 | Ga0501079_0142427 | |||
| 1923 | Ga0501079_0299090 | |||
| 1924 | Ga0501080_0049205 | |||
| 1925 | Ga0501080_0306962 | |||
| 1926 | Ga0501081_0533014 | |||
| 1927 | Ga0501083_0278715 | |||
| 1928 | Ga0501035_0102447 | |||
| 1929 | Ga0501044_0058411 | |||
| 1930 | Ga0501044_0435136 | |||
| 1931 | Ga0501045_0007001 | |||
| 1932 | nmdc:mga03n38_3932_c1 | |||
| 1933 | nmdc:mga03n38_523875_c1 | |||
| 1934 | nmdc:mga0yw44_14371_c1 | |||
| 1935 | nmdc:mga0yw44_155796_c1 | |||
| 1936 | nmdc:mga0yw44_176483_c1 | |||
| 1937 | nmdc:mga0yw44_70420_c1 | |||
| 1938 | nmdc:mga0k408_347576_c1 | |||
| 1939 | nmdc:mga06z11_39475_c1 | |||
| 1940 | nmdc:mga06z11_790_c1 | |||
| 1941 | nmdc:mga06z11_9739_c1 | |||
| 1942 | nmdc:mga04h51_7974_c1 | |||
| 1943 | nmdc:mga05p37_13689_c1 | |||
| 1944 | nmdc:mga05p37_182270_c1 | |||
| 1945 | nmdc:mga05p37_463312_c1 | |||
| 1946 | nmdc:mga05p37_51539_c1 | |||
| 1947 | nmdc:mga09592_26_c1 | |||
| 1948 | nmdc:mga09592_276302_c1 | |||
| 1949 | nmdc:mga09592_351191_c1 | |||
| 1950 | nmdc:mga09592_452835_c1 | |||
| 1951 | nmdc:mga09592_551382_c1 | |||
| 1952 | nmdc:mga0qj67_69955_c1 | |||
| 1953 | nmdc:mga0qj67_72478_c1 | |||
| 1954 | nmdc:mga06r32_118534_c1 | |||
| 1955 | nmdc:mga06r32_134422_c1 | |||
| 1956 | nmdc:mga06r32_274046_c1 | |||
| 1957 | nmdc:mga06r32_5683_c1 | |||
| 1958 | nmdc:mga06r32_898206_c1 | |||
| 1959 | nmdc:mga06r32_899039_c1 | |||
| 1960 | nmdc:mga08y16_147315_c1 | |||
| 1961 | nmdc:mga08y16_496710_c1 | |||
| 1962 | nmdc:mga08y16_627756_c1 | |||
| 1963 | nmdc:mga08y16_66523_c1 | |||
| 1964 | nmdc:mga0n895_155498_c1 | |||
| 1965 | nmdc:mga0n895_454272_c1 | |||
| 1966 | nmdc:mga0n895_459658_c1 | |||
| 1967 | nmdc:mga0n895_4873_c1 | |||
| 1968 | nmdc:mga0n895_809489_c1 | |||
| 1969 | nmdc:mga0n895_84596_c1 | |||
| 1970 | nmdc:mga0n895_938110_c1 | |||
| 1971 | nmdc:mga0n895_98294_c1 | |||
| 1972 | nmdc:mga0rr50_137244_c1 | |||
| 1973 | nmdc:mga0rr50_201279_c1 | |||
| 1974 | nmdc:mga0rr50_294262_c1 | |||
| 1975 | nmdc:mga0rr50_929405_c1 | |||
| 1976 | nmdc:mga0rr50_95527_c1 | |||
| 1977 | nmdc:mga08x19_127143_c1 | |||
| 1978 | nmdc:mga08x19_3673_c1 | |||
| 1979 | nmdc:mga08x19_40687_c1 | |||
| 1980 | nmdc:mga08x19_483147_c1 | |||
| 1981 | nmdc:mga0a205_25016_c1 | |||
| 1982 | nmdc:mga0a205_342822_c1 | |||
| 1983 | nmdc:mga0a205_394674_c1 | |||
| 1984 | nmdc:mga0a205_534460_c1 | |||
| 1985 | nmdc:mga0sz30_5978_c1 | |||
| 1986 | Ga0495601_0000016 | |||
| 1987 | Ga0495601_0006967 | |||
| 1988 | Ga0495601_0011070 | |||
| 1989 | Ga0495601_0017716 | |||
| 1990 | Ga0495601_0043988 | |||
| 1991 | Ga0495601_0095332 | |||
| 1992 | Ga0495601_0259457 | |||
| 1993 | Ga0495601_0343242 | |||
| 1994 | Ga0495612_0000041 | |||
| 1995 | Ga0495612_0008712 | |||
| 1996 | Ga0495612_0097294 | |||
| 1997 | Ga0495612_0222672 | |||
| 1998 | Ga0495612_0237305 | |||
| 1999 | Ga0495655_0000981 | |||
| 2000 | Ga0495595_0000048 | |||
| 2001 | Ga0495595_0001522 | |||
| 2002 | Ga0495595_0143601 | |||
| 2003 | Ga0495619_0000050 | |||
| 2004 | Ga0495619_0002388 | |||
| 2005 | Ga0495619_0041669 | |||
| 2006 | Ga0495619_0088079 | |||
| 2007 | Ga0495619_0118435 | |||
| 2008 | Ga0495619_0313965 | |||
| 2009 | Ga0495619_0391363 | |||
| 2010 | Ga0500566_0112346 | |||
| 2011 | Ga0500641_0000747 | |||
| 2012 | Ga0500650_0089514 | |||
| 2013 | Ga0500568_0052584 | |||
| 2014 | Ga0500616_0004736 | |||
| 2015 | Ga0500616_0036435 | |||
| 2016 | Ga0500645_051596 | |||
| 2017 | Ga0501084_0023539 | |||
| 2018 | Ga0501084_0370131 | |||
| 2019 | Ga0501084_0880187 | |||
| 2020 | Ga0501082_0026550 | |||
| 2021 | Ga0501082_0349555 | |||
| 2022 | Ga0501082_0568735 | |||
| 2023 | Ga0466962_0160303 | |||
| 2024 | Ga0466962_0380322 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kh7-assembly3.cif.gz_B | crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione | 0.9703 | 1 | 207 |
| 4kh7-assembly3.cif.gz_B | crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione | 0.9657 | 1 | 207 |
| 4kh7-assembly2.cif.gz_A | crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione | 0.9648 | 1 | 207 |
| 6nv6-assembly2.cif.gz_B | crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound | 0.9602 | 2 | 207 |
| 6nxv-assembly4.cif.gz_D | crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form | 0.9559 | 2 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ACA7_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9842 | 1 | 78 | 3.40.30.10 |
| 4ielA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.98 | 1 | 79 | 3.40.30.10 |
| 4ke3A01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9709 | 1 | 78 | 3.40.30.10 |
| af_Q7JVZ8_6_81_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9619 | 4 | 77 | 3.40.30.10 |
| 4yh2C01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9602 | 1 | 77 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537Q271-F1-model_v4 | Glutathione S-transferase family protein | 0.989 | 1 | 196 |
GO:0016740
|
| AF-A0A382MT04-F1-model_v4 | GST N-terminal domain-containing protein | 0.9863 | 1 | 76 |
|
| AF-A0A3D3VAC9-F1-model_v4 | Glutathione S-transferase | 0.9809 | 2 | 138 |
GO:0004364
GO:0006749 |
| AF-A0A2H6AS68-F1-model_v4 | Glutathione S-transferase GstB (EC 2.5.1.18) | 0.9796 | 1 | 207 |
GO:0004364
|
| AF-A0A520NSW7-F1-model_v4 | Glutathione S-transferase family protein | 0.9787 | 1 | 207 |
GO:0016740
|