F488178

General Info

Members Datasets Scaffolds Average Seq Length
1012 811 2024 384

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0009514|Ga0495605_0009514_1557_2933
Length 458
Sequence MAICVLVIGNWHSFRALDTMAGLMVVNLNRQITARSAVLKPEFSRPRINRGIVNSQLLRQLSGRHQNLKREAILFSISKRSDVEPFHAMDVLAEATKRRAAGHPVISMAVGQPSHPTPQAALDAARSALEEGRIGYTDALGTARLKHALARHYRDRHGLEIDPGRIAVTTGSSAGFNLAFLSLFDAGDAVAIARPGYPAYRNILGALGLKVLEVPVTADTHFTLTPESLEAAQKESGVTLKGVLLASPANPTGTVTGREGLKALADYCAAHSIAFISDEIYHGLTFAGEETSVLELTDEAIAINSFSKYYCMTGWRIGWMVLPERLVRPIERVAQSLYISPPELSQIAATAALGASAELDVYKASYAANRDFLMKRLPEMGLAIASPMDGAFYAYVDVTRFTNDSMAFAKRMLAEINVAATPGLDFDPLEGNRTMRMSYAGAETEIAEAAERMAAWLK

Samples

Sample ID Description Type Environment
1 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
43 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
51 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
52 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
53 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
54 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
55 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
56 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
57 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
99 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
106 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
107 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
108 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
109 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
110 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
111 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
112 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
113 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
188 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
189 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
190 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
191 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
192 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
195 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
198 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
199 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
204 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
205 2509276019 Ensifer aridi TW10 Isolate Nodule
206 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
207 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
208 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
209 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
210 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
211 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
212 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
213 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
214 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
215 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
216 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
217 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
218 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
219 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
220 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
221 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
222 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
223 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
224 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
225 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
226 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
227 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
228 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
229 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
230 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
231 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
232 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
233 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
234 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
235 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
236 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
237 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
238 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
239 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
240 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
241 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
242 2519899620 Rhizobium sp. Pop5 Isolate Nodule
243 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
244 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
245 2534681786 Brucella suis 92/29 Isolate Unclassified
246 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
247 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
248 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
249 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
250 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
251 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
252 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
253 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
254 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
255 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
256 2582580736 Prauserella sp. Am3 Isolate Unclassified
257 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
258 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
259 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
260 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
261 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
262 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
263 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
264 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
265 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
266 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
267 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
268 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
269 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
270 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
271 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
272 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
273 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
274 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
275 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
276 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
277 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
278 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
279 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
280 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
281 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
282 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
283 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
284 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
285 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
286 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
287 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
288 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
289 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
290 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
291 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
292 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
293 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
294 2643221557 Ensifer sp. Root558 Isolate Unclassified
295 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
296 2643221568 Rhizobium sp. Root564 Isolate Unclassified
297 2643221582 Rhizobium sp. Root651 Isolate Unclassified
298 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
299 2643221607 Rhizobium sp. Root73 Isolate Unclassified
300 2643221610 Ensifer sp. Root74 Isolate Unclassified
301 2643221618 Ensifer sp. Root231 Isolate Unclassified
302 2643221626 Ensifer sp. Root31 Isolate Unclassified
303 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
304 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
305 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
306 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
307 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
308 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
309 2643221655 Ensifer sp. Root1252 Isolate Unclassified
310 2643221659 Ensifer sp. Root127 Isolate Unclassified
311 2643221668 Ensifer sp. Root423 Isolate Unclassified
312 2643221675 Ensifer sp. Root1298 Isolate Unclassified
313 2643221680 Ensifer sp. Root1312 Isolate Unclassified
314 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
315 2643221688 Rhizobium sp. Root482 Isolate Unclassified
316 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
317 2643221693 Rhizobium sp. Root491 Isolate Unclassified
318 2643221698 Ensifer sp. Root142 Isolate Unclassified
319 2643221712 Ensifer sp. Root258 Isolate Unclassified
320 2643221718 Rhizobium sp. Root268 Isolate Unclassified
321 2643221719 Rhizobium sp. Root274 Isolate Unclassified
322 2643221723 Ensifer sp. Root278 Isolate Unclassified
323 2643221726 Ensifer sp. Root954 Isolate Unclassified
324 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
325 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
326 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
327 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
328 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
329 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
330 2738543024 Aminobacter sp. AP02 Isolate Unclassified
331 2751185800 Brucella pituitosa AA2 Isolate Unclassified
332 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
333 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
334 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
335 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
336 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
337 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
338 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
339 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
340 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
341 2791355260 Rhizobium sp. L9 Isolate Nodule
342 2791355261 Rhizobium sp. J15 Isolate Nodule
343 2791355263 Rhizobium chutanense C5 Isolate Nodule
344 2791355266 Rhizobium sp. L43 Isolate Nodule
345 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
346 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
347 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
348 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
349 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
350 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
351 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
352 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
353 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
354 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
355 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
356 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
357 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
358 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
359 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
360 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
361 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
362 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
363 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
364 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
365 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
366 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
367 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
368 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
369 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
370 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
371 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
372 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
373 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
374 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
375 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
376 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
377 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
378 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
379 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
380 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
381 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
382 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
383 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
384 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
385 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
386 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
387 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
388 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
389 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
390 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
391 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
392 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
393 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
394 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
395 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
396 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
397 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
398 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
399 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
400 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
401 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
402 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
403 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
404 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
405 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
406 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
407 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
408 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
409 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
410 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
411 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
412 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
413 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
414 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
415 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
416 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
417 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
418 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
419 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
420 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
421 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
422 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
423 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
424 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
425 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
426 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
427 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
428 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
429 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
430 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
431 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
432 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
433 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
434 2844163670 Ensifer sp. 1H6 Isolate Unclassified
435 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
436 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
437 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
438 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
439 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
440 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
441 2854911287 Brucella lupini LUP21 Isolate Unclassified
442 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
443 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
444 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
445 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
446 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
447 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
448 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
449 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
450 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
451 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
452 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
453 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
454 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
455 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
456 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
457 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
458 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
459 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
460 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
461 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
462 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
463 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
464 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
465 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
466 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
467 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
468 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
469 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
470 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
471 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
472 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
473 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
474 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
475 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
476 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
477 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
478 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
479 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
480 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
481 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
482 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
483 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
484 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
485 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
486 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
487 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
488 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
489 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
490 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
491 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
492 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
493 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
494 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
495 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
496 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
497 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
498 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
499 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
500 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
501 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
502 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
503 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
504 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
505 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
506 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
507 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
508 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
509 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
510 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
511 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
512 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
513 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
514 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
515 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
516 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
517 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
518 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
519 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
520 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
521 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
522 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
523 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
524 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
525 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
526 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
527 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
528 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
529 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
530 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
531 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
532 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
533 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
534 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
535 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
536 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
537 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
538 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
539 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
540 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
541 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
542 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
543 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
544 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
545 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
546 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
547 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
548 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
549 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
550 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
551 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
552 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
553 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
554 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
555 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
556 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
557 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
558 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
559 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
560 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
561 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
562 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
563 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
564 2933599457 Rhizobium phaseoli M3 Isolate Nodule
565 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
566 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
567 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
568 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
569 2936381700 Rhizobium chutanense C16 Isolate Unclassified
570 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
571 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
572 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
573 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
574 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
575 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
576 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
577 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
578 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
579 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
580 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
581 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
582 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
583 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
584 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
585 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
586 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
587 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
588 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
589 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
590 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
591 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
592 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
593 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
594 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
595 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
596 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
597 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
598 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
599 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
600 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
601 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
602 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
603 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
604 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
605 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
606 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
607 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
608 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
609 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
610 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
611 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
612 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
613 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
614 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
615 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
616 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
617 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
618 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
619 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
620 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
621 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
622 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
623 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
624 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
625 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
626 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
627 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
628 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
629 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
630 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
631 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
632 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
633 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
634 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
635 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
636 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
637 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
638 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
639 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
640 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
641 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
642 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
643 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
644 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
645 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
646 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
647 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
648 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
649 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
650 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
651 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
652 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
653 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
654 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
655 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
656 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
657 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
658 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
659 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
660 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
661 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
662 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
663 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
664 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
665 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
666 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
667 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
668 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
669 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
670 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
671 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
672 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
673 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
674 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
675 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
676 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
677 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
678 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
679 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
680 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
681 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
682 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
683 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
684 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
685 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
686 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
687 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
688 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
689 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
690 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
691 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
692 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
693 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
694 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
695 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
696 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
697 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
698 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
699 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
700 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
701 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
702 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
703 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
704 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
705 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
706 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
707 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
708 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
709 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
710 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
711 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
712 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
713 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
714 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
715 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
716 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
717 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
718 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
719 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
720 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
721 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
722 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
723 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
724 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
725 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
726 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
727 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
728 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
729 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
730 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
731 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
732 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
733 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
734 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
735 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
736 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
737 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
738 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
739 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
740 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
741 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
742 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
743 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
744 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
745 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
746 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
747 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
748 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
749 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
750 2996887358 Rhizobium sp. R711 Isolate Nodule
751 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
752 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
753 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
754 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
755 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
756 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
757 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
758 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
759 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
760 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
761 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
762 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
763 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
764 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
765 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
766 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
767 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
768 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
769 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
770 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
771 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
772 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
773 8005258706 Rhizobium sp. R693 Isolate Nodule
774 8005275841 Rhizobium sp. N4311 Isolate Nodule
775 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
776 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
777 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
778 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
779 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
780 8005321885 Rhizobium sp. R72 Isolate Nodule
781 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
782 8005382845 Rhizobium sp. R634 Isolate Nodule
783 8005395548 Rhizobium sp. R339 Isolate Nodule
784 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
785 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
786 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
787 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
788 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
789 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
790 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
791 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
792 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
793 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
794 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
795 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
796 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
797 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
798 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
799 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
800 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
801 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
802 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
803 8024501048 Rhizobium sp. H4 Isolate Nodule
804 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
805 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
806 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
807 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
808 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
809 8056382006 Rhizobium croatiense 13T Isolate Nodule
810 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
811 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.53
Metatranscriptomes 0
Isolates 60.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 14.03
Nodule 46.54
Rhizoplane 1.38
Rhizosphere 20.16
Stem 0
Stem Tuber 0.1
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495605_0009514 3300046474 Bacteria 5458
2 JGI25155J39150_1000019 3300002704 Bacteria 155636
3 JGI25156J39149_1000020 3300002705 Bacteria 156628
4 JGI25154J39366_1000355 3300002738 Bacteria 26026
5 JGI25157J39369_1000129 3300002741 Bacteria 63620
6 JGI25152J39213_1001416 3300002773 Bacteria 10380
7 JGI25152J39213_1007446 3300002773 Bacteria 2833
8 JGI25152J39213_1010485 3300002773 Bacteria 2116
9 JGI25150J39212_1003234 3300002774 Bacteria 3851
10 JGI25150J39212_1003455 3300002774 Bacteria 3693
11 JGI25159J45721_1000002 3300002987 Bacteria 289163
12 JGI25159J45721_1000980 3300002987 Bacteria 12335
13 JGI25159J45721_1001906 3300002987 Bacteria 8339
14 JGI25151J46595_10000202 3300003187 Bacteria 73308
15 JGI25151J46595_10004677 3300003187 Bacteria 7198
16 JGI25151J46595_10010603 3300003187 Bacteria 4272
17 JGI25151J46595_10010765 3300003187 Bacteria 4232
18 JGI25165J46597_1001254 3300003214 Bacteria 14994
19 JGI25153J46596_10014589 3300003215 Bacteria 3255
20 JGI25153J46596_10014620 3300003215 Bacteria 3251
21 JGI25153J46596_10021142 3300003215 Bacteria 2434
22 rootL2_10036886 3300003322 Bacteria 4684
23 rootH1_10016157 3300003323 Bacteria 5463
24 rootH1_10111348 3300003323 Bacteria 2342
25 JGI25160J50197_1000008 3300003354 Bacteria 289163
26 JGI25160J50197_1000015 3300003354 Bacteria 250902
27 JGI25161J50226_1000005 3300003374 Bacteria 292548
28 JGI25161J50226_1000053 3300003374 Bacteria 106635
29 JGI25161J50226_1000806 3300003374 Bacteria 11804
30 Ga0055542_1001254 3300003762 Bacteria 14004
31 Ga0055526_1005935 3300003771 Bacteria 6810
32 Ga0055526_1009889 3300003771 Bacteria 4520
33 Ga0055524_1008166 3300003775 Bacteria 4372
34 Ga0055524_1011673 3300003775 Bacteria 3419
35 Ga0055524_1012225 3300003775 Bacteria 3306
36 Ga0055528_1001627 3300003790 Bacteria 13253
37 Ga0055528_1001795 3300003790 Bacteria 12305
38 Ga0055528_1002851 3300003790 Bacteria 9022
39 Ga0055528_1003705 3300003790 Bacteria 7562
40 Ga0055528_1004157 3300003790 Bacteria 7045
41 Ga0055528_1011336 3300003790 Bacteria 3550
42 Ga0055540_1001936 3300003792 Bacteria 11577
43 Ga0055540_1005993 3300003792 Bacteria 4928
44 Ga0055543_1000019 3300004625 Bacteria 161035
45 Ga0055543_1000027 3300004625 Bacteria 136033
46 Ga0055543_1000109 3300004625 Bacteria 71370
47 Ga0065165_1000015 3300005262 Bacteria 289201
48 Ga0065165_1000915 3300005262 Bacteria 38053
49 Ga0065165_1013694 3300005262 Bacteria 3204
50 Ga0070671_100016258 3300005355 Bacteria 6018
51 Ga0070663_100077398 3300005455 Bacteria 2435
52 Ga0068853_100016315 3300005539 Bacteria 6111
53 Ga0070665_100243844 3300005548 Bacteria 1797
54 Ga0068855_100165758 3300005563 Bacteria 2505
55 Ga0068857_100128688 3300005577 Bacteria 2283
56 Ga0068852_100261718 3300005616 Bacteria 1661
57 Ga0081455_10000290 3300005937 Bacteria 66541
58 Ga0075365_10012434 3300006038 Bacteria 5057
59 Ga0075365_10023974 3300006038 Bacteria 3844
60 Ga0075365_10027559 3300006038 Bacteria 3616
61 Ga0075367_10033019 3300006178 Bacteria 2981
62 Ga0075369_10000841 3300006186 Bacteria 10102
63 Ga0075369_10005679 3300006186 Bacteria 4677
64 Ga0075429_100159863 3300006880 Bacteria 1973
65 Ga0099826_10021676 3300006948 Bacteria 4811
66 Ga0105240_10004701 3300009093 Bacteria 20645
67 Ga0105240_10291129 3300009093 Bacteria 1872
68 Ga0105247_10188996 3300009101 Bacteria 1378
69 Ga0105243_10015458 3300009148 Bacteria 5768
70 Ga0105248_10106365 3300009177 Bacteria 3163
71 Ga0105237_10002935 3300009545 Bacteria 20647
72 Ga0105238_10013392 3300009551 Bacteria 8278
73 Ga0123341_1000001 3300009765 Bacteria 314908
74 Ga0123342_1017951 3300009766 Bacteria 5767
75 Ga0105239_10016921 3300010375 Bacteria 8059
76 Ga0105239_10464388 3300010375 Bacteria 1437
77 Ga0105239_10505569 3300010375 Bacteria 1374
78 Ga0157371_10000132 3300013102 Bacteria 112593
79 Ga0157371_10047427 3300013102 Bacteria 3055
80 Ga0157370_10009036 3300013104 Bacteria 10694
81 Ga0157370_10026075 3300013104 Bacteria 5775
82 Ga0163163_10286487 3300014325 Bacteria 1699
83 Ga0182007_10005369 3300015262 Bacteria 5637
84 Ga0182005_1008308 3300015265 Bacteria 3066
85 Ga0183363_1060 3300015690 Bacteria 33607
86 Ga0214544_1001462 3300021320 Bacteria 49095
87 Ga0214542_1000006 3300021321 Bacteria 345164
88 Ga0214542_1006436 3300021321 Bacteria 21426
89 Ga0214543_1000003 3300021327 Bacteria 692327
90 Ga0214543_1000014 3300021327 Bacteria 324986
91 Ga0228711_1000015 3300022739 Bacteria 126974
92 Ga0228710_1000015 3300022740 Bacteria 133640
93 Ga0209435_100024 3300025206 Bacteria 199665
94 Ga0209760_102334 3300025207 Bacteria 1787
95 Ga0209436_100826 3300025208 Bacteria 12575
96 Ga0209436_103673 3300025208 Bacteria 3993
97 Ga0209437_100033 3300025233 Bacteria 512520
98 Ga0209437_100075 3300025233 Bacteria 297202
99 Ga0207425_1000010 3300025245 Bacteria 572898
100 Ga0207425_1004650 3300025245 Bacteria 4062
101 Ga0209646_1000064 3300025246 Bacteria 246524
102 Ga0209026_1000053 3300025250 Bacteria 246524
103 Ga0209677_102131 3300025253 Bacteria 7757
104 Ga0209148_1000038 3300025254 Bacteria 493744
105 Ga0209759_1000042 3300025256 Bacteria 246524
106 Ga0209129_1000034 3300025258 Bacteria 330950
107 Ga0209129_1000285 3300025258 Bacteria 48259
108 Ga0209129_1001399 3300025258 Bacteria 13499
109 Ga0209129_1001903 3300025258 Bacteria 11008
110 Ga0209129_1002726 3300025258 Bacteria 8273
111 Ga0209129_1003445 3300025258 Bacteria 6867
112 Ga0209129_1006070 3300025258 Bacteria 4039
113 Ga0209233_1000262 3300025261 Bacteria 79485
114 Ga0209233_1000277 3300025261 Bacteria 72470
115 Ga0209233_1001590 3300025261 Bacteria 8885
116 Ga0209455_1000068 3300025272 Bacteria 310024
117 Ga0209673_1000041 3300025273 Bacteria 307397
118 Ga0209673_1000456 3300025273 Bacteria 69267
119 Ga0209673_1004617 3300025273 Bacteria 7295
120 Ga0209673_1006095 3300025273 Bacteria 5913
121 Ga0209673_1007454 3300025273 Bacteria 5038
122 Ga0209673_1016433 3300025273 Bacteria 2768
123 Ga0209673_1024715 3300025273 Bacteria 2012
124 Ga0209130_1000006 3300025284 Bacteria 596528
125 Ga0209130_1000007 3300025284 Bacteria 591584
126 Ga0209130_1000018 3300025284 Bacteria 388301
127 Ga0209025_1000022 3300025294 Bacteria 574487
128 Ga0209025_1000097 3300025294 Bacteria 236632
129 Ga0209025_1000303 3300025294 Bacteria 110086
130 Ga0209025_1000361 3300025294 Bacteria 97060
131 Ga0209025_1001170 3300025294 Bacteria 37166
132 Ga0209025_1001792 3300025294 Bacteria 25500
133 Ga0209025_1006333 3300025294 Bacteria 9228
134 Ga0209025_1014436 3300025294 Bacteria 4854
135 Ga0209025_1014956 3300025294 Bacteria 4724
136 Ga0209025_1023084 3300025294 Bacteria 3269
137 Ga0209025_1040867 3300025294 Bacteria 1997
138 Ga0209564_1000453 3300025295 Bacteria 69474
139 Ga0209564_1000549 3300025295 Bacteria 60609
140 Ga0209564_1001900 3300025295 Bacteria 18728
141 Ga0209564_1010897 3300025295 Bacteria 4135
142 Ga0209564_1015767 3300025295 Bacteria 3054
143 Ga0209758_1000080 3300025297 Bacteria 261472
144 Ga0209758_1000837 3300025297 Bacteria 42938
145 Ga0209758_1001553 3300025297 Bacteria 26371
146 Ga0209758_1007221 3300025297 Bacteria 7646
147 Ga0209758_1009190 3300025297 Bacteria 6213
148 Ga0209758_1009197 3300025297 Bacteria 6206
149 Ga0209050_1002665 3300025298 Bacteria 14590
150 Ga0209256_1000522 3300025299 Bacteria 56073
151 Ga0209256_1000603 3300025299 Bacteria 49871
152 Ga0209256_1001237 3300025299 Bacteria 28317
153 Ga0209256_1004273 3300025299 Bacteria 9122
154 Ga0209256_1006071 3300025299 Bacteria 6582
155 Ga0209256_1008224 3300025299 Bacteria 4891
156 Ga0209256_1014693 3300025299 Bacteria 2794
157 Ga0209256_1020362 3300025299 Bacteria 2073
158 Ga0207426_1000003 3300025302 Bacteria 1063212
159 Ga0207426_1000044 3300025302 Bacteria 428043
160 Ga0207426_1000064 3300025302 Bacteria 358276
161 Ga0207426_1000094 3300025302 Bacteria 275293
162 Ga0207426_1000464 3300025302 Bacteria 62646
163 Ga0209051_1000166 3300025303 Bacteria 120265
164 Ga0209051_1002352 3300025303 Bacteria 13683
165 Ga0209051_1008737 3300025303 Bacteria 5324
166 Ga0209051_1020412 3300025303 Bacteria 2853
167 Ga0207647_10006647 3300025904 Bacteria 8401
168 Ga0207695_10003914 3300025913 Bacteria 20605
169 Ga0207671_10004258 3300025914 Bacteria 13774
170 Ga0207694_10072630 3300025924 Bacteria 2690
171 Ga0207650_10008730 3300025925 Bacteria 6921
172 Ga0207711_10237075 3300025941 Bacteria 1672
173 Ga0207678_10000146 3300026067 Bacteria 58091
174 Ga0207678_10037751 3300026067 Bacteria 4201
175 Ga0207674_10085394 3300026116 Bacteria 3151
176 Ga0207674_10242399 3300026116 Bacteria 1750
177 Ga0209281_1000339 3300027111 Bacteria 79862
178 Ga0209281_1000482 3300027111 Bacteria 55407
179 Ga0209371_1000021 3300027312 Bacteria 555864
180 Ga0209371_1002195 3300027312 Bacteria 11374
181 Ga0209371_1003253 3300027312 Bacteria 8095
182 Ga0209282_1000022 3300027666 Bacteria 173388
183 Ga0209282_1001624 3300027666 Bacteria 12469
184 Ga0268266_10033309 3300028379 Bacteria 4380
185 Ga0268266_10120899 3300028379 Bacteria 2331
186 Ga0268266_10163690 3300028379 Bacteria 2014
187 Ga0307515_10001636 3300028794 Bacteria 49786
188 Ga0307515_10030988 3300028794 Bacteria 8947
189 Ga0268256_1000020 3300030500 Bacteria 557873
190 Ga0268256_1011136 3300030500 Bacteria 2868
191 Ga0307513_10007185 3300031456 Bacteria 14462
192 Ga0307405_10009602 3300031731 Bacteria 4968
193 Ga0307518_10001252 3300031838 Bacteria 19089
194 Ga0307412_10053174 3300031911 Bacteria 2684
195 Ga0315914_1000013 3300031967 Bacteria 133640
196 Ga0307510_10025546 3300033180 Bacteria 6808
197 Ga0315913_1000029 3300033430 Bacteria 76154
198 Ga0315915_1000001 3300033464 Bacteria 481518
199 Ga0395900_0026469 3300037418 Bacteria 5939
200 Ga0395900_0228017 3300037418 Bacteria 1875
201 Ga0395905_0118936 3300037471 Bacteria 2483
202 Ga0395905_0246948 3300037471 Bacteria 1667
203 Ga0395901_0061039 3300038443 Bacteria 3923
204 Ga0439436_0033658 3300041404 Bacteria 1483
205 Ga0439465_0003609 3300041413 Bacteria 5049
206 Ga0439465_0010987 3300041413 Bacteria 2839
207 Ga0439465_0013934 3300041413 Bacteria 2503
208 Ga0451787_114143 3300041441 Bacteria 2746
209 Ga0451833_0722006 3300041491 Bacteria 3529
210 Ga0451839_0703428 3300041496 Bacteria 4595
211 Ga0451845_0606676 3300041501 Bacteria 3735
212 Ga0451847_0034164 3300041503 Bacteria 5332
213 Ga0439449_0009859 3300042007 Bacteria 3614
214 Ga0439462_0020284 3300042015 Bacteria 1733
215 Ga0439462_0025283 3300042015 Bacteria 1563
216 Ga0439434_0004827 3300042435 Bacteria 3944
217 Ga0450918_016393 3300042531 Bacteria 1287
218 Ga0466972_0007039 3300044658 Bacteria 5642
219 Ga0495629_0018391 3300046459 Bacteria 5003
220 Ga0495638_0004035 3300046460 Bacteria 11256
221 Ga0495638_0010365 3300046460 Bacteria 6481
222 Ga0495605_0033618 3300046474 Bacteria 2601
223 Ga0495664_0039136 3300046477 Bacteria 2801
224 Ga0495585_0013185 3300046492 Bacteria 4843
225 Ga0495585_0021341 3300046492 Bacteria 3719
226 Ga0495583_0003707 3300046506 Bacteria 11365
227 Ga0495583_0011864 3300046506 Bacteria 4975
228 Ga0495606_0011305 3300046507 Bacteria 7295
229 Ga0495606_0057475 3300046507 Bacteria 2505
230 Ga0495610_0015909 3300046512 Bacteria 4350
231 Ga0495616_0032591 3300046513 Bacteria 2720
232 Ga0495628_0150407 3300046516 Bacteria 1774
233 Ga0495631_0002092 3300046518 Bacteria 11593
234 Ga0495632_0005211 3300046519 Bacteria 8665
235 Ga0495632_0024108 3300046519 Bacteria 3238
236 Ga0495632_0043917 3300046519 Bacteria 2232
237 Ga0495643_0015315 3300046522 Bacteria 4534
238 Ga0495643_0048672 3300046522 Bacteria 2289
239 Ga0495643_0056037 3300046522 Bacteria 2105
240 Ga0495652_0079747 3300046529 Bacteria 2706
241 Ga0495609_0042144 3300046538 Bacteria 2050
242 Ga0495622_0014684 3300046557 Bacteria 3638
243 Ga0495668_0015751 3300046616 Bacteria 4407
244 Ga0495668_0023002 3300046616 Bacteria 3559
245 Ga0495668_0024950 3300046616 Bacteria 3398
246 Ga0495611_0004168 3300046648 Bacteria 6292
247 Ga0495611_0018034 3300046648 Bacteria 3025
248 Ga0495625_0020061 3300046660 Bacteria 5166
249 Ga0495635_0222604 3300046663 Bacteria 1276
250 Ga0495661_0072397 3300046665 Bacteria 2011
251 Ga0495661_0113622 3300046665 Bacteria 1506
252 Ga0495588_0005347 3300046674 Bacteria 5712
253 Ga0495657_0047784 3300046675 Bacteria 2891
254 Ga0495671_0033406 3300046692 Bacteria 2621
255 Ga0495660_0006974 3300046810 Bacteria 6658
256 Ga0495604_0052259 3300047317 Bacteria 3165
257 Ga0495672_0019908 3300047320 Bacteria 4413
258 Ga0495686_0014181 3300047472 Bacteria 5494
259 Ga0495686_0017416 3300047472 Bacteria 4843
260 Ga0495686_0026395 3300047472 Bacteria 3800
261 Ga0495626_0019178 3300048091 Bacteria 3423
262 Ga0496100_0027627 3300048903 Bacteria 3491
263 Ga0496102_0032820 3300048905 Bacteria 4665
264 Ga0496106_0003949 3300048909 Bacteria 11076
265 Ga0496113_0170764 3300048916 Bacteria 1722
266 Ga0496113_0202762 3300048916 Bacteria 1577
267 Ga0496116_0000043 3300048919 Bacteria 328085
268 Ga0496116_0008619 3300048919 Bacteria 8822
269 Ga0496116_0018497 3300048919 Bacteria 5369
270 Ga0496116_0049065 3300048919 Bacteria 2827
271 Ga0496117_0000002 3300048920 Bacteria 2483758
272 Ga0496117_0017715 3300048920 Bacteria 5941
273 Ga0496117_0028613 3300048920 Bacteria 4313
274 Ga0496117_0033822 3300048920 Bacteria 3861
275 Ga0496117_0100966 3300048920 Bacteria 1826
276 Ga0496118_0006705 3300048921 Bacteria 12546
277 Ga0496118_0019792 3300048921 Bacteria 6003
278 Ga0496118_0021271 3300048921 Bacteria 5717
279 Ga0496118_0023919 3300048921 Bacteria 5289
280 Ga0496118_0024860 3300048921 Bacteria 5156
281 Ga0496118_0068245 3300048921 Bacteria 2584
282 Ga0496118_0083878 3300048921 Bacteria 2226
283 Ga0496119_0004434 3300048922 Bacteria 13978
284 Ga0496119_0015696 3300048922 Bacteria 5809
285 Ga0496119_0035951 3300048922 Bacteria 3239
286 Ga0496119_0072393 3300048922 Bacteria 2014
287 Ga0496120_0000431 3300048923 Bacteria 66335
288 Ga0496120_0014611 3300048923 Bacteria 5223
289 Ga0496120_0039804 3300048923 Bacteria 2769
290 Ga0496120_0123725 3300048923 Bacteria 1334
291 Ga0496121_0000001 3300048924 Bacteria 1830318
292 Ga0496121_0008512 3300048924 Bacteria 12039
293 Ga0496121_0015335 3300048924 Bacteria 8040
294 Ga0496121_0017788 3300048924 Bacteria 7225
295 Ga0496121_0029893 3300048924 Bacteria 5020
296 Ga0496121_0069518 3300048924 Bacteria 2840
297 Ga0496121_0089659 3300048924 Bacteria 2406
298 Ga0496122_0000001 3300048925 Bacteria 1827766
299 Ga0496122_0013614 3300048925 Bacteria 7941
300 Ga0496122_0036204 3300048925 Bacteria 3997
301 Ga0496122_0036369 3300048925 Bacteria 3982
302 Ga0496122_0036924 3300048925 Bacteria 3942
303 Ga0496122_0042561 3300048925 Bacteria 3571
304 Ga0496122_0084276 3300048925 Bacteria 2199
305 Ga0496122_0087810 3300048925 Bacteria 2134
306 Ga0496123_0000001 3300048926 Bacteria 1831497
307 Ga0496123_0017809 3300048926 Bacteria 5689
308 Ga0496123_0025657 3300048926 Bacteria 4436
309 Ga0496123_0032345 3300048926 Bacteria 3789
310 Ga0496123_0127828 3300048926 Bacteria 1415
311 Ga0496124_0000112 3300048927 Bacteria 166282
312 Ga0496124_0005607 3300048927 Bacteria 14042
313 Ga0496124_0025856 3300048927 Bacteria 5305
314 Ga0496124_0084039 3300048927 Bacteria 2611
315 Ga0496124_0134400 3300048927 Bacteria 1960
316 Ga0496125_0021697 3300048928 Bacteria 5978
317 Ga0496125_0026418 3300048928 Bacteria 5292
318 Ga0496125_0027795 3300048928 Bacteria 5120
319 Ga0496125_0123605 3300048928 Bacteria 1839
320 Ga0496126_0000369 3300048929 Bacteria 92814
321 Ga0496126_0056867 3300048929 Bacteria 3534
322 Ga0496126_0144176 3300048929 Bacteria 2047
323 Ga0496126_0310956 3300048929 Bacteria 1297
324 Ga0495678_012417 3300049459 Bacteria 4039
325 Ga0501031_0000013 3300049568 Bacteria 129659
326 Ga0501031_0019588 3300049568 Bacteria 4407
327 Ga0501031_0026036 3300049568 Bacteria 3816
328 Ga0501032_0000192 3300049569 Bacteria 50676
329 Ga0501032_0000425 3300049569 Bacteria 34971
330 Ga0501032_0019410 3300049569 Bacteria 4756
331 Ga0501033_0000044 3300049570 Bacteria 129614
332 Ga0501033_0003970 3300049570 Bacteria 11988
333 Ga0501033_0045492 3300049570 Bacteria 3266
334 Ga0501034_0000155 3300049571 Bacteria 129711
335 Ga0501034_0000314 3300049571 Bacteria 86025
336 Ga0501036_0000016 3300049572 Bacteria 129660
337 Ga0501036_0000577 3300049572 Bacteria 26453
338 Ga0501037_0000033 3300049573 Bacteria 129768
339 Ga0501037_0000296 3300049573 Bacteria 42150
340 Ga0501037_0015615 3300049573 Bacteria 5588
341 Ga0501038_0000085 3300049574 Bacteria 79192
342 Ga0501038_0000106 3300049574 Bacteria 70708
343 Ga0501039_0000003 3300049575 Bacteria 357424
344 Ga0501039_0000007 3300049575 Bacteria 277831
345 Ga0501040_0001250 3300049576 Bacteria 16148
346 Ga0501042_0101863 3300049578 Bacteria 2065
347 Ga0501043_0000068 3300049579 Bacteria 93023
348 Ga0501043_0000187 3300049579 Bacteria 56118
349 Ga0501043_0072640 3300049579 Bacteria 2702
350 Ga0501043_0153521 3300049579 Bacteria 1801
351 Ga0501046_0071429 3300049580 Bacteria 2697
352 Ga0501046_0115429 3300049580 Bacteria 2048
353 Ga0501046_0117657 3300049580 Bacteria 2024
354 Ga0501047_0001049 3300049581 Bacteria 27555
355 Ga0501047_0038419 3300049581 Bacteria 4632
356 Ga0501048_0040722 3300049582 Bacteria 3327
357 Ga0501067_0010529 3300049583 Bacteria 5122
358 Ga0501070_0010552 3300049586 Bacteria 7809
359 Ga0501072_0045298 3300049588 Bacteria 3458
360 Ga0501073_0017149 3300049589 Bacteria 5245
361 Ga0501080_0054107 3300049742 Bacteria 3738
362 Ga0501080_0059797 3300049742 Bacteria 3546
363 Ga0501035_0000032 3300049822 Bacteria 175435
364 Ga0501035_0000171 3300049822 Bacteria 79214
365 Ga0501035_0248363 3300049822 Bacteria 1512
366 Ga0501044_0000175 3300049823 Bacteria 79214
367 Ga0501044_0017877 3300049823 Bacteria 7606
368 Ga0501044_0092715 3300049823 Bacteria 3046
369 Ga0501044_0446441 3300049823 Bacteria 1201
370 Ga0501044_0450744 3300049823 Bacteria 1193
371 Ga0501045_0004424 3300049824 Bacteria 9696
372 nmdc:mga0yw44_704_c1 3300050492 Bacteria 12245
373 nmdc:mga0yw44_7599_c1 3300050492 Bacteria 5345
374 nmdc:mga0k408_117846_c1 3300050493 Bacteria 1572
375 nmdc:mga0k408_18795_c1 3300050493 Bacteria 3859
376 nmdc:mga06z11_15015_c1 3300050494 Bacteria 3448
377 nmdc:mga04h51_44303_c1 3300050495 Bacteria 1467
378 nmdc:mga09592_147898_c1 3300050508 Bacteria 2026
379 nmdc:mga0sz30_13568_c1 3300050516 Bacteria 3193
380 nmdc:mga0sz30_2901_c1 3300050516 Bacteria 6141
381 Ga0500643_007732 3300053087 Bacteria 4293
382 Ga0500569_003291 3300053109 Bacteria 3285
383 Ga0500572_013310 3300053111 Bacteria 2033
384 Ga0500594_0004872 3300053118 Bacteria 2967
385 Ga0500618_010083 3300053125 Bacteria 2547
386 Ga0500618_017606 3300053125 Bacteria 1775
387 Ga0500659_0053100 3300053135 Bacteria 2178
388 Ga0500568_0003769 3300053139 Bacteria 8296
389 Ga0500568_0007872 3300053139 Bacteria 5189
390 Ga0500577_0043254 3300053142 Bacteria 1654
391 Ga0500590_010286 3300053148 Bacteria 4722
392 Ga0500616_0005791 3300053153 Bacteria 8295
393 Ga0500616_0008910 3300053153 Bacteria 6158
394 Ga0500622_0003208 3300053156 Bacteria 11126
395 Ga0500622_0020302 3300053156 Bacteria 3528
396 Ga0500634_0005622 3300053161 Bacteria 5971
397 Ga0500636_0008365 3300053177 Bacteria 6002
398 Ga0501084_0017774 3300054114 Bacteria 5917
399 Ga0501082_0022618 3300060353 Bacteria 5415
400 Ga0466962_0024041 3300061719 Bacteria 2928
401 2509108722 2508501122 Bacteria 6292184
402 2509144111 2508501127 Bacteria 7037543
403 2509374255 2509276019 Bacteria 6802256
404 2509387228 2509276021 Bacteria 7634384
405 2509442628 2509276033 Bacteria 7180565
406 2510132824 2510065019 Bacteria 6903379
407 2510307372 2510065057 Bacteria 6649661
408 2510840098 2510461069 Bacteria 5505000
409 2510894108 2510461076 Bacteria 8618824
410 2510899133 2510461076 Bacteria 8618824
411 2511132972 2510917022 Bacteria 6504556
412 2511183475 2510917028 Bacteria 6185411
413 2511199552 2510917030 Bacteria 7460662
414 2511501218 2511231052 Bacteria 6974333
415 2512972021 2512875026 Bacteria 6861065
416 2513582990 2513237086 Bacteria 7265287
417 2513594791 2513237088 Bacteria 6927906
418 2513604690 2513237089 Bacteria 6553624
419 2513616376 2513237091 Bacteria 6900273
420 2513870346 2513237138 Bacteria 7368160
421 2513880902 2513237140 Bacteria 7076289
422 2513902138 2513237143 Bacteria 6664116
423 2513908847 2513237144 Bacteria 7530820
424 2513925904 2513237146 Bacteria 7166346
425 2513987328 2513237156 Bacteria 6402557
426 2514000981 2513237159 Bacteria 6810126
427 2514007344 2513237160 Bacteria 6650282
428 2514019814 2513237162 Bacteria 7468464
429 2514417792 2513237305 Bacteria 7293571
430 2514590198 2513237351 Bacteria 6968952
431 2515608396 2515154107 Bacteria 6795637
432 2515638206 2515154113 Bacteria 7807172
433 2515656153 2515154116 Bacteria 7552979
434 2515739143 2515154134 Bacteria 7220242
435 2516892497 2516653046 Bacteria 6989037
436 2517040461 2516653077 Bacteria 7555578
437 2517075946 2516653085 Bacteria 7346596
438 2517094608 2517093000 Bacteria 7412387
439 2517406322 2517287029 Bacteria 6905599
440 2517569318 2517487022 Bacteria 7227575
441 2520379506 2519899620 Bacteria 6499161
442 2524461502 2524023209 Bacteria 6679728
443 2530645086 2529292951 Bacteria 6916614
444 2535484643 2534681786 Bacteria 3308809
445 2535515988 2534681796 Bacteria 7146037
446 2537874735 2537561587 Bacteria 5425293
447 2551678302 2551306084 Bacteria 8942552
448 2551689247 2551306085 Bacteria 7347181
449 2551717334 2551306090 Bacteria 7953713
450 2551721666 2551306090 Bacteria 7953713
451 2551729069 2551306091 Bacteria 7086830
452 2551745464 2551306093 Bacteria 7064773
453 2558863280 2558860100 Bacteria 8458965
454 2559294562 2558860242 Bacteria 5568029
455 2561466237 2558860983 Bacteria 4133860
456 2583152161 2582580736 Bacteria 5325865
457 2585165779 2582581283 Bacteria 6030556
458 2585199735 2582581294 Bacteria 6626667
459 2585225957 2582581298 Bacteria 7315509
460 2585231332 2582581299 Bacteria 6518058
461 2585254203 2582581304 Bacteria 5831370
462 2585269472 2582581306 Bacteria 6450535
463 2585273052 2582581307 Bacteria 6597605
464 2585283707 2582581308 Bacteria 7413247
465 2585325259 2582581315 Bacteria 7318924
466 2585329342 2582581316 Bacteria 7774528
467 2585390934 2582581865 Bacteria 6644329
468 2585393013 2582581866 Bacteria 6859583
469 2585400515 2582581867 Bacteria 7184437
470 2585528783 2585427526 Bacteria 7258840
471 2585530940 2585427527 Bacteria 7273426
472 2585546917 2585427529 Bacteria 7395659
473 2585557930 2585427530 Bacteria 7383882
474 2585559649 2585427531 Bacteria 6992870
475 2585819922 2585427590 Bacteria 6824633
476 2585902330 2585427608 Bacteria 6544331
477 2585904973 2585427609 Bacteria 6667127
478 2586065425 2585427649 Bacteria 9053857
479 2587979911 2585428125 Bacteria 6662905
480 2597814664 2597489875 Bacteria 7010078
481 2599333554 2599185156 Bacteria 5403036
482 2599418387 2599185170 Bacteria 7295545
483 2599602307 2599185210 Bacteria 5624189
484 2599937608 2599185301 Bacteria 6161860
485 2600192183 2599185352 Bacteria 7228948
486 2601608448 2600255279 Bacteria 5605316
487 2601745222 2600255308 Bacteria 5611129
488 2616292872 2615840624 Bacteria 6557588
489 2616554164 2615840698 Bacteria 7319877
490 2617381454 2617270742 Bacteria 6808054
491 2643771574 2643221550 Bacteria 4619371
492 2643775110 2643221551 Bacteria 3750538
493 2643793555 2643221555 Bacteria 3749717
494 2643806985 2643221557 Bacteria 7184309
495 2643839928 2643221564 Bacteria 4193379
496 2643855693 2643221568 Bacteria 5187270
497 2643919069 2643221582 Bacteria 5804683
498 2643989490 2643221595 Bacteria 6565519
499 2644048195 2643221607 Bacteria 6314006
500 2644067271 2643221610 Bacteria 7480339
501 2644108780 2643221618 Bacteria 7717186
502 2644151301 2643221626 Bacteria 8069654
503 2644153932 2643221627 Bacteria 6761570
504 2644191421 2643221634 Bacteria 6705461
505 2644200693 2643221636 Bacteria 6583769
506 2644210527 2643221637 Bacteria 5345260
507 2644238774 2643221643 Bacteria 5749658
508 2644296618 2643221653 Bacteria 4569637
509 2644311436 2643221655 Bacteria 7722067
510 2644329694 2643221659 Bacteria 7890716
511 2644378340 2643221668 Bacteria 7306521
512 2644420901 2643221675 Bacteria 7473456
513 2644454425 2643221680 Bacteria 7473610
514 2644485172 2643221686 Bacteria 6310811
515 2644493196 2643221688 Bacteria 5260751
516 2644502186 2643221689 Bacteria 6042950
517 2644518453 2643221693 Bacteria 5513853
518 2644546368 2643221698 Bacteria 7756764
519 2644617235 2643221712 Bacteria 7729434
520 2644654079 2643221718 Bacteria 5345506
521 2644654872 2643221719 Bacteria 4568197
522 2644675351 2643221723 Bacteria 7095460
523 2644689763 2643221726 Bacteria 7455827
524 2657683059 2657244999 Bacteria 5946535
525 2671114806 2667528174 Bacteria 6435400
526 2692316579 2690316117 Bacteria 6800650
527 2694631851 2693429783 Bacteria 7019804
528 2694640281 2693429784 Bacteria 7241525
529 2738946337 2738541317 Bacteria 5340176
530 2739309309 2738543024 Bacteria 5603683
531 2753359225 2751185800 Bacteria 5467370
532 2757570920 2757320392 Bacteria 3737298
533 2758641472 2758568016 Bacteria 5645291
534 2766067990 2765235942 Bacteria 7445910
535 2778177701 2775507266 Bacteria 7392367
536 2792584396 2791355082 Bacteria 5973319
537 2792628609 2791355092 Bacteria 6248105
538 2792642851 2791355094 Bacteria 7011481
539 2792751783 2791355123 Bacteria 8049106
540 2793315664 2791355259 Bacteria 7254731
541 2793321297 2791355260 Bacteria 6598818
542 2793330068 2791355261 Bacteria 6661293
543 2793343113 2791355263 Bacteria 6872478
544 2793360445 2791355266 Bacteria 7116587
545 2802719331 2802428858 Bacteria 6636079
546 2802723108 2802428859 Bacteria 6667919
547 2802732531 2802428860 Bacteria 6525526
548 2802738470 2802428861 Bacteria 6534206
549 2802745094 2802428862 Bacteria 6633353
550 2802751529 2802428863 Bacteria 6410669
551 2804751553 2802429268 Bacteria 6094027
552 2808985662 2808606387 Bacteria 5697198
553 2809593817 2808606522 Bacteria 9488490
554 2819242311 2818991272 Bacteria 4622173
555 2819555781 2818991439 Bacteria 6907412
556 2819611383 2818991448 Bacteria 6772224
557 2819638410 2818991453 Bacteria 7181617
558 2837652914 2837651117 Bacteria 3772164
559 2838028853 2838022645 Bacteria 6494267
560 2838032431 2838029111 Bacteria 6603031
561 2838037921 2838035591 Bacteria 7166484
562 2838071276 2838068647 Bacteria 6208656
563 2838076649 2838074704 Bacteria 6785777
564 2838662919 2838661181 Bacteria 7385261
565 2838669917 2838668709 Bacteria 6671819
566 2838676494 2838675328 Bacteria 4909118
567 2838682673 2838680041 Bacteria 6545511
568 2838693068 2838686498 Bacteria 7807632
569 2838697306 2838694306 Bacteria 6853137
570 2838702289 2838701080 Bacteria 6669771
571 2838709515 2838707686 Bacteria 6619912
572 2838715377 2838714209 Bacteria 5525906
573 2838720823 2838719591 Bacteria 5523910
574 2838726135 2838724970 Bacteria 4908691
575 2838736061 2838729681 Bacteria 7400765
576 2838748946 2838742623 Bacteria 7396178
577 2841740528 2841734538 Bacteria 6784580
578 2841847753 2841846520 Bacteria 5345850
579 2841858282 2841851746 Bacteria 7532261
580 2841859707 2841859092 Bacteria 5436171
581 2841865006 2841864319 Bacteria 6742987
582 2842077627 2842077413 Bacteria 6508645
583 2842110999 2842110456 Bacteria 7656360
584 2842119864 2842118031 Bacteria 7033875
585 2842126217 2842124991 Bacteria 5346824
586 2842131387 2842130223 Bacteria 4909145
587 2842147166 2842146304 Bacteria 5957337
588 2842153443 2842152218 Bacteria 4908957
589 2842163121 2842156927 Bacteria 6894975
590 2842165096 2842163707 Bacteria 6916235
591 2842171620 2842170452 Bacteria 5525737
592 2842177063 2842175837 Bacteria 4908771
593 2842186753 2842180545 Bacteria 6888678
594 2842188485 2842187318 Bacteria 5524014
595 2842197112 2842192696 Bacteria 6147454
596 2842204872 2842198810 Bacteria 6608673
597 2842206514 2842205361 Bacteria 6340321
598 2842212796 2842211629 Bacteria 5523832
599 2842220526 2842217011 Bacteria 7497767
600 2842225585 2842224351 Bacteria 5524473
601 2842235924 2842229732 Bacteria 7475766
602 2842238928 2842237096 Bacteria 6620661
603 2842249783 2842243621 Bacteria 7421798
604 2842252231 2842250916 Bacteria 6579627
605 2842263856 2842257432 Bacteria 7401195
606 2842277536 2842271015 Bacteria 7807131
607 2842279971 2842278818 Bacteria 6340002
608 2842291289 2842291075 Bacteria 7076806
609 2842302826 2842298080 Bacteria 6123127
610 2842310382 2842304105 Bacteria 7023636
611 2842315335 2842311132 Bacteria 6616990
612 2842318361 2842317721 Bacteria 6793725
613 2842346998 2842341865 Bacteria 7003929
614 2842361364 2842357229 Bacteria 6485165
615 2842366831 2842363717 Bacteria 6844742
616 2842373302 2842370503 Bacteria 7038661
617 2842377685 2842377471 Bacteria 7140707
618 2842386374 2842384541 Bacteria 7057858
619 2842399582 2842395702 Bacteria 6780583
620 2842404872 2842402390 Bacteria 6681310
621 2842411454 2842409023 Bacteria 6687331
622 2842418095 2842415677 Bacteria 6596907
623 2842425068 2842422224 Bacteria 6239196
624 2842451649 2842447887 Bacteria 6754142
625 2842478940 2842475841 Bacteria 6603183
626 2842483069 2842482326 Bacteria 7212537
627 2842494403 2842489311 Bacteria 6620893
628 2842500664 2842495871 Bacteria 6820686
629 2842506340 2842502639 Bacteria 6604161
630 2842509940 2842509118 Bacteria 6850950
631 2842516492 2842515876 Bacteria 5436280
632 2842526120 2842521101 Bacteria 6569494
633 2842925037 2842922631 Bacteria 5824079
634 2844168290 2844163670 Bacteria 7266046
635 2844454566 2844454524 Bacteria 7952546
636 2847418353 2847417321 Bacteria 6913799
637 2847670965 2847670302 Bacteria 6165597
638 2848993332 2848992105 Bacteria 6810864
639 2850080685 2850079185 Bacteria 6848280
640 2852389310 2852387548 Bacteria 8025568
641 2854911840 2854911287 Bacteria 5582813
642 2855878691 2855872281 Bacteria 6964271
643 2856316436 2856314179 Bacteria 6477897
644 2856344562 2856342000 Bacteria 7176905
645 2856352903 2856349417 Bacteria 6230045
646 2856367183 2856364286 Bacteria 6939991
647 2857355522 2857349434 Bacteria 7926032
648 2857522980 2857516855 Bacteria 7787325
649 2858801221 2858800743 Bacteria 6603254
650 2869169058 2869162929 Bacteria 6399702
651 2869287488 2869285874 Bacteria 6901219
652 2871431015 2871429161 Bacteria 6547891
653 2871437272 2871435913 Bacteria 6880295
654 2871481062 2871474448 Bacteria 6806570
655 2871495322 2871488783 Bacteria 6929816
656 2871500384 2871495908 Bacteria 6935695
657 2874127982 2874123672 Bacteria 7238285
658 2874150184 2874146452 Bacteria 7533118
659 2874158508 2874155637 Bacteria 6724144
660 2876376280 2876369609 Bacteria 6807521
661 2876378974 2876377896 Bacteria 6565995
662 2876395326 2876392853 Bacteria 6660880
663 2876415637 2876413966 Bacteria 6831344
664 2878041745 2878035449 Bacteria 6555736
665 2878747636 2878745973 Bacteria 6867388
666 2878758012 2878753008 Bacteria 6922523
667 2878764473 2878760144 Bacteria 6823465
668 2878771574 2878767105 Bacteria 6898628
669 2881152483 2881147464 Bacteria 7779814
670 2881155901 2881155292 Bacteria 6461656
671 2881161858 2881161766 Bacteria 7127907
672 2881847209 2881845957 Bacteria 6611900
673 2881859417 2881853255 Bacteria 6698367
674 2881863123 2881861095 Bacteria 7128710
675 2882917378 2882912400 Bacteria 6801539
676 2885310745 2885305155 Bacteria 7348390
677 2885317513 2885312484 Bacteria 6415165
678 2885321722 2885318864 Bacteria 6729568
679 2885330685 2885326080 Bacteria 7134805
680 2885336264 2885334103 Bacteria 7216818
681 2885349269 2885342637 Bacteria 7011821
682 2885352164 2885350715 Bacteria 6787678
683 2888347991 2888343758 Bacteria 6611049
684 2888356957 2888350351 Bacteria 7372807
685 2889012001 2889010040 Bacteria 6749192
686 2889023064 2889016732 Bacteria 6700763
687 2891050775 2891048133 Bacteria 4447501
688 2896386843 2896384573 Bacteria 7700774
689 2899369115 2899359706 Bacteria 10940472
690 2899376927 2899370129 Bacteria 6781179
691 2899796755 2899792073 Bacteria 4926588
692 2899807841 2899803654 Bacteria 5577784
693 2899850288 2899845264 Bacteria 5672268
694 2903501601 2903492973 Bacteria 13473544
695 2903502090 2903492973 Bacteria 13473544
696 2903545197 2903540706 Bacteria 7062119
697 2904661956 2904659560 Bacteria 6685615
698 2906310028 2906308376 Bacteria 6841989
699 2906322901 2906321335 Bacteria 6579571
700 2906360143 2906354277 Bacteria 6991324
701 2906376014 2906370794 Bacteria 6881062
702 2906416573 2906414383 Bacteria 6580790
703 2913301824 2913295892 Bacteria 6333755
704 2913310748 2913308742 Bacteria 5350706
705 2915651740 2915650412 Bacteria 4288180
706 2915772998 2915768154 Bacteria 8424322
707 2915985716 2915980308 Bacteria 6624279
708 2915991753 2915986958 Bacteria 6739310
709 2915995158 2915993759 Bacteria 7016183
710 2916008706 2916007675 Bacteria 6898660
711 2916018005 2916014648 Bacteria 6946486
712 2916022091 2916021584 Bacteria 6854472
713 2916031822 2916028427 Bacteria 6748433
714 2916038632 2916035215 Bacteria 6755766
715 2916046656 2916041962 Bacteria 6820487
716 2916052690 2916048683 Bacteria 6543552
717 2916055114 2916055098 Bacteria 6758838
718 2916065842 2916061851 Bacteria 6737736
719 2916073885 2916068649 Bacteria 6943657
720 2916080235 2916076590 Bacteria 6596108
721 2917744062 2917736166 Bacteria 9690793
722 2919104293 2919100787 Bacteria 7710546
723 2919115470 2919114240 Bacteria 5700270
724 2919167543 2919166419 Bacteria 4952238
725 2919409527 2919408235 Bacteria 6149349
726 2920765429 2920760137 Bacteria 7427611
727 2920824060 2920822456 Bacteria 6897201
728 2921202742 2921201388 Bacteria 6926299
729 2921210811 2921208531 Bacteria 6745326
730 2921242509 2921237296 Bacteria 6876710
731 2921249309 2921244191 Bacteria 6568419
732 2921251612 2921250672 Bacteria 6677771
733 2921260806 2921257292 Bacteria 6808382
734 2921263990 2921263974 Bacteria 6864552
735 2921282844 2921282425 Bacteria 6826397
736 2921294631 2921289301 Bacteria 7316391
737 2921297129 2921296804 Bacteria 7176999
738 2922190569 2922185730 Bacteria 7113964
739 2923560692 2923556063 Bacteria 6793593
740 2924147345 2924144063 Bacteria 6883928
741 2924155024 2924150972 Bacteria 7169444
742 2924164999 2924158325 Bacteria 7188855
743 2924168015 2924165586 Bacteria 7260590
744 2924177098 2924172951 Bacteria 6749356
745 2924184762 2924179722 Bacteria 6843264
746 2924188868 2924186466 Bacteria 6876637
747 2924197333 2924193448 Bacteria 6955718
748 2924204213 2924200457 Bacteria 6757188
749 2924212484 2924207177 Bacteria 6917007
750 2924218813 2924214083 Bacteria 7080103
751 2924225958 2924221636 Bacteria 7113495
752 2924233921 2924228884 Bacteria 6633132
753 2924712402 2924710171 Bacteria 6752351
754 2924760080 2924754689 Bacteria 6774424
755 2924784724 2924784321 Bacteria 7416538
756 2926756520 2926754445 Bacteria 5964435
757 2926760762 2926760298 Bacteria 5505990
758 2929139733 2929138655 Bacteria 5810547
759 2933008087 2933006813 Bacteria 4912075
760 2933012868 2933011516 Bacteria 5439334
761 2933020460 2933016740 Bacteria 6355406
762 2933576823 2933570622 Bacteria 7023390
763 2933587024 2933586486 Bacteria 7667493
764 2933595358 2933594066 Bacteria 5594265
765 2933602075 2933599457 Bacteria 5858799
766 2935900559 2935894831 Bacteria 6620579
767 2935904931 2935901341 Bacteria 7341747
768 2936373267 2936367885 Bacteria 7324495
769 2936381365 2936375103 Bacteria 6652732
770 2936384633 2936381700 Bacteria 7006523
771 2937000854 2936996657 Bacteria 6298727
772 2937006459 2937002841 Bacteria 6934057
773 2937013089 2937009748 Bacteria 6746052
774 2937019549 2937016420 Bacteria 6782579
775 2937028646 2937023124 Bacteria 6815156
776 2937030359 2937029754 Bacteria 6424026
777 2937040742 2937036028 Bacteria 6846469
778 2937044114 2937042894 Bacteria 6741576
779 2937052981 2937049772 Bacteria 6757901
780 2937059313 2937056579 Bacteria 7107896
781 2937068629 2937063883 Bacteria 7199456
782 2937071710 2937071275 Bacteria 6984483
783 2937079393 2937078374 Bacteria 6610289
784 2937091798 2937084907 Bacteria 6618516
785 2937096153 2937091812 Bacteria 6979387
786 2937103819 2937098957 Bacteria 7249374
787 2937110964 2937106411 Bacteria 6947143
788 2937114111 2937113482 Bacteria 6505872
789 2937125611 2937119839 Bacteria 6597547
790 2937126612 2937126314 Bacteria 6771275
791 2937813327 2937813078 Bacteria 7783518
792 2937839919 2937836603 Bacteria 6811263
793 2937845667 2937843397 Bacteria 5256375
794 2937999045 2937994558 Bacteria 7036190
795 2938018870 2938014810 Bacteria 6700592
796 2941499992 2941499720 Bacteria 7599444
797 2957377180 2957375807 Bacteria 6425588
798 2957382895 2957382221 Bacteria 6737050
799 2957388885 2957388812 Bacteria 6778072
800 2957396515 2957395598 Bacteria 6822399
801 2957407682 2957402308 Bacteria 6741770
802 2957409562 2957408893 Bacteria 6558585
803 2957419739 2957415311 Bacteria 6991633
804 2957426507 2957422303 Bacteria 7172205
805 2957431828 2957430029 Bacteria 7022557
806 2957437851 2957437181 Bacteria 6568994
807 2957446709 2957443900 Bacteria 6869977
808 2957453248 2957450854 Bacteria 6765715
809 2957458885 2957457609 Bacteria 6967680
810 2957470971 2957464669 Bacteria 6568877
811 2957475185 2957471148 Bacteria 6797643
812 2957479773 2957478035 Bacteria 6756658
813 2957489900 2957484790 Bacteria 6703082
814 2957497682 2957491536 Bacteria 6695180
815 2957498897 2957498199 Bacteria 7126688
816 2957509105 2957505466 Bacteria 7253085
817 2958043947 2958041894 Bacteria 13082850
818 2958074368 2958071322 Bacteria 6815895
819 2958106062 2958100919 Bacteria 6800575
820 2958131891 2958130278 Bacteria 6897202
821 2958169519 2958165035 Bacteria 6906348
822 2958176195 2958172287 Bacteria 6716688
823 2958181694 2958179912 Bacteria 6874908
824 2960586898 2960584000 Bacteria 6864594
825 2960593475 2960591022 Bacteria 6622873
826 2960598822 2960597568 Bacteria 6550735
827 2960608706 2960603979 Bacteria 6898737
828 2960615710 2960610863 Bacteria 6691244
829 2960617947 2960617483 Bacteria 6727748
830 2960628146 2960624210 Bacteria 6875384
831 2960633867 2960631154 Bacteria 6732508
832 2960642260 2960637947 Bacteria 7296468
833 2960651584 2960645483 Bacteria 7211087
834 2960655100 2960652885 Bacteria 7083688
835 2960662788 2960660292 Bacteria 7041660
836 2960671257 2960667422 Bacteria 6763020
837 2960677165 2960674078 Bacteria 6609048
838 2960685062 2960680706 Bacteria 6624464
839 2960691533 2960687367 Bacteria 6535474
840 2960698694 2960693952 Bacteria 6749742
841 2961079537 2961077736 Bacteria 7079850
842 2961117110 2961114664 Bacteria 6680456
843 2961167979 2961163497 Bacteria 6901077
844 2961174585 2961170736 Bacteria 7072258
845 2964613697 2964607997 Bacteria 7101408
846 2964618788 2964615318 Bacteria 6809089
847 2964627007 2964621998 Bacteria 6834995
848 2964632778 2964628898 Bacteria 7083044
849 2964639374 2964636051 Bacteria 7091832
850 2964648815 2964643177 Bacteria 6820887
851 2964652796 2964649959 Bacteria 6675118
852 2964657870 2964656573 Bacteria 7100150
853 2964667905 2964663802 Bacteria 7019362
854 2964673428 2964670856 Bacteria 6851364
855 2964680996 2964678106 Bacteria 6792020
856 2964687020 2964685014 Bacteria 6839111
857 2964697750 2964691889 Bacteria 6802758
858 2964700656 2964698721 Bacteria 6765331
859 2964708738 2964705432 Bacteria 7114648
860 2964714536 2964712639 Bacteria 6695970
861 2964723812 2964719344 Bacteria 7286602
862 2965022798 2965018300 Bacteria 6883036
863 2965124814 2965119406 Bacteria 6956431
864 2967670400 2967664464 Bacteria 6948836
865 2967678648 2967671571 Bacteria 7021409
866 2967680567 2967678726 Bacteria 7264382
867 2967688587 2967686174 Bacteria 6678622
868 2967693491 2967693043 Bacteria 6804451
869 2967700206 2967699805 Bacteria 6854538
870 2967711945 2967706974 Bacteria 7186053
871 2967717939 2967714385 Bacteria 7000047
872 2967726222 2967721400 Bacteria 7073753
873 2967729700 2967728569 Bacteria 6641507
874 2967738911 2967735183 Bacteria 6827012
875 2967745924 2967742019 Bacteria 6794534
876 2967754357 2967748971 Bacteria 6733771
877 2967761605 2967755722 Bacteria 6814706
878 2967766295 2967762386 Bacteria 6923502
879 2967772331 2967769361 Bacteria 6587838
880 2967777732 2967775926 Bacteria 6738189
881 2968000577 2967996073 Bacteria 6787468
882 2968010051 2968003550 Bacteria 6929263
883 2968113018 2968110612 Bacteria 6814636
884 2968176379 2968171901 Bacteria 6894245
885 2970022699 2970019648 Bacteria 7072033
886 2970027896 2970026789 Bacteria 6785236
887 2970036737 2970033650 Bacteria 7118744
888 2970043487 2970040964 Bacteria 6731123
889 2970052097 2970047711 Bacteria 7088379
890 2970058068 2970054988 Bacteria 6611507
891 2970061934 2970061556 Bacteria 7099761
892 2970072145 2970068827 Bacteria 7123112
893 2970079634 2970076120 Bacteria 6697332
894 2970086705 2970082768 Bacteria 6183754
895 2970089752 2970088815 Bacteria 6933825
896 2970098650 2970095765 Bacteria 6936963
897 2970105800 2970102677 Bacteria 6812532
898 2970111947 2970109326 Bacteria 6863976
899 2970118501 2970116247 Bacteria 6501857
900 2970123218 2970122695 Bacteria 6625855
901 2970129763 2970129317 Bacteria 6806560
902 2970141614 2970136068 Bacteria 7207982
903 2970149762 2970143518 Bacteria 6446480
904 2970154192 2970149975 Bacteria 6779706
905 2970160622 2970156795 Bacteria 7168044
906 2970167814 2970164137 Bacteria 6861252
907 2970172949 2970170962 Bacteria 6876229
908 2970178717 2970177841 Bacteria 6768001
909 2970190291 2970184632 Bacteria 7054431
910 2970194130 2970191845 Bacteria 7032787
911 2970490990 2970489779 Bacteria 6517260
912 2970507172 2970503327 Bacteria 7099517
913 2970531885 2970524798 Bacteria 6840927
914 2970546446 2970540015 Bacteria 6977556
915 2970559318 2970554993 Bacteria 6814252
916 2977520552 2977516862 Bacteria 6940108
917 2977527311 2977523885 Bacteria 6960446
918 2977532297 2977530762 Bacteria 6951399
919 2977538236 2977537788 Bacteria 6929320
920 2977550250 2977544691 Bacteria 6875412
921 2977557550 2977551784 Bacteria 7125765
922 2977561116 2977558990 Bacteria 6863948
923 2977567317 2977565890 Bacteria 6901543
924 2977576681 2977572785 Bacteria 6763888
925 2977584303 2977579622 Bacteria 6772100
926 2977828914 2977821940 Bacteria 6906439
927 2977833720 2977828996 Bacteria 7007971
928 2977846943 2977843712 Bacteria 6753583
929 2977866669 2977864932 Bacteria 7534097
930 2977906013 2977898635 Bacteria 6675551
931 2977949024 2977942078 Bacteria 7570577
932 2977980024 2977971508 Bacteria 7472917
933 2979093960 2979089926 Bacteria 5670289
934 2979098657 2979095461 Bacteria 5669583
935 2979105991 2979100975 Bacteria 5423623
936 2979711667 2979710463 Bacteria 6785254
937 2979751473 2979742915 Bacteria 7301278
938 2979812367 2979808191 Bacteria 7179355
939 2984512222 2984509177 Bacteria 5274802
940 2984521416 2984518228 Bacteria 5277463
941 2984540712 2984537506 Bacteria 5277481
942 2984589319 2984587000 Bacteria 5263363
943 2984602976 2984601300 Bacteria 5455244
944 2987640655 2987636660 Bacteria 8088555
945 2987653593 2987652177 Bacteria 6969023
946 2987663993 2987659509 Bacteria 6966464
947 2989778410 2989776772 Bacteria 4843317
948 2995395080 2995392953 Bacteria 4539380
949 2996310910 2996310559 Bacteria 6357320
950 2996340638 2996336353 Bacteria 5511628
951 2996892203 2996887358 Bacteria 5795980
952 3003932909 3003930520 Bacteria 5667563
953 3004193048 3004188549 Bacteria 6952365
954 3004208853 3004203850 Bacteria 7307914
955 3005412662 3005409236 Bacteria 7188837
956 3005417771 3005416602 Bacteria 7064308
957 3005447147 3005445848 Bacteria 6906074
958 3005453764 3005452660 Bacteria 5889319
959 643825316 643692032 Bacteria 6891900
960 648736610 648276728 Bacteria 6968865
961 650739764 650716007 Bacteria 5573770
962 8002285564 8002285264 Bacteria 6717907
963 8003570820 8003570095 Bacteria 5747666
964 8003993192 8003992118 Bacteria 7266902
965 8004000449 8003999396 Bacteria 7063185
966 8004379524 8004374579 Bacteria 6898112
967 8004390227 8004387939 Bacteria 7049250
968 8004395574 8004395343 Bacteria 6620908
969 8004635532 8004633249 Bacteria 6723080
970 8004643039 8004640170 Bacteria 6723001
971 8004695233 8004695233 Bacteria 6731676
972 8004716290 8004714634 Bacteria 6776161
973 8005251070 8005246636 Bacteria 4933972
974 8005259549 8005258706 Bacteria 6184835
975 8005280122 8005275841 Bacteria 6929066
976 8005288191 8005282627 Bacteria 6675747
977 8005294705 8005289223 Bacteria 6634003
978 8005307123 8005301065 Bacteria 6614431
979 8005314650 8005307578 Bacteria 7395396
980 8005316518 8005314921 Bacteria 7072929
981 8005326730 8005321885 Bacteria 5795980
982 8005378700 8005376324 Bacteria 6590079
983 8005384955 8005382845 Bacteria 6732062
984 8005397119 8005395548 Bacteria 6806915
985 8005436189 8005430974 Bacteria 6689030
986 8005462429 8005460587 Bacteria 7157962
987 8005485410 8005484373 Bacteria 6297373
988 8005544628 8005542996 Bacteria 7077758
989 8005558207 8005556819 Bacteria 6908598
990 8005569387 8005563573 Bacteria 7153261
991 8005575347 8005570704 Bacteria 6957481
992 8005621130 8005619151 Bacteria 7030230
993 8005631519 8005626139 Bacteria 6534237
994 8005650064 8005645114 Bacteria 6950293
995 8005659772 8005658619 Bacteria 4500593
996 8005686615 8005682033 Bacteria 6726518
997 8005695031 8005688590 Bacteria 6610080
998 8005696255 8005695170 Bacteria 6912330
999 8018128158 8018127388 Bacteria 7351159
1000 8018168005 8018163183 Bacteria 7277977
1001 8023680881 8023680758 Bacteria 7729763
1002 8024485652 8024479707 Bacteria 6954785
1003 8024489539 8024486573 Bacteria 6540512
1004 8024505122 8024501048 Bacteria 6427847
1005 8046769289 8046767195 Bacteria 7547379
1006 8049294239 8049293176 Bacteria 6128433
1007 8055432867 8055431914 Bacteria 4551896
1008 8055622100 8055617313 Bacteria 7548464
1009 8056380066 8056375014 Bacteria 7006639
1010 8056387647 8056382006 Bacteria 6408074
1011 8057577078 8057575449 Bacteria 7367519
1012 8057875588 8057874678 Bacteria 7494653
1013 Ga0495605_0009514
1014 JGI25155J39150_1000019
1015 JGI25156J39149_1000020
1016 JGI25154J39366_1000355
1017 JGI25157J39369_1000129
1018 JGI25152J39213_1001416
1019 JGI25152J39213_1007446
1020 JGI25152J39213_1010485
1021 JGI25150J39212_1003234
1022 JGI25150J39212_1003455
1023 JGI25159J45721_1000002
1024 JGI25159J45721_1000980
1025 JGI25159J45721_1001906
1026 JGI25151J46595_10000202
1027 JGI25151J46595_10004677
1028 JGI25151J46595_10010603
1029 JGI25151J46595_10010765
1030 JGI25165J46597_1001254
1031 JGI25153J46596_10014589
1032 JGI25153J46596_10014620
1033 JGI25153J46596_10021142
1034 rootL2_10036886
1035 rootH1_10016157
1036 rootH1_10111348
1037 JGI25160J50197_1000008
1038 JGI25160J50197_1000015
1039 JGI25161J50226_1000005
1040 JGI25161J50226_1000053
1041 JGI25161J50226_1000806
1042 Ga0055542_1001254
1043 Ga0055526_1005935
1044 Ga0055526_1009889
1045 Ga0055524_1008166
1046 Ga0055524_1011673
1047 Ga0055524_1012225
1048 Ga0055528_1001627
1049 Ga0055528_1001795
1050 Ga0055528_1002851
1051 Ga0055528_1003705
1052 Ga0055528_1004157
1053 Ga0055528_1011336
1054 Ga0055540_1001936
1055 Ga0055540_1005993
1056 Ga0055543_1000019
1057 Ga0055543_1000027
1058 Ga0055543_1000109
1059 Ga0065165_1000015
1060 Ga0065165_1000915
1061 Ga0065165_1013694
1062 Ga0070671_100016258
1063 Ga0070663_100077398
1064 Ga0068853_100016315
1065 Ga0070665_100243844
1066 Ga0068855_100165758
1067 Ga0068857_100128688
1068 Ga0068852_100261718
1069 Ga0081455_10000290
1070 Ga0075365_10012434
1071 Ga0075365_10023974
1072 Ga0075365_10027559
1073 Ga0075367_10033019
1074 Ga0075369_10000841
1075 Ga0075369_10005679
1076 Ga0075429_100159863
1077 Ga0099826_10021676
1078 Ga0105240_10004701
1079 Ga0105240_10291129
1080 Ga0105247_10188996
1081 Ga0105243_10015458
1082 Ga0105248_10106365
1083 Ga0105237_10002935
1084 Ga0105238_10013392
1085 Ga0123341_1000001
1086 Ga0123342_1017951
1087 Ga0105239_10016921
1088 Ga0105239_10464388
1089 Ga0105239_10505569
1090 Ga0157371_10000132
1091 Ga0157371_10047427
1092 Ga0157370_10009036
1093 Ga0157370_10026075
1094 Ga0163163_10286487
1095 Ga0182007_10005369
1096 Ga0182005_1008308
1097 Ga0183363_1060
1098 Ga0214544_1001462
1099 Ga0214542_1000006
1100 Ga0214542_1006436
1101 Ga0214543_1000003
1102 Ga0214543_1000014
1103 Ga0228711_1000015
1104 Ga0228710_1000015
1105 Ga0209435_100024
1106 Ga0209760_102334
1107 Ga0209436_100826
1108 Ga0209436_103673
1109 Ga0209437_100033
1110 Ga0209437_100075
1111 Ga0207425_1000010
1112 Ga0207425_1004650
1113 Ga0209646_1000064
1114 Ga0209026_1000053
1115 Ga0209677_102131
1116 Ga0209148_1000038
1117 Ga0209759_1000042
1118 Ga0209129_1000034
1119 Ga0209129_1000285
1120 Ga0209129_1001399
1121 Ga0209129_1001903
1122 Ga0209129_1002726
1123 Ga0209129_1003445
1124 Ga0209129_1006070
1125 Ga0209233_1000262
1126 Ga0209233_1000277
1127 Ga0209233_1001590
1128 Ga0209455_1000068
1129 Ga0209673_1000041
1130 Ga0209673_1000456
1131 Ga0209673_1004617
1132 Ga0209673_1006095
1133 Ga0209673_1007454
1134 Ga0209673_1016433
1135 Ga0209673_1024715
1136 Ga0209130_1000006
1137 Ga0209130_1000007
1138 Ga0209130_1000018
1139 Ga0209025_1000022
1140 Ga0209025_1000097
1141 Ga0209025_1000303
1142 Ga0209025_1000361
1143 Ga0209025_1001170
1144 Ga0209025_1001792
1145 Ga0209025_1006333
1146 Ga0209025_1014436
1147 Ga0209025_1014956
1148 Ga0209025_1023084
1149 Ga0209025_1040867
1150 Ga0209564_1000453
1151 Ga0209564_1000549
1152 Ga0209564_1001900
1153 Ga0209564_1010897
1154 Ga0209564_1015767
1155 Ga0209758_1000080
1156 Ga0209758_1000837
1157 Ga0209758_1001553
1158 Ga0209758_1007221
1159 Ga0209758_1009190
1160 Ga0209758_1009197
1161 Ga0209050_1002665
1162 Ga0209256_1000522
1163 Ga0209256_1000603
1164 Ga0209256_1001237
1165 Ga0209256_1004273
1166 Ga0209256_1006071
1167 Ga0209256_1008224
1168 Ga0209256_1014693
1169 Ga0209256_1020362
1170 Ga0207426_1000003
1171 Ga0207426_1000044
1172 Ga0207426_1000064
1173 Ga0207426_1000094
1174 Ga0207426_1000464
1175 Ga0209051_1000166
1176 Ga0209051_1002352
1177 Ga0209051_1008737
1178 Ga0209051_1020412
1179 Ga0207647_10006647
1180 Ga0207695_10003914
1181 Ga0207671_10004258
1182 Ga0207694_10072630
1183 Ga0207650_10008730
1184 Ga0207711_10237075
1185 Ga0207678_10000146
1186 Ga0207678_10037751
1187 Ga0207674_10085394
1188 Ga0207674_10242399
1189 Ga0209281_1000339
1190 Ga0209281_1000482
1191 Ga0209371_1000021
1192 Ga0209371_1002195
1193 Ga0209371_1003253
1194 Ga0209282_1000022
1195 Ga0209282_1001624
1196 Ga0268266_10033309
1197 Ga0268266_10120899
1198 Ga0268266_10163690
1199 Ga0307515_10001636
1200 Ga0307515_10030988
1201 Ga0268256_1000020
1202 Ga0268256_1011136
1203 Ga0307513_10007185
1204 Ga0307405_10009602
1205 Ga0307518_10001252
1206 Ga0307412_10053174
1207 Ga0315914_1000013
1208 Ga0307510_10025546
1209 Ga0315913_1000029
1210 Ga0315915_1000001
1211 Ga0395900_0026469
1212 Ga0395900_0228017
1213 Ga0395905_0118936
1214 Ga0395905_0246948
1215 Ga0395901_0061039
1216 Ga0439436_0033658
1217 Ga0439465_0003609
1218 Ga0439465_0010987
1219 Ga0439465_0013934
1220 Ga0451787_114143
1221 Ga0451833_0722006
1222 Ga0451839_0703428
1223 Ga0451845_0606676
1224 Ga0451847_0034164
1225 Ga0439449_0009859
1226 Ga0439462_0020284
1227 Ga0439462_0025283
1228 Ga0439434_0004827
1229 Ga0450918_016393
1230 Ga0466972_0007039
1231 Ga0495629_0018391
1232 Ga0495638_0004035
1233 Ga0495638_0010365
1234 Ga0495605_0033618
1235 Ga0495664_0039136
1236 Ga0495585_0013185
1237 Ga0495585_0021341
1238 Ga0495583_0003707
1239 Ga0495583_0011864
1240 Ga0495606_0011305
1241 Ga0495606_0057475
1242 Ga0495610_0015909
1243 Ga0495616_0032591
1244 Ga0495628_0150407
1245 Ga0495631_0002092
1246 Ga0495632_0005211
1247 Ga0495632_0024108
1248 Ga0495632_0043917
1249 Ga0495643_0015315
1250 Ga0495643_0048672
1251 Ga0495643_0056037
1252 Ga0495652_0079747
1253 Ga0495609_0042144
1254 Ga0495622_0014684
1255 Ga0495668_0015751
1256 Ga0495668_0023002
1257 Ga0495668_0024950
1258 Ga0495611_0004168
1259 Ga0495611_0018034
1260 Ga0495625_0020061
1261 Ga0495635_0222604
1262 Ga0495661_0072397
1263 Ga0495661_0113622
1264 Ga0495588_0005347
1265 Ga0495657_0047784
1266 Ga0495671_0033406
1267 Ga0495660_0006974
1268 Ga0495604_0052259
1269 Ga0495672_0019908
1270 Ga0495686_0014181
1271 Ga0495686_0017416
1272 Ga0495686_0026395
1273 Ga0495626_0019178
1274 Ga0496100_0027627
1275 Ga0496102_0032820
1276 Ga0496106_0003949
1277 Ga0496113_0170764
1278 Ga0496113_0202762
1279 Ga0496116_0000043
1280 Ga0496116_0008619
1281 Ga0496116_0018497
1282 Ga0496116_0049065
1283 Ga0496117_0000002
1284 Ga0496117_0017715
1285 Ga0496117_0028613
1286 Ga0496117_0033822
1287 Ga0496117_0100966
1288 Ga0496118_0006705
1289 Ga0496118_0019792
1290 Ga0496118_0021271
1291 Ga0496118_0023919
1292 Ga0496118_0024860
1293 Ga0496118_0068245
1294 Ga0496118_0083878
1295 Ga0496119_0004434
1296 Ga0496119_0015696
1297 Ga0496119_0035951
1298 Ga0496119_0072393
1299 Ga0496120_0000431
1300 Ga0496120_0014611
1301 Ga0496120_0039804
1302 Ga0496120_0123725
1303 Ga0496121_0000001
1304 Ga0496121_0008512
1305 Ga0496121_0015335
1306 Ga0496121_0017788
1307 Ga0496121_0029893
1308 Ga0496121_0069518
1309 Ga0496121_0089659
1310 Ga0496122_0000001
1311 Ga0496122_0013614
1312 Ga0496122_0036204
1313 Ga0496122_0036369
1314 Ga0496122_0036924
1315 Ga0496122_0042561
1316 Ga0496122_0084276
1317 Ga0496122_0087810
1318 Ga0496123_0000001
1319 Ga0496123_0017809
1320 Ga0496123_0025657
1321 Ga0496123_0032345
1322 Ga0496123_0127828
1323 Ga0496124_0000112
1324 Ga0496124_0005607
1325 Ga0496124_0025856
1326 Ga0496124_0084039
1327 Ga0496124_0134400
1328 Ga0496125_0021697
1329 Ga0496125_0026418
1330 Ga0496125_0027795
1331 Ga0496125_0123605
1332 Ga0496126_0000369
1333 Ga0496126_0056867
1334 Ga0496126_0144176
1335 Ga0496126_0310956
1336 Ga0495678_012417
1337 Ga0501031_0000013
1338 Ga0501031_0019588
1339 Ga0501031_0026036
1340 Ga0501032_0000192
1341 Ga0501032_0000425
1342 Ga0501032_0019410
1343 Ga0501033_0000044
1344 Ga0501033_0003970
1345 Ga0501033_0045492
1346 Ga0501034_0000155
1347 Ga0501034_0000314
1348 Ga0501036_0000016
1349 Ga0501036_0000577
1350 Ga0501037_0000033
1351 Ga0501037_0000296
1352 Ga0501037_0015615
1353 Ga0501038_0000085
1354 Ga0501038_0000106
1355 Ga0501039_0000003
1356 Ga0501039_0000007
1357 Ga0501040_0001250
1358 Ga0501042_0101863
1359 Ga0501043_0000068
1360 Ga0501043_0000187
1361 Ga0501043_0072640
1362 Ga0501043_0153521
1363 Ga0501046_0071429
1364 Ga0501046_0115429
1365 Ga0501046_0117657
1366 Ga0501047_0001049
1367 Ga0501047_0038419
1368 Ga0501048_0040722
1369 Ga0501067_0010529
1370 Ga0501070_0010552
1371 Ga0501072_0045298
1372 Ga0501073_0017149
1373 Ga0501080_0054107
1374 Ga0501080_0059797
1375 Ga0501035_0000032
1376 Ga0501035_0000171
1377 Ga0501035_0248363
1378 Ga0501044_0000175
1379 Ga0501044_0017877
1380 Ga0501044_0092715
1381 Ga0501044_0446441
1382 Ga0501044_0450744
1383 Ga0501045_0004424
1384 nmdc:mga0yw44_704_c1
1385 nmdc:mga0yw44_7599_c1
1386 nmdc:mga0k408_117846_c1
1387 nmdc:mga0k408_18795_c1
1388 nmdc:mga06z11_15015_c1
1389 nmdc:mga04h51_44303_c1
1390 nmdc:mga09592_147898_c1
1391 nmdc:mga0sz30_13568_c1
1392 nmdc:mga0sz30_2901_c1
1393 Ga0500643_007732
1394 Ga0500569_003291
1395 Ga0500572_013310
1396 Ga0500594_0004872
1397 Ga0500618_010083
1398 Ga0500618_017606
1399 Ga0500659_0053100
1400 Ga0500568_0003769
1401 Ga0500568_0007872
1402 Ga0500577_0043254
1403 Ga0500590_010286
1404 Ga0500616_0005791
1405 Ga0500616_0008910
1406 Ga0500622_0003208
1407 Ga0500622_0020302
1408 Ga0500634_0005622
1409 Ga0500636_0008365
1410 Ga0501084_0017774
1411 Ga0501082_0022618
1412 Ga0466962_0024041
1413 2509108722
1414 2509144111
1415 2509374255
1416 2509387228
1417 2509442628
1418 2510132824
1419 2510307372
1420 2510840098
1421 2510894108
1422 2510899133
1423 2511132972
1424 2511183475
1425 2511199552
1426 2511501218
1427 2512972021
1428 2513582990
1429 2513594791
1430 2513604690
1431 2513616376
1432 2513870346
1433 2513880902
1434 2513902138
1435 2513908847
1436 2513925904
1437 2513987328
1438 2514000981
1439 2514007344
1440 2514019814
1441 2514417792
1442 2514590198
1443 2515608396
1444 2515638206
1445 2515656153
1446 2515739143
1447 2516892497
1448 2517040461
1449 2517075946
1450 2517094608
1451 2517406322
1452 2517569318
1453 2520379506
1454 2524461502
1455 2530645086
1456 2535484643
1457 2535515988
1458 2537874735
1459 2551678302
1460 2551689247
1461 2551717334
1462 2551721666
1463 2551729069
1464 2551745464
1465 2558863280
1466 2559294562
1467 2561466237
1468 2583152161
1469 2585165779
1470 2585199735
1471 2585225957
1472 2585231332
1473 2585254203
1474 2585269472
1475 2585273052
1476 2585283707
1477 2585325259
1478 2585329342
1479 2585390934
1480 2585393013
1481 2585400515
1482 2585528783
1483 2585530940
1484 2585546917
1485 2585557930
1486 2585559649
1487 2585819922
1488 2585902330
1489 2585904973
1490 2586065425
1491 2587979911
1492 2597814664
1493 2599333554
1494 2599418387
1495 2599602307
1496 2599937608
1497 2600192183
1498 2601608448
1499 2601745222
1500 2616292872
1501 2616554164
1502 2617381454
1503 2643771574
1504 2643775110
1505 2643793555
1506 2643806985
1507 2643839928
1508 2643855693
1509 2643919069
1510 2643989490
1511 2644048195
1512 2644067271
1513 2644108780
1514 2644151301
1515 2644153932
1516 2644191421
1517 2644200693
1518 2644210527
1519 2644238774
1520 2644296618
1521 2644311436
1522 2644329694
1523 2644378340
1524 2644420901
1525 2644454425
1526 2644485172
1527 2644493196
1528 2644502186
1529 2644518453
1530 2644546368
1531 2644617235
1532 2644654079
1533 2644654872
1534 2644675351
1535 2644689763
1536 2657683059
1537 2671114806
1538 2692316579
1539 2694631851
1540 2694640281
1541 2738946337
1542 2739309309
1543 2753359225
1544 2757570920
1545 2758641472
1546 2766067990
1547 2778177701
1548 2792584396
1549 2792628609
1550 2792642851
1551 2792751783
1552 2793315664
1553 2793321297
1554 2793330068
1555 2793343113
1556 2793360445
1557 2802719331
1558 2802723108
1559 2802732531
1560 2802738470
1561 2802745094
1562 2802751529
1563 2804751553
1564 2808985662
1565 2809593817
1566 2819242311
1567 2819555781
1568 2819611383
1569 2819638410
1570 2837652914
1571 2838028853
1572 2838032431
1573 2838037921
1574 2838071276
1575 2838076649
1576 2838662919
1577 2838669917
1578 2838676494
1579 2838682673
1580 2838693068
1581 2838697306
1582 2838702289
1583 2838709515
1584 2838715377
1585 2838720823
1586 2838726135
1587 2838736061
1588 2838748946
1589 2841740528
1590 2841847753
1591 2841858282
1592 2841859707
1593 2841865006
1594 2842077627
1595 2842110999
1596 2842119864
1597 2842126217
1598 2842131387
1599 2842147166
1600 2842153443
1601 2842163121
1602 2842165096
1603 2842171620
1604 2842177063
1605 2842186753
1606 2842188485
1607 2842197112
1608 2842204872
1609 2842206514
1610 2842212796
1611 2842220526
1612 2842225585
1613 2842235924
1614 2842238928
1615 2842249783
1616 2842252231
1617 2842263856
1618 2842277536
1619 2842279971
1620 2842291289
1621 2842302826
1622 2842310382
1623 2842315335
1624 2842318361
1625 2842346998
1626 2842361364
1627 2842366831
1628 2842373302
1629 2842377685
1630 2842386374
1631 2842399582
1632 2842404872
1633 2842411454
1634 2842418095
1635 2842425068
1636 2842451649
1637 2842478940
1638 2842483069
1639 2842494403
1640 2842500664
1641 2842506340
1642 2842509940
1643 2842516492
1644 2842526120
1645 2842925037
1646 2844168290
1647 2844454566
1648 2847418353
1649 2847670965
1650 2848993332
1651 2850080685
1652 2852389310
1653 2854911840
1654 2855878691
1655 2856316436
1656 2856344562
1657 2856352903
1658 2856367183
1659 2857355522
1660 2857522980
1661 2858801221
1662 2869169058
1663 2869287488
1664 2871431015
1665 2871437272
1666 2871481062
1667 2871495322
1668 2871500384
1669 2874127982
1670 2874150184
1671 2874158508
1672 2876376280
1673 2876378974
1674 2876395326
1675 2876415637
1676 2878041745
1677 2878747636
1678 2878758012
1679 2878764473
1680 2878771574
1681 2881152483
1682 2881155901
1683 2881161858
1684 2881847209
1685 2881859417
1686 2881863123
1687 2882917378
1688 2885310745
1689 2885317513
1690 2885321722
1691 2885330685
1692 2885336264
1693 2885349269
1694 2885352164
1695 2888347991
1696 2888356957
1697 2889012001
1698 2889023064
1699 2891050775
1700 2896386843
1701 2899369115
1702 2899376927
1703 2899796755
1704 2899807841
1705 2899850288
1706 2903501601
1707 2903502090
1708 2903545197
1709 2904661956
1710 2906310028
1711 2906322901
1712 2906360143
1713 2906376014
1714 2906416573
1715 2913301824
1716 2913310748
1717 2915651740
1718 2915772998
1719 2915985716
1720 2915991753
1721 2915995158
1722 2916008706
1723 2916018005
1724 2916022091
1725 2916031822
1726 2916038632
1727 2916046656
1728 2916052690
1729 2916055114
1730 2916065842
1731 2916073885
1732 2916080235
1733 2917744062
1734 2919104293
1735 2919115470
1736 2919167543
1737 2919409527
1738 2920765429
1739 2920824060
1740 2921202742
1741 2921210811
1742 2921242509
1743 2921249309
1744 2921251612
1745 2921260806
1746 2921263990
1747 2921282844
1748 2921294631
1749 2921297129
1750 2922190569
1751 2923560692
1752 2924147345
1753 2924155024
1754 2924164999
1755 2924168015
1756 2924177098
1757 2924184762
1758 2924188868
1759 2924197333
1760 2924204213
1761 2924212484
1762 2924218813
1763 2924225958
1764 2924233921
1765 2924712402
1766 2924760080
1767 2924784724
1768 2926756520
1769 2926760762
1770 2929139733
1771 2933008087
1772 2933012868
1773 2933020460
1774 2933576823
1775 2933587024
1776 2933595358
1777 2933602075
1778 2935900559
1779 2935904931
1780 2936373267
1781 2936381365
1782 2936384633
1783 2937000854
1784 2937006459
1785 2937013089
1786 2937019549
1787 2937028646
1788 2937030359
1789 2937040742
1790 2937044114
1791 2937052981
1792 2937059313
1793 2937068629
1794 2937071710
1795 2937079393
1796 2937091798
1797 2937096153
1798 2937103819
1799 2937110964
1800 2937114111
1801 2937125611
1802 2937126612
1803 2937813327
1804 2937839919
1805 2937845667
1806 2937999045
1807 2938018870
1808 2941499992
1809 2957377180
1810 2957382895
1811 2957388885
1812 2957396515
1813 2957407682
1814 2957409562
1815 2957419739
1816 2957426507
1817 2957431828
1818 2957437851
1819 2957446709
1820 2957453248
1821 2957458885
1822 2957470971
1823 2957475185
1824 2957479773
1825 2957489900
1826 2957497682
1827 2957498897
1828 2957509105
1829 2958043947
1830 2958074368
1831 2958106062
1832 2958131891
1833 2958169519
1834 2958176195
1835 2958181694
1836 2960586898
1837 2960593475
1838 2960598822
1839 2960608706
1840 2960615710
1841 2960617947
1842 2960628146
1843 2960633867
1844 2960642260
1845 2960651584
1846 2960655100
1847 2960662788
1848 2960671257
1849 2960677165
1850 2960685062
1851 2960691533
1852 2960698694
1853 2961079537
1854 2961117110
1855 2961167979
1856 2961174585
1857 2964613697
1858 2964618788
1859 2964627007
1860 2964632778
1861 2964639374
1862 2964648815
1863 2964652796
1864 2964657870
1865 2964667905
1866 2964673428
1867 2964680996
1868 2964687020
1869 2964697750
1870 2964700656
1871 2964708738
1872 2964714536
1873 2964723812
1874 2965022798
1875 2965124814
1876 2967670400
1877 2967678648
1878 2967680567
1879 2967688587
1880 2967693491
1881 2967700206
1882 2967711945
1883 2967717939
1884 2967726222
1885 2967729700
1886 2967738911
1887 2967745924
1888 2967754357
1889 2967761605
1890 2967766295
1891 2967772331
1892 2967777732
1893 2968000577
1894 2968010051
1895 2968113018
1896 2968176379
1897 2970022699
1898 2970027896
1899 2970036737
1900 2970043487
1901 2970052097
1902 2970058068
1903 2970061934
1904 2970072145
1905 2970079634
1906 2970086705
1907 2970089752
1908 2970098650
1909 2970105800
1910 2970111947
1911 2970118501
1912 2970123218
1913 2970129763
1914 2970141614
1915 2970149762
1916 2970154192
1917 2970160622
1918 2970167814
1919 2970172949
1920 2970178717
1921 2970190291
1922 2970194130
1923 2970490990
1924 2970507172
1925 2970531885
1926 2970546446
1927 2970559318
1928 2977520552
1929 2977527311
1930 2977532297
1931 2977538236
1932 2977550250
1933 2977557550
1934 2977561116
1935 2977567317
1936 2977576681
1937 2977584303
1938 2977828914
1939 2977833720
1940 2977846943
1941 2977866669
1942 2977906013
1943 2977949024
1944 2977980024
1945 2979093960
1946 2979098657
1947 2979105991
1948 2979711667
1949 2979751473
1950 2979812367
1951 2984512222
1952 2984521416
1953 2984540712
1954 2984589319
1955 2984602976
1956 2987640655
1957 2987653593
1958 2987663993
1959 2989778410
1960 2995395080
1961 2996310910
1962 2996340638
1963 2996892203
1964 3003932909
1965 3004193048
1966 3004208853
1967 3005412662
1968 3005417771
1969 3005447147
1970 3005453764
1971 643825316
1972 648736610
1973 650739764
1974 8002285564
1975 8003570820
1976 8003993192
1977 8004000449
1978 8004379524
1979 8004390227
1980 8004395574
1981 8004635532
1982 8004643039
1983 8004695233
1984 8004716290
1985 8005251070
1986 8005259549
1987 8005280122
1988 8005288191
1989 8005294705
1990 8005307123
1991 8005314650
1992 8005316518
1993 8005326730
1994 8005378700
1995 8005384955
1996 8005397119
1997 8005436189
1998 8005462429
1999 8005485410
2000 8005544628
2001 8005558207
2002 8005569387
2003 8005575347
2004 8005621130
2005 8005631519
2006 8005650064
2007 8005659772
2008 8005686615
2009 8005695031
2010 8005696255
2011 8018128158
2012 8018168005
2013 8023680881
2014 8024485652
2015 8024489539
2016 8024505122
2017 8046769289
2018 8049294239
2019 8055432867
2020 8055622100
2021 8056380066
2022 8056387647
2023 8057577078
2024 8057875588

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

103

453

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h14-assembly1.cif.gz_A crystal structure of a putative aminotransferase from silicibacter pomeroyi 0.964 1 369
5yhv-assembly1.cif.gz_B crystal structure of an aminotransferase from mycobacterium tuberculosis 0.9607 1 369
5yhv-assembly1.cif.gz_D crystal structure of an aminotransferase from mycobacterium tuberculosis 0.9574 1 361
5yhv-assembly1.cif.gz_B crystal structure of an aminotransferase from mycobacterium tuberculosis 0.9556 1 369
2z61-assembly1.cif.gz_A-2 crystal structure of mj0684 from methanococcus jannaschii reveals its similarity in the active site to kynurenine aminotransferases 0.9402 1 370
ID Description Score Start End Superfamily
3h14A00 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9589 2 368 3.40.640.10
af_P96847_4_388_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9552 1 369 3.40.640.10
af_P96847_4_388_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9501 1 369 3.40.640.10
2z61A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9393 267 365 3.90.1150.10
af_Q58097_268_366_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9359 268 365 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A7X6FDL4-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9948 1 370 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A0F4FUP0-F1-model_v4 deleted 0.9926 14 370
AF-A0A7X6FDL4-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9921 1 370 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A537T6U4-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.9776 1 275 GO:0006520
GO:0008483
GO:0009058
GO:0030170
AF-A0A537NJD5-F1-model_v4 aspartate transaminase (EC 2.6.1.1) 0.977 1 370 GO:0006520
GO:0008483
GO:0009058
GO:0030170

Map