F488175

General Info

Members Datasets Scaffolds Average Seq Length
1012 400 2024 208

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0034467|Ga0466963_0034467_1316_2086
Length 256
Sequence LKIAIDGLSSSAPVDDPVFTGVAMYQRAIVYWMPACAGHEQSEEGGGAVIKIWGRNTSSNVQKVMWAVGEMGLPHQRIDIGGPFGKNREPAYLAMNPNGLVPTLEEADGFLLWESNSIVRYLAAKHKSAELEPPDPHARGRASQWMDWQLSVCGPAITPVFWGLIRTPPEKRDHAAIEAGKKNTTAAMLMVDEQLAKTAYLAGDAFSYGDIPVGIMAYRYRQLVPERPALKNFERWYAAISGRQAFKDQVGAVPLT

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
136 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
137 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
212 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
215 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
216 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
219 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
220 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
221 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
224 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
237 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
248 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
257 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
260 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
261 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
262 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
263 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
264 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
265 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
271 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
272 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
283 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
286 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
287 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
288 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
289 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
290 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
291 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
292 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
293 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
294 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
295 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
296 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
297 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
304 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
357 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
363 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
368 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
372 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
373 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
374 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
375 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
376 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
379 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
380 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
381 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
382 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
383 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
384 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
385 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
386 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
387 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
388 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
389 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
390 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
393 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
394 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
395 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
396 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
397 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
400 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 0
Rhizoplane 9.88
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0034467 3300044694 Bacteria 3293
2 JGI24737J22298_10023897 3300001990 Bacteria 1937
3 JGI24743J22301_10000589 3300001991 Bacteria 4389
4 JGI24738J21930_10011323 3300002075 Bacteria 1963
5 JGI24742J22300_10000606 3300002244 Bacteria 5393
6 JGI25404J52841_10004866 3300003659 Bacteria 2754
7 Ga0058862_12191086 3300004803 Bacteria 762
8 Ga0065707_10160974 3300005295 Bacteria 1563
9 Ga0070658_10120406 3300005327 Bacteria 2181
10 Ga0070658_10210450 3300005327 Bacteria 1642
11 Ga0070658_10485900 3300005327 Bacteria 1066
12 Ga0070683_100011408 3300005329 Bacteria 7681
13 Ga0070683_100040594 3300005329 Bacteria 4280
14 Ga0070683_100311639 3300005329 Bacteria 1497
15 Ga0070690_100015826 3300005330 Bacteria 4506
16 Ga0070690_100556198 3300005330 Bacteria 866
17 Ga0070670_100028487 3300005331 Bacteria 4807
18 Ga0070670_100071135 3300005331 Bacteria 2986
19 Ga0068869_100216323 3300005334 Bacteria 1517
20 Ga0070666_10088544 3300005335 Bacteria 2124
21 Ga0070666_10398149 3300005335 Bacteria 990
22 Ga0070680_100001118 3300005336 Bacteria 19276
23 Ga0070680_100109890 3300005336 Bacteria 2294
24 Ga0070682_100022863 3300005337 Bacteria 3708
25 Ga0070682_100605448 3300005337 Bacteria 866
26 Ga0068868_100009632 3300005338 Bacteria 6968
27 Ga0068868_100353123 3300005338 Bacteria 1260
28 Ga0070660_100195675 3300005339 Bacteria 1639
29 Ga0070660_100478208 3300005339 Bacteria 1035
30 Ga0070660_100522540 3300005339 Bacteria 989
31 Ga0070689_100001113 3300005340 Bacteria 16894
32 Ga0070689_100194769 3300005340 Bacteria 1652
33 Ga0070691_10005401 3300005341 Bacteria 5812
34 Ga0070687_100199493 3300005343 Bacteria 1211
35 Ga0070687_100211035 3300005343 Bacteria 1183
36 Ga0070661_100135873 3300005344 Bacteria 1850
37 Ga0070661_100881023 3300005344 Unclassified 738
38 Ga0070692_10022160 3300005345 Bacteria 3101
39 Ga0070668_100113320 3300005347 Bacteria 2160
40 Ga0070669_100140181 3300005353 Unclassified 1863
41 Ga0070669_100206839 3300005353 Bacteria 1547
42 Ga0070675_100018009 3300005354 Bacteria 5622
43 Ga0070675_100445561 3300005354 Bacteria 1161
44 Ga0070671_100010831 3300005355 Bacteria 7316
45 Ga0070674_100018571 3300005356 Bacteria 4400
46 Ga0070674_100026532 3300005356 Bacteria 3786
47 Ga0070673_100003804 3300005364 Bacteria 9468
48 Ga0070673_100227319 3300005364 Bacteria 1617
49 Ga0070673_100520815 3300005364 Bacteria 1078
50 Ga0070673_100954090 3300005364 Bacteria 797
51 Ga0070688_100005939 3300005365 Bacteria 6468
52 Ga0070688_100028550 3300005365 Bacteria 3332
53 Ga0070688_100051339 3300005365 Bacteria 2572
54 Ga0070659_100124649 3300005366 Bacteria 2090
55 Ga0070659_100410292 3300005366 Bacteria 1144
56 Ga0070659_100994151 3300005366 Bacteria 736
57 Ga0070667_100029214 3300005367 Bacteria 4593
58 Ga0070703_10010838 3300005406 Bacteria 2572
59 Ga0070709_10011931 3300005434 Bacteria 4854
60 Ga0070709_10159441 3300005434 Bacteria 1567
61 Ga0070709_10935785 3300005434 Bacteria 687
62 Ga0070714_100003288 3300005435 Bacteria 12043
63 Ga0070714_100058344 3300005435 Bacteria 3306
64 Ga0070714_100206856 3300005435 Bacteria 1797
65 Ga0070714_100309305 3300005435 Bacteria 1475
66 Ga0070714_100665610 3300005435 Bacteria 1003
67 Ga0070713_100022225 3300005436 Bacteria 4898
68 Ga0070713_100108922 3300005436 Bacteria 2412
69 Ga0070713_100125140 3300005436 Bacteria 2260
70 Ga0070713_100586417 3300005436 Bacteria 1058
71 Ga0070710_10047384 3300005437 Bacteria 2397
72 Ga0070711_100028231 3300005439 Bacteria 3691
73 Ga0070711_100036765 3300005439 Bacteria 3282
74 Ga0070711_100080849 3300005439 Bacteria 2315
75 Ga0070711_100142841 3300005439 Bacteria 1796
76 Ga0070705_100054251 3300005440 Bacteria 2350
77 Ga0070705_100189603 3300005440 Bacteria 1400
78 Ga0070700_100066485 3300005441 Bacteria 2288
79 Ga0070700_100712784 3300005441 Bacteria 799
80 Ga0070694_100074074 3300005444 Bacteria 2353
81 Ga0070694_100585525 3300005444 Bacteria 897
82 Ga0070708_100218484 3300005445 Bacteria 1787
83 Ga0070663_100086303 3300005455 Bacteria 2317
84 Ga0070663_100358866 3300005455 Bacteria 1182
85 Ga0070678_100025730 3300005456 Bacteria 3966
86 Ga0070678_100033430 3300005456 Bacteria 3571
87 Ga0070678_100376024 3300005456 Bacteria 1228
88 Ga0070662_100019278 3300005457 Bacteria 4630
89 Ga0070681_10523966 3300005458 Bacteria 1098
90 Ga0070681_11030727 3300005458 Bacteria 743
91 Ga0068867_100019113 3300005459 Bacteria 4879
92 Ga0068867_100725869 3300005459 Bacteria 879
93 Ga0068867_100886910 3300005459 Bacteria 802
94 Ga0070685_10008870 3300005466 Bacteria 5185
95 Ga0070707_100101717 3300005468 Bacteria 2785
96 Ga0070698_100012347 3300005471 Bacteria 9045
97 Ga0070698_100807164 3300005471 Bacteria 882
98 Ga0070699_100123881 3300005518 Bacteria 2274
99 Ga0070699_100573922 3300005518 Bacteria 1027
100 Ga0070699_101090168 3300005518 Bacteria 732
101 Ga0070679_100023849 3300005530 Bacteria 5994
102 Ga0070684_100004629 3300005535 Bacteria 10494
103 Ga0070684_100110848 3300005535 Bacteria 2460
104 Ga0070684_100165021 3300005535 Bacteria 2010
105 Ga0070684_100436286 3300005535 Bacteria 1210
106 Ga0070697_100036459 3300005536 Bacteria 3973
107 Ga0070697_100140324 3300005536 Unclassified 2032
108 Ga0070697_100666805 3300005536 Bacteria 916
109 Ga0068853_100328104 3300005539 Bacteria 1420
110 Ga0070672_100014289 3300005543 Bacteria 5624
111 Ga0070686_100015033 3300005544 Bacteria 4474
112 Ga0070686_100122087 3300005544 Bacteria 1790
113 Ga0070686_100489299 3300005544 Bacteria 953
114 Ga0070695_100052568 3300005545 Bacteria 2618
115 Ga0070695_100545741 3300005545 Bacteria 903
116 Ga0070693_100359509 3300005547 Bacteria 999
117 Ga0070665_100176983 3300005548 Bacteria 2134
118 Ga0070665_100295067 3300005548 Bacteria 1624
119 Ga0070665_100374217 3300005548 Bacteria 1431
120 Ga0070665_100525754 3300005548 Bacteria 1195
121 Ga0070665_100681923 3300005548 Bacteria 1041
122 Ga0070665_100836225 3300005548 Bacteria 934
123 Ga0070704_100001250 3300005549 Bacteria 13398
124 Ga0070704_100377119 3300005549 Bacteria 1204
125 Ga0070704_100543519 3300005549 Bacteria 1014
126 Ga0070704_100807306 3300005549 Bacteria 839
127 Ga0068855_100126004 3300005563 Bacteria 2928
128 Ga0068855_100472019 3300005563 Bacteria 1367
129 Ga0068855_100762977 3300005563 Bacteria 1031
130 Ga0070664_100024037 3300005564 Bacteria 5037
131 Ga0070664_100118550 3300005564 Bacteria 2315
132 Ga0070664_100171265 3300005564 Bacteria 1926
133 Ga0068854_100016650 3300005578 Bacteria 4905
134 Ga0068856_100001606 3300005614 Bacteria 23628
135 Ga0068856_100016444 3300005614 Bacteria 7159
136 Ga0068856_100210294 3300005614 Bacteria 1960
137 Ga0068856_100502094 3300005614 Bacteria 1234
138 Ga0070702_100008194 3300005615 Bacteria 5047
139 Ga0068852_100001045 3300005616 Bacteria 18230
140 Ga0068859_100025009 3300005617 Bacteria 5993
141 Ga0068859_100335208 3300005617 Bacteria 1607
142 Ga0068859_100792025 3300005617 Bacteria 1036
143 Ga0068864_100001978 3300005618 Bacteria 16866
144 Ga0068866_10011518 3300005718 Bacteria 3828
145 Ga0068851_10025091 3300005834 Bacteria 2922
146 Ga0068870_10014577 3300005840 Bacteria 3714
147 Ga0068863_100019233 3300005841 Bacteria 6535
148 Ga0068858_100022418 3300005842 Bacteria 5894
149 Ga0068858_100116932 3300005842 Bacteria 2492
150 Ga0068858_100184675 3300005842 Bacteria 1969
151 Ga0068860_100054877 3300005843 Bacteria 3787
152 Ga0068860_101087720 3300005843 Bacteria 819
153 Ga0068862_100024602 3300005844 Bacteria 5054
154 Ga0068862_100059517 3300005844 Bacteria 3280
155 Ga0068862_100283175 3300005844 Bacteria 1520
156 Ga0068862_100617918 3300005844 Bacteria 1042
157 Ga0081455_10001354 3300005937 Bacteria 30285
158 Ga0081455_10300774 3300005937 Bacteria 1151
159 Ga0081538_10034525 3300005981 Bacteria 3342
160 Ga0081538_10150658 3300005981 Bacteria 1054
161 Ga0081540_1001046 3300005983 Bacteria 24692
162 Ga0081540_1002282 3300005983 Bacteria 15746
163 Ga0081540_1003104 3300005983 Bacteria 13307
164 Ga0081540_1100145 3300005983 Bacteria 1250
165 Ga0081539_10003208 3300005985 Bacteria 20654
166 Ga0070717_10247489 3300006028 Bacteria 1574
167 Ga0070717_10349049 3300006028 Bacteria 1323
168 Ga0075365_10004171 3300006038 Bacteria 7608
169 Ga0075365_10009965 3300006038 Bacteria 5502
170 Ga0075365_10011665 3300006038 Bacteria 5178
171 Ga0075365_10208576 3300006038 Bacteria 1370
172 Ga0075365_10247488 3300006038 Bacteria 1252
173 Ga0075365_10352560 3300006038 Bacteria 1037
174 Ga0075365_10572926 3300006038 Bacteria 798
175 Ga0075368_10012897 3300006042 Bacteria 3061
176 Ga0075368_10018094 3300006042 Bacteria 2644
177 Ga0075368_10086403 3300006042 Bacteria 1280
178 Ga0075363_100009278 3300006048 Bacteria 4621
179 Ga0075363_100025914 3300006048 Bacteria 2995
180 Ga0075364_10100398 3300006051 Bacteria 1926
181 Ga0075364_10124588 3300006051 Bacteria 1726
182 Ga0075364_10260995 3300006051 Bacteria 1178
183 Ga0070715_10005759 3300006163 Bacteria 4163
184 Ga0070716_100016606 3300006173 Bacteria 3803
185 Ga0070712_100052161 3300006175 Bacteria 2851
186 Ga0070712_100076048 3300006175 Bacteria 2417
187 Ga0070712_100579723 3300006175 Bacteria 948
188 Ga0075362_10003444 3300006177 Bacteria 5528
189 Ga0075367_10002008 3300006178 Bacteria 9074
190 Ga0075367_10013529 3300006178 Bacteria 4390
191 Ga0075367_10039306 3300006178 Bacteria 2758
192 Ga0075367_10312623 3300006178 Bacteria 989
193 Ga0097621_100020748 3300006237 Bacteria 5068
194 Ga0075370_10038028 3300006353 Bacteria 2708
195 Ga0075370_10108901 3300006353 Bacteria 1608
196 Ga0068871_100016774 3300006358 Bacteria 5527
197 Ga0068871_100892732 3300006358 Bacteria 823
198 Ga0075428_100000617 3300006844 Bacteria 36390
199 Ga0075428_100062074 3300006844 Bacteria 4092
200 Ga0075428_100082995 3300006844 Bacteria 3496
201 Ga0075428_100194841 3300006844 Bacteria 2191
202 Ga0075428_100378884 3300006844 Bacteria 1517
203 Ga0075428_100532816 3300006844 Bacteria 1256
204 Ga0075428_100578115 3300006844 Bacteria 1201
205 Ga0075430_100045690 3300006846 Bacteria 3699
206 Ga0075431_100073995 3300006847 Bacteria 3515
207 Ga0075431_100108855 3300006847 Bacteria 2860
208 Ga0075431_100171298 3300006847 Bacteria 2230
209 Ga0075431_100820232 3300006847 Bacteria 903
210 Ga0075431_100883641 3300006847 Bacteria 864
211 Ga0075433_10043573 3300006852 Bacteria 3896
212 Ga0075433_10622550 3300006852 Bacteria 947
213 Ga0075434_100070901 3300006871 Bacteria 3475
214 Ga0075434_100103915 3300006871 Bacteria 2850
215 Ga0075434_100131094 3300006871 Bacteria 2526
216 Ga0075434_100540835 3300006871 Bacteria 1185
217 Ga0075434_100622901 3300006871 Bacteria 1098
218 Ga0075434_100811838 3300006871 Bacteria 951
219 Ga0075434_100992981 3300006871 Bacteria 853
220 Ga0075434_101018597 3300006871 Bacteria 842
221 Ga0075429_100000081 3300006880 Bacteria 49207
222 Ga0075429_100271902 3300006880 Bacteria 1484
223 Ga0075429_100430352 3300006880 Bacteria 1156
224 Ga0068865_100174258 3300006881 Bacteria 1652
225 Ga0075436_100004004 3300006914 Bacteria 10108
226 Ga0075436_100004115 3300006914 Bacteria 9977
227 Ga0075436_100090088 3300006914 Bacteria 2132
228 Ga0075436_100129957 3300006914 Bacteria 1766
229 Ga0097620_100025009 3300006931 Bacteria 5993
230 Ga0097620_100335219 3300006931 Bacteria 1607
231 Ga0097620_100792112 3300006931 Bacteria 1036
232 Ga0075435_100275497 3300007076 Bacteria 1436
233 Ga0075435_100316413 3300007076 Bacteria 1336
234 Ga0075435_100667463 3300007076 Bacteria 903
235 Ga0075435_100694013 3300007076 Bacteria 885
236 Ga0099794_10011365 3300007265 Bacteria 3809
237 Ga0099794_10017902 3300007265 Bacteria 3167
238 Ga0099794_10019828 3300007265 Bacteria 3036
239 Ga0099795_10059973 3300007788 Bacteria 1409
240 Ga0105251_10019995 3300009011 Bacteria 3524
241 Ga0105250_10036971 3300009092 Bacteria 1959
242 Ga0105240_10012327 3300009093 Bacteria 11807
243 Ga0105240_10215904 3300009093 Bacteria 2238
244 Ga0105240_10744984 3300009093 Bacteria 1066
245 Ga0111539_10089724 3300009094 Bacteria 3612
246 Ga0111539_10109039 3300009094 Bacteria 3249
247 Ga0111539_10150665 3300009094 Bacteria 2722
248 Ga0111539_10229442 3300009094 Bacteria 2162
249 Ga0111539_10286824 3300009094 Bacteria 1916
250 Ga0111539_10565452 3300009094 Bacteria 1324
251 Ga0111539_10577925 3300009094 Bacteria 1309
252 Ga0111539_10578423 3300009094 Bacteria 1308
253 Ga0111539_11212562 3300009094 Bacteria 876
254 Ga0105245_10051077 3300009098 Bacteria 3707
255 Ga0105245_10231631 3300009098 Bacteria 1787
256 Ga0105245_11406078 3300009098 Bacteria 748
257 Ga0114129_10002113 3300009147 Bacteria 27369
258 Ga0114129_10011617 3300009147 Bacteria 12537
259 Ga0114129_10048513 3300009147 Bacteria 5966
260 Ga0114129_10221243 3300009147 Bacteria 2554
261 Ga0114129_10349571 3300009147 Bacteria 1959
262 Ga0114129_11039546 3300009147 Bacteria 1029
263 Ga0114129_11487948 3300009147 Bacteria 832
264 Ga0114129_11489605 3300009147 Bacteria 832
265 Ga0114129_11987904 3300009147 Bacteria 703
266 Ga0105243_10440664 3300009148 Bacteria 1220
267 Ga0105243_10605780 3300009148 Bacteria 1055
268 Ga0105243_11436345 3300009148 Bacteria 711
269 Ga0105241_10521919 3300009174 Bacteria 1062
270 Ga0105242_10028336 3300009176 Bacteria 4458
271 Ga0105242_10349934 3300009176 Bacteria 1364
272 Ga0105248_10623085 3300009177 Bacteria 1217
273 Ga0105237_10028064 3300009545 Bacteria 5734
274 Ga0105237_10141603 3300009545 Bacteria 2399
275 Ga0105238_10037417 3300009551 Bacteria 4933
276 Ga0105238_10154909 3300009551 Bacteria 2267
277 Ga0105238_10160965 3300009551 Bacteria 2220
278 Ga0105238_10345146 3300009551 Bacteria 1477
279 Ga0105238_10459267 3300009551 Bacteria 1271
280 Ga0105238_10563447 3300009551 Unclassified 1144
281 Ga0105249_10015086 3300009553 Bacteria 6835
282 Ga0105249_10579958 3300009553 Bacteria 1175
283 Ga0105249_10672243 3300009553 Bacteria 1094
284 Ga0099796_10010230 3300010159 Bacteria 2572
285 Ga0099796_10023258 3300010159 Bacteria 1933
286 Ga0105239_10031952 3300010375 Bacteria 5784
287 Ga0105239_10188702 3300010375 Bacteria 2307
288 Ga0105239_10308693 3300010375 Bacteria 1783
289 Ga0105239_10522002 3300010375 Bacteria 1351
290 Ga0105239_11216837 3300010375 Bacteria 868
291 Ga0157373_10093120 3300013100 Bacteria 2122
292 Ga0157370_10980725 3300013104 Bacteria 765
293 Ga0157369_10011724 3300013105 Bacteria 9953
294 Ga0157369_10158993 3300013105 Bacteria 2386
295 Ga0157369_10541407 3300013105 Bacteria 1204
296 Ga0157374_10083923 3300013296 Bacteria 3027
297 Ga0157374_10298170 3300013296 Bacteria 1594
298 Ga0157374_10369049 3300013296 Bacteria 1428
299 Ga0157374_10720035 3300013296 Bacteria 1012
300 Ga0157372_10018682 3300013307 Bacteria 7458
301 Ga0157372_10088796 3300013307 Bacteria 3510
302 Ga0157372_10245304 3300013307 Bacteria 2079
303 Ga0157372_10277978 3300013307 Bacteria 1947
304 Ga0157375_10009835 3300013308 Bacteria 8410
305 Ga0157375_10796818 3300013308 Bacteria 1094
306 Ga0163163_10303939 3300014325 Bacteria 1648
307 Ga0163163_10372967 3300014325 Bacteria 1484
308 Ga0163163_10390837 3300014325 Bacteria 1449
309 Ga0157380_10405511 3300014326 Bacteria 1295
310 Ga0157380_10710931 3300014326 Bacteria 1011
311 Ga0157380_11157619 3300014326 Bacteria 815
312 Ga0157377_10004874 3300014745 Bacteria 6241
313 Ga0157379_10027886 3300014968 Bacteria 5026
314 Ga0157379_10659050 3300014968 Bacteria 980
315 Ga0157376_10135733 3300014969 Bacteria 2201
316 Ga0163161_10120185 3300017792 Bacteria 1973
317 Ga0163161_10780922 3300017792 Bacteria 801
318 Ga0213872_10021062 3300021361 Bacteria 3002
319 Ga0213876_10077341 3300021384 Bacteria 1758
320 Ga0213876_10099408 3300021384 Bacteria 1542
321 Ga0213876_10101010 3300021384 Bacteria 1529
322 Ga0213875_10000053 3300021388 Bacteria 141791
323 Ga0213875_10158083 3300021388 Bacteria 1063
324 Ga0224572_1004891 3300024225 Bacteria 2363
325 Ga0228598_1000876 3300024227 Bacteria 6507
326 Ga0228598_1020313 3300024227 Bacteria 1308
327 Ga0207426_1013129 3300025302 Bacteria 3084
328 Ga0207426_1056002 3300025302 Bacteria 1152
329 Ga0207697_10030261 3300025315 Bacteria 2215
330 Ga0207697_10032524 3300025315 Bacteria 2135
331 Ga0207656_10016209 3300025321 Bacteria 2899
332 Ga0207656_10247897 3300025321 Bacteria 872
333 Ga0207692_10226083 3300025898 Bacteria 1111
334 Ga0207642_10013018 3300025899 Bacteria 3021
335 Ga0207688_10003415 3300025901 Bacteria 8665
336 Ga0207680_10008657 3300025903 Bacteria 5010
337 Ga0207680_10402985 3300025903 Bacteria 967
338 Ga0207647_10064910 3300025904 Bacteria 2217
339 Ga0207685_10031288 3300025905 Bacteria 1904
340 Ga0207685_10102199 3300025905 Bacteria 1227
341 Ga0207699_10014408 3300025906 Bacteria 4075
342 Ga0207699_10316086 3300025906 Bacteria 1094
343 Ga0207645_10048865 3300025907 Bacteria 2702
344 Ga0207645_10049992 3300025907 Bacteria 2670
345 Ga0207645_10398827 3300025907 Bacteria 925
346 Ga0207643_10005672 3300025908 Bacteria 6678
347 Ga0207705_10213428 3300025909 Bacteria 1464
348 Ga0207705_10241045 3300025909 Unclassified 1377
349 Ga0207684_10096437 3300025910 Bacteria 2524
350 Ga0207707_10004277 3300025912 Bacteria 12633
351 Ga0207707_10379776 3300025912 Bacteria 1215
352 Ga0207707_10490182 3300025912 Bacteria 1049
353 Ga0207695_10026716 3300025913 Bacteria 6440
354 Ga0207695_11051143 3300025913 Bacteria 694
355 Ga0207671_10077285 3300025914 Bacteria 2492
356 Ga0207671_10214673 3300025914 Bacteria 1506
357 Ga0207693_10002485 3300025915 Bacteria 16030
358 Ga0207693_10041146 3300025915 Bacteria 3639
359 Ga0207693_10063092 3300025915 Bacteria 2903
360 Ga0207693_10185616 3300025915 Bacteria 1637
361 Ga0207693_10226341 3300025915 Bacteria 1469
362 Ga0207693_10284764 3300025915 Bacteria 1295
363 Ga0207693_10458723 3300025915 Unclassified 996
364 Ga0207663_10045292 3300025916 Bacteria 2705
365 Ga0207663_10080623 3300025916 Bacteria 2129
366 Ga0207663_10118085 3300025916 Bacteria 1811
367 Ga0207660_10008666 3300025917 Bacteria 6579
368 Ga0207660_10328117 3300025917 Bacteria 1223
369 Ga0207662_10290993 3300025918 Bacteria 1083
370 Ga0207662_10313530 3300025918 Bacteria 1046
371 Ga0207657_10100027 3300025919 Bacteria 2408
372 Ga0207657_10554022 3300025919 Bacteria 899
373 Ga0207649_10007883 3300025920 Bacteria 5794
374 Ga0207649_10189617 3300025920 Bacteria 1445
375 Ga0207652_10083726 3300025921 Bacteria 2793
376 Ga0207652_10648679 3300025921 Unclassified 944
377 Ga0207652_10655105 3300025921 Bacteria 939
378 Ga0207646_10268358 3300025922 Bacteria 1542
379 Ga0207681_10118776 3300025923 Unclassified 1936
380 Ga0207694_10129583 3300025924 Bacteria 2021
381 Ga0207694_10290493 3300025924 Bacteria 1344
382 Ga0207694_10499360 3300025924 Bacteria 1019
383 Ga0207650_10031312 3300025925 Bacteria 3840
384 Ga0207650_10071529 3300025925 Bacteria 2609
385 Ga0207650_10149991 3300025925 Bacteria 1839
386 Ga0207659_10298422 3300025926 Bacteria 1322
387 Ga0207659_10309531 3300025926 Bacteria 1300
388 Ga0207659_10552690 3300025926 Bacteria 979
389 Ga0207687_10006331 3300025927 Bacteria 7824
390 Ga0207687_10067357 3300025927 Bacteria 2547
391 Ga0207687_10263202 3300025927 Bacteria 1376
392 Ga0207700_10013689 3300025928 Bacteria 5289
393 Ga0207700_10078066 3300025928 Bacteria 2574
394 Ga0207700_10153148 3300025928 Bacteria 1907
395 Ga0207700_10178347 3300025928 Bacteria 1777
396 Ga0207700_10225900 3300025928 Bacteria 1589
397 Ga0207700_10308481 3300025928 Bacteria 1368
398 Ga0207700_10334744 3300025928 Bacteria 1315
399 Ga0207664_10033479 3300025929 Bacteria 3948
400 Ga0207664_10333892 3300025929 Bacteria 1339
401 Ga0207664_10456388 3300025929 Bacteria 1141
402 Ga0207644_10016623 3300025931 Bacteria 4953
403 Ga0207644_10023230 3300025931 Bacteria 4244
404 Ga0207644_10038217 3300025931 Bacteria 3380
405 Ga0207644_10525956 3300025931 Bacteria 977
406 Ga0207690_10018700 3300025932 Bacteria 4251
407 Ga0207690_10104102 3300025932 Bacteria 2033
408 Ga0207706_10038206 3300025933 Bacteria 4258
409 Ga0207670_10017680 3300025936 Bacteria 4313
410 Ga0207670_10020641 3300025936 Bacteria 4052
411 Ga0207669_10005520 3300025937 Bacteria 5683
412 Ga0207669_10286357 3300025937 Bacteria 1245
413 Ga0207669_10471956 3300025937 Bacteria 998
414 Ga0207669_10740924 3300025937 Bacteria 811
415 Ga0207665_10004102 3300025939 Bacteria 9717
416 Ga0207665_10067219 3300025939 Bacteria 2440
417 Ga0207665_10097939 3300025939 Bacteria 2042
418 Ga0207665_10855171 3300025939 Bacteria 720
419 Ga0207691_10001627 3300025940 Bacteria 22294
420 Ga0207691_10250595 3300025940 Bacteria 1528
421 Ga0207711_10101018 3300025941 Bacteria 2552
422 Ga0207711_10227872 3300025941 Bacteria 1706
423 Ga0207711_10472488 3300025941 Bacteria 1168
424 Ga0207689_10007012 3300025942 Bacteria 9907
425 Ga0207661_10026523 3300025944 Bacteria 4415
426 Ga0207661_10106947 3300025944 Bacteria 2359
427 Ga0207679_10015638 3300025945 Bacteria 5020
428 Ga0207679_10081985 3300025945 Bacteria 2468
429 Ga0207679_10230954 3300025945 Bacteria 1562
430 Ga0207667_10055984 3300025949 Bacteria 4144
431 Ga0207667_10062848 3300025949 Bacteria 3881
432 Ga0207667_10118214 3300025949 Bacteria 2732
433 Ga0207667_10744060 3300025949 Bacteria 980
434 Ga0207651_10135996 3300025960 Bacteria 1890
435 Ga0207651_10269391 3300025960 Bacteria 1402
436 Ga0207712_10234008 3300025961 Bacteria 1476
437 Ga0207668_10007545 3300025972 Bacteria 6475
438 Ga0207640_10019201 3300025981 Bacteria 4034
439 Ga0207640_10341830 3300025981 Bacteria 1199
440 Ga0207640_10529856 3300025981 Bacteria 986
441 Ga0207658_10096845 3300025986 Bacteria 2302
442 Ga0207658_10802301 3300025986 Bacteria 855
443 Ga0207677_10126300 3300026023 Bacteria 1934
444 Ga0207677_10391944 3300026023 Bacteria 1175
445 Ga0207677_10667069 3300026023 Bacteria 919
446 Ga0207703_10167640 3300026035 Bacteria 1929
447 Ga0207703_10525085 3300026035 Bacteria 1114
448 Ga0207703_10686420 3300026035 Bacteria 973
449 Ga0207639_10158101 3300026041 Bacteria 1906
450 Ga0207678_10020051 3300026067 Bacteria 5874
451 Ga0207678_10334683 3300026067 Bacteria 1304
452 Ga0207678_10370403 3300026067 Bacteria 1237
453 Ga0207708_10001502 3300026075 Bacteria 17383
454 Ga0207708_10152108 3300026075 Bacteria 1823
455 Ga0207708_10896307 3300026075 Bacteria 767
456 Ga0207702_10064733 3300026078 Bacteria 3129
457 Ga0207702_11400396 3300026078 Bacteria 693
458 Ga0207648_10006668 3300026089 Bacteria 11454
459 Ga0207648_10074077 3300026089 Bacteria 2967
460 Ga0207648_10278555 3300026089 Bacteria 1495
461 Ga0207648_10710169 3300026089 Bacteria 932
462 Ga0207676_10018586 3300026095 Bacteria 5056
463 Ga0207675_100013475 3300026118 Bacteria 7630
464 Ga0207675_100260100 3300026118 Bacteria 1682
465 Ga0207683_10012333 3300026121 Bacteria 7294
466 Ga0207683_10076816 3300026121 Bacteria 2957
467 Ga0207683_10547128 3300026121 Bacteria 1070
468 Ga0207698_10127091 3300026142 Bacteria 2170
469 Ga0207698_10678084 3300026142 Bacteria 1024
470 Ga0209179_1011531 3300027512 Bacteria 1568
471 Ga0209588_1010903 3300027671 Bacteria 2738
472 Ga0209588_1027516 3300027671 Bacteria 1809
473 Ga0209813_10003719 3300027866 Bacteria 3594
474 Ga0207428_10049012 3300027907 Bacteria 3386
475 Ga0268266_10095158 3300028379 Bacteria 2616
476 Ga0268266_10286712 3300028379 Bacteria 1532
477 Ga0268266_10449037 3300028379 Bacteria 1225
478 Ga0268266_10494120 3300028379 Bacteria 1168
479 Ga0268266_10760726 3300028379 Bacteria 935
480 Ga0268265_10011597 3300028380 Bacteria 5959
481 Ga0268265_10597576 3300028380 Bacteria 1054
482 Ga0268264_10858049 3300028381 Bacteria 910
483 Ga0265334_10012318 3300028573 Bacteria 3595
484 Ga0265338_10151314 3300028800 Bacteria 1802
485 Ga0265763_1007016 3300030763 Bacteria 980
486 Ga0265763_1008412 3300030763 Bacteria 921
487 Ga0265773_1006882 3300031018 Bacteria 872
488 Ga0265332_10006574 3300031238 Bacteria 5271
489 Ga0265325_10002317 3300031241 Bacteria 12919
490 Ga0265329_10070499 3300031242 Bacteria 1106
491 Ga0265340_10015062 3300031247 Bacteria 4025
492 Ga0265339_10000078 3300031249 Bacteria 83767
493 Ga0265339_10019601 3300031249 Bacteria 3968
494 Ga0265331_10154151 3300031250 Bacteria 1043
495 Ga0265316_10228627 3300031344 Bacteria 1370
496 Ga0265313_10003528 3300031595 Bacteria 12614
497 Ga0265314_10022239 3300031711 Bacteria 4859
498 Ga0265342_10002635 3300031712 Bacteria 15340
499 Ga0316578_10268499 3300031728 Bacteria 1022
500 Ga0373926_0022219 3300035083 Bacteria 2201
501 Ga0373929_0111511 3300035085 Bacteria 700
502 Ga0373944_0024358 3300035089 Bacteria 1773
503 Ga0373952_0114059 3300035092 Bacteria 726
504 Ga0373923_0002771 3300035111 Bacteria 5477
505 Ga0373923_0078977 3300035111 Bacteria 1425
506 Ga0373936_0003979 3300035113 Bacteria 5569
507 Ga0373936_0010496 3300035113 Bacteria 3495
508 Ga0373936_0104241 3300035113 Bacteria 1199
509 Ga0373939_0069327 3300035114 Bacteria 1144
510 Ga0373945_0001064 3300035116 Bacteria 8252
511 Ga0373945_0005949 3300035116 Bacteria 3917
512 Ga0373953_0004294 3300035117 Bacteria 4530
513 Ga0373954_0000906 3300035118 Bacteria 11525
514 Ga0373954_0002609 3300035118 Bacteria 7586
515 Ga0373954_0058587 3300035118 Bacteria 1814
516 Ga0373956_0000029 3300035119 Bacteria 45843
517 Ga0373956_0033037 3300035119 Bacteria 2273
518 Ga0373956_0339949 3300035119 Bacteria 715
519 Ga0373957_0010530 3300035120 Bacteria 3060
520 Ga0373957_0015261 3300035120 Bacteria 2641
521 Ga0373960_0014720 3300035121 Bacteria 1986
522 Ga0373943_0000208 3300035170 Bacteria 24045
523 Ga0373943_0003827 3300035170 Bacteria 6840
524 Ga0373943_0032102 3300035170 Bacteria 2494
525 Ga0373943_0058368 3300035170 Bacteria 1921
526 Ga0373946_0001814 3300035171 Bacteria 7457
527 Ga0373946_0006567 3300035171 Bacteria 4221
528 Ga0373946_0020608 3300035171 Bacteria 2549
529 Ga0373955_0000201 3300035172 Bacteria 24761
530 Ga0373955_0003420 3300035172 Bacteria 6976
531 Ga0373942_0088537 3300035207 Bacteria 930
532 Ga0373942_0185417 3300035207 Unclassified 683
533 Ga0373961_0108448 3300035241 Bacteria 907
534 Ga0373924_0062256 3300035410 Bacteria 1562
535 Ga0373931_0024776 3300035691 Bacteria 3043
536 Ga0373931_0049908 3300035691 Bacteria 2225
537 Ga0373931_0177648 3300035691 Bacteria 1259
538 Ga0373935_0000068 3300035692 Bacteria 43997
539 Ga0373935_0048992 3300035692 Bacteria 2677
540 Ga0373935_0213117 3300035692 Bacteria 1339
541 Ga0373935_0431288 3300035692 Bacteria 950
542 Ga0373927_0005387 3300035695 Bacteria 8840
543 Ga0373927_0006191 3300035695 Bacteria 8171
544 Ga0373927_0026505 3300035695 Bacteria 3788
545 Ga0373927_0028489 3300035695 Bacteria 3643
546 Ga0373927_0039331 3300035695 Bacteria 3069
547 Ga0373927_0067847 3300035695 Bacteria 2308
548 Ga0373927_0179490 3300035695 Bacteria 1389
549 Ga0373927_0331838 3300035695 Bacteria 1002
550 Ga0373933_0002902 3300035724 Bacteria 9577
551 Ga0373933_0003207 3300035724 Bacteria 9130
552 Ga0373933_0534282 3300035724 Bacteria 769
553 Ga0373933_0647813 3300035724 Bacteria 694
554 Ga0373947_0000178 3300035725 Bacteria 34953
555 Ga0373947_0002537 3300035725 Bacteria 10978
556 Ga0373947_0023662 3300035725 Bacteria 3575
557 Ga0373947_0064449 3300035725 Bacteria 2234
558 Ga0373947_0102805 3300035725 Bacteria 1797
559 Ga0373947_0125390 3300035725 Bacteria 1635
560 Ga0373947_0180047 3300035725 Bacteria 1375
561 Ga0373937_0000347 3300036401 Bacteria 43749
562 Ga0373937_0000441 3300036401 Bacteria 38394
563 Ga0373937_0045533 3300036401 Bacteria 4010
564 Ga0373937_0179799 3300036401 Bacteria 1986
565 Ga0373937_0194899 3300036401 Bacteria 1904
566 Ga0373937_0250597 3300036401 Bacteria 1669
567 Ga0316582_0245053 3300036647 Bacteria 1228
568 Ga0373925_0000081 3300037068 Bacteria 102407
569 Ga0373925_0001482 3300037068 Bacteria 20154
570 Ga0373925_0044829 3300037068 Bacteria 3284
571 Ga0373925_0250494 3300037068 Bacteria 1420
572 Ga0373925_0302993 3300037068 Bacteria 1290
573 Ga0373925_0324306 3300037068 Bacteria 1247
574 Ga0373925_0454820 3300037068 Bacteria 1049
575 Ga0373925_0638458 3300037068 Bacteria 877
576 Ga0395899_0014903 3300037312 Bacteria 5930
577 Ga0395899_0096464 3300037312 Bacteria 2138
578 Ga0395900_0008428 3300037418 Bacteria 10605
579 Ga0395900_0011461 3300037418 Bacteria 9075
580 Ga0395900_0143324 3300037418 Bacteria 2445
581 Ga0395900_1067436 3300037418 Bacteria 726
582 Ga0395898_0082166 3300037466 Bacteria 3106
583 Ga0395898_0138981 3300037466 Bacteria 2325
584 Ga0395898_0331558 3300037466 Bacteria 1451
585 Ga0395905_0500874 3300037471 Bacteria 1115
586 Ga0436364_0664195 3300037853 Bacteria 2975
587 Ga0436364_0716542 3300037853 Bacteria 2780
588 Ga0436364_0951864 3300037853 Bacteria 9370
589 Ga0395901_0009788 3300038443 Bacteria 9721
590 Ga0395901_0018877 3300038443 Bacteria 7049
591 Ga0395901_0137101 3300038443 Bacteria 2571
592 Ga0395901_0215568 3300038443 Bacteria 2008
593 Ga0395901_0564087 3300038443 Bacteria 1152
594 Ga0436365_0042743 3300039437 Bacteria 2739
595 Ga0436365_0291537 3300039437 Bacteria 629
596 Ga0436365_1099387 3300039437 Bacteria 3202
597 Ga0436365_1251077 3300039437 Bacteria 937
598 Ga0436365_1336443 3300039437 Bacteria 3131
599 Ga0436365_1383206 3300039437 Bacteria 1820
600 Ga0436360_0291491 3300039438 Bacteria 2024
601 Ga0436360_0775077 3300039438 Bacteria 2194
602 Ga0436360_1307075 3300039438 Bacteria 1174
603 Ga0436361_0424457 3300039447 Bacteria 3406
604 Ga0436361_0687582 3300039447 Bacteria 1439
605 Ga0436361_0914825 3300039447 Bacteria 917
606 Ga0436363_0235431 3300039450 Bacteria 801
607 Ga0436363_0753578 3300039450 Bacteria 884
608 Ga0436363_1012681 3300039450 Bacteria 2233
609 Ga0436363_1455596 3300039450 Bacteria 957
610 Ga0439453_0015398 3300041408 Bacteria 1322
611 Ga0451853_1512202 3300041512 Bacteria 1297
612 Ga0439464_0034921 3300042439 Bacteria 1419
613 Ga0451577_0277536 3300042876 Bacteria 1518
614 Ga0466966_0306725 3300044684 Bacteria 954
615 Ga0466961_0158392 3300044693 Bacteria 1412
616 Ga0466963_0018448 3300044694 Bacteria 4363
617 Ga0466963_0025164 3300044694 Bacteria 3794
618 Ga0466957_0125405 3300044842 Bacteria 1640
619 Ga0466959_0034418 3300045049 Bacteria 3747
620 Ga0466959_0036016 3300045049 Bacteria 3657
621 Ga0451576_0295185 3300045051 Bacteria 1695
622 Ga0451576_0599338 3300045051 Bacteria 1158
623 Ga0466958_0014631 3300045836 Bacteria 4480
624 Ga0466958_0067079 3300045836 Bacteria 2191
625 Ga0466967_0091388 3300045976 Bacteria 2766
626 Ga0466967_0320079 3300045976 Bacteria 1495
627 Ga0466967_0611955 3300045976 Bacteria 1076
628 Ga0495617_118481 3300046452 Bacteria 854
629 Ga0495592_0000196 3300046454 Bacteria 51625
630 Ga0495592_0022021 3300046454 Bacteria 4848
631 Ga0495592_0287452 3300046454 Bacteria 1073
632 Ga0495603_0165172 3300046455 Bacteria 1283
633 Ga0495590_0087493 3300046457 Bacteria 1101
634 Ga0495591_045515 3300046458 Bacteria 1223
635 Ga0495629_0003904 3300046459 Bacteria 11215
636 Ga0495651_0000356 3300046462 Bacteria 35210
637 Ga0495651_0000977 3300046462 Bacteria 22167
638 Ga0495651_0062022 3300046462 Bacteria 2861
639 Ga0495651_0088854 3300046462 Bacteria 2321
640 Ga0495653_0000193 3300046463 Bacteria 49516
641 Ga0495653_0125711 3300046463 Bacteria 1821
642 Ga0495653_0367836 3300046463 Bacteria 921
643 Ga0495580_0091021 3300046472 Bacteria 2123
644 Ga0495582_0022901 3300046473 Bacteria 3417
645 Ga0495582_0034182 3300046473 Bacteria 2795
646 Ga0495582_0212729 3300046473 Bacteria 1105
647 Ga0495639_0045107 3300046475 Bacteria 1994
648 Ga0495662_0060059 3300046476 Bacteria 1836
649 Ga0495662_0080447 3300046476 Bacteria 1584
650 Ga0495662_0142170 3300046476 Bacteria 1181
651 Ga0495662_0242024 3300046476 Bacteria 889
652 Ga0495664_0000016 3300046477 Bacteria 175933
653 Ga0495664_0015488 3300046477 Bacteria 4334
654 Ga0495584_0139415 3300046491 Bacteria 1231
655 Ga0495594_0266148 3300046499 Bacteria 976
656 Ga0495607_0119698 3300046501 Bacteria 1384
657 Ga0495608_0000121 3300046511 Bacteria 56189
658 Ga0495608_0279154 3300046511 Bacteria 1037
659 Ga0495616_0056321 3300046513 Bacteria 1942
660 Ga0495618_0000124 3300046514 Bacteria 56215
661 Ga0495618_0041757 3300046514 Bacteria 2889
662 Ga0495618_0091385 3300046514 Bacteria 1946
663 Ga0495628_0000018 3300046516 Bacteria 169916
664 Ga0495628_0015254 3300046516 Bacteria 6417
665 Ga0495628_0101785 3300046516 Bacteria 2216
666 Ga0495628_0139904 3300046516 Bacteria 1847
667 Ga0495630_0002180 3300046517 Bacteria 13643
668 Ga0495630_0088692 3300046517 Bacteria 2336
669 Ga0495630_0269636 3300046517 Bacteria 1300
670 Ga0495630_0432671 3300046517 Bacteria 1008
671 Ga0495644_0015905 3300046523 Bacteria 2883
672 Ga0495666_0057585 3300046526 Bacteria 1860
673 Ga0495666_0124149 3300046526 Bacteria 1208
674 Ga0495652_0000005 3300046529 Bacteria 524368
675 Ga0495652_0006146 3300046529 Bacteria 11223
676 Ga0495652_0044867 3300046529 Bacteria 3805
677 Ga0495652_0173262 3300046529 Bacteria 1663
678 Ga0495665_0022710 3300046531 Bacteria 3370
679 Ga0495665_0062082 3300046531 Bacteria 1973
680 Ga0495665_0111401 3300046531 Bacteria 1435
681 Ga0495640_0000063 3300046533 Bacteria 60255
682 Ga0495640_0186408 3300046533 Bacteria 1320
683 Ga0495640_0192449 3300046533 Bacteria 1296
684 Ga0495640_0261916 3300046533 Bacteria 1080
685 Ga0495586_0027423 3300046535 Bacteria 3048
686 Ga0495587_0000134 3300046536 Bacteria 56076
687 Ga0495587_0063866 3300046536 Bacteria 2152
688 Ga0495587_0289664 3300046536 Bacteria 917
689 Ga0495598_0000513 3300046537 Bacteria 7181
690 Ga0495598_0085309 3300046537 Bacteria 1020
691 Ga0495621_0066992 3300046539 Bacteria 1315
692 Ga0495645_0000070 3300046543 Bacteria 71823
693 Ga0495645_0006688 3300046543 Bacteria 8009
694 Ga0495645_0042265 3300046543 Bacteria 3323
695 Ga0495645_0225337 3300046543 Bacteria 1258
696 Ga0495633_0126843 3300046558 Bacteria 1181
697 Ga0495667_0000023 3300046559 Bacteria 169343
698 Ga0495667_0258536 3300046559 Bacteria 1108
699 Ga0495667_0321339 3300046559 Bacteria 979
700 Ga0495668_0106349 3300046616 Bacteria 1535
701 Ga0495668_0232391 3300046616 Bacteria 1010
702 Ga0495634_0000241 3300046642 Bacteria 51268
703 Ga0495634_0006515 3300046642 Bacteria 8866
704 Ga0495634_0007380 3300046642 Bacteria 8271
705 Ga0495634_0023797 3300046642 Bacteria 4303
706 Ga0495634_0131184 3300046642 Bacteria 1597
707 Ga0495635_0000045 3300046663 Bacteria 82266
708 Ga0495635_0007866 3300046663 Bacteria 7445
709 Ga0495635_0474966 3300046663 Unclassified 825
710 Ga0495659_0046419 3300046664 Bacteria 1568
711 Ga0495657_0001202 3300046675 Bacteria 22674
712 Ga0495657_0054030 3300046675 Bacteria 2685
713 Ga0495657_0227561 3300046675 Bacteria 1129
714 Ga0495657_0297955 3300046675 Bacteria 962
715 Ga0495599_0000107 3300046678 Bacteria 56178
716 Ga0495599_0016176 3300046678 Bacteria 4630
717 Ga0495599_0271096 3300046678 Bacteria 1030
718 Ga0495623_0000180 3300046679 Bacteria 39869
719 Ga0495623_0290852 3300046679 Bacteria 906
720 Ga0495646_0000027 3300046680 Bacteria 97629
721 Ga0495646_0009489 3300046680 Bacteria 6177
722 Ga0495646_0086248 3300046680 Bacteria 1821
723 Ga0495647_0017526 3300046681 Bacteria 2536
724 Ga0495647_0133894 3300046681 Bacteria 1052
725 Ga0495658_0020639 3300046683 Bacteria 3461
726 Ga0495658_0088488 3300046683 Bacteria 1830
727 Ga0495658_0782518 3300046683 Bacteria 611
728 Ga0495613_0028287 3300046689 Bacteria 4169
729 Ga0495613_0055243 3300046689 Bacteria 2918
730 Ga0495613_0056616 3300046689 Bacteria 2879
731 Ga0495613_0070264 3300046689 Bacteria 2553
732 Ga0495613_0103178 3300046689 Bacteria 2059
733 Ga0495624_0052660 3300046690 Bacteria 2571
734 Ga0495624_0093253 3300046690 Bacteria 1857
735 Ga0495670_0004845 3300046691 Bacteria 6606
736 Ga0495671_0025808 3300046692 Bacteria 3051
737 Ga0495600_0000062 3300046809 Bacteria 61420
738 Ga0495600_0028026 3300046809 Bacteria 3643
739 Ga0495581_0050844 3300047315 Bacteria 2394
740 Ga0495581_0164637 3300047315 Bacteria 1297
741 Ga0495581_0251664 3300047315 Bacteria 1033
742 Ga0495604_0000014 3300047317 Bacteria 205481
743 Ga0495674_0000014 3300047319 Bacteria 241211
744 Ga0495674_0146874 3300047319 Bacteria 1979
745 Ga0495674_0452055 3300047319 Bacteria 1032
746 Ga0495672_0091047 3300047320 Bacteria 1675
747 Ga0495676_0021834 3300047321 Bacteria 5581
748 Ga0495676_0072883 3300047321 Bacteria 2635
749 Ga0495676_0542368 3300047321 Bacteria 761
750 Ga0495680_0000779 3300047322 Bacteria 35728
751 Ga0495680_0199616 3300047322 Bacteria 1435
752 Ga0495680_0274377 3300047322 Bacteria 1190
753 Ga0495680_0326915 3300047322 Bacteria 1072
754 Ga0495675_0000058 3300047444 Bacteria 77587
755 Ga0495675_0074564 3300047444 Bacteria 2138
756 Ga0495675_0222744 3300047444 Bacteria 1141
757 Ga0495684_0000059 3300047471 Bacteria 77947
758 Ga0495684_0023040 3300047471 Bacteria 4790
759 Ga0495684_0032711 3300047471 Bacteria 3994
760 Ga0495593_0005129 3300047673 Bacteria 7741
761 Ga0495593_0006926 3300047673 Bacteria 6638
762 Ga0495593_0092976 3300047673 Bacteria 1552
763 Ga0495593_0249251 3300047673 Bacteria 889
764 Ga0495602_0000017 3300048088 Bacteria 184180
765 Ga0495602_0281844 3300048088 Bacteria 1224
766 Ga0495602_0842122 3300048088 Bacteria 613
767 Ga0496100_0006029 3300048903 Bacteria 6579
768 Ga0496100_0007617 3300048903 Bacteria 5988
769 Ga0496100_0221282 3300048903 Bacteria 1389
770 Ga0496100_0577318 3300048903 Bacteria 871
771 Ga0496100_0704446 3300048903 Bacteria 788
772 Ga0496101_0000879 3300048904 Bacteria 17685
773 Ga0496101_0003104 3300048904 Bacteria 10272
774 Ga0496101_0011363 3300048904 Bacteria 5905
775 Ga0496101_0018180 3300048904 Bacteria 4776
776 Ga0496101_0153974 3300048904 Bacteria 1760
777 Ga0496101_0340027 3300048904 Bacteria 1179
778 Ga0496101_0344962 3300048904 Bacteria 1170
779 Ga0496101_0608082 3300048904 Bacteria 864
780 Ga0496101_0629180 3300048904 Bacteria 848
781 Ga0496102_0008462 3300048905 Bacteria 8821
782 Ga0496102_0011826 3300048905 Bacteria 7533
783 Ga0496102_0024214 3300048905 Bacteria 5396
784 Ga0496102_0037021 3300048905 Bacteria 4400
785 Ga0496102_0069866 3300048905 Bacteria 3224
786 Ga0496102_0576835 3300048905 Bacteria 1048
787 Ga0496102_0717283 3300048905 Bacteria 923
788 Ga0496102_0902813 3300048905 Bacteria 805
789 Ga0496103_0007237 3300048906 Bacteria 6615
790 Ga0496103_0048800 3300048906 Bacteria 2617
791 Ga0496103_0102030 3300048906 Bacteria 1817
792 Ga0496103_0243198 3300048906 Bacteria 1158
793 Ga0496104_0001978 3300048907 Bacteria 17751
794 Ga0496104_0004384 3300048907 Bacteria 12293
795 Ga0496104_0006107 3300048907 Bacteria 10574
796 Ga0496104_0017059 3300048907 Bacteria 6607
797 Ga0496104_0195705 3300048907 Bacteria 1934
798 Ga0496104_0374083 3300048907 Bacteria 1337
799 Ga0496104_0468513 3300048907 Bacteria 1171
800 Ga0496104_0848001 3300048907 Bacteria 819
801 Ga0496104_0990057 3300048907 Bacteria 745
802 Ga0496105_0001999 3300048908 Bacteria 14708
803 Ga0496105_0005181 3300048908 Bacteria 9880
804 Ga0496105_0015753 3300048908 Bacteria 6033
805 Ga0496105_0061405 3300048908 Bacteria 3101
806 Ga0496105_0061711 3300048908 Bacteria 3094
807 Ga0496105_0098553 3300048908 Bacteria 2413
808 Ga0496105_0454318 3300048908 Bacteria 1011
809 Ga0496106_0003496 3300048909 Bacteria 11703
810 Ga0496106_0011510 3300048909 Bacteria 6542
811 Ga0496106_0016650 3300048909 Bacteria 5438
812 Ga0496106_0317869 3300048909 Bacteria 1250
813 Ga0496106_0917103 3300048909 Unclassified 691
814 Ga0496107_0008551 3300048910 Bacteria 7083
815 Ga0496107_0028396 3300048910 Bacteria 3975
816 Ga0496107_0062820 3300048910 Bacteria 2690
817 Ga0496107_0181280 3300048910 Bacteria 1564
818 Ga0496107_0318195 3300048910 Bacteria 1158
819 Ga0496108_0000347 3300048911 Bacteria 39108
820 Ga0496108_0005996 3300048911 Bacteria 9840
821 Ga0496108_0013218 3300048911 Bacteria 6727
822 Ga0496108_0018394 3300048911 Bacteria 5720
823 Ga0496108_0032557 3300048911 Bacteria 4330
824 Ga0496108_0077240 3300048911 Bacteria 2816
825 Ga0496109_0005863 3300048912 Bacteria 10300
826 Ga0496109_0022511 3300048912 Bacteria 5583
827 Ga0496109_0032495 3300048912 Bacteria 4691
828 Ga0496109_0045633 3300048912 Bacteria 3977
829 Ga0496109_0313055 3300048912 Bacteria 1481
830 Ga0496109_0498994 3300048912 Bacteria 1149
831 Ga0496109_0586258 3300048912 Bacteria 1051
832 Ga0496110_0000339 3300048913 Bacteria 31235
833 Ga0496110_0003146 3300048913 Bacteria 12548
834 Ga0496110_0012105 3300048913 Bacteria 7086
835 Ga0496110_0029719 3300048913 Bacteria 4706
836 Ga0496110_0074428 3300048913 Bacteria 3016
837 Ga0496110_0170611 3300048913 Bacteria 1974
838 Ga0496110_0264085 3300048913 Bacteria 1567
839 Ga0496110_0323362 3300048913 Bacteria 1405
840 Ga0496110_0625564 3300048913 Bacteria 975
841 Ga0496111_0001676 3300048914 Bacteria 12899
842 Ga0496111_0009006 3300048914 Bacteria 6640
843 Ga0496111_0017366 3300048914 Bacteria 4975
844 Ga0496111_0021601 3300048914 Bacteria 4497
845 Ga0496111_0720866 3300048914 Bacteria 725
846 Ga0496112_0002294 3300048915 Bacteria 15311
847 Ga0496112_0003807 3300048915 Bacteria 12611
848 Ga0496112_0004698 3300048915 Bacteria 11628
849 Ga0496112_0006289 3300048915 Bacteria 10415
850 Ga0496112_0129178 3300048915 Bacteria 2498
851 Ga0496112_0233439 3300048915 Bacteria 1794
852 Ga0496112_0618357 3300048915 Bacteria 1014
853 Ga0496112_0648060 3300048915 Bacteria 986
854 Ga0496112_0917495 3300048915 Bacteria 797
855 Ga0496113_0069726 3300048916 Bacteria 2671
856 Ga0496113_0075665 3300048916 Bacteria 2570
857 Ga0496113_0114824 3300048916 Bacteria 2100
858 Ga0496113_0132092 3300048916 Bacteria 1960
859 Ga0496113_0280044 3300048916 Bacteria 1333
860 Ga0496114_0110149 3300048917 Bacteria 2358
861 Ga0496115_0018524 3300048918 Bacteria 5348
862 Ga0496115_0055975 3300048918 Bacteria 3169
863 Ga0496115_0060795 3300048918 Bacteria 3045
864 Ga0496115_0257531 3300048918 Bacteria 1435
865 Ga0496115_0316815 3300048918 Bacteria 1276
866 Ga0496115_0826093 3300048918 Bacteria 719
867 Ga0501031_0023742 3300049568 Bacteria 3997
868 Ga0501032_0175050 3300049569 Bacteria 1406
869 Ga0501033_0058028 3300049570 Bacteria 2860
870 Ga0501034_0000891 3300049571 Bacteria 43738
871 Ga0501034_0011745 3300049571 Bacteria 9060
872 Ga0501034_0021303 3300049571 Bacteria 6609
873 Ga0501034_0234213 3300049571 Bacteria 1784
874 Ga0501036_0171303 3300049572 Unclassified 1829
875 Ga0501038_0580131 3300049574 Bacteria 850
876 Ga0501039_0008570 3300049575 Bacteria 7798
877 Ga0501040_0015963 3300049576 Bacteria 4966
878 Ga0501040_0725460 3300049576 Bacteria 719
879 Ga0501041_0033918 3300049577 Bacteria 3089
880 Ga0501042_0006103 3300049578 Bacteria 7807
881 Ga0501042_0291971 3300049578 Bacteria 1178
882 Ga0501043_0016253 3300049579 Bacteria 5837
883 Ga0501043_0059010 3300049579 Bacteria 3011
884 Ga0501046_0124912 3300049580 Unclassified 1955
885 Ga0501046_0266063 3300049580 Bacteria 1258
886 Ga0501047_0610694 3300049581 Bacteria 912
887 Ga0501048_0011307 3300049582 Bacteria 6655
888 Ga0501048_0331171 3300049582 Bacteria 1085
889 Ga0501068_0012440 3300049584 Bacteria 4826
890 Ga0501068_0017211 3300049584 Bacteria 4177
891 Ga0501068_0562319 3300049584 Unclassified 742
892 Ga0501069_0041972 3300049585 Bacteria 2529
893 Ga0501069_0047991 3300049585 Bacteria 2371
894 Ga0501070_0003987 3300049586 Bacteria 12699
895 Ga0501070_0185817 3300049586 Bacteria 1709
896 Ga0501070_0787475 3300049586 Bacteria 747
897 Ga0501071_0007220 3300049587 Bacteria 7269
898 Ga0501071_0671147 3300049587 Bacteria 798
899 Ga0501073_0400560 3300049589 Bacteria 948
900 Ga0501074_0001669 3300049590 Bacteria 15112
901 Ga0501074_0116108 3300049590 Bacteria 1915
902 Ga0501075_0038416 3300049591 Bacteria 3579
903 Ga0501075_0164115 3300049591 Bacteria 1695
904 Ga0501075_0248755 3300049591 Bacteria 1355
905 Ga0501075_0412224 3300049591 Bacteria 1030
906 Ga0501075_0451005 3300049591 Bacteria 981
907 Ga0501076_0019950 3300049592 Bacteria 5128
908 Ga0501076_0166618 3300049592 Bacteria 1796
909 Ga0501077_0038035 3300049593 Bacteria 3063
910 Ga0501079_0142427 3300049741 Bacteria 1867
911 Ga0501079_0299090 3300049741 Bacteria 1259
912 Ga0501080_0049205 3300049742 Bacteria 3924
913 Ga0501080_0306962 3300049742 Bacteria 1438
914 Ga0501081_0533014 3300049743 Bacteria 876
915 Ga0501083_0278715 3300049744 Bacteria 1088
916 Ga0501035_0102447 3300049822 Bacteria 2511
917 Ga0501044_0058411 3300049823 Bacteria 3956
918 Ga0501044_0435136 3300049823 Bacteria 1220
919 Ga0501045_0007001 3300049824 Bacteria 7821
920 nmdc:mga03n38_3932_c1 3300050490 Bacteria 4844
921 nmdc:mga03n38_523875_c1 3300050490 Unclassified 668
922 nmdc:mga0yw44_14371_c1 3300050492 Bacteria 4203
923 nmdc:mga0yw44_155796_c1 3300050492 Bacteria 1493
924 nmdc:mga0yw44_176483_c1 3300050492 Bacteria 1405
925 nmdc:mga0yw44_70420_c1 3300050492 Bacteria 2168
926 nmdc:mga0k408_347576_c1 3300050493 Bacteria 884
927 nmdc:mga06z11_39475_c1 3300050494 Bacteria 2349
928 nmdc:mga06z11_790_c1 3300050494 Bacteria 11561
929 nmdc:mga06z11_9739_c1 3300050494 Bacteria 4060
930 nmdc:mga04h51_7974_c1 3300050495 Bacteria 2818
931 nmdc:mga05p37_13689_c1 3300050507 Bacteria 9722
932 nmdc:mga05p37_182270_c1 3300050507 Bacteria 2554
933 nmdc:mga05p37_463312_c1 3300050507 Bacteria 1464
934 nmdc:mga05p37_51539_c1 3300050507 Bacteria 5061
935 nmdc:mga09592_26_c1 3300050508 Bacteria 84260
936 nmdc:mga09592_276302_c1 3300050508 Bacteria 1457
937 nmdc:mga09592_351191_c1 3300050508 Bacteria 1276
938 nmdc:mga09592_452835_c1 3300050508 Bacteria 1107
939 nmdc:mga09592_551382_c1 3300050508 Bacteria 990
940 nmdc:mga0qj67_69955_c1 3300050509 Bacteria 2799
941 nmdc:mga0qj67_72478_c1 3300050509 Bacteria 2750
942 nmdc:mga06r32_118534_c1 3300050510 Bacteria 2609
943 nmdc:mga06r32_134422_c1 3300050510 Bacteria 2447
944 nmdc:mga06r32_274046_c1 3300050510 Bacteria 1675
945 nmdc:mga06r32_5683_c1 3300050510 Bacteria 11226
946 nmdc:mga06r32_898206_c1 3300050510 Bacteria 842
947 nmdc:mga06r32_899039_c1 3300050510 Bacteria 842
948 nmdc:mga08y16_147315_c1 3300050511 Bacteria 2447
949 nmdc:mga08y16_496710_c1 3300050511 Bacteria 1240
950 nmdc:mga08y16_627756_c1 3300050511 Bacteria 1081
951 nmdc:mga08y16_66523_c1 3300050511 Bacteria 3761
952 nmdc:mga0n895_155498_c1 3300050512 Bacteria 2317
953 nmdc:mga0n895_454272_c1 3300050512 Bacteria 1293
954 nmdc:mga0n895_459658_c1 3300050512 Bacteria 1285
955 nmdc:mga0n895_4873_c1 3300050512 Bacteria 11115
956 nmdc:mga0n895_809489_c1 3300050512 Bacteria 927
957 nmdc:mga0n895_84596_c1 3300050512 Bacteria 3165
958 nmdc:mga0n895_938110_c1 3300050512 Bacteria 849
959 nmdc:mga0n895_98294_c1 3300050512 Bacteria 2934
960 nmdc:mga0rr50_137244_c1 3300050513 Bacteria 1964
961 nmdc:mga0rr50_201279_c1 3300050513 Bacteria 1636
962 nmdc:mga0rr50_294262_c1 3300050513 Bacteria 1357
963 nmdc:mga0rr50_929405_c1 3300050513 Bacteria 741
964 nmdc:mga0rr50_95527_c1 3300050513 Bacteria 2323
965 nmdc:mga08x19_127143_c1 3300050514 Bacteria 1712
966 nmdc:mga08x19_3673_c1 3300050514 Bacteria 9135
967 nmdc:mga08x19_40687_c1 3300050514 Bacteria 2959
968 nmdc:mga08x19_483147_c1 3300050514 Bacteria 873
969 nmdc:mga0a205_25016_c1 3300050515 Bacteria 5684
970 nmdc:mga0a205_342822_c1 3300050515 Bacteria 1362
971 nmdc:mga0a205_394674_c1 3300050515 Bacteria 1247
972 nmdc:mga0a205_534460_c1 3300050515 Bacteria 1028
973 nmdc:mga0sz30_5978_c1 3300050516 Bacteria 3448
974 Ga0495601_0000016 3300053077 Bacteria 207486
975 Ga0495601_0006967 3300053077 Bacteria 6619
976 Ga0495601_0011070 3300053077 Bacteria 5390
977 Ga0495601_0017716 3300053077 Bacteria 4327
978 Ga0495601_0043988 3300053077 Bacteria 2806
979 Ga0495601_0095332 3300053077 Bacteria 1918
980 Ga0495601_0259457 3300053077 Bacteria 1134
981 Ga0495601_0343242 3300053077 Bacteria 971
982 Ga0495612_0000041 3300053078 Bacteria 62752
983 Ga0495612_0008712 3300053078 Bacteria 4114
984 Ga0495612_0097294 3300053078 Bacteria 1251
985 Ga0495612_0222672 3300053078 Bacteria 835
986 Ga0495612_0237305 3300053078 Bacteria 809
987 Ga0495655_0000981 3300053083 Bacteria 4424
988 Ga0495595_0000048 3300053084 Bacteria 60581
989 Ga0495595_0001522 3300053084 Bacteria 9051
990 Ga0495595_0143601 3300053084 Bacteria 1172
991 Ga0495619_0000050 3300053085 Bacteria 101361
992 Ga0495619_0002388 3300053085 Bacteria 12328
993 Ga0495619_0041669 3300053085 Bacteria 3004
994 Ga0495619_0088079 3300053085 Bacteria 2100
995 Ga0495619_0118435 3300053085 Bacteria 1814
996 Ga0495619_0313965 3300053085 Bacteria 1085
997 Ga0495619_0391363 3300053085 Bacteria 960
998 Ga0500566_0112346 3300053094 Bacteria 1480
999 Ga0500641_0000747 3300053096 Bacteria 11773
1000 Ga0500650_0089514 3300053098 Bacteria 1440
1001 Ga0500568_0052584 3300053139 Bacteria 1599
1002 Ga0500616_0004736 3300053153 Bacteria 9570
1003 Ga0500616_0036435 3300053153 Bacteria 2670
1004 Ga0500645_051596 3300053730 Bacteria 1200
1005 Ga0501084_0023539 3300054114 Bacteria 5138
1006 Ga0501084_0370131 3300054114 Bacteria 1211
1007 Ga0501084_0880187 3300054114 Bacteria 753
1008 Ga0501082_0026550 3300060353 Bacteria 4992
1009 Ga0501082_0349555 3300060353 Bacteria 1289
1010 Ga0501082_0568735 3300060353 Bacteria 992
1011 Ga0466962_0160303 3300061719 Bacteria 1093
1012 Ga0466962_0380322 3300061719 Bacteria 705
1013 Ga0466963_0034467
1014 JGI24737J22298_10023897
1015 JGI24743J22301_10000589
1016 JGI24738J21930_10011323
1017 JGI24742J22300_10000606
1018 JGI25404J52841_10004866
1019 Ga0058862_12191086
1020 Ga0065707_10160974
1021 Ga0070658_10120406
1022 Ga0070658_10210450
1023 Ga0070658_10485900
1024 Ga0070683_100011408
1025 Ga0070683_100040594
1026 Ga0070683_100311639
1027 Ga0070690_100015826
1028 Ga0070690_100556198
1029 Ga0070670_100028487
1030 Ga0070670_100071135
1031 Ga0068869_100216323
1032 Ga0070666_10088544
1033 Ga0070666_10398149
1034 Ga0070680_100001118
1035 Ga0070680_100109890
1036 Ga0070682_100022863
1037 Ga0070682_100605448
1038 Ga0068868_100009632
1039 Ga0068868_100353123
1040 Ga0070660_100195675
1041 Ga0070660_100478208
1042 Ga0070660_100522540
1043 Ga0070689_100001113
1044 Ga0070689_100194769
1045 Ga0070691_10005401
1046 Ga0070687_100199493
1047 Ga0070687_100211035
1048 Ga0070661_100135873
1049 Ga0070661_100881023
1050 Ga0070692_10022160
1051 Ga0070668_100113320
1052 Ga0070669_100140181
1053 Ga0070669_100206839
1054 Ga0070675_100018009
1055 Ga0070675_100445561
1056 Ga0070671_100010831
1057 Ga0070674_100018571
1058 Ga0070674_100026532
1059 Ga0070673_100003804
1060 Ga0070673_100227319
1061 Ga0070673_100520815
1062 Ga0070673_100954090
1063 Ga0070688_100005939
1064 Ga0070688_100028550
1065 Ga0070688_100051339
1066 Ga0070659_100124649
1067 Ga0070659_100410292
1068 Ga0070659_100994151
1069 Ga0070667_100029214
1070 Ga0070703_10010838
1071 Ga0070709_10011931
1072 Ga0070709_10159441
1073 Ga0070709_10935785
1074 Ga0070714_100003288
1075 Ga0070714_100058344
1076 Ga0070714_100206856
1077 Ga0070714_100309305
1078 Ga0070714_100665610
1079 Ga0070713_100022225
1080 Ga0070713_100108922
1081 Ga0070713_100125140
1082 Ga0070713_100586417
1083 Ga0070710_10047384
1084 Ga0070711_100028231
1085 Ga0070711_100036765
1086 Ga0070711_100080849
1087 Ga0070711_100142841
1088 Ga0070705_100054251
1089 Ga0070705_100189603
1090 Ga0070700_100066485
1091 Ga0070700_100712784
1092 Ga0070694_100074074
1093 Ga0070694_100585525
1094 Ga0070708_100218484
1095 Ga0070663_100086303
1096 Ga0070663_100358866
1097 Ga0070678_100025730
1098 Ga0070678_100033430
1099 Ga0070678_100376024
1100 Ga0070662_100019278
1101 Ga0070681_10523966
1102 Ga0070681_11030727
1103 Ga0068867_100019113
1104 Ga0068867_100725869
1105 Ga0068867_100886910
1106 Ga0070685_10008870
1107 Ga0070707_100101717
1108 Ga0070698_100012347
1109 Ga0070698_100807164
1110 Ga0070699_100123881
1111 Ga0070699_100573922
1112 Ga0070699_101090168
1113 Ga0070679_100023849
1114 Ga0070684_100004629
1115 Ga0070684_100110848
1116 Ga0070684_100165021
1117 Ga0070684_100436286
1118 Ga0070697_100036459
1119 Ga0070697_100140324
1120 Ga0070697_100666805
1121 Ga0068853_100328104
1122 Ga0070672_100014289
1123 Ga0070686_100015033
1124 Ga0070686_100122087
1125 Ga0070686_100489299
1126 Ga0070695_100052568
1127 Ga0070695_100545741
1128 Ga0070693_100359509
1129 Ga0070665_100176983
1130 Ga0070665_100295067
1131 Ga0070665_100374217
1132 Ga0070665_100525754
1133 Ga0070665_100681923
1134 Ga0070665_100836225
1135 Ga0070704_100001250
1136 Ga0070704_100377119
1137 Ga0070704_100543519
1138 Ga0070704_100807306
1139 Ga0068855_100126004
1140 Ga0068855_100472019
1141 Ga0068855_100762977
1142 Ga0070664_100024037
1143 Ga0070664_100118550
1144 Ga0070664_100171265
1145 Ga0068854_100016650
1146 Ga0068856_100001606
1147 Ga0068856_100016444
1148 Ga0068856_100210294
1149 Ga0068856_100502094
1150 Ga0070702_100008194
1151 Ga0068852_100001045
1152 Ga0068859_100025009
1153 Ga0068859_100335208
1154 Ga0068859_100792025
1155 Ga0068864_100001978
1156 Ga0068866_10011518
1157 Ga0068851_10025091
1158 Ga0068870_10014577
1159 Ga0068863_100019233
1160 Ga0068858_100022418
1161 Ga0068858_100116932
1162 Ga0068858_100184675
1163 Ga0068860_100054877
1164 Ga0068860_101087720
1165 Ga0068862_100024602
1166 Ga0068862_100059517
1167 Ga0068862_100283175
1168 Ga0068862_100617918
1169 Ga0081455_10001354
1170 Ga0081455_10300774
1171 Ga0081538_10034525
1172 Ga0081538_10150658
1173 Ga0081540_1001046
1174 Ga0081540_1002282
1175 Ga0081540_1003104
1176 Ga0081540_1100145
1177 Ga0081539_10003208
1178 Ga0070717_10247489
1179 Ga0070717_10349049
1180 Ga0075365_10004171
1181 Ga0075365_10009965
1182 Ga0075365_10011665
1183 Ga0075365_10208576
1184 Ga0075365_10247488
1185 Ga0075365_10352560
1186 Ga0075365_10572926
1187 Ga0075368_10012897
1188 Ga0075368_10018094
1189 Ga0075368_10086403
1190 Ga0075363_100009278
1191 Ga0075363_100025914
1192 Ga0075364_10100398
1193 Ga0075364_10124588
1194 Ga0075364_10260995
1195 Ga0070715_10005759
1196 Ga0070716_100016606
1197 Ga0070712_100052161
1198 Ga0070712_100076048
1199 Ga0070712_100579723
1200 Ga0075362_10003444
1201 Ga0075367_10002008
1202 Ga0075367_10013529
1203 Ga0075367_10039306
1204 Ga0075367_10312623
1205 Ga0097621_100020748
1206 Ga0075370_10038028
1207 Ga0075370_10108901
1208 Ga0068871_100016774
1209 Ga0068871_100892732
1210 Ga0075428_100000617
1211 Ga0075428_100062074
1212 Ga0075428_100082995
1213 Ga0075428_100194841
1214 Ga0075428_100378884
1215 Ga0075428_100532816
1216 Ga0075428_100578115
1217 Ga0075430_100045690
1218 Ga0075431_100073995
1219 Ga0075431_100108855
1220 Ga0075431_100171298
1221 Ga0075431_100820232
1222 Ga0075431_100883641
1223 Ga0075433_10043573
1224 Ga0075433_10622550
1225 Ga0075434_100070901
1226 Ga0075434_100103915
1227 Ga0075434_100131094
1228 Ga0075434_100540835
1229 Ga0075434_100622901
1230 Ga0075434_100811838
1231 Ga0075434_100992981
1232 Ga0075434_101018597
1233 Ga0075429_100000081
1234 Ga0075429_100271902
1235 Ga0075429_100430352
1236 Ga0068865_100174258
1237 Ga0075436_100004004
1238 Ga0075436_100004115
1239 Ga0075436_100090088
1240 Ga0075436_100129957
1241 Ga0097620_100025009
1242 Ga0097620_100335219
1243 Ga0097620_100792112
1244 Ga0075435_100275497
1245 Ga0075435_100316413
1246 Ga0075435_100667463
1247 Ga0075435_100694013
1248 Ga0099794_10011365
1249 Ga0099794_10017902
1250 Ga0099794_10019828
1251 Ga0099795_10059973
1252 Ga0105251_10019995
1253 Ga0105250_10036971
1254 Ga0105240_10012327
1255 Ga0105240_10215904
1256 Ga0105240_10744984
1257 Ga0111539_10089724
1258 Ga0111539_10109039
1259 Ga0111539_10150665
1260 Ga0111539_10229442
1261 Ga0111539_10286824
1262 Ga0111539_10565452
1263 Ga0111539_10577925
1264 Ga0111539_10578423
1265 Ga0111539_11212562
1266 Ga0105245_10051077
1267 Ga0105245_10231631
1268 Ga0105245_11406078
1269 Ga0114129_10002113
1270 Ga0114129_10011617
1271 Ga0114129_10048513
1272 Ga0114129_10221243
1273 Ga0114129_10349571
1274 Ga0114129_11039546
1275 Ga0114129_11487948
1276 Ga0114129_11489605
1277 Ga0114129_11987904
1278 Ga0105243_10440664
1279 Ga0105243_10605780
1280 Ga0105243_11436345
1281 Ga0105241_10521919
1282 Ga0105242_10028336
1283 Ga0105242_10349934
1284 Ga0105248_10623085
1285 Ga0105237_10028064
1286 Ga0105237_10141603
1287 Ga0105238_10037417
1288 Ga0105238_10154909
1289 Ga0105238_10160965
1290 Ga0105238_10345146
1291 Ga0105238_10459267
1292 Ga0105238_10563447
1293 Ga0105249_10015086
1294 Ga0105249_10579958
1295 Ga0105249_10672243
1296 Ga0099796_10010230
1297 Ga0099796_10023258
1298 Ga0105239_10031952
1299 Ga0105239_10188702
1300 Ga0105239_10308693
1301 Ga0105239_10522002
1302 Ga0105239_11216837
1303 Ga0157373_10093120
1304 Ga0157370_10980725
1305 Ga0157369_10011724
1306 Ga0157369_10158993
1307 Ga0157369_10541407
1308 Ga0157374_10083923
1309 Ga0157374_10298170
1310 Ga0157374_10369049
1311 Ga0157374_10720035
1312 Ga0157372_10018682
1313 Ga0157372_10088796
1314 Ga0157372_10245304
1315 Ga0157372_10277978
1316 Ga0157375_10009835
1317 Ga0157375_10796818
1318 Ga0163163_10303939
1319 Ga0163163_10372967
1320 Ga0163163_10390837
1321 Ga0157380_10405511
1322 Ga0157380_10710931
1323 Ga0157380_11157619
1324 Ga0157377_10004874
1325 Ga0157379_10027886
1326 Ga0157379_10659050
1327 Ga0157376_10135733
1328 Ga0163161_10120185
1329 Ga0163161_10780922
1330 Ga0213872_10021062
1331 Ga0213876_10077341
1332 Ga0213876_10099408
1333 Ga0213876_10101010
1334 Ga0213875_10000053
1335 Ga0213875_10158083
1336 Ga0224572_1004891
1337 Ga0228598_1000876
1338 Ga0228598_1020313
1339 Ga0207426_1013129
1340 Ga0207426_1056002
1341 Ga0207697_10030261
1342 Ga0207697_10032524
1343 Ga0207656_10016209
1344 Ga0207656_10247897
1345 Ga0207692_10226083
1346 Ga0207642_10013018
1347 Ga0207688_10003415
1348 Ga0207680_10008657
1349 Ga0207680_10402985
1350 Ga0207647_10064910
1351 Ga0207685_10031288
1352 Ga0207685_10102199
1353 Ga0207699_10014408
1354 Ga0207699_10316086
1355 Ga0207645_10048865
1356 Ga0207645_10049992
1357 Ga0207645_10398827
1358 Ga0207643_10005672
1359 Ga0207705_10213428
1360 Ga0207705_10241045
1361 Ga0207684_10096437
1362 Ga0207707_10004277
1363 Ga0207707_10379776
1364 Ga0207707_10490182
1365 Ga0207695_10026716
1366 Ga0207695_11051143
1367 Ga0207671_10077285
1368 Ga0207671_10214673
1369 Ga0207693_10002485
1370 Ga0207693_10041146
1371 Ga0207693_10063092
1372 Ga0207693_10185616
1373 Ga0207693_10226341
1374 Ga0207693_10284764
1375 Ga0207693_10458723
1376 Ga0207663_10045292
1377 Ga0207663_10080623
1378 Ga0207663_10118085
1379 Ga0207660_10008666
1380 Ga0207660_10328117
1381 Ga0207662_10290993
1382 Ga0207662_10313530
1383 Ga0207657_10100027
1384 Ga0207657_10554022
1385 Ga0207649_10007883
1386 Ga0207649_10189617
1387 Ga0207652_10083726
1388 Ga0207652_10648679
1389 Ga0207652_10655105
1390 Ga0207646_10268358
1391 Ga0207681_10118776
1392 Ga0207694_10129583
1393 Ga0207694_10290493
1394 Ga0207694_10499360
1395 Ga0207650_10031312
1396 Ga0207650_10071529
1397 Ga0207650_10149991
1398 Ga0207659_10298422
1399 Ga0207659_10309531
1400 Ga0207659_10552690
1401 Ga0207687_10006331
1402 Ga0207687_10067357
1403 Ga0207687_10263202
1404 Ga0207700_10013689
1405 Ga0207700_10078066
1406 Ga0207700_10153148
1407 Ga0207700_10178347
1408 Ga0207700_10225900
1409 Ga0207700_10308481
1410 Ga0207700_10334744
1411 Ga0207664_10033479
1412 Ga0207664_10333892
1413 Ga0207664_10456388
1414 Ga0207644_10016623
1415 Ga0207644_10023230
1416 Ga0207644_10038217
1417 Ga0207644_10525956
1418 Ga0207690_10018700
1419 Ga0207690_10104102
1420 Ga0207706_10038206
1421 Ga0207670_10017680
1422 Ga0207670_10020641
1423 Ga0207669_10005520
1424 Ga0207669_10286357
1425 Ga0207669_10471956
1426 Ga0207669_10740924
1427 Ga0207665_10004102
1428 Ga0207665_10067219
1429 Ga0207665_10097939
1430 Ga0207665_10855171
1431 Ga0207691_10001627
1432 Ga0207691_10250595
1433 Ga0207711_10101018
1434 Ga0207711_10227872
1435 Ga0207711_10472488
1436 Ga0207689_10007012
1437 Ga0207661_10026523
1438 Ga0207661_10106947
1439 Ga0207679_10015638
1440 Ga0207679_10081985
1441 Ga0207679_10230954
1442 Ga0207667_10055984
1443 Ga0207667_10062848
1444 Ga0207667_10118214
1445 Ga0207667_10744060
1446 Ga0207651_10135996
1447 Ga0207651_10269391
1448 Ga0207712_10234008
1449 Ga0207668_10007545
1450 Ga0207640_10019201
1451 Ga0207640_10341830
1452 Ga0207640_10529856
1453 Ga0207658_10096845
1454 Ga0207658_10802301
1455 Ga0207677_10126300
1456 Ga0207677_10391944
1457 Ga0207677_10667069
1458 Ga0207703_10167640
1459 Ga0207703_10525085
1460 Ga0207703_10686420
1461 Ga0207639_10158101
1462 Ga0207678_10020051
1463 Ga0207678_10334683
1464 Ga0207678_10370403
1465 Ga0207708_10001502
1466 Ga0207708_10152108
1467 Ga0207708_10896307
1468 Ga0207702_10064733
1469 Ga0207702_11400396
1470 Ga0207648_10006668
1471 Ga0207648_10074077
1472 Ga0207648_10278555
1473 Ga0207648_10710169
1474 Ga0207676_10018586
1475 Ga0207675_100013475
1476 Ga0207675_100260100
1477 Ga0207683_10012333
1478 Ga0207683_10076816
1479 Ga0207683_10547128
1480 Ga0207698_10127091
1481 Ga0207698_10678084
1482 Ga0209179_1011531
1483 Ga0209588_1010903
1484 Ga0209588_1027516
1485 Ga0209813_10003719
1486 Ga0207428_10049012
1487 Ga0268266_10095158
1488 Ga0268266_10286712
1489 Ga0268266_10449037
1490 Ga0268266_10494120
1491 Ga0268266_10760726
1492 Ga0268265_10011597
1493 Ga0268265_10597576
1494 Ga0268264_10858049
1495 Ga0265334_10012318
1496 Ga0265338_10151314
1497 Ga0265763_1007016
1498 Ga0265763_1008412
1499 Ga0265773_1006882
1500 Ga0265332_10006574
1501 Ga0265325_10002317
1502 Ga0265329_10070499
1503 Ga0265340_10015062
1504 Ga0265339_10000078
1505 Ga0265339_10019601
1506 Ga0265331_10154151
1507 Ga0265316_10228627
1508 Ga0265313_10003528
1509 Ga0265314_10022239
1510 Ga0265342_10002635
1511 Ga0316578_10268499
1512 Ga0373926_0022219
1513 Ga0373929_0111511
1514 Ga0373944_0024358
1515 Ga0373952_0114059
1516 Ga0373923_0002771
1517 Ga0373923_0078977
1518 Ga0373936_0003979
1519 Ga0373936_0010496
1520 Ga0373936_0104241
1521 Ga0373939_0069327
1522 Ga0373945_0001064
1523 Ga0373945_0005949
1524 Ga0373953_0004294
1525 Ga0373954_0000906
1526 Ga0373954_0002609
1527 Ga0373954_0058587
1528 Ga0373956_0000029
1529 Ga0373956_0033037
1530 Ga0373956_0339949
1531 Ga0373957_0010530
1532 Ga0373957_0015261
1533 Ga0373960_0014720
1534 Ga0373943_0000208
1535 Ga0373943_0003827
1536 Ga0373943_0032102
1537 Ga0373943_0058368
1538 Ga0373946_0001814
1539 Ga0373946_0006567
1540 Ga0373946_0020608
1541 Ga0373955_0000201
1542 Ga0373955_0003420
1543 Ga0373942_0088537
1544 Ga0373942_0185417
1545 Ga0373961_0108448
1546 Ga0373924_0062256
1547 Ga0373931_0024776
1548 Ga0373931_0049908
1549 Ga0373931_0177648
1550 Ga0373935_0000068
1551 Ga0373935_0048992
1552 Ga0373935_0213117
1553 Ga0373935_0431288
1554 Ga0373927_0005387
1555 Ga0373927_0006191
1556 Ga0373927_0026505
1557 Ga0373927_0028489
1558 Ga0373927_0039331
1559 Ga0373927_0067847
1560 Ga0373927_0179490
1561 Ga0373927_0331838
1562 Ga0373933_0002902
1563 Ga0373933_0003207
1564 Ga0373933_0534282
1565 Ga0373933_0647813
1566 Ga0373947_0000178
1567 Ga0373947_0002537
1568 Ga0373947_0023662
1569 Ga0373947_0064449
1570 Ga0373947_0102805
1571 Ga0373947_0125390
1572 Ga0373947_0180047
1573 Ga0373937_0000347
1574 Ga0373937_0000441
1575 Ga0373937_0045533
1576 Ga0373937_0179799
1577 Ga0373937_0194899
1578 Ga0373937_0250597
1579 Ga0316582_0245053
1580 Ga0373925_0000081
1581 Ga0373925_0001482
1582 Ga0373925_0044829
1583 Ga0373925_0250494
1584 Ga0373925_0302993
1585 Ga0373925_0324306
1586 Ga0373925_0454820
1587 Ga0373925_0638458
1588 Ga0395899_0014903
1589 Ga0395899_0096464
1590 Ga0395900_0008428
1591 Ga0395900_0011461
1592 Ga0395900_0143324
1593 Ga0395900_1067436
1594 Ga0395898_0082166
1595 Ga0395898_0138981
1596 Ga0395898_0331558
1597 Ga0395905_0500874
1598 Ga0436364_0664195
1599 Ga0436364_0716542
1600 Ga0436364_0951864
1601 Ga0395901_0009788
1602 Ga0395901_0018877
1603 Ga0395901_0137101
1604 Ga0395901_0215568
1605 Ga0395901_0564087
1606 Ga0436365_0042743
1607 Ga0436365_0291537
1608 Ga0436365_1099387
1609 Ga0436365_1251077
1610 Ga0436365_1336443
1611 Ga0436365_1383206
1612 Ga0436360_0291491
1613 Ga0436360_0775077
1614 Ga0436360_1307075
1615 Ga0436361_0424457
1616 Ga0436361_0687582
1617 Ga0436361_0914825
1618 Ga0436363_0235431
1619 Ga0436363_0753578
1620 Ga0436363_1012681
1621 Ga0436363_1455596
1622 Ga0439453_0015398
1623 Ga0451853_1512202
1624 Ga0439464_0034921
1625 Ga0451577_0277536
1626 Ga0466966_0306725
1627 Ga0466961_0158392
1628 Ga0466963_0018448
1629 Ga0466963_0025164
1630 Ga0466957_0125405
1631 Ga0466959_0034418
1632 Ga0466959_0036016
1633 Ga0451576_0295185
1634 Ga0451576_0599338
1635 Ga0466958_0014631
1636 Ga0466958_0067079
1637 Ga0466967_0091388
1638 Ga0466967_0320079
1639 Ga0466967_0611955
1640 Ga0495617_118481
1641 Ga0495592_0000196
1642 Ga0495592_0022021
1643 Ga0495592_0287452
1644 Ga0495603_0165172
1645 Ga0495590_0087493
1646 Ga0495591_045515
1647 Ga0495629_0003904
1648 Ga0495651_0000356
1649 Ga0495651_0000977
1650 Ga0495651_0062022
1651 Ga0495651_0088854
1652 Ga0495653_0000193
1653 Ga0495653_0125711
1654 Ga0495653_0367836
1655 Ga0495580_0091021
1656 Ga0495582_0022901
1657 Ga0495582_0034182
1658 Ga0495582_0212729
1659 Ga0495639_0045107
1660 Ga0495662_0060059
1661 Ga0495662_0080447
1662 Ga0495662_0142170
1663 Ga0495662_0242024
1664 Ga0495664_0000016
1665 Ga0495664_0015488
1666 Ga0495584_0139415
1667 Ga0495594_0266148
1668 Ga0495607_0119698
1669 Ga0495608_0000121
1670 Ga0495608_0279154
1671 Ga0495616_0056321
1672 Ga0495618_0000124
1673 Ga0495618_0041757
1674 Ga0495618_0091385
1675 Ga0495628_0000018
1676 Ga0495628_0015254
1677 Ga0495628_0101785
1678 Ga0495628_0139904
1679 Ga0495630_0002180
1680 Ga0495630_0088692
1681 Ga0495630_0269636
1682 Ga0495630_0432671
1683 Ga0495644_0015905
1684 Ga0495666_0057585
1685 Ga0495666_0124149
1686 Ga0495652_0000005
1687 Ga0495652_0006146
1688 Ga0495652_0044867
1689 Ga0495652_0173262
1690 Ga0495665_0022710
1691 Ga0495665_0062082
1692 Ga0495665_0111401
1693 Ga0495640_0000063
1694 Ga0495640_0186408
1695 Ga0495640_0192449
1696 Ga0495640_0261916
1697 Ga0495586_0027423
1698 Ga0495587_0000134
1699 Ga0495587_0063866
1700 Ga0495587_0289664
1701 Ga0495598_0000513
1702 Ga0495598_0085309
1703 Ga0495621_0066992
1704 Ga0495645_0000070
1705 Ga0495645_0006688
1706 Ga0495645_0042265
1707 Ga0495645_0225337
1708 Ga0495633_0126843
1709 Ga0495667_0000023
1710 Ga0495667_0258536
1711 Ga0495667_0321339
1712 Ga0495668_0106349
1713 Ga0495668_0232391
1714 Ga0495634_0000241
1715 Ga0495634_0006515
1716 Ga0495634_0007380
1717 Ga0495634_0023797
1718 Ga0495634_0131184
1719 Ga0495635_0000045
1720 Ga0495635_0007866
1721 Ga0495635_0474966
1722 Ga0495659_0046419
1723 Ga0495657_0001202
1724 Ga0495657_0054030
1725 Ga0495657_0227561
1726 Ga0495657_0297955
1727 Ga0495599_0000107
1728 Ga0495599_0016176
1729 Ga0495599_0271096
1730 Ga0495623_0000180
1731 Ga0495623_0290852
1732 Ga0495646_0000027
1733 Ga0495646_0009489
1734 Ga0495646_0086248
1735 Ga0495647_0017526
1736 Ga0495647_0133894
1737 Ga0495658_0020639
1738 Ga0495658_0088488
1739 Ga0495658_0782518
1740 Ga0495613_0028287
1741 Ga0495613_0055243
1742 Ga0495613_0056616
1743 Ga0495613_0070264
1744 Ga0495613_0103178
1745 Ga0495624_0052660
1746 Ga0495624_0093253
1747 Ga0495670_0004845
1748 Ga0495671_0025808
1749 Ga0495600_0000062
1750 Ga0495600_0028026
1751 Ga0495581_0050844
1752 Ga0495581_0164637
1753 Ga0495581_0251664
1754 Ga0495604_0000014
1755 Ga0495674_0000014
1756 Ga0495674_0146874
1757 Ga0495674_0452055
1758 Ga0495672_0091047
1759 Ga0495676_0021834
1760 Ga0495676_0072883
1761 Ga0495676_0542368
1762 Ga0495680_0000779
1763 Ga0495680_0199616
1764 Ga0495680_0274377
1765 Ga0495680_0326915
1766 Ga0495675_0000058
1767 Ga0495675_0074564
1768 Ga0495675_0222744
1769 Ga0495684_0000059
1770 Ga0495684_0023040
1771 Ga0495684_0032711
1772 Ga0495593_0005129
1773 Ga0495593_0006926
1774 Ga0495593_0092976
1775 Ga0495593_0249251
1776 Ga0495602_0000017
1777 Ga0495602_0281844
1778 Ga0495602_0842122
1779 Ga0496100_0006029
1780 Ga0496100_0007617
1781 Ga0496100_0221282
1782 Ga0496100_0577318
1783 Ga0496100_0704446
1784 Ga0496101_0000879
1785 Ga0496101_0003104
1786 Ga0496101_0011363
1787 Ga0496101_0018180
1788 Ga0496101_0153974
1789 Ga0496101_0340027
1790 Ga0496101_0344962
1791 Ga0496101_0608082
1792 Ga0496101_0629180
1793 Ga0496102_0008462
1794 Ga0496102_0011826
1795 Ga0496102_0024214
1796 Ga0496102_0037021
1797 Ga0496102_0069866
1798 Ga0496102_0576835
1799 Ga0496102_0717283
1800 Ga0496102_0902813
1801 Ga0496103_0007237
1802 Ga0496103_0048800
1803 Ga0496103_0102030
1804 Ga0496103_0243198
1805 Ga0496104_0001978
1806 Ga0496104_0004384
1807 Ga0496104_0006107
1808 Ga0496104_0017059
1809 Ga0496104_0195705
1810 Ga0496104_0374083
1811 Ga0496104_0468513
1812 Ga0496104_0848001
1813 Ga0496104_0990057
1814 Ga0496105_0001999
1815 Ga0496105_0005181
1816 Ga0496105_0015753
1817 Ga0496105_0061405
1818 Ga0496105_0061711
1819 Ga0496105_0098553
1820 Ga0496105_0454318
1821 Ga0496106_0003496
1822 Ga0496106_0011510
1823 Ga0496106_0016650
1824 Ga0496106_0317869
1825 Ga0496106_0917103
1826 Ga0496107_0008551
1827 Ga0496107_0028396
1828 Ga0496107_0062820
1829 Ga0496107_0181280
1830 Ga0496107_0318195
1831 Ga0496108_0000347
1832 Ga0496108_0005996
1833 Ga0496108_0013218
1834 Ga0496108_0018394
1835 Ga0496108_0032557
1836 Ga0496108_0077240
1837 Ga0496109_0005863
1838 Ga0496109_0022511
1839 Ga0496109_0032495
1840 Ga0496109_0045633
1841 Ga0496109_0313055
1842 Ga0496109_0498994
1843 Ga0496109_0586258
1844 Ga0496110_0000339
1845 Ga0496110_0003146
1846 Ga0496110_0012105
1847 Ga0496110_0029719
1848 Ga0496110_0074428
1849 Ga0496110_0170611
1850 Ga0496110_0264085
1851 Ga0496110_0323362
1852 Ga0496110_0625564
1853 Ga0496111_0001676
1854 Ga0496111_0009006
1855 Ga0496111_0017366
1856 Ga0496111_0021601
1857 Ga0496111_0720866
1858 Ga0496112_0002294
1859 Ga0496112_0003807
1860 Ga0496112_0004698
1861 Ga0496112_0006289
1862 Ga0496112_0129178
1863 Ga0496112_0233439
1864 Ga0496112_0618357
1865 Ga0496112_0648060
1866 Ga0496112_0917495
1867 Ga0496113_0069726
1868 Ga0496113_0075665
1869 Ga0496113_0114824
1870 Ga0496113_0132092
1871 Ga0496113_0280044
1872 Ga0496114_0110149
1873 Ga0496115_0018524
1874 Ga0496115_0055975
1875 Ga0496115_0060795
1876 Ga0496115_0257531
1877 Ga0496115_0316815
1878 Ga0496115_0826093
1879 Ga0501031_0023742
1880 Ga0501032_0175050
1881 Ga0501033_0058028
1882 Ga0501034_0000891
1883 Ga0501034_0011745
1884 Ga0501034_0021303
1885 Ga0501034_0234213
1886 Ga0501036_0171303
1887 Ga0501038_0580131
1888 Ga0501039_0008570
1889 Ga0501040_0015963
1890 Ga0501040_0725460
1891 Ga0501041_0033918
1892 Ga0501042_0006103
1893 Ga0501042_0291971
1894 Ga0501043_0016253
1895 Ga0501043_0059010
1896 Ga0501046_0124912
1897 Ga0501046_0266063
1898 Ga0501047_0610694
1899 Ga0501048_0011307
1900 Ga0501048_0331171
1901 Ga0501068_0012440
1902 Ga0501068_0017211
1903 Ga0501068_0562319
1904 Ga0501069_0041972
1905 Ga0501069_0047991
1906 Ga0501070_0003987
1907 Ga0501070_0185817
1908 Ga0501070_0787475
1909 Ga0501071_0007220
1910 Ga0501071_0671147
1911 Ga0501073_0400560
1912 Ga0501074_0001669
1913 Ga0501074_0116108
1914 Ga0501075_0038416
1915 Ga0501075_0164115
1916 Ga0501075_0248755
1917 Ga0501075_0412224
1918 Ga0501075_0451005
1919 Ga0501076_0019950
1920 Ga0501076_0166618
1921 Ga0501077_0038035
1922 Ga0501079_0142427
1923 Ga0501079_0299090
1924 Ga0501080_0049205
1925 Ga0501080_0306962
1926 Ga0501081_0533014
1927 Ga0501083_0278715
1928 Ga0501035_0102447
1929 Ga0501044_0058411
1930 Ga0501044_0435136
1931 Ga0501045_0007001
1932 nmdc:mga03n38_3932_c1
1933 nmdc:mga03n38_523875_c1
1934 nmdc:mga0yw44_14371_c1
1935 nmdc:mga0yw44_155796_c1
1936 nmdc:mga0yw44_176483_c1
1937 nmdc:mga0yw44_70420_c1
1938 nmdc:mga0k408_347576_c1
1939 nmdc:mga06z11_39475_c1
1940 nmdc:mga06z11_790_c1
1941 nmdc:mga06z11_9739_c1
1942 nmdc:mga04h51_7974_c1
1943 nmdc:mga05p37_13689_c1
1944 nmdc:mga05p37_182270_c1
1945 nmdc:mga05p37_463312_c1
1946 nmdc:mga05p37_51539_c1
1947 nmdc:mga09592_26_c1
1948 nmdc:mga09592_276302_c1
1949 nmdc:mga09592_351191_c1
1950 nmdc:mga09592_452835_c1
1951 nmdc:mga09592_551382_c1
1952 nmdc:mga0qj67_69955_c1
1953 nmdc:mga0qj67_72478_c1
1954 nmdc:mga06r32_118534_c1
1955 nmdc:mga06r32_134422_c1
1956 nmdc:mga06r32_274046_c1
1957 nmdc:mga06r32_5683_c1
1958 nmdc:mga06r32_898206_c1
1959 nmdc:mga06r32_899039_c1
1960 nmdc:mga08y16_147315_c1
1961 nmdc:mga08y16_496710_c1
1962 nmdc:mga08y16_627756_c1
1963 nmdc:mga08y16_66523_c1
1964 nmdc:mga0n895_155498_c1
1965 nmdc:mga0n895_454272_c1
1966 nmdc:mga0n895_459658_c1
1967 nmdc:mga0n895_4873_c1
1968 nmdc:mga0n895_809489_c1
1969 nmdc:mga0n895_84596_c1
1970 nmdc:mga0n895_938110_c1
1971 nmdc:mga0n895_98294_c1
1972 nmdc:mga0rr50_137244_c1
1973 nmdc:mga0rr50_201279_c1
1974 nmdc:mga0rr50_294262_c1
1975 nmdc:mga0rr50_929405_c1
1976 nmdc:mga0rr50_95527_c1
1977 nmdc:mga08x19_127143_c1
1978 nmdc:mga08x19_3673_c1
1979 nmdc:mga08x19_40687_c1
1980 nmdc:mga08x19_483147_c1
1981 nmdc:mga0a205_25016_c1
1982 nmdc:mga0a205_342822_c1
1983 nmdc:mga0a205_394674_c1
1984 nmdc:mga0a205_534460_c1
1985 nmdc:mga0sz30_5978_c1
1986 Ga0495601_0000016
1987 Ga0495601_0006967
1988 Ga0495601_0011070
1989 Ga0495601_0017716
1990 Ga0495601_0043988
1991 Ga0495601_0095332
1992 Ga0495601_0259457
1993 Ga0495601_0343242
1994 Ga0495612_0000041
1995 Ga0495612_0008712
1996 Ga0495612_0097294
1997 Ga0495612_0222672
1998 Ga0495612_0237305
1999 Ga0495655_0000981
2000 Ga0495595_0000048
2001 Ga0495595_0001522
2002 Ga0495595_0143601
2003 Ga0495619_0000050
2004 Ga0495619_0002388
2005 Ga0495619_0041669
2006 Ga0495619_0088079
2007 Ga0495619_0118435
2008 Ga0495619_0313965
2009 Ga0495619_0391363
2010 Ga0500566_0112346
2011 Ga0500641_0000747
2012 Ga0500650_0089514
2013 Ga0500568_0052584
2014 Ga0500616_0004736
2015 Ga0500616_0036435
2016 Ga0500645_051596
2017 Ga0501084_0023539
2018 Ga0501084_0370131
2019 Ga0501084_0880187
2020 Ga0501082_0026550
2021 Ga0501082_0349555
2022 Ga0501082_0568735
2023 Ga0466962_0160303
2024 Ga0466962_0380322

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

48

124

0.94

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

57

125

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

53

134

0.88

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

154

244

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kh7-assembly3.cif.gz_B crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione 0.9703 1 207
4kh7-assembly3.cif.gz_B crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione 0.9657 1 207
4kh7-assembly2.cif.gz_A crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione 0.9648 1 207
6nv6-assembly2.cif.gz_B crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound 0.9602 2 207
6nxv-assembly4.cif.gz_D crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.9559 2 207
ID Description Score Start End Superfamily
af_P0ACA7_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9842 1 78 3.40.30.10
4ielA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.98 1 79 3.40.30.10
4ke3A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9709 1 78 3.40.30.10
af_Q7JVZ8_6_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9619 4 77 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9602 1 77 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A537Q271-F1-model_v4 Glutathione S-transferase family protein 0.989 1 196 GO:0016740
AF-A0A382MT04-F1-model_v4 GST N-terminal domain-containing protein 0.9863 1 76
AF-A0A3D3VAC9-F1-model_v4 Glutathione S-transferase 0.9809 2 138 GO:0004364
GO:0006749
AF-A0A2H6AS68-F1-model_v4 Glutathione S-transferase GstB (EC 2.5.1.18) 0.9796 1 207 GO:0004364
AF-A0A520NSW7-F1-model_v4 Glutathione S-transferase family protein 0.9787 1 207 GO:0016740

Map