F488185

General Info

Members Datasets Scaffolds Average Seq Length
1012 456 2024 324

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237087|2513588979
Length 320
Sequence HSVVRGVGSYLPQKVLTNADLAHMVDTSDEWIVQRTGIRERHIAADGEFTSHLGLKAAQAALVDAGLTAADIDLIILATSTPDQTFPATAVTIQYELGITRGAAFDLQAVCSGFVFALATADAHLRMGSFKRALVIGAETFSRILDWQDRGTCVLFGDGAGAVVLEAVPEAEAQGRGLLTSHLRSDGRHRSKLFVDGGPSSTGTVGHLRMEGREVFKHAVGMITDVITDAFAATGQSADSIDWFVPHQANRRIIDASAQKLGIAPEKVVTTVQAHGNTSAASIPLALDVARRDGRIKDGDLVLLEAMGGGFTWGSALLRW

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
103 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
104 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
123 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
124 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
125 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
144 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
145 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
146 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
147 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
148 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
149 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
150 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
154 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
155 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
156 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
157 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
160 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
161 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
162 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
164 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
239 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
240 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
241 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
242 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
243 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
244 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
245 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
246 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
247 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
248 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
249 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
250 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
253 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
254 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
255 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
256 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
257 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
258 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
259 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
260 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
261 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
262 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
263 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
264 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
266 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
268 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
269 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
270 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
271 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
272 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
273 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
274 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
275 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
276 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
277 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
278 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
279 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
280 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
281 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
283 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
284 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
285 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
286 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
287 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
288 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
289 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
290 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
291 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
292 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
293 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
294 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
295 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
296 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
301 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
302 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
305 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
306 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
307 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
308 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
311 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
312 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
313 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
314 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
315 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
316 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
317 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
318 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
319 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
320 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
321 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
322 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
323 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
324 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
325 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
326 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
327 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
328 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
329 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
330 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
331 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
332 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
333 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
334 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
335 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
336 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
337 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
338 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
339 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
342 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
343 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
344 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
345 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
346 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
347 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
348 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
349 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
350 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
351 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
352 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
353 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
354 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
355 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
356 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
357 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
358 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
359 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
360 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
361 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
362 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
363 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
369 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
370 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
371 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
372 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
373 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
374 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
375 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
376 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
377 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
378 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
379 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
380 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
381 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
382 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
383 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
384 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
385 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
386 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
387 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
388 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
389 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
400 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
401 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
402 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
403 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
404 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
405 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
406 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
407 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
408 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
409 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
410 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
411 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
412 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
415 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
416 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
417 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
418 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
419 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
420 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
421 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
422 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
423 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
424 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
425 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
426 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
427 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
428 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
429 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
430 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
431 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
432 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
433 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
434 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
435 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
436 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
437 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
438 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
439 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
440 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
441 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
442 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
443 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
444 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
445 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
446 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
447 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
448 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
449 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
450 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
451 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
452 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
453 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
454 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
455 2909042592 Labrys sp. LIt4 Isolate Nodule
456 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.55
Nodule 0.2
Rhizoplane 11.17
Rhizosphere 82.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214772991 2209111006 Bacteria 11804
2 ARcpr5oldR_c000005 3300000041 Bacteria 43151
3 ARSoilYngRDRAFT_c00062 3300000042 Bacteria 17580
4 ARcpr5yngRDRAFT_c000132 3300000043 Bacteria 11738
5 ARSoilOldRDRAFT_c000012 3300000044 Bacteria 42830
6 ARCol0oldRDRAFT_c00643 3300000045 Bacteria 3066
7 ARCol0yngRDRAFT_1000796 3300000652 Bacteria 2947
8 JGI24032J14994_100303 3300001430 Bacteria 2617
9 JGI24746J21847_1001998 3300001977 Bacteria 3251
10 JGI24747J21853_1001524 3300001978 Bacteria 1751
11 JGI24739J22299_10002632 3300001989 Bacteria 6914
12 JGI24737J22298_10003528 3300001990 Bacteria 5511
13 JGI24737J22298_10021312 3300001990 Bacteria 2066
14 JGI24737J22298_10031640 3300001990 Bacteria 1651
15 JGI24750J21931_1001120 3300002070 Bacteria 3451
16 JGI24738J21930_10000471 3300002075 Bacteria 11404
17 JGI24738J21930_10005129 3300002075 Bacteria 3165
18 JGI24749J21850_1000776 3300002076 Bacteria 4600
19 JGI24744J21845_10001246 3300002077 Bacteria 5007
20 JGI24744J21845_10004033 3300002077 Bacteria 3031
21 JGI24035J26624_1000132 3300002126 Bacteria 6606
22 JGI24034J26672_10005421 3300002239 Bacteria 1829
23 JGI24742J22300_10000997 3300002244 Bacteria 4353
24 JGI24742J22300_10008454 3300002244 Bacteria 1698
25 JGI24751J29686_10009497 3300002459 Bacteria 2001
26 JGI25406J46586_10018079 3300003203 Bacteria 2901
27 JGI26145J50221_1004021 3300003371 Bacteria 1184
28 JGI25405J52794_10008617 3300003911 Bacteria 1909
29 Ga0065704_10081191 3300005289 Bacteria 3805
30 Ga0065712_10002169 3300005290 Bacteria 5824
31 Ga0065712_10073252 3300005290 Bacteria 4450
32 Ga0065712_10099736 3300005290 Bacteria 2082
33 Ga0065715_10001386 3300005293 Bacteria 6343
34 Ga0065715_10009694 3300005293 Bacteria 4472
35 Ga0065707_10096006 3300005295 Bacteria 3314
36 Ga0070658_10013815 3300005327 Bacteria 6478
37 Ga0070676_10001202 3300005328 Bacteria 12981
38 Ga0070676_10183306 3300005328 Bacteria 1363
39 Ga0070683_100000121 3300005329 Bacteria 50845
40 Ga0070683_100131943 3300005329 Bacteria 2364
41 Ga0070683_100284959 3300005329 Bacteria 1572
42 Ga0070690_100002752 3300005330 Bacteria 9491
43 Ga0070690_100006624 3300005330 Bacteria 6579
44 Ga0070670_100005999 3300005331 Bacteria 10273
45 Ga0070670_100025980 3300005331 Bacteria 5039
46 Ga0070670_100179980 3300005331 Bacteria 1835
47 Ga0070677_10000055 3300005333 Bacteria 35005
48 Ga0068869_100000507 3300005334 Bacteria 21693
49 Ga0068869_100019313 3300005334 Bacteria 4654
50 Ga0070666_10012614 3300005335 Bacteria 5338
51 Ga0070680_100005908 3300005336 Bacteria 9298
52 Ga0070680_100011815 3300005336 Bacteria 6773
53 Ga0070680_100016969 3300005336 Bacteria 5733
54 Ga0070680_100017302 3300005336 Bacteria 5681
55 Ga0070680_100030986 3300005336 Bacteria 4297
56 Ga0070680_100117489 3300005336 Bacteria 2217
57 Ga0070682_100000697 3300005337 Bacteria 20192
58 Ga0070682_100273732 3300005337 Bacteria 1228
59 Ga0068868_100002501 3300005338 Bacteria 12763
60 Ga0068868_100035322 3300005338 Bacteria 3863
61 Ga0068868_100077704 3300005338 Bacteria 2656
62 Ga0070660_100010372 3300005339 Bacteria 6584
63 Ga0070660_100028614 3300005339 Bacteria 4171
64 Ga0070660_100314752 3300005339 Bacteria 1285
65 Ga0070689_100012275 3300005340 Bacteria 6165
66 Ga0070689_100048589 3300005340 Bacteria 3272
67 Ga0070691_10000371 3300005341 Bacteria 16253
68 Ga0070691_10028064 3300005341 Bacteria 2628
69 Ga0070691_10165461 3300005341 Bacteria 1143
70 Ga0070687_100001534 3300005343 Bacteria 8181
71 Ga0070687_100002788 3300005343 Bacteria 6647
72 Ga0070661_100000881 3300005344 Bacteria 21577
73 Ga0070661_100167073 3300005344 Bacteria 1669
74 Ga0070692_10000573 3300005345 Bacteria 11543
75 Ga0070692_10153207 3300005345 Bacteria 1315
76 Ga0070668_100004237 3300005347 Bacteria 10641
77 Ga0070669_100019063 3300005353 Bacteria 4904
78 Ga0070675_100000698 3300005354 Bacteria 23271
79 Ga0070671_100000344 3300005355 Bacteria 31796
80 Ga0070671_100029375 3300005355 Bacteria 4532
81 Ga0070674_100000116 3300005356 Bacteria 37121
82 Ga0070674_100015198 3300005356 Bacteria 4802
83 Ga0070674_100274556 3300005356 Bacteria 1334
84 Ga0070673_100000335 3300005364 Bacteria 24640
85 Ga0070688_100000565 3300005365 Bacteria 18794
86 Ga0070688_100008099 3300005365 Bacteria 5694
87 Ga0070688_100090102 3300005365 Bacteria 2002
88 Ga0070659_100011128 3300005366 Bacteria 6647
89 Ga0070659_100018339 3300005366 Bacteria 5282
90 Ga0070659_100027308 3300005366 Bacteria 4397
91 Ga0070667_100007699 3300005367 Bacteria 8931
92 Ga0070667_100013516 3300005367 Bacteria 6746
93 Ga0070703_10001252 3300005406 Bacteria 7724
94 Ga0070709_10169730 3300005434 Bacteria 1524
95 Ga0070714_100020545 3300005435 Bacteria 5395
96 Ga0070714_100045875 3300005435 Bacteria 3705
97 Ga0070713_100002431 3300005436 Bacteria 12142
98 Ga0070713_100010201 3300005436 Bacteria 6778
99 Ga0070710_10009728 3300005437 Bacteria 4709
100 Ga0070710_10033533 3300005437 Bacteria 2788
101 Ga0070701_10002810 3300005438 Bacteria 6773
102 Ga0070711_100079500 3300005439 Bacteria 2332
103 Ga0070700_100003137 3300005441 Bacteria 8491
104 Ga0070700_100005744 3300005441 Bacteria 6584
105 Ga0070694_100016106 3300005444 Bacteria 4705
106 Ga0070708_100011088 3300005445 Bacteria 7325
107 Ga0070708_100065932 3300005445 Bacteria 3248
108 Ga0070663_100001736 3300005455 Bacteria 12106
109 Ga0070678_100000684 3300005456 Bacteria 16710
110 Ga0070678_100114286 3300005456 Bacteria 2117
111 Ga0070662_100009413 3300005457 Bacteria 6385
112 Ga0070662_100018312 3300005457 Bacteria 4736
113 Ga0070681_10006902 3300005458 Bacteria 11053
114 Ga0070681_10035745 3300005458 Bacteria 4990
115 Ga0070681_10048173 3300005458 Bacteria 4259
116 Ga0070681_10084994 3300005458 Bacteria 3117
117 Ga0070681_10171796 3300005458 Bacteria 2089
118 Ga0070681_10328290 3300005458 Bacteria 1439
119 Ga0068867_100004625 3300005459 Bacteria 9680
120 Ga0068867_100009831 3300005459 Bacteria 6741
121 Ga0070685_10005786 3300005466 Bacteria 6283
122 Ga0070699_100019789 3300005518 Bacteria 5802
123 Ga0070699_100231316 3300005518 Bacteria 1648
124 Ga0070679_100001791 3300005530 Bacteria 19375
125 Ga0070679_100008142 3300005530 Bacteria 9848
126 Ga0070679_100016614 3300005530 Bacteria 7107
127 Ga0070679_100136896 3300005530 Bacteria 2430
128 Ga0070679_100146739 3300005530 Bacteria 2336
129 Ga0070679_100178887 3300005530 Bacteria 2094
130 Ga0070684_100001949 3300005535 Bacteria 15134
131 Ga0070684_100019580 3300005535 Bacteria 5600
132 Ga0070684_100049176 3300005535 Bacteria 3659
133 Ga0070684_100159405 3300005535 Bacteria 2046
134 Ga0070684_100202680 3300005535 Bacteria 1807
135 Ga0068853_100052344 3300005539 Bacteria 3517
136 Ga0070672_100000741 3300005543 Bacteria 19384
137 Ga0070672_100108447 3300005543 Bacteria 2260
138 Ga0070686_100015489 3300005544 Bacteria 4419
139 Ga0070686_100089857 3300005544 Bacteria 2052
140 Ga0070695_100017329 3300005545 Bacteria 4367
141 Ga0070695_100078555 3300005545 Bacteria 2176
142 Ga0070696_100007917 3300005546 Bacteria 7095
143 Ga0070696_100153046 3300005546 Bacteria 1694
144 Ga0070693_100001254 3300005547 Bacteria 11478
145 Ga0070665_100167151 3300005548 Bacteria 2202
146 Ga0070704_100016209 3300005549 Bacteria 4705
147 Ga0070704_100133876 3300005549 Bacteria 1925
148 Ga0068855_100037835 3300005563 Bacteria 5734
149 Ga0068855_100132920 3300005563 Bacteria 2840
150 Ga0068855_100285980 3300005563 Bacteria 1829
151 Ga0068855_100291685 3300005563 Bacteria 1808
152 Ga0070664_100015589 3300005564 Bacteria 6218
153 Ga0070664_100049402 3300005564 Bacteria 3557
154 Ga0070664_100143819 3300005564 Bacteria 2102
155 Ga0068857_100000680 3300005577 Bacteria 25262
156 Ga0068857_100084599 3300005577 Bacteria 2835
157 Ga0068854_100000760 3300005578 Bacteria 19146
158 Ga0068854_100043012 3300005578 Bacteria 3200
159 Ga0068856_100021374 3300005614 Bacteria 6291
160 Ga0068856_100132118 3300005614 Bacteria 2501
161 Ga0068856_100193544 3300005614 Bacteria 2047
162 Ga0068856_100253426 3300005614 Bacteria 1775
163 Ga0070702_100000099 3300005615 Bacteria 25765
164 Ga0070702_100017518 3300005615 Bacteria 3696
165 Ga0068852_100006331 3300005616 Bacteria 8540
166 Ga0068852_100008756 3300005616 Bacteria 7484
167 Ga0068852_100227776 3300005616 Bacteria 1776
168 Ga0068864_100007872 3300005618 Bacteria 8782
169 Ga0068864_100016990 3300005618 Bacteria 6063
170 Ga0068866_10001741 3300005718 Bacteria 9153
171 Ga0068861_100000354 3300005719 Bacteria 26182
172 Ga0068851_10041813 3300005834 Bacteria 2306
173 Ga0068870_10000395 3300005840 Bacteria 16399
174 Ga0068870_10001588 3300005840 Bacteria 9245
175 Ga0068863_100013197 3300005841 Bacteria 7969
176 Ga0068863_100022985 3300005841 Bacteria 5959
177 Ga0068863_100096898 3300005841 Bacteria 2800
178 Ga0068858_100017831 3300005842 Bacteria 6647
179 Ga0068858_100471127 3300005842 Bacteria 1211
180 Ga0068860_100007901 3300005843 Bacteria 10619
181 Ga0068860_100076788 3300005843 Bacteria 3176
182 Ga0068862_100013455 3300005844 Bacteria 6773
183 Ga0068862_100121952 3300005844 Bacteria 2298
184 Ga0081455_10001802 3300005937 Bacteria 25849
185 Ga0081455_10003948 3300005937 Bacteria 16849
186 Ga0081455_10030623 3300005937 Bacteria 4885
187 Ga0081455_10084380 3300005937 Bacteria 2593
188 Ga0081455_10109865 3300005937 Bacteria 2194
189 Ga0081538_10095390 3300005981 Bacteria 1520
190 Ga0081540_1002931 3300005983 Bacteria 13732
191 Ga0081540_1048597 3300005983 Bacteria 2123
192 Ga0081539_10001708 3300005985 Bacteria 35326
193 Ga0081539_10012080 3300005985 Bacteria 6711
194 Ga0070717_10255293 3300006028 Bacteria 1550
195 Ga0075365_10011867 3300006038 Bacteria 5144
196 Ga0075368_10038471 3300006042 Bacteria 1873
197 Ga0075368_10039207 3300006042 Bacteria 1856
198 Ga0075363_100154783 3300006048 Bacteria 1295
199 Ga0075364_10016148 3300006051 Bacteria 4642
200 Ga0075364_10034753 3300006051 Bacteria 3255
201 Ga0075364_10173808 3300006051 Bacteria 1456
202 Ga0075432_10002763 3300006058 Bacteria 5880
203 Ga0070715_10001764 3300006163 Bacteria 6436
204 Ga0070712_100000678 3300006175 Bacteria 20131
205 Ga0070712_100005205 3300006175 Bacteria 8045
206 Ga0070712_100049283 3300006175 Bacteria 2924
207 Ga0070712_100115745 3300006175 Bacteria 2010
208 Ga0070712_100154789 3300006175 Bacteria 1764
209 Ga0075362_10070817 3300006177 Bacteria 1592
210 Ga0075367_10006100 3300006178 Bacteria 6058
211 Ga0075367_10065074 3300006178 Bacteria 2182
212 Ga0075369_10003043 3300006186 Bacteria 6066
213 Ga0075369_10003164 3300006186 Bacteria 5969
214 Ga0075369_10033244 3300006186 Bacteria 2185
215 Ga0075427_10000518 3300006194 Bacteria 4424
216 Ga0097621_100000430 3300006237 Bacteria 29289
217 Ga0097621_100028001 3300006237 Bacteria 4436
218 Ga0097621_100112102 3300006237 Bacteria 2305
219 Ga0075370_10078231 3300006353 Bacteria 1899
220 Ga0068871_100000243 3300006358 Bacteria 37961
221 Ga0068871_100052395 3300006358 Bacteria 3305
222 Ga0075428_100074221 3300006844 Bacteria 3715
223 Ga0075428_100217373 3300006844 Bacteria 2064
224 Ga0075430_100008258 3300006846 Bacteria 8792
225 Ga0075430_100138898 3300006846 Bacteria 2024
226 Ga0075431_100013105 3300006847 Bacteria 8377
227 Ga0075433_10000023 3300006852 Bacteria 59195
228 Ga0075433_10027633 3300006852 Bacteria 4814
229 Ga0075433_10057801 3300006852 Bacteria 3391
230 Ga0075434_100011469 3300006871 Bacteria 8363
231 Ga0075434_100088050 3300006871 Bacteria 3106
232 Ga0075434_100190266 3300006871 Bacteria 2072
233 Ga0075429_100000227 3300006880 Bacteria 38168
234 Ga0075429_100017930 3300006880 Bacteria 6121
235 Ga0075429_100207939 3300006880 Bacteria 1715
236 Ga0068865_100000675 3300006881 Bacteria 19258
237 Ga0068865_100134708 3300006881 Bacteria 1855
238 Ga0075436_100060467 3300006914 Bacteria 2617
239 Ga0075435_100010404 3300007076 Bacteria 6805
240 Ga0105251_10038039 3300009011 Bacteria 2358
241 Ga0105244_10030760 3300009036 Bacteria 2854
242 Ga0105240_10034321 3300009093 Bacteria 6545
243 Ga0111539_10000561 3300009094 Bacteria 47610
244 Ga0111539_10004002 3300009094 Bacteria 19352
245 Ga0111539_10004660 3300009094 Bacteria 17922
246 Ga0111539_10012526 3300009094 Bacteria 10628
247 Ga0111539_10303003 3300009094 Bacteria 1860
248 Ga0105245_10000943 3300009098 Bacteria 26432
249 Ga0105245_10019420 3300009098 Bacteria 5953
250 Ga0105247_10008605 3300009101 Bacteria 6221
251 Ga0105247_10010184 3300009101 Bacteria 5693
252 Ga0105247_10014588 3300009101 Bacteria 4713
253 Ga0105247_10075754 3300009101 Bacteria 2112
254 Ga0114129_10003375 3300009147 Bacteria 22429
255 Ga0114129_10067744 3300009147 Bacteria 4977
256 Ga0114129_10136853 3300009147 Bacteria 3360
257 Ga0114129_10161019 3300009147 Bacteria 3065
258 Ga0114129_10165742 3300009147 Bacteria 3016
259 Ga0114129_10457612 3300009147 Bacteria 1673
260 Ga0105243_10002854 3300009148 Bacteria 14321
261 Ga0105243_10008993 3300009148 Bacteria 7635
262 Ga0105243_10011868 3300009148 Bacteria 6589
263 Ga0105243_10234057 3300009148 Bacteria 1631
264 Ga0105241_10001331 3300009174 Bacteria 18766
265 Ga0105241_10123091 3300009174 Bacteria 2091
266 Ga0105242_10000036 3300009176 Bacteria 91470
267 Ga0105242_10102489 3300009176 Bacteria 2427
268 Ga0105242_10144878 3300009176 Bacteria 2065
269 Ga0105248_10058205 3300009177 Bacteria 4339
270 Ga0105248_10176664 3300009177 Bacteria 2406
271 Ga0105248_10346351 3300009177 Bacteria 1673
272 Ga0105237_10030440 3300009545 Bacteria 5482
273 Ga0105237_10093691 3300009545 Bacteria 2993
274 Ga0105238_10118261 3300009551 Bacteria 2630
275 Ga0105238_10136258 3300009551 Bacteria 2433
276 Ga0105238_10244135 3300009551 Bacteria 1774
277 Ga0105238_10260465 3300009551 Bacteria 1714
278 Ga0105238_10333042 3300009551 Bacteria 1505
279 Ga0105249_10018622 3300009553 Bacteria 6183
280 Ga0105249_10224425 3300009553 Bacteria 1850
281 Ga0105249_10578243 3300009553 Bacteria 1176
282 Ga0105239_10024026 3300010375 Bacteria 6713
283 Ga0105239_10236007 3300010375 Bacteria 2052
284 Ga0105239_10292968 3300010375 Bacteria 1832
285 Ga0105239_10371948 3300010375 Bacteria 1615
286 Ga0105246_10146328 3300011119 Bacteria 1783
287 Ga0157342_1001381 3300012507 Bacteria 1781
288 Ga0157342_1003146 3300012507 Bacteria 1397
289 Ga0157373_10004533 3300013100 Bacteria 10449
290 Ga0157373_10248740 3300013100 Bacteria 1257
291 Ga0157371_10033655 3300013102 Bacteria 3681
292 Ga0157370_10009857 3300013104 Bacteria 10125
293 Ga0157369_10120649 3300013105 Bacteria 2782
294 Ga0157369_10548126 3300013105 Bacteria 1195
295 Ga0157374_10012850 3300013296 Bacteria 7292
296 Ga0157374_10018742 3300013296 Bacteria 6114
297 Ga0157374_10162136 3300013296 Bacteria 2178
298 Ga0157378_10000462 3300013297 Bacteria 38648
299 Ga0157378_10140239 3300013297 Bacteria 2244
300 Ga0157378_10180837 3300013297 Bacteria 1984
301 Ga0163162_10002063 3300013306 Bacteria 18880
302 Ga0163162_10015790 3300013306 Bacteria 7380
303 Ga0163162_10470279 3300013306 Bacteria 1389
304 Ga0157372_10021178 3300013307 Bacteria 7024
305 Ga0157372_10139453 3300013307 Bacteria 2792
306 Ga0157372_10144115 3300013307 Bacteria 2747
307 Ga0157375_10017542 3300013308 Bacteria 6464
308 Ga0163163_10020553 3300014325 Bacteria 6220
309 Ga0163163_10030054 3300014325 Bacteria 5230
310 Ga0157380_10000274 3300014326 Bacteria 30965
311 Ga0182008_10120456 3300014497 Bacteria 1304
312 Ga0157377_10000470 3300014745 Bacteria 17366
313 Ga0157379_10007174 3300014968 Bacteria 9642
314 Ga0157379_10155045 3300014968 Bacteria 2066
315 Ga0157379_10214428 3300014968 Bacteria 1743
316 Ga0157376_10000508 3300014969 Bacteria 25164
317 Ga0182007_10038335 3300015262 Bacteria 1607
318 Ga0163161_10001021 3300017792 Bacteria 21333
319 Ga0213872_10036843 3300021361 Bacteria 2234
320 Ga0213872_10044315 3300021361 Bacteria 2025
321 Ga0213874_10019175 3300021377 Bacteria 1859
322 Ga0209233_1001929 3300025261 Bacteria 7926
323 Ga0207666_1000356 3300025271 Bacteria 6282
324 Ga0207673_1000077 3300025290 Bacteria 8568
325 Ga0207697_10004946 3300025315 Bacteria 6282
326 Ga0207697_10088865 3300025315 Bacteria 1308
327 Ga0207656_10017829 3300025321 Bacteria 2787
328 Ga0207653_10012306 3300025885 Bacteria 2671
329 Ga0207682_10000135 3300025893 Bacteria 33308
330 Ga0207642_10000073 3300025899 Bacteria 27837
331 Ga0207710_10074385 3300025900 Bacteria 1564
332 Ga0207688_10002338 3300025901 Bacteria 10187
333 Ga0207688_10006665 3300025901 Bacteria 6282
334 Ga0207680_10007561 3300025903 Bacteria 5305
335 Ga0207647_10012910 3300025904 Bacteria 5804
336 Ga0207647_10024800 3300025904 Bacteria 3951
337 Ga0207647_10155504 3300025904 Bacteria 1335
338 Ga0207685_10034337 3300025905 Bacteria 1842
339 Ga0207699_10006915 3300025906 Bacteria 5520
340 Ga0207699_10079107 3300025906 Bacteria 2033
341 Ga0207645_10000457 3300025907 Bacteria 33747
342 Ga0207643_10000853 3300025908 Bacteria 18464
343 Ga0207643_10006512 3300025908 Bacteria 6255
344 Ga0207705_10104455 3300025909 Bacteria 2087
345 Ga0207684_10061490 3300025910 Bacteria 3189
346 Ga0207654_10000638 3300025911 Bacteria 19789
347 Ga0207707_10016702 3300025912 Bacteria 6398
348 Ga0207707_10017958 3300025912 Bacteria 6167
349 Ga0207707_10043824 3300025912 Bacteria 3901
350 Ga0207707_10089331 3300025912 Bacteria 2692
351 Ga0207671_10278740 3300025914 Bacteria 1318
352 Ga0207693_10014951 3300025915 Bacteria 6233
353 Ga0207693_10016289 3300025915 Bacteria 5944
354 Ga0207693_10053723 3300025915 Bacteria 3161
355 Ga0207693_10060824 3300025915 Bacteria 2958
356 Ga0207693_10103895 3300025915 Bacteria 2228
357 Ga0207693_10130652 3300025915 Bacteria 1974
358 Ga0207663_10238495 3300025916 Bacteria 1332
359 Ga0207660_10001020 3300025917 Bacteria 18545
360 Ga0207660_10031240 3300025917 Bacteria 3665
361 Ga0207660_10086873 3300025917 Bacteria 2310
362 Ga0207662_10001714 3300025918 Bacteria 10736
363 Ga0207662_10005471 3300025918 Bacteria 6773
364 Ga0207657_10020840 3300025919 Bacteria 6186
365 Ga0207657_10025718 3300025919 Bacteria 5422
366 Ga0207657_10046593 3300025919 Bacteria 3797
367 Ga0207657_10152850 3300025919 Bacteria 1879
368 Ga0207649_10000760 3300025920 Bacteria 20983
369 Ga0207652_10000764 3300025921 Bacteria 30807
370 Ga0207646_10077702 3300025922 Bacteria 2966
371 Ga0207681_10000065 3300025923 Bacteria 98832
372 Ga0207694_10148672 3300025924 Bacteria 1886
373 Ga0207650_10001773 3300025925 Bacteria 15269
374 Ga0207650_10060316 3300025925 Bacteria 2831
375 Ga0207650_10133917 3300025925 Bacteria 1942
376 Ga0207650_10229691 3300025925 Bacteria 1496
377 Ga0207659_10000142 3300025926 Bacteria 42302
378 Ga0207687_10000125 3300025927 Bacteria 51567
379 Ga0207687_10007547 3300025927 Bacteria 7151
380 Ga0207700_10039274 3300025928 Bacteria 3444
381 Ga0207700_10233078 3300025928 Bacteria 1566
382 Ga0207700_10272524 3300025928 Bacteria 1453
383 Ga0207664_10007299 3300025929 Bacteria 7663
384 Ga0207644_10001470 3300025931 Bacteria 15193
385 Ga0207644_10004403 3300025931 Bacteria 9137
386 Ga0207690_10003823 3300025932 Bacteria 8908
387 Ga0207690_10013751 3300025932 Bacteria 4872
388 Ga0207706_10007990 3300025933 Bacteria 9770
389 Ga0207706_10019275 3300025933 Bacteria 6135
390 Ga0207706_10019316 3300025933 Bacteria 6129
391 Ga0207686_10000344 3300025934 Bacteria 33461
392 Ga0207686_10065309 3300025934 Bacteria 2320
393 Ga0207709_10000183 3300025935 Bacteria 83374
394 Ga0207670_10000288 3300025936 Bacteria 30769
395 Ga0207670_10002143 3300025936 Bacteria 10333
396 Ga0207670_10034555 3300025936 Bacteria 3269
397 Ga0207670_10356562 3300025936 Bacteria 1159
398 Ga0207669_10000081 3300025937 Bacteria 48214
399 Ga0207669_10171644 3300025937 Bacteria 1544
400 Ga0207704_10000121 3300025938 Bacteria 42395
401 Ga0207704_10120340 3300025938 Bacteria 1795
402 Ga0207704_10242918 3300025938 Bacteria 1347
403 Ga0207665_10002359 3300025939 Bacteria 12750
404 Ga0207665_10134599 3300025939 Bacteria 1757
405 Ga0207691_10004599 3300025940 Bacteria 13358
406 Ga0207691_10008864 3300025940 Bacteria 9655
407 Ga0207711_10062918 3300025941 Bacteria 3202
408 Ga0207689_10000696 3300025942 Bacteria 32214
409 Ga0207689_10007426 3300025942 Bacteria 9611
410 Ga0207689_10041147 3300025942 Bacteria 3824
411 Ga0207661_10000286 3300025944 Bacteria 31850
412 Ga0207661_10081972 3300025944 Bacteria 2666
413 Ga0207661_10104153 3300025944 Bacteria 2389
414 Ga0207661_10191694 3300025944 Bacteria 1792
415 Ga0207679_10000064 3300025945 Bacteria 98118
416 Ga0207679_10334608 3300025945 Bacteria 1315
417 Ga0207679_10339599 3300025945 Bacteria 1306
418 Ga0207667_10057387 3300025949 Bacteria 4086
419 Ga0207667_10192677 3300025949 Bacteria 2091
420 Ga0207667_10332016 3300025949 Bacteria 1552
421 Ga0207651_10000395 3300025960 Bacteria 18475
422 Ga0207651_10038681 3300025960 Bacteria 3138
423 Ga0207712_10000752 3300025961 Bacteria 24492
424 Ga0207668_10000715 3300025972 Bacteria 20294
425 Ga0207668_10077636 3300025972 Bacteria 2395
426 Ga0207640_10003491 3300025981 Bacteria 8467
427 Ga0207640_10120683 3300025981 Bacteria 1877
428 Ga0207658_10001038 3300025986 Bacteria 22571
429 Ga0207658_10107419 3300025986 Bacteria 2199
430 Ga0207677_10000985 3300026023 Bacteria 15691
431 Ga0207677_10070724 3300026023 Bacteria 2460
432 Ga0207703_10001400 3300026035 Bacteria 21963
433 Ga0207639_10005141 3300026041 Bacteria 8820
434 Ga0207639_10135522 3300026041 Bacteria 2044
435 Ga0207678_10009603 3300026067 Bacteria 8508
436 Ga0207678_10014572 3300026067 Bacteria 6917
437 Ga0207678_10076643 3300026067 Bacteria 2864
438 Ga0207708_10004954 3300026075 Bacteria 9817
439 Ga0207708_10012692 3300026075 Bacteria 6282
440 Ga0207708_10015109 3300026075 Bacteria 5784
441 Ga0207702_10001395 3300026078 Bacteria 24082
442 Ga0207702_10293109 3300026078 Bacteria 1542
443 Ga0207641_10003265 3300026088 Bacteria 14436
444 Ga0207641_10045617 3300026088 Bacteria 3691
445 Ga0207648_10008132 3300026089 Bacteria 10204
446 Ga0207648_10011624 3300026089 Bacteria 8288
447 Ga0207648_10192382 3300026089 Bacteria 1808
448 Ga0207676_10000079 3300026095 Bacteria 94811
449 Ga0207674_10006886 3300026116 Bacteria 13321
450 Ga0207674_10402282 3300026116 Bacteria 1323
451 Ga0207675_100003662 3300026118 Bacteria 14985
452 Ga0207675_100019734 3300026118 Bacteria 6291
453 Ga0207675_100076823 3300026118 Bacteria 3127
454 Ga0207683_10000037 3300026121 Bacteria 100920
455 Ga0207683_10011735 3300026121 Bacteria 7478
456 Ga0207683_10040380 3300026121 Bacteria 4072
457 Ga0207683_10047045 3300026121 Bacteria 3778
458 Ga0207683_10205675 3300026121 Bacteria 1790
459 Ga0207698_10002333 3300026142 Bacteria 11239
460 Ga0207698_10006345 3300026142 Bacteria 7368
461 Ga0207698_10194099 3300026142 Bacteria 1812
462 Ga0210002_1001169 3300027617 Bacteria 3654
463 Ga0209966_1001440 3300027695 Bacteria 4125
464 Ga0209998_10016721 3300027717 Bacteria 1545
465 Ga0209974_10003753 3300027876 Bacteria 5440
466 Ga0207428_10000292 3300027907 Bacteria 67070
467 Ga0207428_10002255 3300027907 Bacteria 19356
468 Ga0207428_10043033 3300027907 Bacteria 3650
469 Ga0268266_10117991 3300028379 Bacteria 2359
470 Ga0268266_10133590 3300028379 Bacteria 2221
471 Ga0268265_10001133 3300028380 Bacteria 23531
472 Ga0268265_10009438 3300028380 Bacteria 6588
473 Ga0268265_10075768 3300028380 Bacteria 2637
474 Ga0268264_10000805 3300028381 Bacteria 33825
475 Ga0268264_10059829 3300028381 Bacteria 3193
476 Ga0265330_10017320 3300031235 Bacteria 3319
477 Ga0265330_10049817 3300031235 Bacteria 1838
478 Ga0265332_10037858 3300031238 Bacteria 2091
479 Ga0265328_10000155 3300031239 Bacteria 32139
480 Ga0265328_10004630 3300031239 Bacteria 5956
481 Ga0265325_10000006 3300031241 Bacteria 255758
482 Ga0265325_10000743 3300031241 Bacteria 23567
483 Ga0265325_10023635 3300031241 Bacteria 3351
484 Ga0265325_10023675 3300031241 Bacteria 3348
485 Ga0265325_10046577 3300031241 Bacteria 2248
486 Ga0265325_10048882 3300031241 Bacteria 2184
487 Ga0265329_10040204 3300031242 Bacteria 1501
488 Ga0265329_10049964 3300031242 Bacteria 1332
489 Ga0265340_10005222 3300031247 Bacteria 7211
490 Ga0265340_10035015 3300031247 Bacteria 2494
491 Ga0265331_10000005 3300031250 Bacteria 465192
492 Ga0265331_10001410 3300031250 Bacteria 17644
493 Ga0265331_10001741 3300031250 Bacteria 15639
494 Ga0265327_10010541 3300031251 Bacteria 6478
495 Ga0265316_10000387 3300031344 Bacteria 50269
496 Ga0265313_10000553 3300031595 Bacteria 38982
497 Ga0265313_10022732 3300031595 Bacteria 3394
498 Ga0265313_10062417 3300031595 Bacteria 1741
499 Ga0265313_10088789 3300031595 Bacteria 1391
500 Ga0307508_10103695 3300031616 Bacteria 2440
501 Ga0265314_10021841 3300031711 Bacteria 4911
502 Ga0265314_10026031 3300031711 Bacteria 4402
503 Ga0265314_10026645 3300031711 Bacteria 4339
504 Ga0265314_10201691 3300031711 Bacteria 1175
505 Ga0265342_10000011 3300031712 Bacteria 208435
506 Ga0265342_10004370 3300031712 Bacteria 11169
507 Ga0265342_10023672 3300031712 Bacteria 3883
508 Ga0307510_10129905 3300033180 Bacteria 2196
509 Ga0373930_0004021 3300034816 Bacteria 2369
510 Ga0373950_0008814 3300034818 Bacteria 1596
511 Ga0373958_0001465 3300034819 Bacteria 3176
512 Ga0373958_0015703 3300034819 Bacteria 1341
513 Ga0373938_0000063 3300034957 Bacteria 13779
514 Ga0373938_0019066 3300034957 Bacteria 1368
515 Ga0373926_0005620 3300035083 Bacteria 4136
516 Ga0373926_0018917 3300035083 Bacteria 2373
517 Ga0373926_0023654 3300035083 Bacteria 2135
518 Ga0373928_0001474 3300035084 Bacteria 4578
519 Ga0373929_0001110 3300035085 Bacteria 5223
520 Ga0373940_0000418 3300035088 Bacteria 6472
521 Ga0373940_0049936 3300035088 Bacteria 1172
522 Ga0373944_0005850 3300035089 Bacteria 3254
523 Ga0373949_0000779 3300035090 Bacteria 10258
524 Ga0373949_0002326 3300035090 Bacteria 4938
525 Ga0373951_0001074 3300035091 Bacteria 7317
526 Ga0373952_0001672 3300035092 Bacteria 4033
527 Ga0373952_0004710 3300035092 Bacteria 2480
528 Ga0373923_0016457 3300035111 Bacteria 2810
529 Ga0373923_0023882 3300035111 Bacteria 2409
530 Ga0373923_0055561 3300035111 Bacteria 1669
531 Ga0373932_0000516 3300035112 Bacteria 11899
532 Ga0373932_0002506 3300035112 Bacteria 4619
533 Ga0373932_0002800 3300035112 Bacteria 4321
534 Ga0373936_0111308 3300035113 Bacteria 1163
535 Ga0373939_0001269 3300035114 Bacteria 6162
536 Ga0373939_0002352 3300035114 Bacteria 4472
537 Ga0373939_0003293 3300035114 Bacteria 3791
538 Ga0373941_0001012 3300035115 Bacteria 5840
539 Ga0373941_0002320 3300035115 Bacteria 4170
540 Ga0373953_0000171 3300035117 Bacteria 17129
541 Ga0373953_0004537 3300035117 Bacteria 4433
542 Ga0373953_0033793 3300035117 Bacteria 2002
543 Ga0373954_0001704 3300035118 Bacteria 9020
544 Ga0373954_0039628 3300035118 Bacteria 2193
545 Ga0373956_0007874 3300035119 Bacteria 4299
546 Ga0373956_0050932 3300035119 Bacteria 1860
547 Ga0373957_0000100 3300035120 Bacteria 20828
548 Ga0373960_0002055 3300035121 Bacteria 4527
549 Ga0373960_0002580 3300035121 Bacteria 4090
550 Ga0373943_0173049 3300035170 Bacteria 1182
551 Ga0373946_0011600 3300035171 Bacteria 3291
552 Ga0373946_0012514 3300035171 Bacteria 3177
553 Ga0373955_0005067 3300035172 Bacteria 5891
554 Ga0373955_0024025 3300035172 Bacteria 3112
555 Ga0373942_0000898 3300035207 Bacteria 8141
556 Ga0373942_0007710 3300035207 Bacteria 2503
557 Ga0373962_0006516 3300035242 Bacteria 2829
558 Ga0373924_0024194 3300035410 Bacteria 2391
559 Ga0373924_0037768 3300035410 Bacteria 1968
560 Ga0373931_0002005 3300035691 Bacteria 8964
561 Ga0373931_0015704 3300035691 Bacteria 3716
562 Ga0373931_0129586 3300035691 Bacteria 1450
563 Ga0373935_0021083 3300035692 Bacteria 3988
564 Ga0373935_0043578 3300035692 Bacteria 2824
565 Ga0373927_0023381 3300035695 Bacteria 4047
566 Ga0373927_0030690 3300035695 Bacteria 3506
567 Ga0373927_0073054 3300035695 Bacteria 2221
568 Ga0373927_0074566 3300035695 Bacteria 2197
569 Ga0373927_0101689 3300035695 Bacteria 1869
570 Ga0373927_0127892 3300035695 Bacteria 1659
571 Ga0373933_0002823 3300035724 Bacteria 9705
572 Ga0373947_0000637 3300035725 Bacteria 20738
573 Ga0373947_0061380 3300035725 Bacteria 2284
574 Ga0373937_0000915 3300036401 Bacteria 25081
575 Ga0373937_0007517 3300036401 Bacteria 9432
576 Ga0373937_0049609 3300036401 Bacteria 3843
577 Ga0373937_0127276 3300036401 Bacteria 2377
578 Ga0373925_0038714 3300037068 Bacteria 3526
579 Ga0395899_0007257 3300037312 Bacteria 8576
580 Ga0395899_0181312 3300037312 Bacteria 1478
581 Ga0395900_0005384 3300037418 Bacteria 13408
582 Ga0395900_0008739 3300037418 Bacteria 10404
583 Ga0395900_0196626 3300037418 Bacteria 2042
584 Ga0395898_0002953 3300037466 Bacteria 19329
585 Ga0395898_0009867 3300037466 Bacteria 10010
586 Ga0395898_0127576 3300037466 Bacteria 2437
587 Ga0395901_0373677 3300038443 Bacteria 1468
588 Ga0436365_1276737 3300039437 Bacteria 14687
589 Ga0436365_1341680 3300039437 Bacteria 3228
590 Ga0436360_1267809 3300039438 Bacteria 1040
591 Ga0436361_0427176 3300039447 Bacteria 14155
592 Ga0436361_0812703 3300039447 Bacteria 4735
593 Ga0436363_0681660 3300039450 Bacteria 2044
594 Ga0436363_1183746 3300039450 Bacteria 1404
595 Ga0439465_0035307 3300041413 Bacteria 1603
596 Ga0439441_007966 3300042001 Bacteria 1721
597 Ga0466966_0060066 3300044684 Bacteria 2400
598 Ga0466963_0051782 3300044694 Bacteria 2722
599 Ga0466963_0141924 3300044694 Bacteria 1664
600 Ga0466957_0049772 3300044842 Bacteria 2548
601 Ga0466957_0095999 3300044842 Bacteria 1862
602 Ga0466957_0104286 3300044842 Bacteria 1791
603 Ga0466959_0013676 3300045049 Bacteria 5889
604 Ga0466959_0042026 3300045049 Bacteria 3373
605 Ga0451576_0158483 3300045051 Bacteria 2361
606 Ga0466958_0066489 3300045836 Bacteria 2201
607 Ga0466967_0006900 3300045976 Bacteria 8112
608 Ga0495592_0000890 3300046454 Bacteria 20716
609 Ga0495592_0004650 3300046454 Bacteria 10057
610 Ga0495592_0029178 3300046454 Bacteria 4176
611 Ga0495603_0007685 3300046455 Bacteria 6495
612 Ga0495603_0171300 3300046455 Bacteria 1257
613 Ga0495629_0001003 3300046459 Bacteria 22634
614 Ga0495629_0001665 3300046459 Bacteria 17436
615 Ga0495629_0031671 3300046459 Bacteria 3743
616 Ga0495629_0032442 3300046459 Bacteria 3698
617 Ga0495629_0108649 3300046459 Bacteria 1935
618 Ga0495651_0004120 3300046462 Bacteria 11129
619 Ga0495651_0007992 3300046462 Bacteria 8110
620 Ga0495651_0033029 3300046462 Bacteria 4037
621 Ga0495651_0281215 3300046462 Bacteria 1124
622 Ga0495653_0000905 3300046463 Bacteria 22949
623 Ga0495653_0016883 3300046463 Bacteria 5940
624 Ga0495653_0082835 3300046463 Bacteria 2367
625 Ga0495580_0034764 3300046472 Bacteria 3627
626 Ga0495580_0064508 3300046472 Bacteria 2567
627 Ga0495582_0025753 3300046473 Bacteria 3222
628 Ga0495582_0044624 3300046473 Bacteria 2441
629 Ga0495639_0018623 3300046475 Bacteria 3025
630 Ga0495639_0039029 3300046475 Bacteria 2134
631 Ga0495662_0018907 3300046476 Bacteria 3334
632 Ga0495662_0088899 3300046476 Bacteria 1505
633 Ga0495584_0004853 3300046491 Bacteria 7183
634 Ga0495584_0110130 3300046491 Bacteria 1393
635 Ga0495585_0004199 3300046492 Bacteria 9408
636 Ga0495594_0044700 3300046499 Bacteria 2430
637 Ga0495607_0008348 3300046501 Bacteria 7084
638 Ga0495607_0084710 3300046501 Bacteria 1733
639 Ga0495608_0005206 3300046511 Bacteria 9295
640 Ga0495608_0083651 3300046511 Bacteria 2071
641 Ga0495618_0064701 3300046514 Bacteria 2324
642 Ga0495618_0076076 3300046514 Bacteria 2139
643 Ga0495628_0001391 3300046516 Bacteria 22205
644 Ga0495628_0113550 3300046516 Bacteria 2082
645 Ga0495630_0090875 3300046517 Bacteria 2307
646 Ga0495630_0119237 3300046517 Bacteria 2001
647 Ga0495630_0153320 3300046517 Bacteria 1753
648 Ga0495631_0117145 3300046518 Bacteria 1145
649 Ga0495637_0057641 3300046520 Bacteria 1604
650 Ga0495644_0001707 3300046523 Bacteria 8891
651 Ga0495644_0022206 3300046523 Bacteria 2419
652 Ga0495644_0067810 3300046523 Bacteria 1340
653 Ga0495663_0015933 3300046525 Bacteria 2123
654 Ga0495666_0005800 3300046526 Bacteria 6224
655 Ga0495652_0006710 3300046529 Bacteria 10684
656 Ga0495652_0046672 3300046529 Bacteria 3717
657 Ga0495652_0092111 3300046529 Bacteria 2477
658 Ga0495665_0027299 3300046531 Bacteria 3064
659 Ga0495665_0070071 3300046531 Bacteria 1848
660 Ga0495665_0116986 3300046531 Bacteria 1396
661 Ga0495640_0002380 3300046533 Bacteria 15099
662 Ga0495640_0029249 3300046533 Bacteria 3958
663 Ga0495587_0001761 3300046536 Bacteria 14465
664 Ga0495587_0009886 3300046536 Bacteria 6090
665 Ga0495598_0002793 3300046537 Bacteria 3631
666 Ga0495609_0024443 3300046538 Bacteria 2772
667 Ga0495621_0051812 3300046539 Bacteria 1470
668 Ga0495645_0000765 3300046543 Bacteria 21965
669 Ga0495645_0011866 3300046543 Bacteria 6139
670 Ga0495645_0065866 3300046543 Bacteria 2621
671 Ga0495645_0082736 3300046543 Bacteria 2302
672 Ga0495622_0027980 3300046557 Bacteria 2631
673 Ga0495633_0003249 3300046558 Bacteria 10952
674 Ga0495667_0004508 3300046559 Bacteria 9402
675 Ga0495667_0039724 3300046559 Bacteria 3127
676 Ga0495656_0000538 3300046615 Bacteria 12366
677 Ga0495656_0078934 3300046615 Bacteria 1481
678 Ga0495634_0037712 3300046642 Bacteria 3301
679 Ga0495634_0057814 3300046642 Bacteria 2587
680 Ga0495634_0130335 3300046642 Bacteria 1604
681 Ga0495611_0109448 3300046648 Bacteria 1286
682 Ga0495635_0008724 3300046663 Bacteria 7079
683 Ga0495635_0038113 3300046663 Bacteria 3328
684 Ga0495659_0004530 3300046664 Bacteria 4371
685 Ga0495659_0005376 3300046664 Bacteria 4029
686 Ga0495588_0002190 3300046674 Bacteria 8363
687 Ga0495588_0013369 3300046674 Bacteria 3910
688 Ga0495588_0073230 3300046674 Bacteria 1783
689 Ga0495657_0001869 3300046675 Bacteria 17925
690 Ga0495657_0029647 3300046675 Bacteria 3836
691 Ga0495657_0106121 3300046675 Bacteria 1784
692 Ga0495599_0037997 3300046678 Bacteria 3024
693 Ga0495623_0001546 3300046679 Bacteria 15532
694 Ga0495623_0042614 3300046679 Bacteria 2891
695 Ga0495646_0002015 3300046680 Bacteria 12296
696 Ga0495646_0043669 3300046680 Bacteria 2743
697 Ga0495647_0002287 3300046681 Bacteria 6009
698 Ga0495647_0023153 3300046681 Bacteria 2250
699 Ga0495647_0027707 3300046681 Bacteria 2084
700 Ga0495658_0000814 3300046683 Bacteria 16758
701 Ga0495658_0036013 3300046683 Bacteria 2727
702 Ga0495658_0124213 3300046683 Bacteria 1564
703 Ga0495613_0009829 3300046689 Bacteria 7114
704 Ga0495613_0033916 3300046689 Bacteria 3791
705 Ga0495613_0054130 3300046689 Bacteria 2951
706 Ga0495613_0164933 3300046689 Bacteria 1574
707 Ga0495624_0013504 3300046690 Bacteria 5568
708 Ga0495624_0146277 3300046690 Bacteria 1446
709 Ga0495670_0002388 3300046691 Bacteria 9251
710 Ga0495670_0008528 3300046691 Bacteria 5045
711 Ga0495670_0067877 3300046691 Bacteria 1801
712 Ga0495649_0042455 3300046694 Bacteria 2485
713 Ga0495600_0000380 3300046809 Bacteria 23025
714 Ga0495600_0024236 3300046809 Bacteria 3905
715 Ga0495600_0052595 3300046809 Bacteria 2660
716 Ga0495660_0071411 3300046810 Bacteria 1841
717 Ga0495581_0055790 3300047315 Bacteria 2280
718 Ga0495581_0208804 3300047315 Bacteria 1142
719 Ga0495604_0003890 3300047317 Bacteria 11888
720 Ga0495604_0012078 3300047317 Bacteria 6867
721 Ga0495604_0156374 3300047317 Bacteria 1614
722 Ga0495604_0305668 3300047317 Bacteria 1067
723 Ga0495636_0017370 3300047318 Bacteria 2880
724 Ga0495674_0144845 3300047319 Bacteria 1995
725 Ga0495674_0185409 3300047319 Bacteria 1731
726 Ga0495680_0007705 3300047322 Bacteria 9829
727 Ga0495680_0046161 3300047322 Bacteria 3436
728 Ga0495680_0080621 3300047322 Bacteria 2459
729 Ga0495675_0003666 3300047444 Bacteria 9283
730 Ga0495679_028996 3300047446 Bacteria 1809
731 Ga0495684_0000942 3300047471 Bacteria 23681
732 Ga0495684_0009099 3300047471 Bacteria 7672
733 Ga0495684_0103061 3300047471 Bacteria 2157
734 Ga0495593_0001112 3300047673 Bacteria 15705
735 Ga0495593_0005331 3300047673 Bacteria 7603
736 Ga0495593_0024206 3300047673 Bacteria 3367
737 Ga0495593_0124173 3300047673 Bacteria 1313
738 Ga0495602_0003245 3300048088 Bacteria 16794
739 Ga0495602_0010887 3300048088 Bacteria 9426
740 Ga0495614_0033804 3300048089 Bacteria 2199
741 Ga0496100_0000280 3300048903 Bacteria 25823
742 Ga0496100_0001702 3300048903 Bacteria 10941
743 Ga0496100_0039476 3300048903 Bacteria 2998
744 Ga0496100_0046758 3300048903 Bacteria 2785
745 Ga0496100_0059116 3300048903 Bacteria 2517
746 Ga0496100_0076430 3300048903 Bacteria 2248
747 Ga0496100_0104167 3300048903 Bacteria 1960
748 Ga0496101_0000842 3300048904 Bacteria 18039
749 Ga0496101_0010098 3300048904 Bacteria 6225
750 Ga0496101_0023716 3300048904 Bacteria 4241
751 Ga0496101_0028308 3300048904 Bacteria 3911
752 Ga0496102_0001974 3300048905 Bacteria 17705
753 Ga0496102_0104824 3300048905 Bacteria 2630
754 Ga0496102_0141938 3300048905 Bacteria 2252
755 Ga0496102_0186117 3300048905 Bacteria 1957
756 Ga0496102_0195804 3300048905 Bacteria 1904
757 Ga0496103_0000571 3300048906 Bacteria 29249
758 Ga0496103_0001934 3300048906 Bacteria 13423
759 Ga0496103_0034020 3300048906 Bacteria 3115
760 Ga0496103_0198077 3300048906 Bacteria 1291
761 Ga0496104_0000062 3300048907 Bacteria 117255
762 Ga0496104_0002831 3300048907 Bacteria 14969
763 Ga0496104_0005648 3300048907 Bacteria 10953
764 Ga0496104_0010124 3300048907 Bacteria 8419
765 Ga0496104_0012909 3300048907 Bacteria 7522
766 Ga0496104_0018615 3300048907 Bacteria 6338
767 Ga0496104_0046451 3300048907 Bacteria 4090
768 Ga0496104_0052304 3300048907 Bacteria 3857
769 Ga0496104_0079107 3300048907 Bacteria 3133
770 Ga0496104_0114608 3300048907 Bacteria 2585
771 Ga0496104_0279147 3300048907 Bacteria 1584
772 Ga0496104_0297502 3300048907 Bacteria 1526
773 Ga0496104_0486334 3300048907 Bacteria 1145
774 Ga0496105_0000248 3300048908 Bacteria 36266
775 Ga0496105_0004144 3300048908 Bacteria 10875
776 Ga0496105_0006737 3300048908 Bacteria 8833
777 Ga0496105_0057362 3300048908 Bacteria 3215
778 Ga0496105_0063009 3300048908 Bacteria 3059
779 Ga0496105_0063920 3300048908 Bacteria 3036
780 Ga0496105_0149701 3300048908 Bacteria 1919
781 Ga0496105_0153994 3300048908 Bacteria 1888
782 Ga0496105_0323041 3300048908 Bacteria 1236
783 Ga0496105_0424348 3300048908 Bacteria 1052
784 Ga0496106_0001303 3300048909 Bacteria 18732
785 Ga0496106_0001661 3300048909 Bacteria 16698
786 Ga0496106_0005281 3300048909 Bacteria 9569
787 Ga0496106_0040324 3300048909 Bacteria 3496
788 Ga0496106_0070619 3300048909 Bacteria 2667
789 Ga0496106_0111500 3300048909 Bacteria 2130
790 Ga0496107_0001700 3300048910 Bacteria 13784
791 Ga0496107_0002060 3300048910 Bacteria 12854
792 Ga0496107_0014742 3300048910 Bacteria 5474
793 Ga0496107_0015601 3300048910 Bacteria 5326
794 Ga0496107_0063112 3300048910 Bacteria 2684
795 Ga0496107_0152405 3300048910 Bacteria 1710
796 Ga0496107_0260023 3300048910 Bacteria 1291
797 Ga0496107_0260037 3300048910 Bacteria 1291
798 Ga0496108_0001882 3300048911 Bacteria 16811
799 Ga0496108_0006924 3300048911 Bacteria 9176
800 Ga0496108_0030571 3300048911 Bacteria 4463
801 Ga0496108_0035403 3300048911 Bacteria 4150
802 Ga0496108_0058129 3300048911 Bacteria 3249
803 Ga0496109_0000260 3300048912 Bacteria 50877
804 Ga0496109_0002958 3300048912 Bacteria 14216
805 Ga0496109_0032397 3300048912 Bacteria 4698
806 Ga0496109_0050133 3300048912 Bacteria 3802
807 Ga0496109_0052153 3300048912 Bacteria 3727
808 Ga0496109_0176527 3300048912 Bacteria 2005
809 Ga0496109_0497643 3300048912 Bacteria 1150
810 Ga0496110_0001367 3300048913 Bacteria 17572
811 Ga0496110_0005035 3300048913 Bacteria 10325
812 Ga0496110_0017894 3300048913 Bacteria 5933
813 Ga0496110_0024032 3300048913 Bacteria 5192
814 Ga0496110_0071711 3300048913 Bacteria 3072
815 Ga0496110_0081393 3300048913 Bacteria 2886
816 Ga0496110_0157096 3300048913 Bacteria 2060
817 Ga0496110_0411118 3300048913 Bacteria 1233
818 Ga0496111_0012211 3300048914 Bacteria 5809
819 Ga0496111_0020763 3300048914 Bacteria 4578
820 Ga0496111_0030755 3300048914 Bacteria 3819
821 Ga0496111_0043626 3300048914 Bacteria 3223
822 Ga0496111_0046368 3300048914 Bacteria 3129
823 Ga0496111_0188462 3300048914 Bacteria 1533
824 Ga0496111_0308141 3300048914 Bacteria 1173
825 Ga0496112_0000945 3300048915 Bacteria 21079
826 Ga0496112_0007228 3300048915 Bacteria 9841
827 Ga0496112_0017732 3300048915 Bacteria 6700
828 Ga0496112_0033955 3300048915 Bacteria 4962
829 Ga0496112_0057850 3300048915 Bacteria 3818
830 Ga0496112_0137851 3300048915 Bacteria 2409
831 Ga0496112_0158049 3300048915 Bacteria 2233
832 Ga0496112_0303975 3300048915 Bacteria 1540
833 Ga0496112_0429436 3300048915 Bacteria 1259
834 Ga0496113_0016864 3300048916 Bacteria 5055
835 Ga0496113_0017758 3300048916 Bacteria 4945
836 Ga0496113_0021366 3300048916 Bacteria 4565
837 Ga0496113_0041169 3300048916 Bacteria 3407
838 Ga0496113_0143252 3300048916 Bacteria 1881
839 Ga0496113_0149487 3300048916 Bacteria 1842
840 Ga0496114_0010719 3300048917 Bacteria 7295
841 Ga0496114_0015222 3300048917 Bacteria 6183
842 Ga0496114_0018780 3300048917 Bacteria 5595
843 Ga0496114_0027109 3300048917 Bacteria 4692
844 Ga0496114_0201646 3300048917 Bacteria 1742
845 Ga0496115_0001610 3300048918 Bacteria 16223
846 Ga0496115_0043160 3300048918 Bacteria 3595
847 Ga0496115_0071037 3300048918 Bacteria 2823
848 Ga0496115_0093987 3300048918 Bacteria 2452
849 Ga0496115_0114110 3300048918 Bacteria 2220
850 Ga0496115_0122648 3300048918 Bacteria 2139
851 Ga0496115_0138981 3300048918 Bacteria 2003
852 Ga0496115_0158327 3300048918 Bacteria 1871
853 Ga0496115_0369534 3300048918 Bacteria 1167
854 Ga0496117_0026851 3300048920 Bacteria 4497
855 Ga0496118_0033619 3300048921 Bacteria 4204
856 Ga0496119_0001630 3300048922 Bacteria 26493
857 Ga0496119_0060256 3300048922 Bacteria 2274
858 Ga0496121_0005711 3300048924 Bacteria 15800
859 Ga0496121_0292001 3300048924 Bacteria 1110
860 Ga0496124_0001010 3300048927 Bacteria 44569
861 Ga0496125_0076589 3300048928 Bacteria 2582
862 Ga0496126_0239033 3300048929 Bacteria 1518
863 Ga0501031_0037770 3300049568 Bacteria 3152
864 Ga0501031_0132538 3300049568 Bacteria 1628
865 Ga0501034_0000097 3300049571 Bacteria 161027
866 Ga0501034_0003862 3300049571 Bacteria 16878
867 Ga0501034_0056039 3300049571 Bacteria 3967
868 Ga0501034_0063450 3300049571 Bacteria 3708
869 Ga0501034_0176007 3300049571 Bacteria 2105
870 Ga0501034_0473333 3300049571 Bacteria 1168
871 Ga0501034_0539840 3300049571 Bacteria 1076
872 Ga0501036_0000198 3300049572 Bacteria 39881
873 Ga0501036_0023367 3300049572 Bacteria 5207
874 Ga0501036_0041532 3300049572 Bacteria 3890
875 Ga0501037_0012328 3300049573 Bacteria 6292
876 Ga0501037_0020433 3300049573 Bacteria 4889
877 Ga0501038_0006501 3300049574 Bacteria 10816
878 Ga0501038_0072276 3300049574 Bacteria 2923
879 Ga0501038_0126237 3300049574 Bacteria 2105
880 Ga0501039_0050488 3300049575 Bacteria 3218
881 Ga0501039_0121828 3300049575 Bacteria 2044
882 Ga0501040_0185170 3300049576 Bacteria 1477
883 Ga0501043_0001799 3300049579 Bacteria 18425
884 Ga0501043_0087364 3300049579 Bacteria 2450
885 Ga0501043_0287202 3300049579 Bacteria 1260
886 Ga0501047_0000257 3300049581 Bacteria 62079
887 Ga0501047_0036109 3300049581 Bacteria 4775
888 Ga0501048_0001287 3300049582 Bacteria 19026
889 Ga0501067_0046974 3300049583 Bacteria 2396
890 Ga0501068_0034779 3300049584 Bacteria 3006
891 Ga0501068_0043470 3300049584 Bacteria 2703
892 Ga0501070_0032521 3300049586 Bacteria 4366
893 Ga0501070_0057411 3300049586 Bacteria 3226
894 Ga0501070_0126120 3300049586 Bacteria 2115
895 Ga0501070_0283649 3300049586 Bacteria 1351
896 Ga0501071_0280970 3300049587 Bacteria 1260
897 Ga0501072_0088233 3300049588 Bacteria 2461
898 Ga0501073_0024896 3300049589 Bacteria 4295
899 Ga0501074_0012029 3300049590 Bacteria 6287
900 Ga0501075_0184227 3300049591 Bacteria 1593
901 Ga0501076_0168642 3300049592 Bacteria 1784
902 Ga0501079_0066283 3300049741 Bacteria 2786
903 Ga0501080_0040549 3300049742 Bacteria 4342
904 Ga0501081_0039930 3300049743 Bacteria 3213
905 Ga0501081_0142249 3300049743 Bacteria 1720
906 Ga0501083_0008682 3300049744 Bacteria 7164
907 Ga0501083_0019073 3300049744 Bacteria 4776
908 Ga0501083_0038174 3300049744 Bacteria 3266
909 Ga0501083_0053537 3300049744 Bacteria 2709
910 Ga0501083_0148289 3300049744 Bacteria 1536
911 Ga0501035_0065880 3300049822 Bacteria 3215
912 Ga0501035_0081968 3300049822 Bacteria 2847
913 Ga0501035_0104063 3300049822 Bacteria 2489
914 Ga0501044_0000238 3300049823 Bacteria 69472
915 Ga0501044_0000841 3300049823 Bacteria 36801
916 Ga0501045_0141750 3300049824 Bacteria 1787
917 Ga0501045_0155456 3300049824 Bacteria 1702
918 nmdc:mga03n38_30974_c1 3300050490 Bacteria 2254
919 nmdc:mga00v17_23567_c1 3300050491 Bacteria 3561
920 nmdc:mga00v17_82654_c1 3300050491 Bacteria 2008
921 nmdc:mga0yw44_104323_c1 3300050492 Bacteria 1810
922 nmdc:mga0yw44_15228_c1 3300050492 Bacteria 4112
923 nmdc:mga0yw44_267518_c1 3300050492 Bacteria 1141
924 nmdc:mga0yw44_7719_c1 3300050492 Bacteria 5311
925 nmdc:mga0k408_5388_c1 3300050493 Bacteria 6805
926 nmdc:mga06z11_116679_c1 3300050494 Bacteria 1485
927 nmdc:mga06z11_46047_c1 3300050494 Bacteria 2208
928 nmdc:mga04h51_90914_c1 3300050495 Bacteria 1098
929 nmdc:mga07m45_167503_c1 3300050496 Bacteria 1276
930 nmdc:mga07m45_174113_c1 3300050496 Bacteria 1251
931 nmdc:mga07m45_43279_c1 3300050496 Bacteria 2525
932 nmdc:mga05p37_1109_c1 3300050507 Bacteria 30953
933 nmdc:mga05p37_22888_c1 3300050507 Bacteria 7578
934 nmdc:mga05p37_36053_c1 3300050507 Bacteria 6069
935 nmdc:mga05p37_366858_c1 3300050507 Bacteria 1691
936 nmdc:mga05p37_3812_c1 3300050507 Bacteria 17636
937 nmdc:mga05p37_79233_c1 3300050507 Bacteria 4045
938 nmdc:mga05p37_93412_c1 3300050507 Bacteria 3707
939 nmdc:mga09592_33106_c1 3300050508 Bacteria 4312
940 nmdc:mga09592_399604_c1 3300050508 Bacteria 1188
941 nmdc:mga09592_470_c1 3300050508 Bacteria 30193
942 nmdc:mga0qj67_1459_c1 3300050509 Bacteria 16581
943 nmdc:mga0qj67_22131_c1 3300050509 Bacteria 4880
944 nmdc:mga06r32_284989_c1 3300050510 Bacteria 1639
945 nmdc:mga08y16_2292_c1 3300050511 Bacteria 19584
946 nmdc:mga08y16_299957_c1 3300050511 Bacteria 1656
947 nmdc:mga08y16_362073_c1 3300050511 Bacteria 1489
948 nmdc:mga08y16_855_c1 3300050511 Bacteria 29241
949 nmdc:mga08y16_8714_c1 3300050511 Bacteria 10636
950 nmdc:mga08y16_95295_c1 3300050511 Bacteria 3100
951 nmdc:mga0n895_1286_c1 3300050512 Bacteria 18558
952 nmdc:mga0n895_2848_c1 3300050512 Bacteria 13703
953 nmdc:mga0n895_79530_c1 3300050512 Bacteria 3265
954 nmdc:mga0n895_94110_c1 3300050512 Bacteria 3000
955 nmdc:mga0rr50_15409_c1 3300050513 Bacteria 5046
956 nmdc:mga0rr50_171644_c1 3300050513 Bacteria 1767
957 nmdc:mga08x19_47018_c1 3300050514 Bacteria 2761
958 nmdc:mga0a205_172099_c1 3300050515 Bacteria 2061
959 nmdc:mga0a205_485_c1 3300050515 Bacteria 16164
960 nmdc:mga0a205_51775_c1 3300050515 Bacteria 3964
961 nmdc:mga0a205_6599_c1 3300050515 Bacteria 10497
962 nmdc:mga0sz30_47743_c1 3300050516 Bacteria 1810
963 Ga0495601_0000414 3300053077 Bacteria 22360
964 Ga0495601_0010490 3300053077 Bacteria 5516
965 Ga0495601_0024580 3300053077 Bacteria 3711
966 Ga0495601_0030002 3300053077 Bacteria 3375
967 Ga0495601_0050437 3300053077 Bacteria 2625
968 Ga0495601_0061134 3300053077 Bacteria 2391
969 Ga0495612_0000736 3300053078 Bacteria 13291
970 Ga0495612_0014780 3300053078 Bacteria 3132
971 Ga0495595_0000897 3300053084 Bacteria 11454
972 Ga0495595_0006151 3300053084 Bacteria 4880
973 Ga0495595_0022375 3300053084 Bacteria 2775
974 Ga0495595_0039745 3300053084 Bacteria 2147
975 Ga0495595_0040979 3300053084 Bacteria 2117
976 Ga0495595_0054647 3300053084 Bacteria 1857
977 Ga0495619_0000097 3300053085 Bacteria 65411
978 Ga0495619_0000646 3300053085 Bacteria 22914
979 Ga0495619_0001717 3300053085 Bacteria 14530
980 Ga0495619_0002583 3300053085 Bacteria 11827
981 Ga0495619_0011191 3300053085 Bacteria 5642
982 Ga0495619_0013003 3300053085 Bacteria 5243
983 Ga0495619_0025301 3300053085 Bacteria 3811
984 Ga0495619_0037282 3300053085 Bacteria 3166
985 Ga0495619_0103875 3300053085 Bacteria 1936
986 Ga0500644_0000429 3300053088 Bacteria 19667
987 Ga0500651_0049303 3300053093 Bacteria 2645
988 Ga0500566_0036855 3300053094 Bacteria 2836
989 Ga0500641_0006504 3300053096 Bacteria 4145
990 Ga0500595_000002 3300053119 Bacteria 1074388
991 Ga0500595_006663 3300053119 Bacteria 4872
992 Ga0500595_060528 3300053119 Bacteria 1145
993 Ga0500597_113490 3300053120 Bacteria 1176
994 Ga0500652_000124 3300053131 Bacteria 29312
995 Ga0500568_0017814 3300053139 Bacteria 3125
996 Ga0500616_0000002 3300053153 Bacteria 1611257
997 Ga0500636_0010128 3300053177 Bacteria 5495
998 Ga0500637_0018132 3300053178 Bacteria 3777
999 Ga0500657_030092 3300053728 Bacteria 2557
1000 Ga0500645_000079 3300053730 Bacteria 76832
1001 Ga0500645_012709 3300053730 Bacteria 2716
1002 Ga0501084_0273441 3300054114 Bacteria 1426
1003 Ga0501082_0143552 3300060353 Bacteria 2072
1004 Ga0501082_0260535 3300060353 Bacteria 1508
1005 Ga0501082_0326967 3300060353 Bacteria 1336
1006 Ga0530510_0069943 3300061734 Bacteria 2547
1007 Ga0530510_0103959 3300061734 Bacteria 2078
1008 2513588979 2513237087 Bacteria 5817514
1009 2643756121 2643221547 Bacteria 4740017
1010 2861692043 2861691609 Bacteria 5628931
1011 2909044155 2909042592 Bacteria 6499737
1012 8002062950 8002060224 Bacteria 4026565
1013 2214772991
1014 ARcpr5oldR_c000005
1015 ARSoilYngRDRAFT_c00062
1016 ARcpr5yngRDRAFT_c000132
1017 ARSoilOldRDRAFT_c000012
1018 ARCol0oldRDRAFT_c00643
1019 ARCol0yngRDRAFT_1000796
1020 JGI24032J14994_100303
1021 JGI24746J21847_1001998
1022 JGI24747J21853_1001524
1023 JGI24739J22299_10002632
1024 JGI24737J22298_10003528
1025 JGI24737J22298_10021312
1026 JGI24737J22298_10031640
1027 JGI24750J21931_1001120
1028 JGI24738J21930_10000471
1029 JGI24738J21930_10005129
1030 JGI24749J21850_1000776
1031 JGI24744J21845_10001246
1032 JGI24744J21845_10004033
1033 JGI24035J26624_1000132
1034 JGI24034J26672_10005421
1035 JGI24742J22300_10000997
1036 JGI24742J22300_10008454
1037 JGI24751J29686_10009497
1038 JGI25406J46586_10018079
1039 JGI26145J50221_1004021
1040 JGI25405J52794_10008617
1041 Ga0065704_10081191
1042 Ga0065712_10002169
1043 Ga0065712_10073252
1044 Ga0065712_10099736
1045 Ga0065715_10001386
1046 Ga0065715_10009694
1047 Ga0065707_10096006
1048 Ga0070658_10013815
1049 Ga0070676_10001202
1050 Ga0070676_10183306
1051 Ga0070683_100000121
1052 Ga0070683_100131943
1053 Ga0070683_100284959
1054 Ga0070690_100002752
1055 Ga0070690_100006624
1056 Ga0070670_100005999
1057 Ga0070670_100025980
1058 Ga0070670_100179980
1059 Ga0070677_10000055
1060 Ga0068869_100000507
1061 Ga0068869_100019313
1062 Ga0070666_10012614
1063 Ga0070680_100005908
1064 Ga0070680_100011815
1065 Ga0070680_100016969
1066 Ga0070680_100017302
1067 Ga0070680_100030986
1068 Ga0070680_100117489
1069 Ga0070682_100000697
1070 Ga0070682_100273732
1071 Ga0068868_100002501
1072 Ga0068868_100035322
1073 Ga0068868_100077704
1074 Ga0070660_100010372
1075 Ga0070660_100028614
1076 Ga0070660_100314752
1077 Ga0070689_100012275
1078 Ga0070689_100048589
1079 Ga0070691_10000371
1080 Ga0070691_10028064
1081 Ga0070691_10165461
1082 Ga0070687_100001534
1083 Ga0070687_100002788
1084 Ga0070661_100000881
1085 Ga0070661_100167073
1086 Ga0070692_10000573
1087 Ga0070692_10153207
1088 Ga0070668_100004237
1089 Ga0070669_100019063
1090 Ga0070675_100000698
1091 Ga0070671_100000344
1092 Ga0070671_100029375
1093 Ga0070674_100000116
1094 Ga0070674_100015198
1095 Ga0070674_100274556
1096 Ga0070673_100000335
1097 Ga0070688_100000565
1098 Ga0070688_100008099
1099 Ga0070688_100090102
1100 Ga0070659_100011128
1101 Ga0070659_100018339
1102 Ga0070659_100027308
1103 Ga0070667_100007699
1104 Ga0070667_100013516
1105 Ga0070703_10001252
1106 Ga0070709_10169730
1107 Ga0070714_100020545
1108 Ga0070714_100045875
1109 Ga0070713_100002431
1110 Ga0070713_100010201
1111 Ga0070710_10009728
1112 Ga0070710_10033533
1113 Ga0070701_10002810
1114 Ga0070711_100079500
1115 Ga0070700_100003137
1116 Ga0070700_100005744
1117 Ga0070694_100016106
1118 Ga0070708_100011088
1119 Ga0070708_100065932
1120 Ga0070663_100001736
1121 Ga0070678_100000684
1122 Ga0070678_100114286
1123 Ga0070662_100009413
1124 Ga0070662_100018312
1125 Ga0070681_10006902
1126 Ga0070681_10035745
1127 Ga0070681_10048173
1128 Ga0070681_10084994
1129 Ga0070681_10171796
1130 Ga0070681_10328290
1131 Ga0068867_100004625
1132 Ga0068867_100009831
1133 Ga0070685_10005786
1134 Ga0070699_100019789
1135 Ga0070699_100231316
1136 Ga0070679_100001791
1137 Ga0070679_100008142
1138 Ga0070679_100016614
1139 Ga0070679_100136896
1140 Ga0070679_100146739
1141 Ga0070679_100178887
1142 Ga0070684_100001949
1143 Ga0070684_100019580
1144 Ga0070684_100049176
1145 Ga0070684_100159405
1146 Ga0070684_100202680
1147 Ga0068853_100052344
1148 Ga0070672_100000741
1149 Ga0070672_100108447
1150 Ga0070686_100015489
1151 Ga0070686_100089857
1152 Ga0070695_100017329
1153 Ga0070695_100078555
1154 Ga0070696_100007917
1155 Ga0070696_100153046
1156 Ga0070693_100001254
1157 Ga0070665_100167151
1158 Ga0070704_100016209
1159 Ga0070704_100133876
1160 Ga0068855_100037835
1161 Ga0068855_100132920
1162 Ga0068855_100285980
1163 Ga0068855_100291685
1164 Ga0070664_100015589
1165 Ga0070664_100049402
1166 Ga0070664_100143819
1167 Ga0068857_100000680
1168 Ga0068857_100084599
1169 Ga0068854_100000760
1170 Ga0068854_100043012
1171 Ga0068856_100021374
1172 Ga0068856_100132118
1173 Ga0068856_100193544
1174 Ga0068856_100253426
1175 Ga0070702_100000099
1176 Ga0070702_100017518
1177 Ga0068852_100006331
1178 Ga0068852_100008756
1179 Ga0068852_100227776
1180 Ga0068864_100007872
1181 Ga0068864_100016990
1182 Ga0068866_10001741
1183 Ga0068861_100000354
1184 Ga0068851_10041813
1185 Ga0068870_10000395
1186 Ga0068870_10001588
1187 Ga0068863_100013197
1188 Ga0068863_100022985
1189 Ga0068863_100096898
1190 Ga0068858_100017831
1191 Ga0068858_100471127
1192 Ga0068860_100007901
1193 Ga0068860_100076788
1194 Ga0068862_100013455
1195 Ga0068862_100121952
1196 Ga0081455_10001802
1197 Ga0081455_10003948
1198 Ga0081455_10030623
1199 Ga0081455_10084380
1200 Ga0081455_10109865
1201 Ga0081538_10095390
1202 Ga0081540_1002931
1203 Ga0081540_1048597
1204 Ga0081539_10001708
1205 Ga0081539_10012080
1206 Ga0070717_10255293
1207 Ga0075365_10011867
1208 Ga0075368_10038471
1209 Ga0075368_10039207
1210 Ga0075363_100154783
1211 Ga0075364_10016148
1212 Ga0075364_10034753
1213 Ga0075364_10173808
1214 Ga0075432_10002763
1215 Ga0070715_10001764
1216 Ga0070712_100000678
1217 Ga0070712_100005205
1218 Ga0070712_100049283
1219 Ga0070712_100115745
1220 Ga0070712_100154789
1221 Ga0075362_10070817
1222 Ga0075367_10006100
1223 Ga0075367_10065074
1224 Ga0075369_10003043
1225 Ga0075369_10003164
1226 Ga0075369_10033244
1227 Ga0075427_10000518
1228 Ga0097621_100000430
1229 Ga0097621_100028001
1230 Ga0097621_100112102
1231 Ga0075370_10078231
1232 Ga0068871_100000243
1233 Ga0068871_100052395
1234 Ga0075428_100074221
1235 Ga0075428_100217373
1236 Ga0075430_100008258
1237 Ga0075430_100138898
1238 Ga0075431_100013105
1239 Ga0075433_10000023
1240 Ga0075433_10027633
1241 Ga0075433_10057801
1242 Ga0075434_100011469
1243 Ga0075434_100088050
1244 Ga0075434_100190266
1245 Ga0075429_100000227
1246 Ga0075429_100017930
1247 Ga0075429_100207939
1248 Ga0068865_100000675
1249 Ga0068865_100134708
1250 Ga0075436_100060467
1251 Ga0075435_100010404
1252 Ga0105251_10038039
1253 Ga0105244_10030760
1254 Ga0105240_10034321
1255 Ga0111539_10000561
1256 Ga0111539_10004002
1257 Ga0111539_10004660
1258 Ga0111539_10012526
1259 Ga0111539_10303003
1260 Ga0105245_10000943
1261 Ga0105245_10019420
1262 Ga0105247_10008605
1263 Ga0105247_10010184
1264 Ga0105247_10014588
1265 Ga0105247_10075754
1266 Ga0114129_10003375
1267 Ga0114129_10067744
1268 Ga0114129_10136853
1269 Ga0114129_10161019
1270 Ga0114129_10165742
1271 Ga0114129_10457612
1272 Ga0105243_10002854
1273 Ga0105243_10008993
1274 Ga0105243_10011868
1275 Ga0105243_10234057
1276 Ga0105241_10001331
1277 Ga0105241_10123091
1278 Ga0105242_10000036
1279 Ga0105242_10102489
1280 Ga0105242_10144878
1281 Ga0105248_10058205
1282 Ga0105248_10176664
1283 Ga0105248_10346351
1284 Ga0105237_10030440
1285 Ga0105237_10093691
1286 Ga0105238_10118261
1287 Ga0105238_10136258
1288 Ga0105238_10244135
1289 Ga0105238_10260465
1290 Ga0105238_10333042
1291 Ga0105249_10018622
1292 Ga0105249_10224425
1293 Ga0105249_10578243
1294 Ga0105239_10024026
1295 Ga0105239_10236007
1296 Ga0105239_10292968
1297 Ga0105239_10371948
1298 Ga0105246_10146328
1299 Ga0157342_1001381
1300 Ga0157342_1003146
1301 Ga0157373_10004533
1302 Ga0157373_10248740
1303 Ga0157371_10033655
1304 Ga0157370_10009857
1305 Ga0157369_10120649
1306 Ga0157369_10548126
1307 Ga0157374_10012850
1308 Ga0157374_10018742
1309 Ga0157374_10162136
1310 Ga0157378_10000462
1311 Ga0157378_10140239
1312 Ga0157378_10180837
1313 Ga0163162_10002063
1314 Ga0163162_10015790
1315 Ga0163162_10470279
1316 Ga0157372_10021178
1317 Ga0157372_10139453
1318 Ga0157372_10144115
1319 Ga0157375_10017542
1320 Ga0163163_10020553
1321 Ga0163163_10030054
1322 Ga0157380_10000274
1323 Ga0182008_10120456
1324 Ga0157377_10000470
1325 Ga0157379_10007174
1326 Ga0157379_10155045
1327 Ga0157379_10214428
1328 Ga0157376_10000508
1329 Ga0182007_10038335
1330 Ga0163161_10001021
1331 Ga0213872_10036843
1332 Ga0213872_10044315
1333 Ga0213874_10019175
1334 Ga0209233_1001929
1335 Ga0207666_1000356
1336 Ga0207673_1000077
1337 Ga0207697_10004946
1338 Ga0207697_10088865
1339 Ga0207656_10017829
1340 Ga0207653_10012306
1341 Ga0207682_10000135
1342 Ga0207642_10000073
1343 Ga0207710_10074385
1344 Ga0207688_10002338
1345 Ga0207688_10006665
1346 Ga0207680_10007561
1347 Ga0207647_10012910
1348 Ga0207647_10024800
1349 Ga0207647_10155504
1350 Ga0207685_10034337
1351 Ga0207699_10006915
1352 Ga0207699_10079107
1353 Ga0207645_10000457
1354 Ga0207643_10000853
1355 Ga0207643_10006512
1356 Ga0207705_10104455
1357 Ga0207684_10061490
1358 Ga0207654_10000638
1359 Ga0207707_10016702
1360 Ga0207707_10017958
1361 Ga0207707_10043824
1362 Ga0207707_10089331
1363 Ga0207671_10278740
1364 Ga0207693_10014951
1365 Ga0207693_10016289
1366 Ga0207693_10053723
1367 Ga0207693_10060824
1368 Ga0207693_10103895
1369 Ga0207693_10130652
1370 Ga0207663_10238495
1371 Ga0207660_10001020
1372 Ga0207660_10031240
1373 Ga0207660_10086873
1374 Ga0207662_10001714
1375 Ga0207662_10005471
1376 Ga0207657_10020840
1377 Ga0207657_10025718
1378 Ga0207657_10046593
1379 Ga0207657_10152850
1380 Ga0207649_10000760
1381 Ga0207652_10000764
1382 Ga0207646_10077702
1383 Ga0207681_10000065
1384 Ga0207694_10148672
1385 Ga0207650_10001773
1386 Ga0207650_10060316
1387 Ga0207650_10133917
1388 Ga0207650_10229691
1389 Ga0207659_10000142
1390 Ga0207687_10000125
1391 Ga0207687_10007547
1392 Ga0207700_10039274
1393 Ga0207700_10233078
1394 Ga0207700_10272524
1395 Ga0207664_10007299
1396 Ga0207644_10001470
1397 Ga0207644_10004403
1398 Ga0207690_10003823
1399 Ga0207690_10013751
1400 Ga0207706_10007990
1401 Ga0207706_10019275
1402 Ga0207706_10019316
1403 Ga0207686_10000344
1404 Ga0207686_10065309
1405 Ga0207709_10000183
1406 Ga0207670_10000288
1407 Ga0207670_10002143
1408 Ga0207670_10034555
1409 Ga0207670_10356562
1410 Ga0207669_10000081
1411 Ga0207669_10171644
1412 Ga0207704_10000121
1413 Ga0207704_10120340
1414 Ga0207704_10242918
1415 Ga0207665_10002359
1416 Ga0207665_10134599
1417 Ga0207691_10004599
1418 Ga0207691_10008864
1419 Ga0207711_10062918
1420 Ga0207689_10000696
1421 Ga0207689_10007426
1422 Ga0207689_10041147
1423 Ga0207661_10000286
1424 Ga0207661_10081972
1425 Ga0207661_10104153
1426 Ga0207661_10191694
1427 Ga0207679_10000064
1428 Ga0207679_10334608
1429 Ga0207679_10339599
1430 Ga0207667_10057387
1431 Ga0207667_10192677
1432 Ga0207667_10332016
1433 Ga0207651_10000395
1434 Ga0207651_10038681
1435 Ga0207712_10000752
1436 Ga0207668_10000715
1437 Ga0207668_10077636
1438 Ga0207640_10003491
1439 Ga0207640_10120683
1440 Ga0207658_10001038
1441 Ga0207658_10107419
1442 Ga0207677_10000985
1443 Ga0207677_10070724
1444 Ga0207703_10001400
1445 Ga0207639_10005141
1446 Ga0207639_10135522
1447 Ga0207678_10009603
1448 Ga0207678_10014572
1449 Ga0207678_10076643
1450 Ga0207708_10004954
1451 Ga0207708_10012692
1452 Ga0207708_10015109
1453 Ga0207702_10001395
1454 Ga0207702_10293109
1455 Ga0207641_10003265
1456 Ga0207641_10045617
1457 Ga0207648_10008132
1458 Ga0207648_10011624
1459 Ga0207648_10192382
1460 Ga0207676_10000079
1461 Ga0207674_10006886
1462 Ga0207674_10402282
1463 Ga0207675_100003662
1464 Ga0207675_100019734
1465 Ga0207675_100076823
1466 Ga0207683_10000037
1467 Ga0207683_10011735
1468 Ga0207683_10040380
1469 Ga0207683_10047045
1470 Ga0207683_10205675
1471 Ga0207698_10002333
1472 Ga0207698_10006345
1473 Ga0207698_10194099
1474 Ga0210002_1001169
1475 Ga0209966_1001440
1476 Ga0209998_10016721
1477 Ga0209974_10003753
1478 Ga0207428_10000292
1479 Ga0207428_10002255
1480 Ga0207428_10043033
1481 Ga0268266_10117991
1482 Ga0268266_10133590
1483 Ga0268265_10001133
1484 Ga0268265_10009438
1485 Ga0268265_10075768
1486 Ga0268264_10000805
1487 Ga0268264_10059829
1488 Ga0265330_10017320
1489 Ga0265330_10049817
1490 Ga0265332_10037858
1491 Ga0265328_10000155
1492 Ga0265328_10004630
1493 Ga0265325_10000006
1494 Ga0265325_10000743
1495 Ga0265325_10023635
1496 Ga0265325_10023675
1497 Ga0265325_10046577
1498 Ga0265325_10048882
1499 Ga0265329_10040204
1500 Ga0265329_10049964
1501 Ga0265340_10005222
1502 Ga0265340_10035015
1503 Ga0265331_10000005
1504 Ga0265331_10001410
1505 Ga0265331_10001741
1506 Ga0265327_10010541
1507 Ga0265316_10000387
1508 Ga0265313_10000553
1509 Ga0265313_10022732
1510 Ga0265313_10062417
1511 Ga0265313_10088789
1512 Ga0307508_10103695
1513 Ga0265314_10021841
1514 Ga0265314_10026031
1515 Ga0265314_10026645
1516 Ga0265314_10201691
1517 Ga0265342_10000011
1518 Ga0265342_10004370
1519 Ga0265342_10023672
1520 Ga0307510_10129905
1521 Ga0373930_0004021
1522 Ga0373950_0008814
1523 Ga0373958_0001465
1524 Ga0373958_0015703
1525 Ga0373938_0000063
1526 Ga0373938_0019066
1527 Ga0373926_0005620
1528 Ga0373926_0018917
1529 Ga0373926_0023654
1530 Ga0373928_0001474
1531 Ga0373929_0001110
1532 Ga0373940_0000418
1533 Ga0373940_0049936
1534 Ga0373944_0005850
1535 Ga0373949_0000779
1536 Ga0373949_0002326
1537 Ga0373951_0001074
1538 Ga0373952_0001672
1539 Ga0373952_0004710
1540 Ga0373923_0016457
1541 Ga0373923_0023882
1542 Ga0373923_0055561
1543 Ga0373932_0000516
1544 Ga0373932_0002506
1545 Ga0373932_0002800
1546 Ga0373936_0111308
1547 Ga0373939_0001269
1548 Ga0373939_0002352
1549 Ga0373939_0003293
1550 Ga0373941_0001012
1551 Ga0373941_0002320
1552 Ga0373953_0000171
1553 Ga0373953_0004537
1554 Ga0373953_0033793
1555 Ga0373954_0001704
1556 Ga0373954_0039628
1557 Ga0373956_0007874
1558 Ga0373956_0050932
1559 Ga0373957_0000100
1560 Ga0373960_0002055
1561 Ga0373960_0002580
1562 Ga0373943_0173049
1563 Ga0373946_0011600
1564 Ga0373946_0012514
1565 Ga0373955_0005067
1566 Ga0373955_0024025
1567 Ga0373942_0000898
1568 Ga0373942_0007710
1569 Ga0373962_0006516
1570 Ga0373924_0024194
1571 Ga0373924_0037768
1572 Ga0373931_0002005
1573 Ga0373931_0015704
1574 Ga0373931_0129586
1575 Ga0373935_0021083
1576 Ga0373935_0043578
1577 Ga0373927_0023381
1578 Ga0373927_0030690
1579 Ga0373927_0073054
1580 Ga0373927_0074566
1581 Ga0373927_0101689
1582 Ga0373927_0127892
1583 Ga0373933_0002823
1584 Ga0373947_0000637
1585 Ga0373947_0061380
1586 Ga0373937_0000915
1587 Ga0373937_0007517
1588 Ga0373937_0049609
1589 Ga0373937_0127276
1590 Ga0373925_0038714
1591 Ga0395899_0007257
1592 Ga0395899_0181312
1593 Ga0395900_0005384
1594 Ga0395900_0008739
1595 Ga0395900_0196626
1596 Ga0395898_0002953
1597 Ga0395898_0009867
1598 Ga0395898_0127576
1599 Ga0395901_0373677
1600 Ga0436365_1276737
1601 Ga0436365_1341680
1602 Ga0436360_1267809
1603 Ga0436361_0427176
1604 Ga0436361_0812703
1605 Ga0436363_0681660
1606 Ga0436363_1183746
1607 Ga0439465_0035307
1608 Ga0439441_007966
1609 Ga0466966_0060066
1610 Ga0466963_0051782
1611 Ga0466963_0141924
1612 Ga0466957_0049772
1613 Ga0466957_0095999
1614 Ga0466957_0104286
1615 Ga0466959_0013676
1616 Ga0466959_0042026
1617 Ga0451576_0158483
1618 Ga0466958_0066489
1619 Ga0466967_0006900
1620 Ga0495592_0000890
1621 Ga0495592_0004650
1622 Ga0495592_0029178
1623 Ga0495603_0007685
1624 Ga0495603_0171300
1625 Ga0495629_0001003
1626 Ga0495629_0001665
1627 Ga0495629_0031671
1628 Ga0495629_0032442
1629 Ga0495629_0108649
1630 Ga0495651_0004120
1631 Ga0495651_0007992
1632 Ga0495651_0033029
1633 Ga0495651_0281215
1634 Ga0495653_0000905
1635 Ga0495653_0016883
1636 Ga0495653_0082835
1637 Ga0495580_0034764
1638 Ga0495580_0064508
1639 Ga0495582_0025753
1640 Ga0495582_0044624
1641 Ga0495639_0018623
1642 Ga0495639_0039029
1643 Ga0495662_0018907
1644 Ga0495662_0088899
1645 Ga0495584_0004853
1646 Ga0495584_0110130
1647 Ga0495585_0004199
1648 Ga0495594_0044700
1649 Ga0495607_0008348
1650 Ga0495607_0084710
1651 Ga0495608_0005206
1652 Ga0495608_0083651
1653 Ga0495618_0064701
1654 Ga0495618_0076076
1655 Ga0495628_0001391
1656 Ga0495628_0113550
1657 Ga0495630_0090875
1658 Ga0495630_0119237
1659 Ga0495630_0153320
1660 Ga0495631_0117145
1661 Ga0495637_0057641
1662 Ga0495644_0001707
1663 Ga0495644_0022206
1664 Ga0495644_0067810
1665 Ga0495663_0015933
1666 Ga0495666_0005800
1667 Ga0495652_0006710
1668 Ga0495652_0046672
1669 Ga0495652_0092111
1670 Ga0495665_0027299
1671 Ga0495665_0070071
1672 Ga0495665_0116986
1673 Ga0495640_0002380
1674 Ga0495640_0029249
1675 Ga0495587_0001761
1676 Ga0495587_0009886
1677 Ga0495598_0002793
1678 Ga0495609_0024443
1679 Ga0495621_0051812
1680 Ga0495645_0000765
1681 Ga0495645_0011866
1682 Ga0495645_0065866
1683 Ga0495645_0082736
1684 Ga0495622_0027980
1685 Ga0495633_0003249
1686 Ga0495667_0004508
1687 Ga0495667_0039724
1688 Ga0495656_0000538
1689 Ga0495656_0078934
1690 Ga0495634_0037712
1691 Ga0495634_0057814
1692 Ga0495634_0130335
1693 Ga0495611_0109448
1694 Ga0495635_0008724
1695 Ga0495635_0038113
1696 Ga0495659_0004530
1697 Ga0495659_0005376
1698 Ga0495588_0002190
1699 Ga0495588_0013369
1700 Ga0495588_0073230
1701 Ga0495657_0001869
1702 Ga0495657_0029647
1703 Ga0495657_0106121
1704 Ga0495599_0037997
1705 Ga0495623_0001546
1706 Ga0495623_0042614
1707 Ga0495646_0002015
1708 Ga0495646_0043669
1709 Ga0495647_0002287
1710 Ga0495647_0023153
1711 Ga0495647_0027707
1712 Ga0495658_0000814
1713 Ga0495658_0036013
1714 Ga0495658_0124213
1715 Ga0495613_0009829
1716 Ga0495613_0033916
1717 Ga0495613_0054130
1718 Ga0495613_0164933
1719 Ga0495624_0013504
1720 Ga0495624_0146277
1721 Ga0495670_0002388
1722 Ga0495670_0008528
1723 Ga0495670_0067877
1724 Ga0495649_0042455
1725 Ga0495600_0000380
1726 Ga0495600_0024236
1727 Ga0495600_0052595
1728 Ga0495660_0071411
1729 Ga0495581_0055790
1730 Ga0495581_0208804
1731 Ga0495604_0003890
1732 Ga0495604_0012078
1733 Ga0495604_0156374
1734 Ga0495604_0305668
1735 Ga0495636_0017370
1736 Ga0495674_0144845
1737 Ga0495674_0185409
1738 Ga0495680_0007705
1739 Ga0495680_0046161
1740 Ga0495680_0080621
1741 Ga0495675_0003666
1742 Ga0495679_028996
1743 Ga0495684_0000942
1744 Ga0495684_0009099
1745 Ga0495684_0103061
1746 Ga0495593_0001112
1747 Ga0495593_0005331
1748 Ga0495593_0024206
1749 Ga0495593_0124173
1750 Ga0495602_0003245
1751 Ga0495602_0010887
1752 Ga0495614_0033804
1753 Ga0496100_0000280
1754 Ga0496100_0001702
1755 Ga0496100_0039476
1756 Ga0496100_0046758
1757 Ga0496100_0059116
1758 Ga0496100_0076430
1759 Ga0496100_0104167
1760 Ga0496101_0000842
1761 Ga0496101_0010098
1762 Ga0496101_0023716
1763 Ga0496101_0028308
1764 Ga0496102_0001974
1765 Ga0496102_0104824
1766 Ga0496102_0141938
1767 Ga0496102_0186117
1768 Ga0496102_0195804
1769 Ga0496103_0000571
1770 Ga0496103_0001934
1771 Ga0496103_0034020
1772 Ga0496103_0198077
1773 Ga0496104_0000062
1774 Ga0496104_0002831
1775 Ga0496104_0005648
1776 Ga0496104_0010124
1777 Ga0496104_0012909
1778 Ga0496104_0018615
1779 Ga0496104_0046451
1780 Ga0496104_0052304
1781 Ga0496104_0079107
1782 Ga0496104_0114608
1783 Ga0496104_0279147
1784 Ga0496104_0297502
1785 Ga0496104_0486334
1786 Ga0496105_0000248
1787 Ga0496105_0004144
1788 Ga0496105_0006737
1789 Ga0496105_0057362
1790 Ga0496105_0063009
1791 Ga0496105_0063920
1792 Ga0496105_0149701
1793 Ga0496105_0153994
1794 Ga0496105_0323041
1795 Ga0496105_0424348
1796 Ga0496106_0001303
1797 Ga0496106_0001661
1798 Ga0496106_0005281
1799 Ga0496106_0040324
1800 Ga0496106_0070619
1801 Ga0496106_0111500
1802 Ga0496107_0001700
1803 Ga0496107_0002060
1804 Ga0496107_0014742
1805 Ga0496107_0015601
1806 Ga0496107_0063112
1807 Ga0496107_0152405
1808 Ga0496107_0260023
1809 Ga0496107_0260037
1810 Ga0496108_0001882
1811 Ga0496108_0006924
1812 Ga0496108_0030571
1813 Ga0496108_0035403
1814 Ga0496108_0058129
1815 Ga0496109_0000260
1816 Ga0496109_0002958
1817 Ga0496109_0032397
1818 Ga0496109_0050133
1819 Ga0496109_0052153
1820 Ga0496109_0176527
1821 Ga0496109_0497643
1822 Ga0496110_0001367
1823 Ga0496110_0005035
1824 Ga0496110_0017894
1825 Ga0496110_0024032
1826 Ga0496110_0071711
1827 Ga0496110_0081393
1828 Ga0496110_0157096
1829 Ga0496110_0411118
1830 Ga0496111_0012211
1831 Ga0496111_0020763
1832 Ga0496111_0030755
1833 Ga0496111_0043626
1834 Ga0496111_0046368
1835 Ga0496111_0188462
1836 Ga0496111_0308141
1837 Ga0496112_0000945
1838 Ga0496112_0007228
1839 Ga0496112_0017732
1840 Ga0496112_0033955
1841 Ga0496112_0057850
1842 Ga0496112_0137851
1843 Ga0496112_0158049
1844 Ga0496112_0303975
1845 Ga0496112_0429436
1846 Ga0496113_0016864
1847 Ga0496113_0017758
1848 Ga0496113_0021366
1849 Ga0496113_0041169
1850 Ga0496113_0143252
1851 Ga0496113_0149487
1852 Ga0496114_0010719
1853 Ga0496114_0015222
1854 Ga0496114_0018780
1855 Ga0496114_0027109
1856 Ga0496114_0201646
1857 Ga0496115_0001610
1858 Ga0496115_0043160
1859 Ga0496115_0071037
1860 Ga0496115_0093987
1861 Ga0496115_0114110
1862 Ga0496115_0122648
1863 Ga0496115_0138981
1864 Ga0496115_0158327
1865 Ga0496115_0369534
1866 Ga0496117_0026851
1867 Ga0496118_0033619
1868 Ga0496119_0001630
1869 Ga0496119_0060256
1870 Ga0496121_0005711
1871 Ga0496121_0292001
1872 Ga0496124_0001010
1873 Ga0496125_0076589
1874 Ga0496126_0239033
1875 Ga0501031_0037770
1876 Ga0501031_0132538
1877 Ga0501034_0000097
1878 Ga0501034_0003862
1879 Ga0501034_0056039
1880 Ga0501034_0063450
1881 Ga0501034_0176007
1882 Ga0501034_0473333
1883 Ga0501034_0539840
1884 Ga0501036_0000198
1885 Ga0501036_0023367
1886 Ga0501036_0041532
1887 Ga0501037_0012328
1888 Ga0501037_0020433
1889 Ga0501038_0006501
1890 Ga0501038_0072276
1891 Ga0501038_0126237
1892 Ga0501039_0050488
1893 Ga0501039_0121828
1894 Ga0501040_0185170
1895 Ga0501043_0001799
1896 Ga0501043_0087364
1897 Ga0501043_0287202
1898 Ga0501047_0000257
1899 Ga0501047_0036109
1900 Ga0501048_0001287
1901 Ga0501067_0046974
1902 Ga0501068_0034779
1903 Ga0501068_0043470
1904 Ga0501070_0032521
1905 Ga0501070_0057411
1906 Ga0501070_0126120
1907 Ga0501070_0283649
1908 Ga0501071_0280970
1909 Ga0501072_0088233
1910 Ga0501073_0024896
1911 Ga0501074_0012029
1912 Ga0501075_0184227
1913 Ga0501076_0168642
1914 Ga0501079_0066283
1915 Ga0501080_0040549
1916 Ga0501081_0039930
1917 Ga0501081_0142249
1918 Ga0501083_0008682
1919 Ga0501083_0019073
1920 Ga0501083_0038174
1921 Ga0501083_0053537
1922 Ga0501083_0148289
1923 Ga0501035_0065880
1924 Ga0501035_0081968
1925 Ga0501035_0104063
1926 Ga0501044_0000238
1927 Ga0501044_0000841
1928 Ga0501045_0141750
1929 Ga0501045_0155456
1930 nmdc:mga03n38_30974_c1
1931 nmdc:mga00v17_23567_c1
1932 nmdc:mga00v17_82654_c1
1933 nmdc:mga0yw44_104323_c1
1934 nmdc:mga0yw44_15228_c1
1935 nmdc:mga0yw44_267518_c1
1936 nmdc:mga0yw44_7719_c1
1937 nmdc:mga0k408_5388_c1
1938 nmdc:mga06z11_116679_c1
1939 nmdc:mga06z11_46047_c1
1940 nmdc:mga04h51_90914_c1
1941 nmdc:mga07m45_167503_c1
1942 nmdc:mga07m45_174113_c1
1943 nmdc:mga07m45_43279_c1
1944 nmdc:mga05p37_1109_c1
1945 nmdc:mga05p37_22888_c1
1946 nmdc:mga05p37_36053_c1
1947 nmdc:mga05p37_366858_c1
1948 nmdc:mga05p37_3812_c1
1949 nmdc:mga05p37_79233_c1
1950 nmdc:mga05p37_93412_c1
1951 nmdc:mga09592_33106_c1
1952 nmdc:mga09592_399604_c1
1953 nmdc:mga09592_470_c1
1954 nmdc:mga0qj67_1459_c1
1955 nmdc:mga0qj67_22131_c1
1956 nmdc:mga06r32_284989_c1
1957 nmdc:mga08y16_2292_c1
1958 nmdc:mga08y16_299957_c1
1959 nmdc:mga08y16_362073_c1
1960 nmdc:mga08y16_855_c1
1961 nmdc:mga08y16_8714_c1
1962 nmdc:mga08y16_95295_c1
1963 nmdc:mga0n895_1286_c1
1964 nmdc:mga0n895_2848_c1
1965 nmdc:mga0n895_79530_c1
1966 nmdc:mga0n895_94110_c1
1967 nmdc:mga0rr50_15409_c1
1968 nmdc:mga0rr50_171644_c1
1969 nmdc:mga08x19_47018_c1
1970 nmdc:mga0a205_172099_c1
1971 nmdc:mga0a205_485_c1
1972 nmdc:mga0a205_51775_c1
1973 nmdc:mga0a205_6599_c1
1974 nmdc:mga0sz30_47743_c1
1975 Ga0495601_0000414
1976 Ga0495601_0010490
1977 Ga0495601_0024580
1978 Ga0495601_0030002
1979 Ga0495601_0050437
1980 Ga0495601_0061134
1981 Ga0495612_0000736
1982 Ga0495612_0014780
1983 Ga0495595_0000897
1984 Ga0495595_0006151
1985 Ga0495595_0022375
1986 Ga0495595_0039745
1987 Ga0495595_0040979
1988 Ga0495595_0054647
1989 Ga0495619_0000097
1990 Ga0495619_0000646
1991 Ga0495619_0001717
1992 Ga0495619_0002583
1993 Ga0495619_0011191
1994 Ga0495619_0013003
1995 Ga0495619_0025301
1996 Ga0495619_0037282
1997 Ga0495619_0103875
1998 Ga0500644_0000429
1999 Ga0500651_0049303
2000 Ga0500566_0036855
2001 Ga0500641_0006504
2002 Ga0500595_000002
2003 Ga0500595_006663
2004 Ga0500595_060528
2005 Ga0500597_113490
2006 Ga0500652_000124
2007 Ga0500568_0017814
2008 Ga0500616_0000002
2009 Ga0500636_0010128
2010 Ga0500637_0018132
2011 Ga0500657_030092
2012 Ga0500645_000079
2013 Ga0500645_012709
2014 Ga0501084_0273441
2015 Ga0501082_0143552
2016 Ga0501082_0260535
2017 Ga0501082_0326967
2018 Ga0530510_0069943
2019 Ga0530510_0103959
2020 2513588979
2021 2643756121
2022 2861692043
2023 2909044155
2024 8002062950

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

231

320

0.97

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

105

187

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.9401 5 320
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.939 6 320
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9386 5 320
4x9o-assembly1.cif.gz_B beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate 0.9382 4 320
4ylt-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis 0.9348 5 320
ID Description Score Start End Superfamily
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9844 5 172 3.40.47.10
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9672 5 172 3.40.47.10
3il4B01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9662 3 172 3.40.47.10
1mzjA01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9657 5 166 3.40.47.10
2x3eB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9636 5 172 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A259KT87-F1-model_v4 3-oxoacyl-ACP synthase 0.9972 5 168 GO:0004315
GO:0006633
GO:0044550
AF-A0A3D1FU58-F1-model_v4 deleted 0.9884 4 172
AF-A0A3S3DM21-F1-model_v4 3-oxoacyl-ACP synthase (EC 2.3.1.180) 0.9882 4 133 GO:0004315
GO:0006633
GO:0033818
AF-A0A382KHD8-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III N-terminal domain-containing protein 0.9879 14 160 GO:0004315
GO:0006633
AF-A0A7C1H7X3-F1-model_v4 3-oxoacyl-ACP synthase 0.9869 5 144 GO:0004315
GO:0006633
GO:0044550

Map