F488185
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1012 | 456 | 2024 | 324 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2513237087|2513588979 |
| Length | 320 |
| Sequence | HSVVRGVGSYLPQKVLTNADLAHMVDTSDEWIVQRTGIRERHIAADGEFTSHLGLKAAQAALVDAGLTAADIDLIILATSTPDQTFPATAVTIQYELGITRGAAFDLQAVCSGFVFALATADAHLRMGSFKRALVIGAETFSRILDWQDRGTCVLFGDGAGAVVLEAVPEAEAQGRGLLTSHLRSDGRHRSKLFVDGGPSSTGTVGHLRMEGREVFKHAVGMITDVITDAFAATGQSADSIDWFVPHQANRRIIDASAQKLGIAPEKVVTTVQAHGNTSAASIPLALDVARRDGRIKDGDLVLLEAMGGGFTWGSALLRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 19 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 20 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 21 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 22 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 112 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 113 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 122 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 123 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 124 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 125 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 142 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 154 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 160 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 161 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 235 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 239 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 241 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 242 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 243 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 244 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 245 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 246 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 247 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 249 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 250 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 254 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 255 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 256 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 257 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 259 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 261 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 264 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 267 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 268 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 269 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 273 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 274 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 275 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 276 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 277 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 280 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 281 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 283 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 284 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 285 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 286 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 288 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 289 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 290 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 291 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 292 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 293 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 294 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 295 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 296 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 299 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 300 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 301 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 302 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 303 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 304 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 369 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 370 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 371 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 372 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 373 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 374 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 377 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 378 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 379 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 380 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 381 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 382 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 383 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 384 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 385 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 386 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 387 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 388 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 389 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 416 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 417 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 418 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 419 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 420 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 421 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 422 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 424 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 425 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 432 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 438 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 439 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 440 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 441 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 442 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 443 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 444 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 445 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 446 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 447 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 448 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 449 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 452 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 453 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 454 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 455 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 456 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.51 |
| Metatranscriptomes | 0 |
| Isolates | 0.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.55 |
| Nodule | 0.2 |
| Rhizoplane | 11.17 |
| Rhizosphere | 82.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214772991 | 2209111006 | Bacteria | 11804 |
| 2 | ARcpr5oldR_c000005 | 3300000041 | Bacteria | 43151 |
| 3 | ARSoilYngRDRAFT_c00062 | 3300000042 | Bacteria | 17580 |
| 4 | ARcpr5yngRDRAFT_c000132 | 3300000043 | Bacteria | 11738 |
| 5 | ARSoilOldRDRAFT_c000012 | 3300000044 | Bacteria | 42830 |
| 6 | ARCol0oldRDRAFT_c00643 | 3300000045 | Bacteria | 3066 |
| 7 | ARCol0yngRDRAFT_1000796 | 3300000652 | Bacteria | 2947 |
| 8 | JGI24032J14994_100303 | 3300001430 | Bacteria | 2617 |
| 9 | JGI24746J21847_1001998 | 3300001977 | Bacteria | 3251 |
| 10 | JGI24747J21853_1001524 | 3300001978 | Bacteria | 1751 |
| 11 | JGI24739J22299_10002632 | 3300001989 | Bacteria | 6914 |
| 12 | JGI24737J22298_10003528 | 3300001990 | Bacteria | 5511 |
| 13 | JGI24737J22298_10021312 | 3300001990 | Bacteria | 2066 |
| 14 | JGI24737J22298_10031640 | 3300001990 | Bacteria | 1651 |
| 15 | JGI24750J21931_1001120 | 3300002070 | Bacteria | 3451 |
| 16 | JGI24738J21930_10000471 | 3300002075 | Bacteria | 11404 |
| 17 | JGI24738J21930_10005129 | 3300002075 | Bacteria | 3165 |
| 18 | JGI24749J21850_1000776 | 3300002076 | Bacteria | 4600 |
| 19 | JGI24744J21845_10001246 | 3300002077 | Bacteria | 5007 |
| 20 | JGI24744J21845_10004033 | 3300002077 | Bacteria | 3031 |
| 21 | JGI24035J26624_1000132 | 3300002126 | Bacteria | 6606 |
| 22 | JGI24034J26672_10005421 | 3300002239 | Bacteria | 1829 |
| 23 | JGI24742J22300_10000997 | 3300002244 | Bacteria | 4353 |
| 24 | JGI24742J22300_10008454 | 3300002244 | Bacteria | 1698 |
| 25 | JGI24751J29686_10009497 | 3300002459 | Bacteria | 2001 |
| 26 | JGI25406J46586_10018079 | 3300003203 | Bacteria | 2901 |
| 27 | JGI26145J50221_1004021 | 3300003371 | Bacteria | 1184 |
| 28 | JGI25405J52794_10008617 | 3300003911 | Bacteria | 1909 |
| 29 | Ga0065704_10081191 | 3300005289 | Bacteria | 3805 |
| 30 | Ga0065712_10002169 | 3300005290 | Bacteria | 5824 |
| 31 | Ga0065712_10073252 | 3300005290 | Bacteria | 4450 |
| 32 | Ga0065712_10099736 | 3300005290 | Bacteria | 2082 |
| 33 | Ga0065715_10001386 | 3300005293 | Bacteria | 6343 |
| 34 | Ga0065715_10009694 | 3300005293 | Bacteria | 4472 |
| 35 | Ga0065707_10096006 | 3300005295 | Bacteria | 3314 |
| 36 | Ga0070658_10013815 | 3300005327 | Bacteria | 6478 |
| 37 | Ga0070676_10001202 | 3300005328 | Bacteria | 12981 |
| 38 | Ga0070676_10183306 | 3300005328 | Bacteria | 1363 |
| 39 | Ga0070683_100000121 | 3300005329 | Bacteria | 50845 |
| 40 | Ga0070683_100131943 | 3300005329 | Bacteria | 2364 |
| 41 | Ga0070683_100284959 | 3300005329 | Bacteria | 1572 |
| 42 | Ga0070690_100002752 | 3300005330 | Bacteria | 9491 |
| 43 | Ga0070690_100006624 | 3300005330 | Bacteria | 6579 |
| 44 | Ga0070670_100005999 | 3300005331 | Bacteria | 10273 |
| 45 | Ga0070670_100025980 | 3300005331 | Bacteria | 5039 |
| 46 | Ga0070670_100179980 | 3300005331 | Bacteria | 1835 |
| 47 | Ga0070677_10000055 | 3300005333 | Bacteria | 35005 |
| 48 | Ga0068869_100000507 | 3300005334 | Bacteria | 21693 |
| 49 | Ga0068869_100019313 | 3300005334 | Bacteria | 4654 |
| 50 | Ga0070666_10012614 | 3300005335 | Bacteria | 5338 |
| 51 | Ga0070680_100005908 | 3300005336 | Bacteria | 9298 |
| 52 | Ga0070680_100011815 | 3300005336 | Bacteria | 6773 |
| 53 | Ga0070680_100016969 | 3300005336 | Bacteria | 5733 |
| 54 | Ga0070680_100017302 | 3300005336 | Bacteria | 5681 |
| 55 | Ga0070680_100030986 | 3300005336 | Bacteria | 4297 |
| 56 | Ga0070680_100117489 | 3300005336 | Bacteria | 2217 |
| 57 | Ga0070682_100000697 | 3300005337 | Bacteria | 20192 |
| 58 | Ga0070682_100273732 | 3300005337 | Bacteria | 1228 |
| 59 | Ga0068868_100002501 | 3300005338 | Bacteria | 12763 |
| 60 | Ga0068868_100035322 | 3300005338 | Bacteria | 3863 |
| 61 | Ga0068868_100077704 | 3300005338 | Bacteria | 2656 |
| 62 | Ga0070660_100010372 | 3300005339 | Bacteria | 6584 |
| 63 | Ga0070660_100028614 | 3300005339 | Bacteria | 4171 |
| 64 | Ga0070660_100314752 | 3300005339 | Bacteria | 1285 |
| 65 | Ga0070689_100012275 | 3300005340 | Bacteria | 6165 |
| 66 | Ga0070689_100048589 | 3300005340 | Bacteria | 3272 |
| 67 | Ga0070691_10000371 | 3300005341 | Bacteria | 16253 |
| 68 | Ga0070691_10028064 | 3300005341 | Bacteria | 2628 |
| 69 | Ga0070691_10165461 | 3300005341 | Bacteria | 1143 |
| 70 | Ga0070687_100001534 | 3300005343 | Bacteria | 8181 |
| 71 | Ga0070687_100002788 | 3300005343 | Bacteria | 6647 |
| 72 | Ga0070661_100000881 | 3300005344 | Bacteria | 21577 |
| 73 | Ga0070661_100167073 | 3300005344 | Bacteria | 1669 |
| 74 | Ga0070692_10000573 | 3300005345 | Bacteria | 11543 |
| 75 | Ga0070692_10153207 | 3300005345 | Bacteria | 1315 |
| 76 | Ga0070668_100004237 | 3300005347 | Bacteria | 10641 |
| 77 | Ga0070669_100019063 | 3300005353 | Bacteria | 4904 |
| 78 | Ga0070675_100000698 | 3300005354 | Bacteria | 23271 |
| 79 | Ga0070671_100000344 | 3300005355 | Bacteria | 31796 |
| 80 | Ga0070671_100029375 | 3300005355 | Bacteria | 4532 |
| 81 | Ga0070674_100000116 | 3300005356 | Bacteria | 37121 |
| 82 | Ga0070674_100015198 | 3300005356 | Bacteria | 4802 |
| 83 | Ga0070674_100274556 | 3300005356 | Bacteria | 1334 |
| 84 | Ga0070673_100000335 | 3300005364 | Bacteria | 24640 |
| 85 | Ga0070688_100000565 | 3300005365 | Bacteria | 18794 |
| 86 | Ga0070688_100008099 | 3300005365 | Bacteria | 5694 |
| 87 | Ga0070688_100090102 | 3300005365 | Bacteria | 2002 |
| 88 | Ga0070659_100011128 | 3300005366 | Bacteria | 6647 |
| 89 | Ga0070659_100018339 | 3300005366 | Bacteria | 5282 |
| 90 | Ga0070659_100027308 | 3300005366 | Bacteria | 4397 |
| 91 | Ga0070667_100007699 | 3300005367 | Bacteria | 8931 |
| 92 | Ga0070667_100013516 | 3300005367 | Bacteria | 6746 |
| 93 | Ga0070703_10001252 | 3300005406 | Bacteria | 7724 |
| 94 | Ga0070709_10169730 | 3300005434 | Bacteria | 1524 |
| 95 | Ga0070714_100020545 | 3300005435 | Bacteria | 5395 |
| 96 | Ga0070714_100045875 | 3300005435 | Bacteria | 3705 |
| 97 | Ga0070713_100002431 | 3300005436 | Bacteria | 12142 |
| 98 | Ga0070713_100010201 | 3300005436 | Bacteria | 6778 |
| 99 | Ga0070710_10009728 | 3300005437 | Bacteria | 4709 |
| 100 | Ga0070710_10033533 | 3300005437 | Bacteria | 2788 |
| 101 | Ga0070701_10002810 | 3300005438 | Bacteria | 6773 |
| 102 | Ga0070711_100079500 | 3300005439 | Bacteria | 2332 |
| 103 | Ga0070700_100003137 | 3300005441 | Bacteria | 8491 |
| 104 | Ga0070700_100005744 | 3300005441 | Bacteria | 6584 |
| 105 | Ga0070694_100016106 | 3300005444 | Bacteria | 4705 |
| 106 | Ga0070708_100011088 | 3300005445 | Bacteria | 7325 |
| 107 | Ga0070708_100065932 | 3300005445 | Bacteria | 3248 |
| 108 | Ga0070663_100001736 | 3300005455 | Bacteria | 12106 |
| 109 | Ga0070678_100000684 | 3300005456 | Bacteria | 16710 |
| 110 | Ga0070678_100114286 | 3300005456 | Bacteria | 2117 |
| 111 | Ga0070662_100009413 | 3300005457 | Bacteria | 6385 |
| 112 | Ga0070662_100018312 | 3300005457 | Bacteria | 4736 |
| 113 | Ga0070681_10006902 | 3300005458 | Bacteria | 11053 |
| 114 | Ga0070681_10035745 | 3300005458 | Bacteria | 4990 |
| 115 | Ga0070681_10048173 | 3300005458 | Bacteria | 4259 |
| 116 | Ga0070681_10084994 | 3300005458 | Bacteria | 3117 |
| 117 | Ga0070681_10171796 | 3300005458 | Bacteria | 2089 |
| 118 | Ga0070681_10328290 | 3300005458 | Bacteria | 1439 |
| 119 | Ga0068867_100004625 | 3300005459 | Bacteria | 9680 |
| 120 | Ga0068867_100009831 | 3300005459 | Bacteria | 6741 |
| 121 | Ga0070685_10005786 | 3300005466 | Bacteria | 6283 |
| 122 | Ga0070699_100019789 | 3300005518 | Bacteria | 5802 |
| 123 | Ga0070699_100231316 | 3300005518 | Bacteria | 1648 |
| 124 | Ga0070679_100001791 | 3300005530 | Bacteria | 19375 |
| 125 | Ga0070679_100008142 | 3300005530 | Bacteria | 9848 |
| 126 | Ga0070679_100016614 | 3300005530 | Bacteria | 7107 |
| 127 | Ga0070679_100136896 | 3300005530 | Bacteria | 2430 |
| 128 | Ga0070679_100146739 | 3300005530 | Bacteria | 2336 |
| 129 | Ga0070679_100178887 | 3300005530 | Bacteria | 2094 |
| 130 | Ga0070684_100001949 | 3300005535 | Bacteria | 15134 |
| 131 | Ga0070684_100019580 | 3300005535 | Bacteria | 5600 |
| 132 | Ga0070684_100049176 | 3300005535 | Bacteria | 3659 |
| 133 | Ga0070684_100159405 | 3300005535 | Bacteria | 2046 |
| 134 | Ga0070684_100202680 | 3300005535 | Bacteria | 1807 |
| 135 | Ga0068853_100052344 | 3300005539 | Bacteria | 3517 |
| 136 | Ga0070672_100000741 | 3300005543 | Bacteria | 19384 |
| 137 | Ga0070672_100108447 | 3300005543 | Bacteria | 2260 |
| 138 | Ga0070686_100015489 | 3300005544 | Bacteria | 4419 |
| 139 | Ga0070686_100089857 | 3300005544 | Bacteria | 2052 |
| 140 | Ga0070695_100017329 | 3300005545 | Bacteria | 4367 |
| 141 | Ga0070695_100078555 | 3300005545 | Bacteria | 2176 |
| 142 | Ga0070696_100007917 | 3300005546 | Bacteria | 7095 |
| 143 | Ga0070696_100153046 | 3300005546 | Bacteria | 1694 |
| 144 | Ga0070693_100001254 | 3300005547 | Bacteria | 11478 |
| 145 | Ga0070665_100167151 | 3300005548 | Bacteria | 2202 |
| 146 | Ga0070704_100016209 | 3300005549 | Bacteria | 4705 |
| 147 | Ga0070704_100133876 | 3300005549 | Bacteria | 1925 |
| 148 | Ga0068855_100037835 | 3300005563 | Bacteria | 5734 |
| 149 | Ga0068855_100132920 | 3300005563 | Bacteria | 2840 |
| 150 | Ga0068855_100285980 | 3300005563 | Bacteria | 1829 |
| 151 | Ga0068855_100291685 | 3300005563 | Bacteria | 1808 |
| 152 | Ga0070664_100015589 | 3300005564 | Bacteria | 6218 |
| 153 | Ga0070664_100049402 | 3300005564 | Bacteria | 3557 |
| 154 | Ga0070664_100143819 | 3300005564 | Bacteria | 2102 |
| 155 | Ga0068857_100000680 | 3300005577 | Bacteria | 25262 |
| 156 | Ga0068857_100084599 | 3300005577 | Bacteria | 2835 |
| 157 | Ga0068854_100000760 | 3300005578 | Bacteria | 19146 |
| 158 | Ga0068854_100043012 | 3300005578 | Bacteria | 3200 |
| 159 | Ga0068856_100021374 | 3300005614 | Bacteria | 6291 |
| 160 | Ga0068856_100132118 | 3300005614 | Bacteria | 2501 |
| 161 | Ga0068856_100193544 | 3300005614 | Bacteria | 2047 |
| 162 | Ga0068856_100253426 | 3300005614 | Bacteria | 1775 |
| 163 | Ga0070702_100000099 | 3300005615 | Bacteria | 25765 |
| 164 | Ga0070702_100017518 | 3300005615 | Bacteria | 3696 |
| 165 | Ga0068852_100006331 | 3300005616 | Bacteria | 8540 |
| 166 | Ga0068852_100008756 | 3300005616 | Bacteria | 7484 |
| 167 | Ga0068852_100227776 | 3300005616 | Bacteria | 1776 |
| 168 | Ga0068864_100007872 | 3300005618 | Bacteria | 8782 |
| 169 | Ga0068864_100016990 | 3300005618 | Bacteria | 6063 |
| 170 | Ga0068866_10001741 | 3300005718 | Bacteria | 9153 |
| 171 | Ga0068861_100000354 | 3300005719 | Bacteria | 26182 |
| 172 | Ga0068851_10041813 | 3300005834 | Bacteria | 2306 |
| 173 | Ga0068870_10000395 | 3300005840 | Bacteria | 16399 |
| 174 | Ga0068870_10001588 | 3300005840 | Bacteria | 9245 |
| 175 | Ga0068863_100013197 | 3300005841 | Bacteria | 7969 |
| 176 | Ga0068863_100022985 | 3300005841 | Bacteria | 5959 |
| 177 | Ga0068863_100096898 | 3300005841 | Bacteria | 2800 |
| 178 | Ga0068858_100017831 | 3300005842 | Bacteria | 6647 |
| 179 | Ga0068858_100471127 | 3300005842 | Bacteria | 1211 |
| 180 | Ga0068860_100007901 | 3300005843 | Bacteria | 10619 |
| 181 | Ga0068860_100076788 | 3300005843 | Bacteria | 3176 |
| 182 | Ga0068862_100013455 | 3300005844 | Bacteria | 6773 |
| 183 | Ga0068862_100121952 | 3300005844 | Bacteria | 2298 |
| 184 | Ga0081455_10001802 | 3300005937 | Bacteria | 25849 |
| 185 | Ga0081455_10003948 | 3300005937 | Bacteria | 16849 |
| 186 | Ga0081455_10030623 | 3300005937 | Bacteria | 4885 |
| 187 | Ga0081455_10084380 | 3300005937 | Bacteria | 2593 |
| 188 | Ga0081455_10109865 | 3300005937 | Bacteria | 2194 |
| 189 | Ga0081538_10095390 | 3300005981 | Bacteria | 1520 |
| 190 | Ga0081540_1002931 | 3300005983 | Bacteria | 13732 |
| 191 | Ga0081540_1048597 | 3300005983 | Bacteria | 2123 |
| 192 | Ga0081539_10001708 | 3300005985 | Bacteria | 35326 |
| 193 | Ga0081539_10012080 | 3300005985 | Bacteria | 6711 |
| 194 | Ga0070717_10255293 | 3300006028 | Bacteria | 1550 |
| 195 | Ga0075365_10011867 | 3300006038 | Bacteria | 5144 |
| 196 | Ga0075368_10038471 | 3300006042 | Bacteria | 1873 |
| 197 | Ga0075368_10039207 | 3300006042 | Bacteria | 1856 |
| 198 | Ga0075363_100154783 | 3300006048 | Bacteria | 1295 |
| 199 | Ga0075364_10016148 | 3300006051 | Bacteria | 4642 |
| 200 | Ga0075364_10034753 | 3300006051 | Bacteria | 3255 |
| 201 | Ga0075364_10173808 | 3300006051 | Bacteria | 1456 |
| 202 | Ga0075432_10002763 | 3300006058 | Bacteria | 5880 |
| 203 | Ga0070715_10001764 | 3300006163 | Bacteria | 6436 |
| 204 | Ga0070712_100000678 | 3300006175 | Bacteria | 20131 |
| 205 | Ga0070712_100005205 | 3300006175 | Bacteria | 8045 |
| 206 | Ga0070712_100049283 | 3300006175 | Bacteria | 2924 |
| 207 | Ga0070712_100115745 | 3300006175 | Bacteria | 2010 |
| 208 | Ga0070712_100154789 | 3300006175 | Bacteria | 1764 |
| 209 | Ga0075362_10070817 | 3300006177 | Bacteria | 1592 |
| 210 | Ga0075367_10006100 | 3300006178 | Bacteria | 6058 |
| 211 | Ga0075367_10065074 | 3300006178 | Bacteria | 2182 |
| 212 | Ga0075369_10003043 | 3300006186 | Bacteria | 6066 |
| 213 | Ga0075369_10003164 | 3300006186 | Bacteria | 5969 |
| 214 | Ga0075369_10033244 | 3300006186 | Bacteria | 2185 |
| 215 | Ga0075427_10000518 | 3300006194 | Bacteria | 4424 |
| 216 | Ga0097621_100000430 | 3300006237 | Bacteria | 29289 |
| 217 | Ga0097621_100028001 | 3300006237 | Bacteria | 4436 |
| 218 | Ga0097621_100112102 | 3300006237 | Bacteria | 2305 |
| 219 | Ga0075370_10078231 | 3300006353 | Bacteria | 1899 |
| 220 | Ga0068871_100000243 | 3300006358 | Bacteria | 37961 |
| 221 | Ga0068871_100052395 | 3300006358 | Bacteria | 3305 |
| 222 | Ga0075428_100074221 | 3300006844 | Bacteria | 3715 |
| 223 | Ga0075428_100217373 | 3300006844 | Bacteria | 2064 |
| 224 | Ga0075430_100008258 | 3300006846 | Bacteria | 8792 |
| 225 | Ga0075430_100138898 | 3300006846 | Bacteria | 2024 |
| 226 | Ga0075431_100013105 | 3300006847 | Bacteria | 8377 |
| 227 | Ga0075433_10000023 | 3300006852 | Bacteria | 59195 |
| 228 | Ga0075433_10027633 | 3300006852 | Bacteria | 4814 |
| 229 | Ga0075433_10057801 | 3300006852 | Bacteria | 3391 |
| 230 | Ga0075434_100011469 | 3300006871 | Bacteria | 8363 |
| 231 | Ga0075434_100088050 | 3300006871 | Bacteria | 3106 |
| 232 | Ga0075434_100190266 | 3300006871 | Bacteria | 2072 |
| 233 | Ga0075429_100000227 | 3300006880 | Bacteria | 38168 |
| 234 | Ga0075429_100017930 | 3300006880 | Bacteria | 6121 |
| 235 | Ga0075429_100207939 | 3300006880 | Bacteria | 1715 |
| 236 | Ga0068865_100000675 | 3300006881 | Bacteria | 19258 |
| 237 | Ga0068865_100134708 | 3300006881 | Bacteria | 1855 |
| 238 | Ga0075436_100060467 | 3300006914 | Bacteria | 2617 |
| 239 | Ga0075435_100010404 | 3300007076 | Bacteria | 6805 |
| 240 | Ga0105251_10038039 | 3300009011 | Bacteria | 2358 |
| 241 | Ga0105244_10030760 | 3300009036 | Bacteria | 2854 |
| 242 | Ga0105240_10034321 | 3300009093 | Bacteria | 6545 |
| 243 | Ga0111539_10000561 | 3300009094 | Bacteria | 47610 |
| 244 | Ga0111539_10004002 | 3300009094 | Bacteria | 19352 |
| 245 | Ga0111539_10004660 | 3300009094 | Bacteria | 17922 |
| 246 | Ga0111539_10012526 | 3300009094 | Bacteria | 10628 |
| 247 | Ga0111539_10303003 | 3300009094 | Bacteria | 1860 |
| 248 | Ga0105245_10000943 | 3300009098 | Bacteria | 26432 |
| 249 | Ga0105245_10019420 | 3300009098 | Bacteria | 5953 |
| 250 | Ga0105247_10008605 | 3300009101 | Bacteria | 6221 |
| 251 | Ga0105247_10010184 | 3300009101 | Bacteria | 5693 |
| 252 | Ga0105247_10014588 | 3300009101 | Bacteria | 4713 |
| 253 | Ga0105247_10075754 | 3300009101 | Bacteria | 2112 |
| 254 | Ga0114129_10003375 | 3300009147 | Bacteria | 22429 |
| 255 | Ga0114129_10067744 | 3300009147 | Bacteria | 4977 |
| 256 | Ga0114129_10136853 | 3300009147 | Bacteria | 3360 |
| 257 | Ga0114129_10161019 | 3300009147 | Bacteria | 3065 |
| 258 | Ga0114129_10165742 | 3300009147 | Bacteria | 3016 |
| 259 | Ga0114129_10457612 | 3300009147 | Bacteria | 1673 |
| 260 | Ga0105243_10002854 | 3300009148 | Bacteria | 14321 |
| 261 | Ga0105243_10008993 | 3300009148 | Bacteria | 7635 |
| 262 | Ga0105243_10011868 | 3300009148 | Bacteria | 6589 |
| 263 | Ga0105243_10234057 | 3300009148 | Bacteria | 1631 |
| 264 | Ga0105241_10001331 | 3300009174 | Bacteria | 18766 |
| 265 | Ga0105241_10123091 | 3300009174 | Bacteria | 2091 |
| 266 | Ga0105242_10000036 | 3300009176 | Bacteria | 91470 |
| 267 | Ga0105242_10102489 | 3300009176 | Bacteria | 2427 |
| 268 | Ga0105242_10144878 | 3300009176 | Bacteria | 2065 |
| 269 | Ga0105248_10058205 | 3300009177 | Bacteria | 4339 |
| 270 | Ga0105248_10176664 | 3300009177 | Bacteria | 2406 |
| 271 | Ga0105248_10346351 | 3300009177 | Bacteria | 1673 |
| 272 | Ga0105237_10030440 | 3300009545 | Bacteria | 5482 |
| 273 | Ga0105237_10093691 | 3300009545 | Bacteria | 2993 |
| 274 | Ga0105238_10118261 | 3300009551 | Bacteria | 2630 |
| 275 | Ga0105238_10136258 | 3300009551 | Bacteria | 2433 |
| 276 | Ga0105238_10244135 | 3300009551 | Bacteria | 1774 |
| 277 | Ga0105238_10260465 | 3300009551 | Bacteria | 1714 |
| 278 | Ga0105238_10333042 | 3300009551 | Bacteria | 1505 |
| 279 | Ga0105249_10018622 | 3300009553 | Bacteria | 6183 |
| 280 | Ga0105249_10224425 | 3300009553 | Bacteria | 1850 |
| 281 | Ga0105249_10578243 | 3300009553 | Bacteria | 1176 |
| 282 | Ga0105239_10024026 | 3300010375 | Bacteria | 6713 |
| 283 | Ga0105239_10236007 | 3300010375 | Bacteria | 2052 |
| 284 | Ga0105239_10292968 | 3300010375 | Bacteria | 1832 |
| 285 | Ga0105239_10371948 | 3300010375 | Bacteria | 1615 |
| 286 | Ga0105246_10146328 | 3300011119 | Bacteria | 1783 |
| 287 | Ga0157342_1001381 | 3300012507 | Bacteria | 1781 |
| 288 | Ga0157342_1003146 | 3300012507 | Bacteria | 1397 |
| 289 | Ga0157373_10004533 | 3300013100 | Bacteria | 10449 |
| 290 | Ga0157373_10248740 | 3300013100 | Bacteria | 1257 |
| 291 | Ga0157371_10033655 | 3300013102 | Bacteria | 3681 |
| 292 | Ga0157370_10009857 | 3300013104 | Bacteria | 10125 |
| 293 | Ga0157369_10120649 | 3300013105 | Bacteria | 2782 |
| 294 | Ga0157369_10548126 | 3300013105 | Bacteria | 1195 |
| 295 | Ga0157374_10012850 | 3300013296 | Bacteria | 7292 |
| 296 | Ga0157374_10018742 | 3300013296 | Bacteria | 6114 |
| 297 | Ga0157374_10162136 | 3300013296 | Bacteria | 2178 |
| 298 | Ga0157378_10000462 | 3300013297 | Bacteria | 38648 |
| 299 | Ga0157378_10140239 | 3300013297 | Bacteria | 2244 |
| 300 | Ga0157378_10180837 | 3300013297 | Bacteria | 1984 |
| 301 | Ga0163162_10002063 | 3300013306 | Bacteria | 18880 |
| 302 | Ga0163162_10015790 | 3300013306 | Bacteria | 7380 |
| 303 | Ga0163162_10470279 | 3300013306 | Bacteria | 1389 |
| 304 | Ga0157372_10021178 | 3300013307 | Bacteria | 7024 |
| 305 | Ga0157372_10139453 | 3300013307 | Bacteria | 2792 |
| 306 | Ga0157372_10144115 | 3300013307 | Bacteria | 2747 |
| 307 | Ga0157375_10017542 | 3300013308 | Bacteria | 6464 |
| 308 | Ga0163163_10020553 | 3300014325 | Bacteria | 6220 |
| 309 | Ga0163163_10030054 | 3300014325 | Bacteria | 5230 |
| 310 | Ga0157380_10000274 | 3300014326 | Bacteria | 30965 |
| 311 | Ga0182008_10120456 | 3300014497 | Bacteria | 1304 |
| 312 | Ga0157377_10000470 | 3300014745 | Bacteria | 17366 |
| 313 | Ga0157379_10007174 | 3300014968 | Bacteria | 9642 |
| 314 | Ga0157379_10155045 | 3300014968 | Bacteria | 2066 |
| 315 | Ga0157379_10214428 | 3300014968 | Bacteria | 1743 |
| 316 | Ga0157376_10000508 | 3300014969 | Bacteria | 25164 |
| 317 | Ga0182007_10038335 | 3300015262 | Bacteria | 1607 |
| 318 | Ga0163161_10001021 | 3300017792 | Bacteria | 21333 |
| 319 | Ga0213872_10036843 | 3300021361 | Bacteria | 2234 |
| 320 | Ga0213872_10044315 | 3300021361 | Bacteria | 2025 |
| 321 | Ga0213874_10019175 | 3300021377 | Bacteria | 1859 |
| 322 | Ga0209233_1001929 | 3300025261 | Bacteria | 7926 |
| 323 | Ga0207666_1000356 | 3300025271 | Bacteria | 6282 |
| 324 | Ga0207673_1000077 | 3300025290 | Bacteria | 8568 |
| 325 | Ga0207697_10004946 | 3300025315 | Bacteria | 6282 |
| 326 | Ga0207697_10088865 | 3300025315 | Bacteria | 1308 |
| 327 | Ga0207656_10017829 | 3300025321 | Bacteria | 2787 |
| 328 | Ga0207653_10012306 | 3300025885 | Bacteria | 2671 |
| 329 | Ga0207682_10000135 | 3300025893 | Bacteria | 33308 |
| 330 | Ga0207642_10000073 | 3300025899 | Bacteria | 27837 |
| 331 | Ga0207710_10074385 | 3300025900 | Bacteria | 1564 |
| 332 | Ga0207688_10002338 | 3300025901 | Bacteria | 10187 |
| 333 | Ga0207688_10006665 | 3300025901 | Bacteria | 6282 |
| 334 | Ga0207680_10007561 | 3300025903 | Bacteria | 5305 |
| 335 | Ga0207647_10012910 | 3300025904 | Bacteria | 5804 |
| 336 | Ga0207647_10024800 | 3300025904 | Bacteria | 3951 |
| 337 | Ga0207647_10155504 | 3300025904 | Bacteria | 1335 |
| 338 | Ga0207685_10034337 | 3300025905 | Bacteria | 1842 |
| 339 | Ga0207699_10006915 | 3300025906 | Bacteria | 5520 |
| 340 | Ga0207699_10079107 | 3300025906 | Bacteria | 2033 |
| 341 | Ga0207645_10000457 | 3300025907 | Bacteria | 33747 |
| 342 | Ga0207643_10000853 | 3300025908 | Bacteria | 18464 |
| 343 | Ga0207643_10006512 | 3300025908 | Bacteria | 6255 |
| 344 | Ga0207705_10104455 | 3300025909 | Bacteria | 2087 |
| 345 | Ga0207684_10061490 | 3300025910 | Bacteria | 3189 |
| 346 | Ga0207654_10000638 | 3300025911 | Bacteria | 19789 |
| 347 | Ga0207707_10016702 | 3300025912 | Bacteria | 6398 |
| 348 | Ga0207707_10017958 | 3300025912 | Bacteria | 6167 |
| 349 | Ga0207707_10043824 | 3300025912 | Bacteria | 3901 |
| 350 | Ga0207707_10089331 | 3300025912 | Bacteria | 2692 |
| 351 | Ga0207671_10278740 | 3300025914 | Bacteria | 1318 |
| 352 | Ga0207693_10014951 | 3300025915 | Bacteria | 6233 |
| 353 | Ga0207693_10016289 | 3300025915 | Bacteria | 5944 |
| 354 | Ga0207693_10053723 | 3300025915 | Bacteria | 3161 |
| 355 | Ga0207693_10060824 | 3300025915 | Bacteria | 2958 |
| 356 | Ga0207693_10103895 | 3300025915 | Bacteria | 2228 |
| 357 | Ga0207693_10130652 | 3300025915 | Bacteria | 1974 |
| 358 | Ga0207663_10238495 | 3300025916 | Bacteria | 1332 |
| 359 | Ga0207660_10001020 | 3300025917 | Bacteria | 18545 |
| 360 | Ga0207660_10031240 | 3300025917 | Bacteria | 3665 |
| 361 | Ga0207660_10086873 | 3300025917 | Bacteria | 2310 |
| 362 | Ga0207662_10001714 | 3300025918 | Bacteria | 10736 |
| 363 | Ga0207662_10005471 | 3300025918 | Bacteria | 6773 |
| 364 | Ga0207657_10020840 | 3300025919 | Bacteria | 6186 |
| 365 | Ga0207657_10025718 | 3300025919 | Bacteria | 5422 |
| 366 | Ga0207657_10046593 | 3300025919 | Bacteria | 3797 |
| 367 | Ga0207657_10152850 | 3300025919 | Bacteria | 1879 |
| 368 | Ga0207649_10000760 | 3300025920 | Bacteria | 20983 |
| 369 | Ga0207652_10000764 | 3300025921 | Bacteria | 30807 |
| 370 | Ga0207646_10077702 | 3300025922 | Bacteria | 2966 |
| 371 | Ga0207681_10000065 | 3300025923 | Bacteria | 98832 |
| 372 | Ga0207694_10148672 | 3300025924 | Bacteria | 1886 |
| 373 | Ga0207650_10001773 | 3300025925 | Bacteria | 15269 |
| 374 | Ga0207650_10060316 | 3300025925 | Bacteria | 2831 |
| 375 | Ga0207650_10133917 | 3300025925 | Bacteria | 1942 |
| 376 | Ga0207650_10229691 | 3300025925 | Bacteria | 1496 |
| 377 | Ga0207659_10000142 | 3300025926 | Bacteria | 42302 |
| 378 | Ga0207687_10000125 | 3300025927 | Bacteria | 51567 |
| 379 | Ga0207687_10007547 | 3300025927 | Bacteria | 7151 |
| 380 | Ga0207700_10039274 | 3300025928 | Bacteria | 3444 |
| 381 | Ga0207700_10233078 | 3300025928 | Bacteria | 1566 |
| 382 | Ga0207700_10272524 | 3300025928 | Bacteria | 1453 |
| 383 | Ga0207664_10007299 | 3300025929 | Bacteria | 7663 |
| 384 | Ga0207644_10001470 | 3300025931 | Bacteria | 15193 |
| 385 | Ga0207644_10004403 | 3300025931 | Bacteria | 9137 |
| 386 | Ga0207690_10003823 | 3300025932 | Bacteria | 8908 |
| 387 | Ga0207690_10013751 | 3300025932 | Bacteria | 4872 |
| 388 | Ga0207706_10007990 | 3300025933 | Bacteria | 9770 |
| 389 | Ga0207706_10019275 | 3300025933 | Bacteria | 6135 |
| 390 | Ga0207706_10019316 | 3300025933 | Bacteria | 6129 |
| 391 | Ga0207686_10000344 | 3300025934 | Bacteria | 33461 |
| 392 | Ga0207686_10065309 | 3300025934 | Bacteria | 2320 |
| 393 | Ga0207709_10000183 | 3300025935 | Bacteria | 83374 |
| 394 | Ga0207670_10000288 | 3300025936 | Bacteria | 30769 |
| 395 | Ga0207670_10002143 | 3300025936 | Bacteria | 10333 |
| 396 | Ga0207670_10034555 | 3300025936 | Bacteria | 3269 |
| 397 | Ga0207670_10356562 | 3300025936 | Bacteria | 1159 |
| 398 | Ga0207669_10000081 | 3300025937 | Bacteria | 48214 |
| 399 | Ga0207669_10171644 | 3300025937 | Bacteria | 1544 |
| 400 | Ga0207704_10000121 | 3300025938 | Bacteria | 42395 |
| 401 | Ga0207704_10120340 | 3300025938 | Bacteria | 1795 |
| 402 | Ga0207704_10242918 | 3300025938 | Bacteria | 1347 |
| 403 | Ga0207665_10002359 | 3300025939 | Bacteria | 12750 |
| 404 | Ga0207665_10134599 | 3300025939 | Bacteria | 1757 |
| 405 | Ga0207691_10004599 | 3300025940 | Bacteria | 13358 |
| 406 | Ga0207691_10008864 | 3300025940 | Bacteria | 9655 |
| 407 | Ga0207711_10062918 | 3300025941 | Bacteria | 3202 |
| 408 | Ga0207689_10000696 | 3300025942 | Bacteria | 32214 |
| 409 | Ga0207689_10007426 | 3300025942 | Bacteria | 9611 |
| 410 | Ga0207689_10041147 | 3300025942 | Bacteria | 3824 |
| 411 | Ga0207661_10000286 | 3300025944 | Bacteria | 31850 |
| 412 | Ga0207661_10081972 | 3300025944 | Bacteria | 2666 |
| 413 | Ga0207661_10104153 | 3300025944 | Bacteria | 2389 |
| 414 | Ga0207661_10191694 | 3300025944 | Bacteria | 1792 |
| 415 | Ga0207679_10000064 | 3300025945 | Bacteria | 98118 |
| 416 | Ga0207679_10334608 | 3300025945 | Bacteria | 1315 |
| 417 | Ga0207679_10339599 | 3300025945 | Bacteria | 1306 |
| 418 | Ga0207667_10057387 | 3300025949 | Bacteria | 4086 |
| 419 | Ga0207667_10192677 | 3300025949 | Bacteria | 2091 |
| 420 | Ga0207667_10332016 | 3300025949 | Bacteria | 1552 |
| 421 | Ga0207651_10000395 | 3300025960 | Bacteria | 18475 |
| 422 | Ga0207651_10038681 | 3300025960 | Bacteria | 3138 |
| 423 | Ga0207712_10000752 | 3300025961 | Bacteria | 24492 |
| 424 | Ga0207668_10000715 | 3300025972 | Bacteria | 20294 |
| 425 | Ga0207668_10077636 | 3300025972 | Bacteria | 2395 |
| 426 | Ga0207640_10003491 | 3300025981 | Bacteria | 8467 |
| 427 | Ga0207640_10120683 | 3300025981 | Bacteria | 1877 |
| 428 | Ga0207658_10001038 | 3300025986 | Bacteria | 22571 |
| 429 | Ga0207658_10107419 | 3300025986 | Bacteria | 2199 |
| 430 | Ga0207677_10000985 | 3300026023 | Bacteria | 15691 |
| 431 | Ga0207677_10070724 | 3300026023 | Bacteria | 2460 |
| 432 | Ga0207703_10001400 | 3300026035 | Bacteria | 21963 |
| 433 | Ga0207639_10005141 | 3300026041 | Bacteria | 8820 |
| 434 | Ga0207639_10135522 | 3300026041 | Bacteria | 2044 |
| 435 | Ga0207678_10009603 | 3300026067 | Bacteria | 8508 |
| 436 | Ga0207678_10014572 | 3300026067 | Bacteria | 6917 |
| 437 | Ga0207678_10076643 | 3300026067 | Bacteria | 2864 |
| 438 | Ga0207708_10004954 | 3300026075 | Bacteria | 9817 |
| 439 | Ga0207708_10012692 | 3300026075 | Bacteria | 6282 |
| 440 | Ga0207708_10015109 | 3300026075 | Bacteria | 5784 |
| 441 | Ga0207702_10001395 | 3300026078 | Bacteria | 24082 |
| 442 | Ga0207702_10293109 | 3300026078 | Bacteria | 1542 |
| 443 | Ga0207641_10003265 | 3300026088 | Bacteria | 14436 |
| 444 | Ga0207641_10045617 | 3300026088 | Bacteria | 3691 |
| 445 | Ga0207648_10008132 | 3300026089 | Bacteria | 10204 |
| 446 | Ga0207648_10011624 | 3300026089 | Bacteria | 8288 |
| 447 | Ga0207648_10192382 | 3300026089 | Bacteria | 1808 |
| 448 | Ga0207676_10000079 | 3300026095 | Bacteria | 94811 |
| 449 | Ga0207674_10006886 | 3300026116 | Bacteria | 13321 |
| 450 | Ga0207674_10402282 | 3300026116 | Bacteria | 1323 |
| 451 | Ga0207675_100003662 | 3300026118 | Bacteria | 14985 |
| 452 | Ga0207675_100019734 | 3300026118 | Bacteria | 6291 |
| 453 | Ga0207675_100076823 | 3300026118 | Bacteria | 3127 |
| 454 | Ga0207683_10000037 | 3300026121 | Bacteria | 100920 |
| 455 | Ga0207683_10011735 | 3300026121 | Bacteria | 7478 |
| 456 | Ga0207683_10040380 | 3300026121 | Bacteria | 4072 |
| 457 | Ga0207683_10047045 | 3300026121 | Bacteria | 3778 |
| 458 | Ga0207683_10205675 | 3300026121 | Bacteria | 1790 |
| 459 | Ga0207698_10002333 | 3300026142 | Bacteria | 11239 |
| 460 | Ga0207698_10006345 | 3300026142 | Bacteria | 7368 |
| 461 | Ga0207698_10194099 | 3300026142 | Bacteria | 1812 |
| 462 | Ga0210002_1001169 | 3300027617 | Bacteria | 3654 |
| 463 | Ga0209966_1001440 | 3300027695 | Bacteria | 4125 |
| 464 | Ga0209998_10016721 | 3300027717 | Bacteria | 1545 |
| 465 | Ga0209974_10003753 | 3300027876 | Bacteria | 5440 |
| 466 | Ga0207428_10000292 | 3300027907 | Bacteria | 67070 |
| 467 | Ga0207428_10002255 | 3300027907 | Bacteria | 19356 |
| 468 | Ga0207428_10043033 | 3300027907 | Bacteria | 3650 |
| 469 | Ga0268266_10117991 | 3300028379 | Bacteria | 2359 |
| 470 | Ga0268266_10133590 | 3300028379 | Bacteria | 2221 |
| 471 | Ga0268265_10001133 | 3300028380 | Bacteria | 23531 |
| 472 | Ga0268265_10009438 | 3300028380 | Bacteria | 6588 |
| 473 | Ga0268265_10075768 | 3300028380 | Bacteria | 2637 |
| 474 | Ga0268264_10000805 | 3300028381 | Bacteria | 33825 |
| 475 | Ga0268264_10059829 | 3300028381 | Bacteria | 3193 |
| 476 | Ga0265330_10017320 | 3300031235 | Bacteria | 3319 |
| 477 | Ga0265330_10049817 | 3300031235 | Bacteria | 1838 |
| 478 | Ga0265332_10037858 | 3300031238 | Bacteria | 2091 |
| 479 | Ga0265328_10000155 | 3300031239 | Bacteria | 32139 |
| 480 | Ga0265328_10004630 | 3300031239 | Bacteria | 5956 |
| 481 | Ga0265325_10000006 | 3300031241 | Bacteria | 255758 |
| 482 | Ga0265325_10000743 | 3300031241 | Bacteria | 23567 |
| 483 | Ga0265325_10023635 | 3300031241 | Bacteria | 3351 |
| 484 | Ga0265325_10023675 | 3300031241 | Bacteria | 3348 |
| 485 | Ga0265325_10046577 | 3300031241 | Bacteria | 2248 |
| 486 | Ga0265325_10048882 | 3300031241 | Bacteria | 2184 |
| 487 | Ga0265329_10040204 | 3300031242 | Bacteria | 1501 |
| 488 | Ga0265329_10049964 | 3300031242 | Bacteria | 1332 |
| 489 | Ga0265340_10005222 | 3300031247 | Bacteria | 7211 |
| 490 | Ga0265340_10035015 | 3300031247 | Bacteria | 2494 |
| 491 | Ga0265331_10000005 | 3300031250 | Bacteria | 465192 |
| 492 | Ga0265331_10001410 | 3300031250 | Bacteria | 17644 |
| 493 | Ga0265331_10001741 | 3300031250 | Bacteria | 15639 |
| 494 | Ga0265327_10010541 | 3300031251 | Bacteria | 6478 |
| 495 | Ga0265316_10000387 | 3300031344 | Bacteria | 50269 |
| 496 | Ga0265313_10000553 | 3300031595 | Bacteria | 38982 |
| 497 | Ga0265313_10022732 | 3300031595 | Bacteria | 3394 |
| 498 | Ga0265313_10062417 | 3300031595 | Bacteria | 1741 |
| 499 | Ga0265313_10088789 | 3300031595 | Bacteria | 1391 |
| 500 | Ga0307508_10103695 | 3300031616 | Bacteria | 2440 |
| 501 | Ga0265314_10021841 | 3300031711 | Bacteria | 4911 |
| 502 | Ga0265314_10026031 | 3300031711 | Bacteria | 4402 |
| 503 | Ga0265314_10026645 | 3300031711 | Bacteria | 4339 |
| 504 | Ga0265314_10201691 | 3300031711 | Bacteria | 1175 |
| 505 | Ga0265342_10000011 | 3300031712 | Bacteria | 208435 |
| 506 | Ga0265342_10004370 | 3300031712 | Bacteria | 11169 |
| 507 | Ga0265342_10023672 | 3300031712 | Bacteria | 3883 |
| 508 | Ga0307510_10129905 | 3300033180 | Bacteria | 2196 |
| 509 | Ga0373930_0004021 | 3300034816 | Bacteria | 2369 |
| 510 | Ga0373950_0008814 | 3300034818 | Bacteria | 1596 |
| 511 | Ga0373958_0001465 | 3300034819 | Bacteria | 3176 |
| 512 | Ga0373958_0015703 | 3300034819 | Bacteria | 1341 |
| 513 | Ga0373938_0000063 | 3300034957 | Bacteria | 13779 |
| 514 | Ga0373938_0019066 | 3300034957 | Bacteria | 1368 |
| 515 | Ga0373926_0005620 | 3300035083 | Bacteria | 4136 |
| 516 | Ga0373926_0018917 | 3300035083 | Bacteria | 2373 |
| 517 | Ga0373926_0023654 | 3300035083 | Bacteria | 2135 |
| 518 | Ga0373928_0001474 | 3300035084 | Bacteria | 4578 |
| 519 | Ga0373929_0001110 | 3300035085 | Bacteria | 5223 |
| 520 | Ga0373940_0000418 | 3300035088 | Bacteria | 6472 |
| 521 | Ga0373940_0049936 | 3300035088 | Bacteria | 1172 |
| 522 | Ga0373944_0005850 | 3300035089 | Bacteria | 3254 |
| 523 | Ga0373949_0000779 | 3300035090 | Bacteria | 10258 |
| 524 | Ga0373949_0002326 | 3300035090 | Bacteria | 4938 |
| 525 | Ga0373951_0001074 | 3300035091 | Bacteria | 7317 |
| 526 | Ga0373952_0001672 | 3300035092 | Bacteria | 4033 |
| 527 | Ga0373952_0004710 | 3300035092 | Bacteria | 2480 |
| 528 | Ga0373923_0016457 | 3300035111 | Bacteria | 2810 |
| 529 | Ga0373923_0023882 | 3300035111 | Bacteria | 2409 |
| 530 | Ga0373923_0055561 | 3300035111 | Bacteria | 1669 |
| 531 | Ga0373932_0000516 | 3300035112 | Bacteria | 11899 |
| 532 | Ga0373932_0002506 | 3300035112 | Bacteria | 4619 |
| 533 | Ga0373932_0002800 | 3300035112 | Bacteria | 4321 |
| 534 | Ga0373936_0111308 | 3300035113 | Bacteria | 1163 |
| 535 | Ga0373939_0001269 | 3300035114 | Bacteria | 6162 |
| 536 | Ga0373939_0002352 | 3300035114 | Bacteria | 4472 |
| 537 | Ga0373939_0003293 | 3300035114 | Bacteria | 3791 |
| 538 | Ga0373941_0001012 | 3300035115 | Bacteria | 5840 |
| 539 | Ga0373941_0002320 | 3300035115 | Bacteria | 4170 |
| 540 | Ga0373953_0000171 | 3300035117 | Bacteria | 17129 |
| 541 | Ga0373953_0004537 | 3300035117 | Bacteria | 4433 |
| 542 | Ga0373953_0033793 | 3300035117 | Bacteria | 2002 |
| 543 | Ga0373954_0001704 | 3300035118 | Bacteria | 9020 |
| 544 | Ga0373954_0039628 | 3300035118 | Bacteria | 2193 |
| 545 | Ga0373956_0007874 | 3300035119 | Bacteria | 4299 |
| 546 | Ga0373956_0050932 | 3300035119 | Bacteria | 1860 |
| 547 | Ga0373957_0000100 | 3300035120 | Bacteria | 20828 |
| 548 | Ga0373960_0002055 | 3300035121 | Bacteria | 4527 |
| 549 | Ga0373960_0002580 | 3300035121 | Bacteria | 4090 |
| 550 | Ga0373943_0173049 | 3300035170 | Bacteria | 1182 |
| 551 | Ga0373946_0011600 | 3300035171 | Bacteria | 3291 |
| 552 | Ga0373946_0012514 | 3300035171 | Bacteria | 3177 |
| 553 | Ga0373955_0005067 | 3300035172 | Bacteria | 5891 |
| 554 | Ga0373955_0024025 | 3300035172 | Bacteria | 3112 |
| 555 | Ga0373942_0000898 | 3300035207 | Bacteria | 8141 |
| 556 | Ga0373942_0007710 | 3300035207 | Bacteria | 2503 |
| 557 | Ga0373962_0006516 | 3300035242 | Bacteria | 2829 |
| 558 | Ga0373924_0024194 | 3300035410 | Bacteria | 2391 |
| 559 | Ga0373924_0037768 | 3300035410 | Bacteria | 1968 |
| 560 | Ga0373931_0002005 | 3300035691 | Bacteria | 8964 |
| 561 | Ga0373931_0015704 | 3300035691 | Bacteria | 3716 |
| 562 | Ga0373931_0129586 | 3300035691 | Bacteria | 1450 |
| 563 | Ga0373935_0021083 | 3300035692 | Bacteria | 3988 |
| 564 | Ga0373935_0043578 | 3300035692 | Bacteria | 2824 |
| 565 | Ga0373927_0023381 | 3300035695 | Bacteria | 4047 |
| 566 | Ga0373927_0030690 | 3300035695 | Bacteria | 3506 |
| 567 | Ga0373927_0073054 | 3300035695 | Bacteria | 2221 |
| 568 | Ga0373927_0074566 | 3300035695 | Bacteria | 2197 |
| 569 | Ga0373927_0101689 | 3300035695 | Bacteria | 1869 |
| 570 | Ga0373927_0127892 | 3300035695 | Bacteria | 1659 |
| 571 | Ga0373933_0002823 | 3300035724 | Bacteria | 9705 |
| 572 | Ga0373947_0000637 | 3300035725 | Bacteria | 20738 |
| 573 | Ga0373947_0061380 | 3300035725 | Bacteria | 2284 |
| 574 | Ga0373937_0000915 | 3300036401 | Bacteria | 25081 |
| 575 | Ga0373937_0007517 | 3300036401 | Bacteria | 9432 |
| 576 | Ga0373937_0049609 | 3300036401 | Bacteria | 3843 |
| 577 | Ga0373937_0127276 | 3300036401 | Bacteria | 2377 |
| 578 | Ga0373925_0038714 | 3300037068 | Bacteria | 3526 |
| 579 | Ga0395899_0007257 | 3300037312 | Bacteria | 8576 |
| 580 | Ga0395899_0181312 | 3300037312 | Bacteria | 1478 |
| 581 | Ga0395900_0005384 | 3300037418 | Bacteria | 13408 |
| 582 | Ga0395900_0008739 | 3300037418 | Bacteria | 10404 |
| 583 | Ga0395900_0196626 | 3300037418 | Bacteria | 2042 |
| 584 | Ga0395898_0002953 | 3300037466 | Bacteria | 19329 |
| 585 | Ga0395898_0009867 | 3300037466 | Bacteria | 10010 |
| 586 | Ga0395898_0127576 | 3300037466 | Bacteria | 2437 |
| 587 | Ga0395901_0373677 | 3300038443 | Bacteria | 1468 |
| 588 | Ga0436365_1276737 | 3300039437 | Bacteria | 14687 |
| 589 | Ga0436365_1341680 | 3300039437 | Bacteria | 3228 |
| 590 | Ga0436360_1267809 | 3300039438 | Bacteria | 1040 |
| 591 | Ga0436361_0427176 | 3300039447 | Bacteria | 14155 |
| 592 | Ga0436361_0812703 | 3300039447 | Bacteria | 4735 |
| 593 | Ga0436363_0681660 | 3300039450 | Bacteria | 2044 |
| 594 | Ga0436363_1183746 | 3300039450 | Bacteria | 1404 |
| 595 | Ga0439465_0035307 | 3300041413 | Bacteria | 1603 |
| 596 | Ga0439441_007966 | 3300042001 | Bacteria | 1721 |
| 597 | Ga0466966_0060066 | 3300044684 | Bacteria | 2400 |
| 598 | Ga0466963_0051782 | 3300044694 | Bacteria | 2722 |
| 599 | Ga0466963_0141924 | 3300044694 | Bacteria | 1664 |
| 600 | Ga0466957_0049772 | 3300044842 | Bacteria | 2548 |
| 601 | Ga0466957_0095999 | 3300044842 | Bacteria | 1862 |
| 602 | Ga0466957_0104286 | 3300044842 | Bacteria | 1791 |
| 603 | Ga0466959_0013676 | 3300045049 | Bacteria | 5889 |
| 604 | Ga0466959_0042026 | 3300045049 | Bacteria | 3373 |
| 605 | Ga0451576_0158483 | 3300045051 | Bacteria | 2361 |
| 606 | Ga0466958_0066489 | 3300045836 | Bacteria | 2201 |
| 607 | Ga0466967_0006900 | 3300045976 | Bacteria | 8112 |
| 608 | Ga0495592_0000890 | 3300046454 | Bacteria | 20716 |
| 609 | Ga0495592_0004650 | 3300046454 | Bacteria | 10057 |
| 610 | Ga0495592_0029178 | 3300046454 | Bacteria | 4176 |
| 611 | Ga0495603_0007685 | 3300046455 | Bacteria | 6495 |
| 612 | Ga0495603_0171300 | 3300046455 | Bacteria | 1257 |
| 613 | Ga0495629_0001003 | 3300046459 | Bacteria | 22634 |
| 614 | Ga0495629_0001665 | 3300046459 | Bacteria | 17436 |
| 615 | Ga0495629_0031671 | 3300046459 | Bacteria | 3743 |
| 616 | Ga0495629_0032442 | 3300046459 | Bacteria | 3698 |
| 617 | Ga0495629_0108649 | 3300046459 | Bacteria | 1935 |
| 618 | Ga0495651_0004120 | 3300046462 | Bacteria | 11129 |
| 619 | Ga0495651_0007992 | 3300046462 | Bacteria | 8110 |
| 620 | Ga0495651_0033029 | 3300046462 | Bacteria | 4037 |
| 621 | Ga0495651_0281215 | 3300046462 | Bacteria | 1124 |
| 622 | Ga0495653_0000905 | 3300046463 | Bacteria | 22949 |
| 623 | Ga0495653_0016883 | 3300046463 | Bacteria | 5940 |
| 624 | Ga0495653_0082835 | 3300046463 | Bacteria | 2367 |
| 625 | Ga0495580_0034764 | 3300046472 | Bacteria | 3627 |
| 626 | Ga0495580_0064508 | 3300046472 | Bacteria | 2567 |
| 627 | Ga0495582_0025753 | 3300046473 | Bacteria | 3222 |
| 628 | Ga0495582_0044624 | 3300046473 | Bacteria | 2441 |
| 629 | Ga0495639_0018623 | 3300046475 | Bacteria | 3025 |
| 630 | Ga0495639_0039029 | 3300046475 | Bacteria | 2134 |
| 631 | Ga0495662_0018907 | 3300046476 | Bacteria | 3334 |
| 632 | Ga0495662_0088899 | 3300046476 | Bacteria | 1505 |
| 633 | Ga0495584_0004853 | 3300046491 | Bacteria | 7183 |
| 634 | Ga0495584_0110130 | 3300046491 | Bacteria | 1393 |
| 635 | Ga0495585_0004199 | 3300046492 | Bacteria | 9408 |
| 636 | Ga0495594_0044700 | 3300046499 | Bacteria | 2430 |
| 637 | Ga0495607_0008348 | 3300046501 | Bacteria | 7084 |
| 638 | Ga0495607_0084710 | 3300046501 | Bacteria | 1733 |
| 639 | Ga0495608_0005206 | 3300046511 | Bacteria | 9295 |
| 640 | Ga0495608_0083651 | 3300046511 | Bacteria | 2071 |
| 641 | Ga0495618_0064701 | 3300046514 | Bacteria | 2324 |
| 642 | Ga0495618_0076076 | 3300046514 | Bacteria | 2139 |
| 643 | Ga0495628_0001391 | 3300046516 | Bacteria | 22205 |
| 644 | Ga0495628_0113550 | 3300046516 | Bacteria | 2082 |
| 645 | Ga0495630_0090875 | 3300046517 | Bacteria | 2307 |
| 646 | Ga0495630_0119237 | 3300046517 | Bacteria | 2001 |
| 647 | Ga0495630_0153320 | 3300046517 | Bacteria | 1753 |
| 648 | Ga0495631_0117145 | 3300046518 | Bacteria | 1145 |
| 649 | Ga0495637_0057641 | 3300046520 | Bacteria | 1604 |
| 650 | Ga0495644_0001707 | 3300046523 | Bacteria | 8891 |
| 651 | Ga0495644_0022206 | 3300046523 | Bacteria | 2419 |
| 652 | Ga0495644_0067810 | 3300046523 | Bacteria | 1340 |
| 653 | Ga0495663_0015933 | 3300046525 | Bacteria | 2123 |
| 654 | Ga0495666_0005800 | 3300046526 | Bacteria | 6224 |
| 655 | Ga0495652_0006710 | 3300046529 | Bacteria | 10684 |
| 656 | Ga0495652_0046672 | 3300046529 | Bacteria | 3717 |
| 657 | Ga0495652_0092111 | 3300046529 | Bacteria | 2477 |
| 658 | Ga0495665_0027299 | 3300046531 | Bacteria | 3064 |
| 659 | Ga0495665_0070071 | 3300046531 | Bacteria | 1848 |
| 660 | Ga0495665_0116986 | 3300046531 | Bacteria | 1396 |
| 661 | Ga0495640_0002380 | 3300046533 | Bacteria | 15099 |
| 662 | Ga0495640_0029249 | 3300046533 | Bacteria | 3958 |
| 663 | Ga0495587_0001761 | 3300046536 | Bacteria | 14465 |
| 664 | Ga0495587_0009886 | 3300046536 | Bacteria | 6090 |
| 665 | Ga0495598_0002793 | 3300046537 | Bacteria | 3631 |
| 666 | Ga0495609_0024443 | 3300046538 | Bacteria | 2772 |
| 667 | Ga0495621_0051812 | 3300046539 | Bacteria | 1470 |
| 668 | Ga0495645_0000765 | 3300046543 | Bacteria | 21965 |
| 669 | Ga0495645_0011866 | 3300046543 | Bacteria | 6139 |
| 670 | Ga0495645_0065866 | 3300046543 | Bacteria | 2621 |
| 671 | Ga0495645_0082736 | 3300046543 | Bacteria | 2302 |
| 672 | Ga0495622_0027980 | 3300046557 | Bacteria | 2631 |
| 673 | Ga0495633_0003249 | 3300046558 | Bacteria | 10952 |
| 674 | Ga0495667_0004508 | 3300046559 | Bacteria | 9402 |
| 675 | Ga0495667_0039724 | 3300046559 | Bacteria | 3127 |
| 676 | Ga0495656_0000538 | 3300046615 | Bacteria | 12366 |
| 677 | Ga0495656_0078934 | 3300046615 | Bacteria | 1481 |
| 678 | Ga0495634_0037712 | 3300046642 | Bacteria | 3301 |
| 679 | Ga0495634_0057814 | 3300046642 | Bacteria | 2587 |
| 680 | Ga0495634_0130335 | 3300046642 | Bacteria | 1604 |
| 681 | Ga0495611_0109448 | 3300046648 | Bacteria | 1286 |
| 682 | Ga0495635_0008724 | 3300046663 | Bacteria | 7079 |
| 683 | Ga0495635_0038113 | 3300046663 | Bacteria | 3328 |
| 684 | Ga0495659_0004530 | 3300046664 | Bacteria | 4371 |
| 685 | Ga0495659_0005376 | 3300046664 | Bacteria | 4029 |
| 686 | Ga0495588_0002190 | 3300046674 | Bacteria | 8363 |
| 687 | Ga0495588_0013369 | 3300046674 | Bacteria | 3910 |
| 688 | Ga0495588_0073230 | 3300046674 | Bacteria | 1783 |
| 689 | Ga0495657_0001869 | 3300046675 | Bacteria | 17925 |
| 690 | Ga0495657_0029647 | 3300046675 | Bacteria | 3836 |
| 691 | Ga0495657_0106121 | 3300046675 | Bacteria | 1784 |
| 692 | Ga0495599_0037997 | 3300046678 | Bacteria | 3024 |
| 693 | Ga0495623_0001546 | 3300046679 | Bacteria | 15532 |
| 694 | Ga0495623_0042614 | 3300046679 | Bacteria | 2891 |
| 695 | Ga0495646_0002015 | 3300046680 | Bacteria | 12296 |
| 696 | Ga0495646_0043669 | 3300046680 | Bacteria | 2743 |
| 697 | Ga0495647_0002287 | 3300046681 | Bacteria | 6009 |
| 698 | Ga0495647_0023153 | 3300046681 | Bacteria | 2250 |
| 699 | Ga0495647_0027707 | 3300046681 | Bacteria | 2084 |
| 700 | Ga0495658_0000814 | 3300046683 | Bacteria | 16758 |
| 701 | Ga0495658_0036013 | 3300046683 | Bacteria | 2727 |
| 702 | Ga0495658_0124213 | 3300046683 | Bacteria | 1564 |
| 703 | Ga0495613_0009829 | 3300046689 | Bacteria | 7114 |
| 704 | Ga0495613_0033916 | 3300046689 | Bacteria | 3791 |
| 705 | Ga0495613_0054130 | 3300046689 | Bacteria | 2951 |
| 706 | Ga0495613_0164933 | 3300046689 | Bacteria | 1574 |
| 707 | Ga0495624_0013504 | 3300046690 | Bacteria | 5568 |
| 708 | Ga0495624_0146277 | 3300046690 | Bacteria | 1446 |
| 709 | Ga0495670_0002388 | 3300046691 | Bacteria | 9251 |
| 710 | Ga0495670_0008528 | 3300046691 | Bacteria | 5045 |
| 711 | Ga0495670_0067877 | 3300046691 | Bacteria | 1801 |
| 712 | Ga0495649_0042455 | 3300046694 | Bacteria | 2485 |
| 713 | Ga0495600_0000380 | 3300046809 | Bacteria | 23025 |
| 714 | Ga0495600_0024236 | 3300046809 | Bacteria | 3905 |
| 715 | Ga0495600_0052595 | 3300046809 | Bacteria | 2660 |
| 716 | Ga0495660_0071411 | 3300046810 | Bacteria | 1841 |
| 717 | Ga0495581_0055790 | 3300047315 | Bacteria | 2280 |
| 718 | Ga0495581_0208804 | 3300047315 | Bacteria | 1142 |
| 719 | Ga0495604_0003890 | 3300047317 | Bacteria | 11888 |
| 720 | Ga0495604_0012078 | 3300047317 | Bacteria | 6867 |
| 721 | Ga0495604_0156374 | 3300047317 | Bacteria | 1614 |
| 722 | Ga0495604_0305668 | 3300047317 | Bacteria | 1067 |
| 723 | Ga0495636_0017370 | 3300047318 | Bacteria | 2880 |
| 724 | Ga0495674_0144845 | 3300047319 | Bacteria | 1995 |
| 725 | Ga0495674_0185409 | 3300047319 | Bacteria | 1731 |
| 726 | Ga0495680_0007705 | 3300047322 | Bacteria | 9829 |
| 727 | Ga0495680_0046161 | 3300047322 | Bacteria | 3436 |
| 728 | Ga0495680_0080621 | 3300047322 | Bacteria | 2459 |
| 729 | Ga0495675_0003666 | 3300047444 | Bacteria | 9283 |
| 730 | Ga0495679_028996 | 3300047446 | Bacteria | 1809 |
| 731 | Ga0495684_0000942 | 3300047471 | Bacteria | 23681 |
| 732 | Ga0495684_0009099 | 3300047471 | Bacteria | 7672 |
| 733 | Ga0495684_0103061 | 3300047471 | Bacteria | 2157 |
| 734 | Ga0495593_0001112 | 3300047673 | Bacteria | 15705 |
| 735 | Ga0495593_0005331 | 3300047673 | Bacteria | 7603 |
| 736 | Ga0495593_0024206 | 3300047673 | Bacteria | 3367 |
| 737 | Ga0495593_0124173 | 3300047673 | Bacteria | 1313 |
| 738 | Ga0495602_0003245 | 3300048088 | Bacteria | 16794 |
| 739 | Ga0495602_0010887 | 3300048088 | Bacteria | 9426 |
| 740 | Ga0495614_0033804 | 3300048089 | Bacteria | 2199 |
| 741 | Ga0496100_0000280 | 3300048903 | Bacteria | 25823 |
| 742 | Ga0496100_0001702 | 3300048903 | Bacteria | 10941 |
| 743 | Ga0496100_0039476 | 3300048903 | Bacteria | 2998 |
| 744 | Ga0496100_0046758 | 3300048903 | Bacteria | 2785 |
| 745 | Ga0496100_0059116 | 3300048903 | Bacteria | 2517 |
| 746 | Ga0496100_0076430 | 3300048903 | Bacteria | 2248 |
| 747 | Ga0496100_0104167 | 3300048903 | Bacteria | 1960 |
| 748 | Ga0496101_0000842 | 3300048904 | Bacteria | 18039 |
| 749 | Ga0496101_0010098 | 3300048904 | Bacteria | 6225 |
| 750 | Ga0496101_0023716 | 3300048904 | Bacteria | 4241 |
| 751 | Ga0496101_0028308 | 3300048904 | Bacteria | 3911 |
| 752 | Ga0496102_0001974 | 3300048905 | Bacteria | 17705 |
| 753 | Ga0496102_0104824 | 3300048905 | Bacteria | 2630 |
| 754 | Ga0496102_0141938 | 3300048905 | Bacteria | 2252 |
| 755 | Ga0496102_0186117 | 3300048905 | Bacteria | 1957 |
| 756 | Ga0496102_0195804 | 3300048905 | Bacteria | 1904 |
| 757 | Ga0496103_0000571 | 3300048906 | Bacteria | 29249 |
| 758 | Ga0496103_0001934 | 3300048906 | Bacteria | 13423 |
| 759 | Ga0496103_0034020 | 3300048906 | Bacteria | 3115 |
| 760 | Ga0496103_0198077 | 3300048906 | Bacteria | 1291 |
| 761 | Ga0496104_0000062 | 3300048907 | Bacteria | 117255 |
| 762 | Ga0496104_0002831 | 3300048907 | Bacteria | 14969 |
| 763 | Ga0496104_0005648 | 3300048907 | Bacteria | 10953 |
| 764 | Ga0496104_0010124 | 3300048907 | Bacteria | 8419 |
| 765 | Ga0496104_0012909 | 3300048907 | Bacteria | 7522 |
| 766 | Ga0496104_0018615 | 3300048907 | Bacteria | 6338 |
| 767 | Ga0496104_0046451 | 3300048907 | Bacteria | 4090 |
| 768 | Ga0496104_0052304 | 3300048907 | Bacteria | 3857 |
| 769 | Ga0496104_0079107 | 3300048907 | Bacteria | 3133 |
| 770 | Ga0496104_0114608 | 3300048907 | Bacteria | 2585 |
| 771 | Ga0496104_0279147 | 3300048907 | Bacteria | 1584 |
| 772 | Ga0496104_0297502 | 3300048907 | Bacteria | 1526 |
| 773 | Ga0496104_0486334 | 3300048907 | Bacteria | 1145 |
| 774 | Ga0496105_0000248 | 3300048908 | Bacteria | 36266 |
| 775 | Ga0496105_0004144 | 3300048908 | Bacteria | 10875 |
| 776 | Ga0496105_0006737 | 3300048908 | Bacteria | 8833 |
| 777 | Ga0496105_0057362 | 3300048908 | Bacteria | 3215 |
| 778 | Ga0496105_0063009 | 3300048908 | Bacteria | 3059 |
| 779 | Ga0496105_0063920 | 3300048908 | Bacteria | 3036 |
| 780 | Ga0496105_0149701 | 3300048908 | Bacteria | 1919 |
| 781 | Ga0496105_0153994 | 3300048908 | Bacteria | 1888 |
| 782 | Ga0496105_0323041 | 3300048908 | Bacteria | 1236 |
| 783 | Ga0496105_0424348 | 3300048908 | Bacteria | 1052 |
| 784 | Ga0496106_0001303 | 3300048909 | Bacteria | 18732 |
| 785 | Ga0496106_0001661 | 3300048909 | Bacteria | 16698 |
| 786 | Ga0496106_0005281 | 3300048909 | Bacteria | 9569 |
| 787 | Ga0496106_0040324 | 3300048909 | Bacteria | 3496 |
| 788 | Ga0496106_0070619 | 3300048909 | Bacteria | 2667 |
| 789 | Ga0496106_0111500 | 3300048909 | Bacteria | 2130 |
| 790 | Ga0496107_0001700 | 3300048910 | Bacteria | 13784 |
| 791 | Ga0496107_0002060 | 3300048910 | Bacteria | 12854 |
| 792 | Ga0496107_0014742 | 3300048910 | Bacteria | 5474 |
| 793 | Ga0496107_0015601 | 3300048910 | Bacteria | 5326 |
| 794 | Ga0496107_0063112 | 3300048910 | Bacteria | 2684 |
| 795 | Ga0496107_0152405 | 3300048910 | Bacteria | 1710 |
| 796 | Ga0496107_0260023 | 3300048910 | Bacteria | 1291 |
| 797 | Ga0496107_0260037 | 3300048910 | Bacteria | 1291 |
| 798 | Ga0496108_0001882 | 3300048911 | Bacteria | 16811 |
| 799 | Ga0496108_0006924 | 3300048911 | Bacteria | 9176 |
| 800 | Ga0496108_0030571 | 3300048911 | Bacteria | 4463 |
| 801 | Ga0496108_0035403 | 3300048911 | Bacteria | 4150 |
| 802 | Ga0496108_0058129 | 3300048911 | Bacteria | 3249 |
| 803 | Ga0496109_0000260 | 3300048912 | Bacteria | 50877 |
| 804 | Ga0496109_0002958 | 3300048912 | Bacteria | 14216 |
| 805 | Ga0496109_0032397 | 3300048912 | Bacteria | 4698 |
| 806 | Ga0496109_0050133 | 3300048912 | Bacteria | 3802 |
| 807 | Ga0496109_0052153 | 3300048912 | Bacteria | 3727 |
| 808 | Ga0496109_0176527 | 3300048912 | Bacteria | 2005 |
| 809 | Ga0496109_0497643 | 3300048912 | Bacteria | 1150 |
| 810 | Ga0496110_0001367 | 3300048913 | Bacteria | 17572 |
| 811 | Ga0496110_0005035 | 3300048913 | Bacteria | 10325 |
| 812 | Ga0496110_0017894 | 3300048913 | Bacteria | 5933 |
| 813 | Ga0496110_0024032 | 3300048913 | Bacteria | 5192 |
| 814 | Ga0496110_0071711 | 3300048913 | Bacteria | 3072 |
| 815 | Ga0496110_0081393 | 3300048913 | Bacteria | 2886 |
| 816 | Ga0496110_0157096 | 3300048913 | Bacteria | 2060 |
| 817 | Ga0496110_0411118 | 3300048913 | Bacteria | 1233 |
| 818 | Ga0496111_0012211 | 3300048914 | Bacteria | 5809 |
| 819 | Ga0496111_0020763 | 3300048914 | Bacteria | 4578 |
| 820 | Ga0496111_0030755 | 3300048914 | Bacteria | 3819 |
| 821 | Ga0496111_0043626 | 3300048914 | Bacteria | 3223 |
| 822 | Ga0496111_0046368 | 3300048914 | Bacteria | 3129 |
| 823 | Ga0496111_0188462 | 3300048914 | Bacteria | 1533 |
| 824 | Ga0496111_0308141 | 3300048914 | Bacteria | 1173 |
| 825 | Ga0496112_0000945 | 3300048915 | Bacteria | 21079 |
| 826 | Ga0496112_0007228 | 3300048915 | Bacteria | 9841 |
| 827 | Ga0496112_0017732 | 3300048915 | Bacteria | 6700 |
| 828 | Ga0496112_0033955 | 3300048915 | Bacteria | 4962 |
| 829 | Ga0496112_0057850 | 3300048915 | Bacteria | 3818 |
| 830 | Ga0496112_0137851 | 3300048915 | Bacteria | 2409 |
| 831 | Ga0496112_0158049 | 3300048915 | Bacteria | 2233 |
| 832 | Ga0496112_0303975 | 3300048915 | Bacteria | 1540 |
| 833 | Ga0496112_0429436 | 3300048915 | Bacteria | 1259 |
| 834 | Ga0496113_0016864 | 3300048916 | Bacteria | 5055 |
| 835 | Ga0496113_0017758 | 3300048916 | Bacteria | 4945 |
| 836 | Ga0496113_0021366 | 3300048916 | Bacteria | 4565 |
| 837 | Ga0496113_0041169 | 3300048916 | Bacteria | 3407 |
| 838 | Ga0496113_0143252 | 3300048916 | Bacteria | 1881 |
| 839 | Ga0496113_0149487 | 3300048916 | Bacteria | 1842 |
| 840 | Ga0496114_0010719 | 3300048917 | Bacteria | 7295 |
| 841 | Ga0496114_0015222 | 3300048917 | Bacteria | 6183 |
| 842 | Ga0496114_0018780 | 3300048917 | Bacteria | 5595 |
| 843 | Ga0496114_0027109 | 3300048917 | Bacteria | 4692 |
| 844 | Ga0496114_0201646 | 3300048917 | Bacteria | 1742 |
| 845 | Ga0496115_0001610 | 3300048918 | Bacteria | 16223 |
| 846 | Ga0496115_0043160 | 3300048918 | Bacteria | 3595 |
| 847 | Ga0496115_0071037 | 3300048918 | Bacteria | 2823 |
| 848 | Ga0496115_0093987 | 3300048918 | Bacteria | 2452 |
| 849 | Ga0496115_0114110 | 3300048918 | Bacteria | 2220 |
| 850 | Ga0496115_0122648 | 3300048918 | Bacteria | 2139 |
| 851 | Ga0496115_0138981 | 3300048918 | Bacteria | 2003 |
| 852 | Ga0496115_0158327 | 3300048918 | Bacteria | 1871 |
| 853 | Ga0496115_0369534 | 3300048918 | Bacteria | 1167 |
| 854 | Ga0496117_0026851 | 3300048920 | Bacteria | 4497 |
| 855 | Ga0496118_0033619 | 3300048921 | Bacteria | 4204 |
| 856 | Ga0496119_0001630 | 3300048922 | Bacteria | 26493 |
| 857 | Ga0496119_0060256 | 3300048922 | Bacteria | 2274 |
| 858 | Ga0496121_0005711 | 3300048924 | Bacteria | 15800 |
| 859 | Ga0496121_0292001 | 3300048924 | Bacteria | 1110 |
| 860 | Ga0496124_0001010 | 3300048927 | Bacteria | 44569 |
| 861 | Ga0496125_0076589 | 3300048928 | Bacteria | 2582 |
| 862 | Ga0496126_0239033 | 3300048929 | Bacteria | 1518 |
| 863 | Ga0501031_0037770 | 3300049568 | Bacteria | 3152 |
| 864 | Ga0501031_0132538 | 3300049568 | Bacteria | 1628 |
| 865 | Ga0501034_0000097 | 3300049571 | Bacteria | 161027 |
| 866 | Ga0501034_0003862 | 3300049571 | Bacteria | 16878 |
| 867 | Ga0501034_0056039 | 3300049571 | Bacteria | 3967 |
| 868 | Ga0501034_0063450 | 3300049571 | Bacteria | 3708 |
| 869 | Ga0501034_0176007 | 3300049571 | Bacteria | 2105 |
| 870 | Ga0501034_0473333 | 3300049571 | Bacteria | 1168 |
| 871 | Ga0501034_0539840 | 3300049571 | Bacteria | 1076 |
| 872 | Ga0501036_0000198 | 3300049572 | Bacteria | 39881 |
| 873 | Ga0501036_0023367 | 3300049572 | Bacteria | 5207 |
| 874 | Ga0501036_0041532 | 3300049572 | Bacteria | 3890 |
| 875 | Ga0501037_0012328 | 3300049573 | Bacteria | 6292 |
| 876 | Ga0501037_0020433 | 3300049573 | Bacteria | 4889 |
| 877 | Ga0501038_0006501 | 3300049574 | Bacteria | 10816 |
| 878 | Ga0501038_0072276 | 3300049574 | Bacteria | 2923 |
| 879 | Ga0501038_0126237 | 3300049574 | Bacteria | 2105 |
| 880 | Ga0501039_0050488 | 3300049575 | Bacteria | 3218 |
| 881 | Ga0501039_0121828 | 3300049575 | Bacteria | 2044 |
| 882 | Ga0501040_0185170 | 3300049576 | Bacteria | 1477 |
| 883 | Ga0501043_0001799 | 3300049579 | Bacteria | 18425 |
| 884 | Ga0501043_0087364 | 3300049579 | Bacteria | 2450 |
| 885 | Ga0501043_0287202 | 3300049579 | Bacteria | 1260 |
| 886 | Ga0501047_0000257 | 3300049581 | Bacteria | 62079 |
| 887 | Ga0501047_0036109 | 3300049581 | Bacteria | 4775 |
| 888 | Ga0501048_0001287 | 3300049582 | Bacteria | 19026 |
| 889 | Ga0501067_0046974 | 3300049583 | Bacteria | 2396 |
| 890 | Ga0501068_0034779 | 3300049584 | Bacteria | 3006 |
| 891 | Ga0501068_0043470 | 3300049584 | Bacteria | 2703 |
| 892 | Ga0501070_0032521 | 3300049586 | Bacteria | 4366 |
| 893 | Ga0501070_0057411 | 3300049586 | Bacteria | 3226 |
| 894 | Ga0501070_0126120 | 3300049586 | Bacteria | 2115 |
| 895 | Ga0501070_0283649 | 3300049586 | Bacteria | 1351 |
| 896 | Ga0501071_0280970 | 3300049587 | Bacteria | 1260 |
| 897 | Ga0501072_0088233 | 3300049588 | Bacteria | 2461 |
| 898 | Ga0501073_0024896 | 3300049589 | Bacteria | 4295 |
| 899 | Ga0501074_0012029 | 3300049590 | Bacteria | 6287 |
| 900 | Ga0501075_0184227 | 3300049591 | Bacteria | 1593 |
| 901 | Ga0501076_0168642 | 3300049592 | Bacteria | 1784 |
| 902 | Ga0501079_0066283 | 3300049741 | Bacteria | 2786 |
| 903 | Ga0501080_0040549 | 3300049742 | Bacteria | 4342 |
| 904 | Ga0501081_0039930 | 3300049743 | Bacteria | 3213 |
| 905 | Ga0501081_0142249 | 3300049743 | Bacteria | 1720 |
| 906 | Ga0501083_0008682 | 3300049744 | Bacteria | 7164 |
| 907 | Ga0501083_0019073 | 3300049744 | Bacteria | 4776 |
| 908 | Ga0501083_0038174 | 3300049744 | Bacteria | 3266 |
| 909 | Ga0501083_0053537 | 3300049744 | Bacteria | 2709 |
| 910 | Ga0501083_0148289 | 3300049744 | Bacteria | 1536 |
| 911 | Ga0501035_0065880 | 3300049822 | Bacteria | 3215 |
| 912 | Ga0501035_0081968 | 3300049822 | Bacteria | 2847 |
| 913 | Ga0501035_0104063 | 3300049822 | Bacteria | 2489 |
| 914 | Ga0501044_0000238 | 3300049823 | Bacteria | 69472 |
| 915 | Ga0501044_0000841 | 3300049823 | Bacteria | 36801 |
| 916 | Ga0501045_0141750 | 3300049824 | Bacteria | 1787 |
| 917 | Ga0501045_0155456 | 3300049824 | Bacteria | 1702 |
| 918 | nmdc:mga03n38_30974_c1 | 3300050490 | Bacteria | 2254 |
| 919 | nmdc:mga00v17_23567_c1 | 3300050491 | Bacteria | 3561 |
| 920 | nmdc:mga00v17_82654_c1 | 3300050491 | Bacteria | 2008 |
| 921 | nmdc:mga0yw44_104323_c1 | 3300050492 | Bacteria | 1810 |
| 922 | nmdc:mga0yw44_15228_c1 | 3300050492 | Bacteria | 4112 |
| 923 | nmdc:mga0yw44_267518_c1 | 3300050492 | Bacteria | 1141 |
| 924 | nmdc:mga0yw44_7719_c1 | 3300050492 | Bacteria | 5311 |
| 925 | nmdc:mga0k408_5388_c1 | 3300050493 | Bacteria | 6805 |
| 926 | nmdc:mga06z11_116679_c1 | 3300050494 | Bacteria | 1485 |
| 927 | nmdc:mga06z11_46047_c1 | 3300050494 | Bacteria | 2208 |
| 928 | nmdc:mga04h51_90914_c1 | 3300050495 | Bacteria | 1098 |
| 929 | nmdc:mga07m45_167503_c1 | 3300050496 | Bacteria | 1276 |
| 930 | nmdc:mga07m45_174113_c1 | 3300050496 | Bacteria | 1251 |
| 931 | nmdc:mga07m45_43279_c1 | 3300050496 | Bacteria | 2525 |
| 932 | nmdc:mga05p37_1109_c1 | 3300050507 | Bacteria | 30953 |
| 933 | nmdc:mga05p37_22888_c1 | 3300050507 | Bacteria | 7578 |
| 934 | nmdc:mga05p37_36053_c1 | 3300050507 | Bacteria | 6069 |
| 935 | nmdc:mga05p37_366858_c1 | 3300050507 | Bacteria | 1691 |
| 936 | nmdc:mga05p37_3812_c1 | 3300050507 | Bacteria | 17636 |
| 937 | nmdc:mga05p37_79233_c1 | 3300050507 | Bacteria | 4045 |
| 938 | nmdc:mga05p37_93412_c1 | 3300050507 | Bacteria | 3707 |
| 939 | nmdc:mga09592_33106_c1 | 3300050508 | Bacteria | 4312 |
| 940 | nmdc:mga09592_399604_c1 | 3300050508 | Bacteria | 1188 |
| 941 | nmdc:mga09592_470_c1 | 3300050508 | Bacteria | 30193 |
| 942 | nmdc:mga0qj67_1459_c1 | 3300050509 | Bacteria | 16581 |
| 943 | nmdc:mga0qj67_22131_c1 | 3300050509 | Bacteria | 4880 |
| 944 | nmdc:mga06r32_284989_c1 | 3300050510 | Bacteria | 1639 |
| 945 | nmdc:mga08y16_2292_c1 | 3300050511 | Bacteria | 19584 |
| 946 | nmdc:mga08y16_299957_c1 | 3300050511 | Bacteria | 1656 |
| 947 | nmdc:mga08y16_362073_c1 | 3300050511 | Bacteria | 1489 |
| 948 | nmdc:mga08y16_855_c1 | 3300050511 | Bacteria | 29241 |
| 949 | nmdc:mga08y16_8714_c1 | 3300050511 | Bacteria | 10636 |
| 950 | nmdc:mga08y16_95295_c1 | 3300050511 | Bacteria | 3100 |
| 951 | nmdc:mga0n895_1286_c1 | 3300050512 | Bacteria | 18558 |
| 952 | nmdc:mga0n895_2848_c1 | 3300050512 | Bacteria | 13703 |
| 953 | nmdc:mga0n895_79530_c1 | 3300050512 | Bacteria | 3265 |
| 954 | nmdc:mga0n895_94110_c1 | 3300050512 | Bacteria | 3000 |
| 955 | nmdc:mga0rr50_15409_c1 | 3300050513 | Bacteria | 5046 |
| 956 | nmdc:mga0rr50_171644_c1 | 3300050513 | Bacteria | 1767 |
| 957 | nmdc:mga08x19_47018_c1 | 3300050514 | Bacteria | 2761 |
| 958 | nmdc:mga0a205_172099_c1 | 3300050515 | Bacteria | 2061 |
| 959 | nmdc:mga0a205_485_c1 | 3300050515 | Bacteria | 16164 |
| 960 | nmdc:mga0a205_51775_c1 | 3300050515 | Bacteria | 3964 |
| 961 | nmdc:mga0a205_6599_c1 | 3300050515 | Bacteria | 10497 |
| 962 | nmdc:mga0sz30_47743_c1 | 3300050516 | Bacteria | 1810 |
| 963 | Ga0495601_0000414 | 3300053077 | Bacteria | 22360 |
| 964 | Ga0495601_0010490 | 3300053077 | Bacteria | 5516 |
| 965 | Ga0495601_0024580 | 3300053077 | Bacteria | 3711 |
| 966 | Ga0495601_0030002 | 3300053077 | Bacteria | 3375 |
| 967 | Ga0495601_0050437 | 3300053077 | Bacteria | 2625 |
| 968 | Ga0495601_0061134 | 3300053077 | Bacteria | 2391 |
| 969 | Ga0495612_0000736 | 3300053078 | Bacteria | 13291 |
| 970 | Ga0495612_0014780 | 3300053078 | Bacteria | 3132 |
| 971 | Ga0495595_0000897 | 3300053084 | Bacteria | 11454 |
| 972 | Ga0495595_0006151 | 3300053084 | Bacteria | 4880 |
| 973 | Ga0495595_0022375 | 3300053084 | Bacteria | 2775 |
| 974 | Ga0495595_0039745 | 3300053084 | Bacteria | 2147 |
| 975 | Ga0495595_0040979 | 3300053084 | Bacteria | 2117 |
| 976 | Ga0495595_0054647 | 3300053084 | Bacteria | 1857 |
| 977 | Ga0495619_0000097 | 3300053085 | Bacteria | 65411 |
| 978 | Ga0495619_0000646 | 3300053085 | Bacteria | 22914 |
| 979 | Ga0495619_0001717 | 3300053085 | Bacteria | 14530 |
| 980 | Ga0495619_0002583 | 3300053085 | Bacteria | 11827 |
| 981 | Ga0495619_0011191 | 3300053085 | Bacteria | 5642 |
| 982 | Ga0495619_0013003 | 3300053085 | Bacteria | 5243 |
| 983 | Ga0495619_0025301 | 3300053085 | Bacteria | 3811 |
| 984 | Ga0495619_0037282 | 3300053085 | Bacteria | 3166 |
| 985 | Ga0495619_0103875 | 3300053085 | Bacteria | 1936 |
| 986 | Ga0500644_0000429 | 3300053088 | Bacteria | 19667 |
| 987 | Ga0500651_0049303 | 3300053093 | Bacteria | 2645 |
| 988 | Ga0500566_0036855 | 3300053094 | Bacteria | 2836 |
| 989 | Ga0500641_0006504 | 3300053096 | Bacteria | 4145 |
| 990 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 991 | Ga0500595_006663 | 3300053119 | Bacteria | 4872 |
| 992 | Ga0500595_060528 | 3300053119 | Bacteria | 1145 |
| 993 | Ga0500597_113490 | 3300053120 | Bacteria | 1176 |
| 994 | Ga0500652_000124 | 3300053131 | Bacteria | 29312 |
| 995 | Ga0500568_0017814 | 3300053139 | Bacteria | 3125 |
| 996 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 997 | Ga0500636_0010128 | 3300053177 | Bacteria | 5495 |
| 998 | Ga0500637_0018132 | 3300053178 | Bacteria | 3777 |
| 999 | Ga0500657_030092 | 3300053728 | Bacteria | 2557 |
| 1000 | Ga0500645_000079 | 3300053730 | Bacteria | 76832 |
| 1001 | Ga0500645_012709 | 3300053730 | Bacteria | 2716 |
| 1002 | Ga0501084_0273441 | 3300054114 | Bacteria | 1426 |
| 1003 | Ga0501082_0143552 | 3300060353 | Bacteria | 2072 |
| 1004 | Ga0501082_0260535 | 3300060353 | Bacteria | 1508 |
| 1005 | Ga0501082_0326967 | 3300060353 | Bacteria | 1336 |
| 1006 | Ga0530510_0069943 | 3300061734 | Bacteria | 2547 |
| 1007 | Ga0530510_0103959 | 3300061734 | Bacteria | 2078 |
| 1008 | 2513588979 | 2513237087 | Bacteria | 5817514 |
| 1009 | 2643756121 | 2643221547 | Bacteria | 4740017 |
| 1010 | 2861692043 | 2861691609 | Bacteria | 5628931 |
| 1011 | 2909044155 | 2909042592 | Bacteria | 6499737 |
| 1012 | 8002062950 | 8002060224 | Bacteria | 4026565 |
| 1013 | 2214772991 | |||
| 1014 | ARcpr5oldR_c000005 | |||
| 1015 | ARSoilYngRDRAFT_c00062 | |||
| 1016 | ARcpr5yngRDRAFT_c000132 | |||
| 1017 | ARSoilOldRDRAFT_c000012 | |||
| 1018 | ARCol0oldRDRAFT_c00643 | |||
| 1019 | ARCol0yngRDRAFT_1000796 | |||
| 1020 | JGI24032J14994_100303 | |||
| 1021 | JGI24746J21847_1001998 | |||
| 1022 | JGI24747J21853_1001524 | |||
| 1023 | JGI24739J22299_10002632 | |||
| 1024 | JGI24737J22298_10003528 | |||
| 1025 | JGI24737J22298_10021312 | |||
| 1026 | JGI24737J22298_10031640 | |||
| 1027 | JGI24750J21931_1001120 | |||
| 1028 | JGI24738J21930_10000471 | |||
| 1029 | JGI24738J21930_10005129 | |||
| 1030 | JGI24749J21850_1000776 | |||
| 1031 | JGI24744J21845_10001246 | |||
| 1032 | JGI24744J21845_10004033 | |||
| 1033 | JGI24035J26624_1000132 | |||
| 1034 | JGI24034J26672_10005421 | |||
| 1035 | JGI24742J22300_10000997 | |||
| 1036 | JGI24742J22300_10008454 | |||
| 1037 | JGI24751J29686_10009497 | |||
| 1038 | JGI25406J46586_10018079 | |||
| 1039 | JGI26145J50221_1004021 | |||
| 1040 | JGI25405J52794_10008617 | |||
| 1041 | Ga0065704_10081191 | |||
| 1042 | Ga0065712_10002169 | |||
| 1043 | Ga0065712_10073252 | |||
| 1044 | Ga0065712_10099736 | |||
| 1045 | Ga0065715_10001386 | |||
| 1046 | Ga0065715_10009694 | |||
| 1047 | Ga0065707_10096006 | |||
| 1048 | Ga0070658_10013815 | |||
| 1049 | Ga0070676_10001202 | |||
| 1050 | Ga0070676_10183306 | |||
| 1051 | Ga0070683_100000121 | |||
| 1052 | Ga0070683_100131943 | |||
| 1053 | Ga0070683_100284959 | |||
| 1054 | Ga0070690_100002752 | |||
| 1055 | Ga0070690_100006624 | |||
| 1056 | Ga0070670_100005999 | |||
| 1057 | Ga0070670_100025980 | |||
| 1058 | Ga0070670_100179980 | |||
| 1059 | Ga0070677_10000055 | |||
| 1060 | Ga0068869_100000507 | |||
| 1061 | Ga0068869_100019313 | |||
| 1062 | Ga0070666_10012614 | |||
| 1063 | Ga0070680_100005908 | |||
| 1064 | Ga0070680_100011815 | |||
| 1065 | Ga0070680_100016969 | |||
| 1066 | Ga0070680_100017302 | |||
| 1067 | Ga0070680_100030986 | |||
| 1068 | Ga0070680_100117489 | |||
| 1069 | Ga0070682_100000697 | |||
| 1070 | Ga0070682_100273732 | |||
| 1071 | Ga0068868_100002501 | |||
| 1072 | Ga0068868_100035322 | |||
| 1073 | Ga0068868_100077704 | |||
| 1074 | Ga0070660_100010372 | |||
| 1075 | Ga0070660_100028614 | |||
| 1076 | Ga0070660_100314752 | |||
| 1077 | Ga0070689_100012275 | |||
| 1078 | Ga0070689_100048589 | |||
| 1079 | Ga0070691_10000371 | |||
| 1080 | Ga0070691_10028064 | |||
| 1081 | Ga0070691_10165461 | |||
| 1082 | Ga0070687_100001534 | |||
| 1083 | Ga0070687_100002788 | |||
| 1084 | Ga0070661_100000881 | |||
| 1085 | Ga0070661_100167073 | |||
| 1086 | Ga0070692_10000573 | |||
| 1087 | Ga0070692_10153207 | |||
| 1088 | Ga0070668_100004237 | |||
| 1089 | Ga0070669_100019063 | |||
| 1090 | Ga0070675_100000698 | |||
| 1091 | Ga0070671_100000344 | |||
| 1092 | Ga0070671_100029375 | |||
| 1093 | Ga0070674_100000116 | |||
| 1094 | Ga0070674_100015198 | |||
| 1095 | Ga0070674_100274556 | |||
| 1096 | Ga0070673_100000335 | |||
| 1097 | Ga0070688_100000565 | |||
| 1098 | Ga0070688_100008099 | |||
| 1099 | Ga0070688_100090102 | |||
| 1100 | Ga0070659_100011128 | |||
| 1101 | Ga0070659_100018339 | |||
| 1102 | Ga0070659_100027308 | |||
| 1103 | Ga0070667_100007699 | |||
| 1104 | Ga0070667_100013516 | |||
| 1105 | Ga0070703_10001252 | |||
| 1106 | Ga0070709_10169730 | |||
| 1107 | Ga0070714_100020545 | |||
| 1108 | Ga0070714_100045875 | |||
| 1109 | Ga0070713_100002431 | |||
| 1110 | Ga0070713_100010201 | |||
| 1111 | Ga0070710_10009728 | |||
| 1112 | Ga0070710_10033533 | |||
| 1113 | Ga0070701_10002810 | |||
| 1114 | Ga0070711_100079500 | |||
| 1115 | Ga0070700_100003137 | |||
| 1116 | Ga0070700_100005744 | |||
| 1117 | Ga0070694_100016106 | |||
| 1118 | Ga0070708_100011088 | |||
| 1119 | Ga0070708_100065932 | |||
| 1120 | Ga0070663_100001736 | |||
| 1121 | Ga0070678_100000684 | |||
| 1122 | Ga0070678_100114286 | |||
| 1123 | Ga0070662_100009413 | |||
| 1124 | Ga0070662_100018312 | |||
| 1125 | Ga0070681_10006902 | |||
| 1126 | Ga0070681_10035745 | |||
| 1127 | Ga0070681_10048173 | |||
| 1128 | Ga0070681_10084994 | |||
| 1129 | Ga0070681_10171796 | |||
| 1130 | Ga0070681_10328290 | |||
| 1131 | Ga0068867_100004625 | |||
| 1132 | Ga0068867_100009831 | |||
| 1133 | Ga0070685_10005786 | |||
| 1134 | Ga0070699_100019789 | |||
| 1135 | Ga0070699_100231316 | |||
| 1136 | Ga0070679_100001791 | |||
| 1137 | Ga0070679_100008142 | |||
| 1138 | Ga0070679_100016614 | |||
| 1139 | Ga0070679_100136896 | |||
| 1140 | Ga0070679_100146739 | |||
| 1141 | Ga0070679_100178887 | |||
| 1142 | Ga0070684_100001949 | |||
| 1143 | Ga0070684_100019580 | |||
| 1144 | Ga0070684_100049176 | |||
| 1145 | Ga0070684_100159405 | |||
| 1146 | Ga0070684_100202680 | |||
| 1147 | Ga0068853_100052344 | |||
| 1148 | Ga0070672_100000741 | |||
| 1149 | Ga0070672_100108447 | |||
| 1150 | Ga0070686_100015489 | |||
| 1151 | Ga0070686_100089857 | |||
| 1152 | Ga0070695_100017329 | |||
| 1153 | Ga0070695_100078555 | |||
| 1154 | Ga0070696_100007917 | |||
| 1155 | Ga0070696_100153046 | |||
| 1156 | Ga0070693_100001254 | |||
| 1157 | Ga0070665_100167151 | |||
| 1158 | Ga0070704_100016209 | |||
| 1159 | Ga0070704_100133876 | |||
| 1160 | Ga0068855_100037835 | |||
| 1161 | Ga0068855_100132920 | |||
| 1162 | Ga0068855_100285980 | |||
| 1163 | Ga0068855_100291685 | |||
| 1164 | Ga0070664_100015589 | |||
| 1165 | Ga0070664_100049402 | |||
| 1166 | Ga0070664_100143819 | |||
| 1167 | Ga0068857_100000680 | |||
| 1168 | Ga0068857_100084599 | |||
| 1169 | Ga0068854_100000760 | |||
| 1170 | Ga0068854_100043012 | |||
| 1171 | Ga0068856_100021374 | |||
| 1172 | Ga0068856_100132118 | |||
| 1173 | Ga0068856_100193544 | |||
| 1174 | Ga0068856_100253426 | |||
| 1175 | Ga0070702_100000099 | |||
| 1176 | Ga0070702_100017518 | |||
| 1177 | Ga0068852_100006331 | |||
| 1178 | Ga0068852_100008756 | |||
| 1179 | Ga0068852_100227776 | |||
| 1180 | Ga0068864_100007872 | |||
| 1181 | Ga0068864_100016990 | |||
| 1182 | Ga0068866_10001741 | |||
| 1183 | Ga0068861_100000354 | |||
| 1184 | Ga0068851_10041813 | |||
| 1185 | Ga0068870_10000395 | |||
| 1186 | Ga0068870_10001588 | |||
| 1187 | Ga0068863_100013197 | |||
| 1188 | Ga0068863_100022985 | |||
| 1189 | Ga0068863_100096898 | |||
| 1190 | Ga0068858_100017831 | |||
| 1191 | Ga0068858_100471127 | |||
| 1192 | Ga0068860_100007901 | |||
| 1193 | Ga0068860_100076788 | |||
| 1194 | Ga0068862_100013455 | |||
| 1195 | Ga0068862_100121952 | |||
| 1196 | Ga0081455_10001802 | |||
| 1197 | Ga0081455_10003948 | |||
| 1198 | Ga0081455_10030623 | |||
| 1199 | Ga0081455_10084380 | |||
| 1200 | Ga0081455_10109865 | |||
| 1201 | Ga0081538_10095390 | |||
| 1202 | Ga0081540_1002931 | |||
| 1203 | Ga0081540_1048597 | |||
| 1204 | Ga0081539_10001708 | |||
| 1205 | Ga0081539_10012080 | |||
| 1206 | Ga0070717_10255293 | |||
| 1207 | Ga0075365_10011867 | |||
| 1208 | Ga0075368_10038471 | |||
| 1209 | Ga0075368_10039207 | |||
| 1210 | Ga0075363_100154783 | |||
| 1211 | Ga0075364_10016148 | |||
| 1212 | Ga0075364_10034753 | |||
| 1213 | Ga0075364_10173808 | |||
| 1214 | Ga0075432_10002763 | |||
| 1215 | Ga0070715_10001764 | |||
| 1216 | Ga0070712_100000678 | |||
| 1217 | Ga0070712_100005205 | |||
| 1218 | Ga0070712_100049283 | |||
| 1219 | Ga0070712_100115745 | |||
| 1220 | Ga0070712_100154789 | |||
| 1221 | Ga0075362_10070817 | |||
| 1222 | Ga0075367_10006100 | |||
| 1223 | Ga0075367_10065074 | |||
| 1224 | Ga0075369_10003043 | |||
| 1225 | Ga0075369_10003164 | |||
| 1226 | Ga0075369_10033244 | |||
| 1227 | Ga0075427_10000518 | |||
| 1228 | Ga0097621_100000430 | |||
| 1229 | Ga0097621_100028001 | |||
| 1230 | Ga0097621_100112102 | |||
| 1231 | Ga0075370_10078231 | |||
| 1232 | Ga0068871_100000243 | |||
| 1233 | Ga0068871_100052395 | |||
| 1234 | Ga0075428_100074221 | |||
| 1235 | Ga0075428_100217373 | |||
| 1236 | Ga0075430_100008258 | |||
| 1237 | Ga0075430_100138898 | |||
| 1238 | Ga0075431_100013105 | |||
| 1239 | Ga0075433_10000023 | |||
| 1240 | Ga0075433_10027633 | |||
| 1241 | Ga0075433_10057801 | |||
| 1242 | Ga0075434_100011469 | |||
| 1243 | Ga0075434_100088050 | |||
| 1244 | Ga0075434_100190266 | |||
| 1245 | Ga0075429_100000227 | |||
| 1246 | Ga0075429_100017930 | |||
| 1247 | Ga0075429_100207939 | |||
| 1248 | Ga0068865_100000675 | |||
| 1249 | Ga0068865_100134708 | |||
| 1250 | Ga0075436_100060467 | |||
| 1251 | Ga0075435_100010404 | |||
| 1252 | Ga0105251_10038039 | |||
| 1253 | Ga0105244_10030760 | |||
| 1254 | Ga0105240_10034321 | |||
| 1255 | Ga0111539_10000561 | |||
| 1256 | Ga0111539_10004002 | |||
| 1257 | Ga0111539_10004660 | |||
| 1258 | Ga0111539_10012526 | |||
| 1259 | Ga0111539_10303003 | |||
| 1260 | Ga0105245_10000943 | |||
| 1261 | Ga0105245_10019420 | |||
| 1262 | Ga0105247_10008605 | |||
| 1263 | Ga0105247_10010184 | |||
| 1264 | Ga0105247_10014588 | |||
| 1265 | Ga0105247_10075754 | |||
| 1266 | Ga0114129_10003375 | |||
| 1267 | Ga0114129_10067744 | |||
| 1268 | Ga0114129_10136853 | |||
| 1269 | Ga0114129_10161019 | |||
| 1270 | Ga0114129_10165742 | |||
| 1271 | Ga0114129_10457612 | |||
| 1272 | Ga0105243_10002854 | |||
| 1273 | Ga0105243_10008993 | |||
| 1274 | Ga0105243_10011868 | |||
| 1275 | Ga0105243_10234057 | |||
| 1276 | Ga0105241_10001331 | |||
| 1277 | Ga0105241_10123091 | |||
| 1278 | Ga0105242_10000036 | |||
| 1279 | Ga0105242_10102489 | |||
| 1280 | Ga0105242_10144878 | |||
| 1281 | Ga0105248_10058205 | |||
| 1282 | Ga0105248_10176664 | |||
| 1283 | Ga0105248_10346351 | |||
| 1284 | Ga0105237_10030440 | |||
| 1285 | Ga0105237_10093691 | |||
| 1286 | Ga0105238_10118261 | |||
| 1287 | Ga0105238_10136258 | |||
| 1288 | Ga0105238_10244135 | |||
| 1289 | Ga0105238_10260465 | |||
| 1290 | Ga0105238_10333042 | |||
| 1291 | Ga0105249_10018622 | |||
| 1292 | Ga0105249_10224425 | |||
| 1293 | Ga0105249_10578243 | |||
| 1294 | Ga0105239_10024026 | |||
| 1295 | Ga0105239_10236007 | |||
| 1296 | Ga0105239_10292968 | |||
| 1297 | Ga0105239_10371948 | |||
| 1298 | Ga0105246_10146328 | |||
| 1299 | Ga0157342_1001381 | |||
| 1300 | Ga0157342_1003146 | |||
| 1301 | Ga0157373_10004533 | |||
| 1302 | Ga0157373_10248740 | |||
| 1303 | Ga0157371_10033655 | |||
| 1304 | Ga0157370_10009857 | |||
| 1305 | Ga0157369_10120649 | |||
| 1306 | Ga0157369_10548126 | |||
| 1307 | Ga0157374_10012850 | |||
| 1308 | Ga0157374_10018742 | |||
| 1309 | Ga0157374_10162136 | |||
| 1310 | Ga0157378_10000462 | |||
| 1311 | Ga0157378_10140239 | |||
| 1312 | Ga0157378_10180837 | |||
| 1313 | Ga0163162_10002063 | |||
| 1314 | Ga0163162_10015790 | |||
| 1315 | Ga0163162_10470279 | |||
| 1316 | Ga0157372_10021178 | |||
| 1317 | Ga0157372_10139453 | |||
| 1318 | Ga0157372_10144115 | |||
| 1319 | Ga0157375_10017542 | |||
| 1320 | Ga0163163_10020553 | |||
| 1321 | Ga0163163_10030054 | |||
| 1322 | Ga0157380_10000274 | |||
| 1323 | Ga0182008_10120456 | |||
| 1324 | Ga0157377_10000470 | |||
| 1325 | Ga0157379_10007174 | |||
| 1326 | Ga0157379_10155045 | |||
| 1327 | Ga0157379_10214428 | |||
| 1328 | Ga0157376_10000508 | |||
| 1329 | Ga0182007_10038335 | |||
| 1330 | Ga0163161_10001021 | |||
| 1331 | Ga0213872_10036843 | |||
| 1332 | Ga0213872_10044315 | |||
| 1333 | Ga0213874_10019175 | |||
| 1334 | Ga0209233_1001929 | |||
| 1335 | Ga0207666_1000356 | |||
| 1336 | Ga0207673_1000077 | |||
| 1337 | Ga0207697_10004946 | |||
| 1338 | Ga0207697_10088865 | |||
| 1339 | Ga0207656_10017829 | |||
| 1340 | Ga0207653_10012306 | |||
| 1341 | Ga0207682_10000135 | |||
| 1342 | Ga0207642_10000073 | |||
| 1343 | Ga0207710_10074385 | |||
| 1344 | Ga0207688_10002338 | |||
| 1345 | Ga0207688_10006665 | |||
| 1346 | Ga0207680_10007561 | |||
| 1347 | Ga0207647_10012910 | |||
| 1348 | Ga0207647_10024800 | |||
| 1349 | Ga0207647_10155504 | |||
| 1350 | Ga0207685_10034337 | |||
| 1351 | Ga0207699_10006915 | |||
| 1352 | Ga0207699_10079107 | |||
| 1353 | Ga0207645_10000457 | |||
| 1354 | Ga0207643_10000853 | |||
| 1355 | Ga0207643_10006512 | |||
| 1356 | Ga0207705_10104455 | |||
| 1357 | Ga0207684_10061490 | |||
| 1358 | Ga0207654_10000638 | |||
| 1359 | Ga0207707_10016702 | |||
| 1360 | Ga0207707_10017958 | |||
| 1361 | Ga0207707_10043824 | |||
| 1362 | Ga0207707_10089331 | |||
| 1363 | Ga0207671_10278740 | |||
| 1364 | Ga0207693_10014951 | |||
| 1365 | Ga0207693_10016289 | |||
| 1366 | Ga0207693_10053723 | |||
| 1367 | Ga0207693_10060824 | |||
| 1368 | Ga0207693_10103895 | |||
| 1369 | Ga0207693_10130652 | |||
| 1370 | Ga0207663_10238495 | |||
| 1371 | Ga0207660_10001020 | |||
| 1372 | Ga0207660_10031240 | |||
| 1373 | Ga0207660_10086873 | |||
| 1374 | Ga0207662_10001714 | |||
| 1375 | Ga0207662_10005471 | |||
| 1376 | Ga0207657_10020840 | |||
| 1377 | Ga0207657_10025718 | |||
| 1378 | Ga0207657_10046593 | |||
| 1379 | Ga0207657_10152850 | |||
| 1380 | Ga0207649_10000760 | |||
| 1381 | Ga0207652_10000764 | |||
| 1382 | Ga0207646_10077702 | |||
| 1383 | Ga0207681_10000065 | |||
| 1384 | Ga0207694_10148672 | |||
| 1385 | Ga0207650_10001773 | |||
| 1386 | Ga0207650_10060316 | |||
| 1387 | Ga0207650_10133917 | |||
| 1388 | Ga0207650_10229691 | |||
| 1389 | Ga0207659_10000142 | |||
| 1390 | Ga0207687_10000125 | |||
| 1391 | Ga0207687_10007547 | |||
| 1392 | Ga0207700_10039274 | |||
| 1393 | Ga0207700_10233078 | |||
| 1394 | Ga0207700_10272524 | |||
| 1395 | Ga0207664_10007299 | |||
| 1396 | Ga0207644_10001470 | |||
| 1397 | Ga0207644_10004403 | |||
| 1398 | Ga0207690_10003823 | |||
| 1399 | Ga0207690_10013751 | |||
| 1400 | Ga0207706_10007990 | |||
| 1401 | Ga0207706_10019275 | |||
| 1402 | Ga0207706_10019316 | |||
| 1403 | Ga0207686_10000344 | |||
| 1404 | Ga0207686_10065309 | |||
| 1405 | Ga0207709_10000183 | |||
| 1406 | Ga0207670_10000288 | |||
| 1407 | Ga0207670_10002143 | |||
| 1408 | Ga0207670_10034555 | |||
| 1409 | Ga0207670_10356562 | |||
| 1410 | Ga0207669_10000081 | |||
| 1411 | Ga0207669_10171644 | |||
| 1412 | Ga0207704_10000121 | |||
| 1413 | Ga0207704_10120340 | |||
| 1414 | Ga0207704_10242918 | |||
| 1415 | Ga0207665_10002359 | |||
| 1416 | Ga0207665_10134599 | |||
| 1417 | Ga0207691_10004599 | |||
| 1418 | Ga0207691_10008864 | |||
| 1419 | Ga0207711_10062918 | |||
| 1420 | Ga0207689_10000696 | |||
| 1421 | Ga0207689_10007426 | |||
| 1422 | Ga0207689_10041147 | |||
| 1423 | Ga0207661_10000286 | |||
| 1424 | Ga0207661_10081972 | |||
| 1425 | Ga0207661_10104153 | |||
| 1426 | Ga0207661_10191694 | |||
| 1427 | Ga0207679_10000064 | |||
| 1428 | Ga0207679_10334608 | |||
| 1429 | Ga0207679_10339599 | |||
| 1430 | Ga0207667_10057387 | |||
| 1431 | Ga0207667_10192677 | |||
| 1432 | Ga0207667_10332016 | |||
| 1433 | Ga0207651_10000395 | |||
| 1434 | Ga0207651_10038681 | |||
| 1435 | Ga0207712_10000752 | |||
| 1436 | Ga0207668_10000715 | |||
| 1437 | Ga0207668_10077636 | |||
| 1438 | Ga0207640_10003491 | |||
| 1439 | Ga0207640_10120683 | |||
| 1440 | Ga0207658_10001038 | |||
| 1441 | Ga0207658_10107419 | |||
| 1442 | Ga0207677_10000985 | |||
| 1443 | Ga0207677_10070724 | |||
| 1444 | Ga0207703_10001400 | |||
| 1445 | Ga0207639_10005141 | |||
| 1446 | Ga0207639_10135522 | |||
| 1447 | Ga0207678_10009603 | |||
| 1448 | Ga0207678_10014572 | |||
| 1449 | Ga0207678_10076643 | |||
| 1450 | Ga0207708_10004954 | |||
| 1451 | Ga0207708_10012692 | |||
| 1452 | Ga0207708_10015109 | |||
| 1453 | Ga0207702_10001395 | |||
| 1454 | Ga0207702_10293109 | |||
| 1455 | Ga0207641_10003265 | |||
| 1456 | Ga0207641_10045617 | |||
| 1457 | Ga0207648_10008132 | |||
| 1458 | Ga0207648_10011624 | |||
| 1459 | Ga0207648_10192382 | |||
| 1460 | Ga0207676_10000079 | |||
| 1461 | Ga0207674_10006886 | |||
| 1462 | Ga0207674_10402282 | |||
| 1463 | Ga0207675_100003662 | |||
| 1464 | Ga0207675_100019734 | |||
| 1465 | Ga0207675_100076823 | |||
| 1466 | Ga0207683_10000037 | |||
| 1467 | Ga0207683_10011735 | |||
| 1468 | Ga0207683_10040380 | |||
| 1469 | Ga0207683_10047045 | |||
| 1470 | Ga0207683_10205675 | |||
| 1471 | Ga0207698_10002333 | |||
| 1472 | Ga0207698_10006345 | |||
| 1473 | Ga0207698_10194099 | |||
| 1474 | Ga0210002_1001169 | |||
| 1475 | Ga0209966_1001440 | |||
| 1476 | Ga0209998_10016721 | |||
| 1477 | Ga0209974_10003753 | |||
| 1478 | Ga0207428_10000292 | |||
| 1479 | Ga0207428_10002255 | |||
| 1480 | Ga0207428_10043033 | |||
| 1481 | Ga0268266_10117991 | |||
| 1482 | Ga0268266_10133590 | |||
| 1483 | Ga0268265_10001133 | |||
| 1484 | Ga0268265_10009438 | |||
| 1485 | Ga0268265_10075768 | |||
| 1486 | Ga0268264_10000805 | |||
| 1487 | Ga0268264_10059829 | |||
| 1488 | Ga0265330_10017320 | |||
| 1489 | Ga0265330_10049817 | |||
| 1490 | Ga0265332_10037858 | |||
| 1491 | Ga0265328_10000155 | |||
| 1492 | Ga0265328_10004630 | |||
| 1493 | Ga0265325_10000006 | |||
| 1494 | Ga0265325_10000743 | |||
| 1495 | Ga0265325_10023635 | |||
| 1496 | Ga0265325_10023675 | |||
| 1497 | Ga0265325_10046577 | |||
| 1498 | Ga0265325_10048882 | |||
| 1499 | Ga0265329_10040204 | |||
| 1500 | Ga0265329_10049964 | |||
| 1501 | Ga0265340_10005222 | |||
| 1502 | Ga0265340_10035015 | |||
| 1503 | Ga0265331_10000005 | |||
| 1504 | Ga0265331_10001410 | |||
| 1505 | Ga0265331_10001741 | |||
| 1506 | Ga0265327_10010541 | |||
| 1507 | Ga0265316_10000387 | |||
| 1508 | Ga0265313_10000553 | |||
| 1509 | Ga0265313_10022732 | |||
| 1510 | Ga0265313_10062417 | |||
| 1511 | Ga0265313_10088789 | |||
| 1512 | Ga0307508_10103695 | |||
| 1513 | Ga0265314_10021841 | |||
| 1514 | Ga0265314_10026031 | |||
| 1515 | Ga0265314_10026645 | |||
| 1516 | Ga0265314_10201691 | |||
| 1517 | Ga0265342_10000011 | |||
| 1518 | Ga0265342_10004370 | |||
| 1519 | Ga0265342_10023672 | |||
| 1520 | Ga0307510_10129905 | |||
| 1521 | Ga0373930_0004021 | |||
| 1522 | Ga0373950_0008814 | |||
| 1523 | Ga0373958_0001465 | |||
| 1524 | Ga0373958_0015703 | |||
| 1525 | Ga0373938_0000063 | |||
| 1526 | Ga0373938_0019066 | |||
| 1527 | Ga0373926_0005620 | |||
| 1528 | Ga0373926_0018917 | |||
| 1529 | Ga0373926_0023654 | |||
| 1530 | Ga0373928_0001474 | |||
| 1531 | Ga0373929_0001110 | |||
| 1532 | Ga0373940_0000418 | |||
| 1533 | Ga0373940_0049936 | |||
| 1534 | Ga0373944_0005850 | |||
| 1535 | Ga0373949_0000779 | |||
| 1536 | Ga0373949_0002326 | |||
| 1537 | Ga0373951_0001074 | |||
| 1538 | Ga0373952_0001672 | |||
| 1539 | Ga0373952_0004710 | |||
| 1540 | Ga0373923_0016457 | |||
| 1541 | Ga0373923_0023882 | |||
| 1542 | Ga0373923_0055561 | |||
| 1543 | Ga0373932_0000516 | |||
| 1544 | Ga0373932_0002506 | |||
| 1545 | Ga0373932_0002800 | |||
| 1546 | Ga0373936_0111308 | |||
| 1547 | Ga0373939_0001269 | |||
| 1548 | Ga0373939_0002352 | |||
| 1549 | Ga0373939_0003293 | |||
| 1550 | Ga0373941_0001012 | |||
| 1551 | Ga0373941_0002320 | |||
| 1552 | Ga0373953_0000171 | |||
| 1553 | Ga0373953_0004537 | |||
| 1554 | Ga0373953_0033793 | |||
| 1555 | Ga0373954_0001704 | |||
| 1556 | Ga0373954_0039628 | |||
| 1557 | Ga0373956_0007874 | |||
| 1558 | Ga0373956_0050932 | |||
| 1559 | Ga0373957_0000100 | |||
| 1560 | Ga0373960_0002055 | |||
| 1561 | Ga0373960_0002580 | |||
| 1562 | Ga0373943_0173049 | |||
| 1563 | Ga0373946_0011600 | |||
| 1564 | Ga0373946_0012514 | |||
| 1565 | Ga0373955_0005067 | |||
| 1566 | Ga0373955_0024025 | |||
| 1567 | Ga0373942_0000898 | |||
| 1568 | Ga0373942_0007710 | |||
| 1569 | Ga0373962_0006516 | |||
| 1570 | Ga0373924_0024194 | |||
| 1571 | Ga0373924_0037768 | |||
| 1572 | Ga0373931_0002005 | |||
| 1573 | Ga0373931_0015704 | |||
| 1574 | Ga0373931_0129586 | |||
| 1575 | Ga0373935_0021083 | |||
| 1576 | Ga0373935_0043578 | |||
| 1577 | Ga0373927_0023381 | |||
| 1578 | Ga0373927_0030690 | |||
| 1579 | Ga0373927_0073054 | |||
| 1580 | Ga0373927_0074566 | |||
| 1581 | Ga0373927_0101689 | |||
| 1582 | Ga0373927_0127892 | |||
| 1583 | Ga0373933_0002823 | |||
| 1584 | Ga0373947_0000637 | |||
| 1585 | Ga0373947_0061380 | |||
| 1586 | Ga0373937_0000915 | |||
| 1587 | Ga0373937_0007517 | |||
| 1588 | Ga0373937_0049609 | |||
| 1589 | Ga0373937_0127276 | |||
| 1590 | Ga0373925_0038714 | |||
| 1591 | Ga0395899_0007257 | |||
| 1592 | Ga0395899_0181312 | |||
| 1593 | Ga0395900_0005384 | |||
| 1594 | Ga0395900_0008739 | |||
| 1595 | Ga0395900_0196626 | |||
| 1596 | Ga0395898_0002953 | |||
| 1597 | Ga0395898_0009867 | |||
| 1598 | Ga0395898_0127576 | |||
| 1599 | Ga0395901_0373677 | |||
| 1600 | Ga0436365_1276737 | |||
| 1601 | Ga0436365_1341680 | |||
| 1602 | Ga0436360_1267809 | |||
| 1603 | Ga0436361_0427176 | |||
| 1604 | Ga0436361_0812703 | |||
| 1605 | Ga0436363_0681660 | |||
| 1606 | Ga0436363_1183746 | |||
| 1607 | Ga0439465_0035307 | |||
| 1608 | Ga0439441_007966 | |||
| 1609 | Ga0466966_0060066 | |||
| 1610 | Ga0466963_0051782 | |||
| 1611 | Ga0466963_0141924 | |||
| 1612 | Ga0466957_0049772 | |||
| 1613 | Ga0466957_0095999 | |||
| 1614 | Ga0466957_0104286 | |||
| 1615 | Ga0466959_0013676 | |||
| 1616 | Ga0466959_0042026 | |||
| 1617 | Ga0451576_0158483 | |||
| 1618 | Ga0466958_0066489 | |||
| 1619 | Ga0466967_0006900 | |||
| 1620 | Ga0495592_0000890 | |||
| 1621 | Ga0495592_0004650 | |||
| 1622 | Ga0495592_0029178 | |||
| 1623 | Ga0495603_0007685 | |||
| 1624 | Ga0495603_0171300 | |||
| 1625 | Ga0495629_0001003 | |||
| 1626 | Ga0495629_0001665 | |||
| 1627 | Ga0495629_0031671 | |||
| 1628 | Ga0495629_0032442 | |||
| 1629 | Ga0495629_0108649 | |||
| 1630 | Ga0495651_0004120 | |||
| 1631 | Ga0495651_0007992 | |||
| 1632 | Ga0495651_0033029 | |||
| 1633 | Ga0495651_0281215 | |||
| 1634 | Ga0495653_0000905 | |||
| 1635 | Ga0495653_0016883 | |||
| 1636 | Ga0495653_0082835 | |||
| 1637 | Ga0495580_0034764 | |||
| 1638 | Ga0495580_0064508 | |||
| 1639 | Ga0495582_0025753 | |||
| 1640 | Ga0495582_0044624 | |||
| 1641 | Ga0495639_0018623 | |||
| 1642 | Ga0495639_0039029 | |||
| 1643 | Ga0495662_0018907 | |||
| 1644 | Ga0495662_0088899 | |||
| 1645 | Ga0495584_0004853 | |||
| 1646 | Ga0495584_0110130 | |||
| 1647 | Ga0495585_0004199 | |||
| 1648 | Ga0495594_0044700 | |||
| 1649 | Ga0495607_0008348 | |||
| 1650 | Ga0495607_0084710 | |||
| 1651 | Ga0495608_0005206 | |||
| 1652 | Ga0495608_0083651 | |||
| 1653 | Ga0495618_0064701 | |||
| 1654 | Ga0495618_0076076 | |||
| 1655 | Ga0495628_0001391 | |||
| 1656 | Ga0495628_0113550 | |||
| 1657 | Ga0495630_0090875 | |||
| 1658 | Ga0495630_0119237 | |||
| 1659 | Ga0495630_0153320 | |||
| 1660 | Ga0495631_0117145 | |||
| 1661 | Ga0495637_0057641 | |||
| 1662 | Ga0495644_0001707 | |||
| 1663 | Ga0495644_0022206 | |||
| 1664 | Ga0495644_0067810 | |||
| 1665 | Ga0495663_0015933 | |||
| 1666 | Ga0495666_0005800 | |||
| 1667 | Ga0495652_0006710 | |||
| 1668 | Ga0495652_0046672 | |||
| 1669 | Ga0495652_0092111 | |||
| 1670 | Ga0495665_0027299 | |||
| 1671 | Ga0495665_0070071 | |||
| 1672 | Ga0495665_0116986 | |||
| 1673 | Ga0495640_0002380 | |||
| 1674 | Ga0495640_0029249 | |||
| 1675 | Ga0495587_0001761 | |||
| 1676 | Ga0495587_0009886 | |||
| 1677 | Ga0495598_0002793 | |||
| 1678 | Ga0495609_0024443 | |||
| 1679 | Ga0495621_0051812 | |||
| 1680 | Ga0495645_0000765 | |||
| 1681 | Ga0495645_0011866 | |||
| 1682 | Ga0495645_0065866 | |||
| 1683 | Ga0495645_0082736 | |||
| 1684 | Ga0495622_0027980 | |||
| 1685 | Ga0495633_0003249 | |||
| 1686 | Ga0495667_0004508 | |||
| 1687 | Ga0495667_0039724 | |||
| 1688 | Ga0495656_0000538 | |||
| 1689 | Ga0495656_0078934 | |||
| 1690 | Ga0495634_0037712 | |||
| 1691 | Ga0495634_0057814 | |||
| 1692 | Ga0495634_0130335 | |||
| 1693 | Ga0495611_0109448 | |||
| 1694 | Ga0495635_0008724 | |||
| 1695 | Ga0495635_0038113 | |||
| 1696 | Ga0495659_0004530 | |||
| 1697 | Ga0495659_0005376 | |||
| 1698 | Ga0495588_0002190 | |||
| 1699 | Ga0495588_0013369 | |||
| 1700 | Ga0495588_0073230 | |||
| 1701 | Ga0495657_0001869 | |||
| 1702 | Ga0495657_0029647 | |||
| 1703 | Ga0495657_0106121 | |||
| 1704 | Ga0495599_0037997 | |||
| 1705 | Ga0495623_0001546 | |||
| 1706 | Ga0495623_0042614 | |||
| 1707 | Ga0495646_0002015 | |||
| 1708 | Ga0495646_0043669 | |||
| 1709 | Ga0495647_0002287 | |||
| 1710 | Ga0495647_0023153 | |||
| 1711 | Ga0495647_0027707 | |||
| 1712 | Ga0495658_0000814 | |||
| 1713 | Ga0495658_0036013 | |||
| 1714 | Ga0495658_0124213 | |||
| 1715 | Ga0495613_0009829 | |||
| 1716 | Ga0495613_0033916 | |||
| 1717 | Ga0495613_0054130 | |||
| 1718 | Ga0495613_0164933 | |||
| 1719 | Ga0495624_0013504 | |||
| 1720 | Ga0495624_0146277 | |||
| 1721 | Ga0495670_0002388 | |||
| 1722 | Ga0495670_0008528 | |||
| 1723 | Ga0495670_0067877 | |||
| 1724 | Ga0495649_0042455 | |||
| 1725 | Ga0495600_0000380 | |||
| 1726 | Ga0495600_0024236 | |||
| 1727 | Ga0495600_0052595 | |||
| 1728 | Ga0495660_0071411 | |||
| 1729 | Ga0495581_0055790 | |||
| 1730 | Ga0495581_0208804 | |||
| 1731 | Ga0495604_0003890 | |||
| 1732 | Ga0495604_0012078 | |||
| 1733 | Ga0495604_0156374 | |||
| 1734 | Ga0495604_0305668 | |||
| 1735 | Ga0495636_0017370 | |||
| 1736 | Ga0495674_0144845 | |||
| 1737 | Ga0495674_0185409 | |||
| 1738 | Ga0495680_0007705 | |||
| 1739 | Ga0495680_0046161 | |||
| 1740 | Ga0495680_0080621 | |||
| 1741 | Ga0495675_0003666 | |||
| 1742 | Ga0495679_028996 | |||
| 1743 | Ga0495684_0000942 | |||
| 1744 | Ga0495684_0009099 | |||
| 1745 | Ga0495684_0103061 | |||
| 1746 | Ga0495593_0001112 | |||
| 1747 | Ga0495593_0005331 | |||
| 1748 | Ga0495593_0024206 | |||
| 1749 | Ga0495593_0124173 | |||
| 1750 | Ga0495602_0003245 | |||
| 1751 | Ga0495602_0010887 | |||
| 1752 | Ga0495614_0033804 | |||
| 1753 | Ga0496100_0000280 | |||
| 1754 | Ga0496100_0001702 | |||
| 1755 | Ga0496100_0039476 | |||
| 1756 | Ga0496100_0046758 | |||
| 1757 | Ga0496100_0059116 | |||
| 1758 | Ga0496100_0076430 | |||
| 1759 | Ga0496100_0104167 | |||
| 1760 | Ga0496101_0000842 | |||
| 1761 | Ga0496101_0010098 | |||
| 1762 | Ga0496101_0023716 | |||
| 1763 | Ga0496101_0028308 | |||
| 1764 | Ga0496102_0001974 | |||
| 1765 | Ga0496102_0104824 | |||
| 1766 | Ga0496102_0141938 | |||
| 1767 | Ga0496102_0186117 | |||
| 1768 | Ga0496102_0195804 | |||
| 1769 | Ga0496103_0000571 | |||
| 1770 | Ga0496103_0001934 | |||
| 1771 | Ga0496103_0034020 | |||
| 1772 | Ga0496103_0198077 | |||
| 1773 | Ga0496104_0000062 | |||
| 1774 | Ga0496104_0002831 | |||
| 1775 | Ga0496104_0005648 | |||
| 1776 | Ga0496104_0010124 | |||
| 1777 | Ga0496104_0012909 | |||
| 1778 | Ga0496104_0018615 | |||
| 1779 | Ga0496104_0046451 | |||
| 1780 | Ga0496104_0052304 | |||
| 1781 | Ga0496104_0079107 | |||
| 1782 | Ga0496104_0114608 | |||
| 1783 | Ga0496104_0279147 | |||
| 1784 | Ga0496104_0297502 | |||
| 1785 | Ga0496104_0486334 | |||
| 1786 | Ga0496105_0000248 | |||
| 1787 | Ga0496105_0004144 | |||
| 1788 | Ga0496105_0006737 | |||
| 1789 | Ga0496105_0057362 | |||
| 1790 | Ga0496105_0063009 | |||
| 1791 | Ga0496105_0063920 | |||
| 1792 | Ga0496105_0149701 | |||
| 1793 | Ga0496105_0153994 | |||
| 1794 | Ga0496105_0323041 | |||
| 1795 | Ga0496105_0424348 | |||
| 1796 | Ga0496106_0001303 | |||
| 1797 | Ga0496106_0001661 | |||
| 1798 | Ga0496106_0005281 | |||
| 1799 | Ga0496106_0040324 | |||
| 1800 | Ga0496106_0070619 | |||
| 1801 | Ga0496106_0111500 | |||
| 1802 | Ga0496107_0001700 | |||
| 1803 | Ga0496107_0002060 | |||
| 1804 | Ga0496107_0014742 | |||
| 1805 | Ga0496107_0015601 | |||
| 1806 | Ga0496107_0063112 | |||
| 1807 | Ga0496107_0152405 | |||
| 1808 | Ga0496107_0260023 | |||
| 1809 | Ga0496107_0260037 | |||
| 1810 | Ga0496108_0001882 | |||
| 1811 | Ga0496108_0006924 | |||
| 1812 | Ga0496108_0030571 | |||
| 1813 | Ga0496108_0035403 | |||
| 1814 | Ga0496108_0058129 | |||
| 1815 | Ga0496109_0000260 | |||
| 1816 | Ga0496109_0002958 | |||
| 1817 | Ga0496109_0032397 | |||
| 1818 | Ga0496109_0050133 | |||
| 1819 | Ga0496109_0052153 | |||
| 1820 | Ga0496109_0176527 | |||
| 1821 | Ga0496109_0497643 | |||
| 1822 | Ga0496110_0001367 | |||
| 1823 | Ga0496110_0005035 | |||
| 1824 | Ga0496110_0017894 | |||
| 1825 | Ga0496110_0024032 | |||
| 1826 | Ga0496110_0071711 | |||
| 1827 | Ga0496110_0081393 | |||
| 1828 | Ga0496110_0157096 | |||
| 1829 | Ga0496110_0411118 | |||
| 1830 | Ga0496111_0012211 | |||
| 1831 | Ga0496111_0020763 | |||
| 1832 | Ga0496111_0030755 | |||
| 1833 | Ga0496111_0043626 | |||
| 1834 | Ga0496111_0046368 | |||
| 1835 | Ga0496111_0188462 | |||
| 1836 | Ga0496111_0308141 | |||
| 1837 | Ga0496112_0000945 | |||
| 1838 | Ga0496112_0007228 | |||
| 1839 | Ga0496112_0017732 | |||
| 1840 | Ga0496112_0033955 | |||
| 1841 | Ga0496112_0057850 | |||
| 1842 | Ga0496112_0137851 | |||
| 1843 | Ga0496112_0158049 | |||
| 1844 | Ga0496112_0303975 | |||
| 1845 | Ga0496112_0429436 | |||
| 1846 | Ga0496113_0016864 | |||
| 1847 | Ga0496113_0017758 | |||
| 1848 | Ga0496113_0021366 | |||
| 1849 | Ga0496113_0041169 | |||
| 1850 | Ga0496113_0143252 | |||
| 1851 | Ga0496113_0149487 | |||
| 1852 | Ga0496114_0010719 | |||
| 1853 | Ga0496114_0015222 | |||
| 1854 | Ga0496114_0018780 | |||
| 1855 | Ga0496114_0027109 | |||
| 1856 | Ga0496114_0201646 | |||
| 1857 | Ga0496115_0001610 | |||
| 1858 | Ga0496115_0043160 | |||
| 1859 | Ga0496115_0071037 | |||
| 1860 | Ga0496115_0093987 | |||
| 1861 | Ga0496115_0114110 | |||
| 1862 | Ga0496115_0122648 | |||
| 1863 | Ga0496115_0138981 | |||
| 1864 | Ga0496115_0158327 | |||
| 1865 | Ga0496115_0369534 | |||
| 1866 | Ga0496117_0026851 | |||
| 1867 | Ga0496118_0033619 | |||
| 1868 | Ga0496119_0001630 | |||
| 1869 | Ga0496119_0060256 | |||
| 1870 | Ga0496121_0005711 | |||
| 1871 | Ga0496121_0292001 | |||
| 1872 | Ga0496124_0001010 | |||
| 1873 | Ga0496125_0076589 | |||
| 1874 | Ga0496126_0239033 | |||
| 1875 | Ga0501031_0037770 | |||
| 1876 | Ga0501031_0132538 | |||
| 1877 | Ga0501034_0000097 | |||
| 1878 | Ga0501034_0003862 | |||
| 1879 | Ga0501034_0056039 | |||
| 1880 | Ga0501034_0063450 | |||
| 1881 | Ga0501034_0176007 | |||
| 1882 | Ga0501034_0473333 | |||
| 1883 | Ga0501034_0539840 | |||
| 1884 | Ga0501036_0000198 | |||
| 1885 | Ga0501036_0023367 | |||
| 1886 | Ga0501036_0041532 | |||
| 1887 | Ga0501037_0012328 | |||
| 1888 | Ga0501037_0020433 | |||
| 1889 | Ga0501038_0006501 | |||
| 1890 | Ga0501038_0072276 | |||
| 1891 | Ga0501038_0126237 | |||
| 1892 | Ga0501039_0050488 | |||
| 1893 | Ga0501039_0121828 | |||
| 1894 | Ga0501040_0185170 | |||
| 1895 | Ga0501043_0001799 | |||
| 1896 | Ga0501043_0087364 | |||
| 1897 | Ga0501043_0287202 | |||
| 1898 | Ga0501047_0000257 | |||
| 1899 | Ga0501047_0036109 | |||
| 1900 | Ga0501048_0001287 | |||
| 1901 | Ga0501067_0046974 | |||
| 1902 | Ga0501068_0034779 | |||
| 1903 | Ga0501068_0043470 | |||
| 1904 | Ga0501070_0032521 | |||
| 1905 | Ga0501070_0057411 | |||
| 1906 | Ga0501070_0126120 | |||
| 1907 | Ga0501070_0283649 | |||
| 1908 | Ga0501071_0280970 | |||
| 1909 | Ga0501072_0088233 | |||
| 1910 | Ga0501073_0024896 | |||
| 1911 | Ga0501074_0012029 | |||
| 1912 | Ga0501075_0184227 | |||
| 1913 | Ga0501076_0168642 | |||
| 1914 | Ga0501079_0066283 | |||
| 1915 | Ga0501080_0040549 | |||
| 1916 | Ga0501081_0039930 | |||
| 1917 | Ga0501081_0142249 | |||
| 1918 | Ga0501083_0008682 | |||
| 1919 | Ga0501083_0019073 | |||
| 1920 | Ga0501083_0038174 | |||
| 1921 | Ga0501083_0053537 | |||
| 1922 | Ga0501083_0148289 | |||
| 1923 | Ga0501035_0065880 | |||
| 1924 | Ga0501035_0081968 | |||
| 1925 | Ga0501035_0104063 | |||
| 1926 | Ga0501044_0000238 | |||
| 1927 | Ga0501044_0000841 | |||
| 1928 | Ga0501045_0141750 | |||
| 1929 | Ga0501045_0155456 | |||
| 1930 | nmdc:mga03n38_30974_c1 | |||
| 1931 | nmdc:mga00v17_23567_c1 | |||
| 1932 | nmdc:mga00v17_82654_c1 | |||
| 1933 | nmdc:mga0yw44_104323_c1 | |||
| 1934 | nmdc:mga0yw44_15228_c1 | |||
| 1935 | nmdc:mga0yw44_267518_c1 | |||
| 1936 | nmdc:mga0yw44_7719_c1 | |||
| 1937 | nmdc:mga0k408_5388_c1 | |||
| 1938 | nmdc:mga06z11_116679_c1 | |||
| 1939 | nmdc:mga06z11_46047_c1 | |||
| 1940 | nmdc:mga04h51_90914_c1 | |||
| 1941 | nmdc:mga07m45_167503_c1 | |||
| 1942 | nmdc:mga07m45_174113_c1 | |||
| 1943 | nmdc:mga07m45_43279_c1 | |||
| 1944 | nmdc:mga05p37_1109_c1 | |||
| 1945 | nmdc:mga05p37_22888_c1 | |||
| 1946 | nmdc:mga05p37_36053_c1 | |||
| 1947 | nmdc:mga05p37_366858_c1 | |||
| 1948 | nmdc:mga05p37_3812_c1 | |||
| 1949 | nmdc:mga05p37_79233_c1 | |||
| 1950 | nmdc:mga05p37_93412_c1 | |||
| 1951 | nmdc:mga09592_33106_c1 | |||
| 1952 | nmdc:mga09592_399604_c1 | |||
| 1953 | nmdc:mga09592_470_c1 | |||
| 1954 | nmdc:mga0qj67_1459_c1 | |||
| 1955 | nmdc:mga0qj67_22131_c1 | |||
| 1956 | nmdc:mga06r32_284989_c1 | |||
| 1957 | nmdc:mga08y16_2292_c1 | |||
| 1958 | nmdc:mga08y16_299957_c1 | |||
| 1959 | nmdc:mga08y16_362073_c1 | |||
| 1960 | nmdc:mga08y16_855_c1 | |||
| 1961 | nmdc:mga08y16_8714_c1 | |||
| 1962 | nmdc:mga08y16_95295_c1 | |||
| 1963 | nmdc:mga0n895_1286_c1 | |||
| 1964 | nmdc:mga0n895_2848_c1 | |||
| 1965 | nmdc:mga0n895_79530_c1 | |||
| 1966 | nmdc:mga0n895_94110_c1 | |||
| 1967 | nmdc:mga0rr50_15409_c1 | |||
| 1968 | nmdc:mga0rr50_171644_c1 | |||
| 1969 | nmdc:mga08x19_47018_c1 | |||
| 1970 | nmdc:mga0a205_172099_c1 | |||
| 1971 | nmdc:mga0a205_485_c1 | |||
| 1972 | nmdc:mga0a205_51775_c1 | |||
| 1973 | nmdc:mga0a205_6599_c1 | |||
| 1974 | nmdc:mga0sz30_47743_c1 | |||
| 1975 | Ga0495601_0000414 | |||
| 1976 | Ga0495601_0010490 | |||
| 1977 | Ga0495601_0024580 | |||
| 1978 | Ga0495601_0030002 | |||
| 1979 | Ga0495601_0050437 | |||
| 1980 | Ga0495601_0061134 | |||
| 1981 | Ga0495612_0000736 | |||
| 1982 | Ga0495612_0014780 | |||
| 1983 | Ga0495595_0000897 | |||
| 1984 | Ga0495595_0006151 | |||
| 1985 | Ga0495595_0022375 | |||
| 1986 | Ga0495595_0039745 | |||
| 1987 | Ga0495595_0040979 | |||
| 1988 | Ga0495595_0054647 | |||
| 1989 | Ga0495619_0000097 | |||
| 1990 | Ga0495619_0000646 | |||
| 1991 | Ga0495619_0001717 | |||
| 1992 | Ga0495619_0002583 | |||
| 1993 | Ga0495619_0011191 | |||
| 1994 | Ga0495619_0013003 | |||
| 1995 | Ga0495619_0025301 | |||
| 1996 | Ga0495619_0037282 | |||
| 1997 | Ga0495619_0103875 | |||
| 1998 | Ga0500644_0000429 | |||
| 1999 | Ga0500651_0049303 | |||
| 2000 | Ga0500566_0036855 | |||
| 2001 | Ga0500641_0006504 | |||
| 2002 | Ga0500595_000002 | |||
| 2003 | Ga0500595_006663 | |||
| 2004 | Ga0500595_060528 | |||
| 2005 | Ga0500597_113490 | |||
| 2006 | Ga0500652_000124 | |||
| 2007 | Ga0500568_0017814 | |||
| 2008 | Ga0500616_0000002 | |||
| 2009 | Ga0500636_0010128 | |||
| 2010 | Ga0500637_0018132 | |||
| 2011 | Ga0500657_030092 | |||
| 2012 | Ga0500645_000079 | |||
| 2013 | Ga0500645_012709 | |||
| 2014 | Ga0501084_0273441 | |||
| 2015 | Ga0501082_0143552 | |||
| 2016 | Ga0501082_0260535 | |||
| 2017 | Ga0501082_0326967 | |||
| 2018 | Ga0530510_0069943 | |||
| 2019 | Ga0530510_0103959 | |||
| 2020 | 2513588979 | |||
| 2021 | 2643756121 | |||
| 2022 | 2861692043 | |||
| 2023 | 2909044155 | |||
| 2024 | 8002062950 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5bnr-assembly1.cif.gz_A-2 | e. coli fabh with small molecule inhibitor 2 | 0.9401 | 5 | 320 |
| 2ebd-assembly1.cif.gz_B | crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 | 0.939 | 6 | 320 |
| 4z19-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine | 0.9386 | 5 | 320 |
| 4x9o-assembly1.cif.gz_B | beta-ketoacyl-acp synthase iii -2 (fabh2) (c113a) from vibrio cholerae soaked with octanoyl-coa: conformational changes without clearly bound substrate | 0.9382 | 4 | 320 |
| 4ylt-assembly1.cif.gz_A-2 | crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis | 0.9348 | 5 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3il3A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9844 | 5 | 172 | 3.40.47.10 |
| 3il3A01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9672 | 5 | 172 | 3.40.47.10 |
| 3il4B01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9662 | 3 | 172 | 3.40.47.10 |
| 1mzjA01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9657 | 5 | 166 | 3.40.47.10 |
| 2x3eB01 | Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase | 0.9636 | 5 | 172 | 3.40.47.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A259KT87-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9972 | 5 | 168 |
GO:0004315
GO:0006633 GO:0044550 |
| AF-A0A3D1FU58-F1-model_v4 | deleted | 0.9884 | 4 | 172 |
|
| AF-A0A3S3DM21-F1-model_v4 | 3-oxoacyl-ACP synthase (EC 2.3.1.180) | 0.9882 | 4 | 133 |
GO:0004315
GO:0006633 GO:0033818 |
| AF-A0A382KHD8-F1-model_v4 | Beta-ketoacyl-[acyl-carrier-protein] synthase III N-terminal domain-containing protein | 0.9879 | 14 | 160 |
GO:0004315
GO:0006633 |
| AF-A0A7C1H7X3-F1-model_v4 | 3-oxoacyl-ACP synthase | 0.9869 | 5 | 144 |
GO:0004315
GO:0006633 GO:0044550 |