F488186

General Info

Members Datasets Scaffolds Average Seq Length
1012 782 2024 290

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2840878972|2840879234
Length 265
Sequence LIDATGVTIRLDGHTILRDMFVSIAPGEIVTIVGPNGSGKSTFLKALIGAVPLAEGRVSRMPGLRIGYVPQRLAIDASLPMTVRRFLSLPSRVGQAESAAALDKAGVPDLAGRQMADLSGGQFQRVLLARALLERPHVLLLDEATQGLDQPGSAAFYERIEEVRSELGCAVVMVSHDLHVVMAASDRVLCVNGHICCQGTPEIVASAPEYRALFGSGTRGTLALYRHQHSHSHDHDHDHDHDGHNHDHGHGHDHHHHDHSRENAS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
49 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
58 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
59 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
60 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
61 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
62 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
63 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
64 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
65 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
72 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
91 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
103 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
104 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
105 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
106 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
108 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
112 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
113 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
114 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
115 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
116 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
119 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
120 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
121 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
122 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
123 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
128 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
129 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
201 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
202 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
203 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
204 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
205 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
210 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
213 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
214 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
215 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
216 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
219 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
220 2509276019 Ensifer aridi TW10 Isolate Nodule
221 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
222 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
223 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
224 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
225 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
226 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
227 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
228 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
229 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
230 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
231 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
232 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
233 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
234 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
235 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
236 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
237 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
238 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
239 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
240 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
241 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
242 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
243 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
244 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
245 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
246 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
247 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
248 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
249 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
250 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
251 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
252 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
253 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
254 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
255 2516143018 Ensifer sp. BR816 Isolate Nodule
256 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
257 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
258 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
259 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
260 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
261 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
262 2519899620 Rhizobium sp. Pop5 Isolate Nodule
263 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
264 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
265 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
266 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
267 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
268 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
269 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
270 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
271 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
272 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
273 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
274 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
275 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
276 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
277 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
278 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
279 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
280 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
281 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
282 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
283 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
284 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
285 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
286 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
287 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
288 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
289 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
290 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
291 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
292 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
293 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
294 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
295 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
296 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
297 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
298 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
299 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
300 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
301 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
302 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
303 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
304 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
305 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
306 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
307 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
308 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
309 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
310 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
311 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
312 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
313 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
314 2643221557 Ensifer sp. Root558 Isolate Unclassified
315 2643221558 Rhizobium sp. Root149 Isolate Unclassified
316 2643221582 Rhizobium sp. Root651 Isolate Unclassified
317 2643221599 Rhizobium sp. Root708 Isolate Unclassified
318 2643221607 Rhizobium sp. Root73 Isolate Unclassified
319 2643221610 Ensifer sp. Root74 Isolate Unclassified
320 2643221618 Ensifer sp. Root231 Isolate Unclassified
321 2643221626 Ensifer sp. Root31 Isolate Unclassified
322 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
323 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
324 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
325 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
326 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
327 2643221655 Ensifer sp. Root1252 Isolate Unclassified
328 2643221659 Ensifer sp. Root127 Isolate Unclassified
329 2643221668 Ensifer sp. Root423 Isolate Unclassified
330 2643221675 Ensifer sp. Root1298 Isolate Unclassified
331 2643221680 Ensifer sp. Root1312 Isolate Unclassified
332 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
333 2643221688 Rhizobium sp. Root482 Isolate Unclassified
334 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
335 2643221693 Rhizobium sp. Root491 Isolate Unclassified
336 2643221698 Ensifer sp. Root142 Isolate Unclassified
337 2643221712 Ensifer sp. Root258 Isolate Unclassified
338 2643221718 Rhizobium sp. Root268 Isolate Unclassified
339 2643221719 Rhizobium sp. Root274 Isolate Unclassified
340 2643221723 Ensifer sp. Root278 Isolate Unclassified
341 2643221726 Ensifer sp. Root954 Isolate Unclassified
342 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
343 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
344 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
345 2718217882 Rhizobium sp. N741 Isolate Nodule
346 2718217927 Rhizobium sp. N324 Isolate Nodule
347 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
348 2718218009 Rhizobium sp. N561 Isolate Nodule
349 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
350 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
351 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
352 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
353 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
354 2718218363 Rhizobium sp. N113 Isolate Nodule
355 2718218365 Rhizobium sp. N731 Isolate Nodule
356 2718218366 Rhizobium sp. N621 Isolate Nodule
357 2718218423 Rhizobium sp. N941 Isolate Nodule
358 2721755514 Rhizobium sp. N6212 Isolate Nodule
359 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
360 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
361 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
362 2721755809 Rhizobium sp. N541 Isolate Nodule
363 2721755810 Rhizobium sp. N871 Isolate Nodule
364 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
365 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
366 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
367 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
368 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
369 2728369365 Rhizobium sp. N1341 Isolate Nodule
370 2728369397 Rhizobium sp. N1314 Isolate Nodule
371 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
372 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
373 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
374 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
375 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
376 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
377 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
378 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
379 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
380 2791355256 Rhizobium sp. M10 Isolate Nodule
381 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
382 2791355260 Rhizobium sp. L9 Isolate Nodule
383 2791355261 Rhizobium sp. J15 Isolate Nodule
384 2791355262 Rhizobium sp. M1 Isolate Nodule
385 2791355263 Rhizobium chutanense C5 Isolate Nodule
386 2791355264 Rhizobium sp. S9 Isolate Nodule
387 2791355265 Rhizobium sp. H4 Isolate Nodule
388 2791355266 Rhizobium sp. L43 Isolate Nodule
389 2791355267 Rhizobium sp. L18 Isolate Nodule
390 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
391 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
392 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
393 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
394 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
395 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
396 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
397 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
398 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
399 2802429633 Rhizobium anhuiense J3 Isolate Nodule
400 2802429634 Rhizobium anhuiense S10 Isolate Nodule
401 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
402 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
403 2802429637 Rhizobium anhuiense C15 Isolate Nodule
404 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
405 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
406 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
407 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
408 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
409 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
410 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
411 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
412 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
413 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
414 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
415 2838048938 Rhizobium pisi 27/80 Isolate Nodule
416 2838061910 Rhizobium phaseoli L15 Isolate Nodule
417 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
418 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
419 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
420 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
421 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
422 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
423 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
424 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
425 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
426 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
427 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
428 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
429 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
430 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
431 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
432 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
433 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
434 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
435 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
436 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
437 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
438 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
439 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
440 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
441 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
442 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
443 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
444 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
445 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
446 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
447 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
448 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
449 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
450 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
451 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
452 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
453 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
454 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
455 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
456 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
457 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
458 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
459 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
460 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
461 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
462 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
463 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
464 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
465 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
466 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
467 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
468 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
469 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
470 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
471 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
472 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
473 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
474 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
475 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
476 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
477 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
478 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
479 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
480 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
481 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
482 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
483 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
484 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
485 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
486 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
487 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
488 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
489 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
490 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
491 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
492 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
493 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
494 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
495 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
496 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
497 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
498 2844163670 Ensifer sp. 1H6 Isolate Unclassified
499 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
500 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
501 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
502 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
503 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
504 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
505 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
506 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
507 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
508 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
509 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
510 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
511 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
512 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
513 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
514 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
515 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
516 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
517 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
518 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
519 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
520 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
521 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
522 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
523 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
524 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
525 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
526 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
527 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
528 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
529 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
530 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
531 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
532 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
533 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
534 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
535 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
536 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
537 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
538 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
539 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
540 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
541 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
542 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
543 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
544 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
545 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
546 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
547 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
548 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
549 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
550 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
551 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
552 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
553 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
554 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
555 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
556 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
557 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
558 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
559 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
560 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
561 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
562 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
563 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
564 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
565 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
566 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
567 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
568 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
569 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
570 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
571 2932401849 Devosia sp. 2618 Isolate Rhizosphere
572 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
573 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
574 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
575 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
576 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
577 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
578 2933599457 Rhizobium phaseoli M3 Isolate Nodule
579 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
580 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
581 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
582 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
583 2936381700 Rhizobium chutanense C16 Isolate Unclassified
584 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
585 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
586 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
587 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
588 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
589 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
590 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
591 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
592 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
593 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
594 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
595 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
596 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
597 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
598 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
599 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
600 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
601 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
602 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
603 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
604 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
605 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
606 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
607 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
608 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
609 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
610 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
611 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
612 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
613 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
614 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
615 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
616 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
617 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
618 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
619 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
620 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
621 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
622 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
623 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
624 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
625 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
626 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
627 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
628 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
629 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
630 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
631 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
632 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
633 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
634 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
635 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
636 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
637 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
638 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
639 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
640 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
641 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
642 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
643 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
644 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
645 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
646 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
647 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
648 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
649 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
650 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
651 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
652 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
653 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
654 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
655 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
656 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
657 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
658 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
659 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
660 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
661 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
662 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
663 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
664 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
665 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
666 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
667 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
668 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
669 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
670 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
671 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
672 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
673 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
674 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
675 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
676 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
677 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
678 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
679 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
680 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
681 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
682 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
683 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
684 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
685 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
686 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
687 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
688 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
689 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
690 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
691 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
692 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
693 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
694 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
695 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
696 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
697 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
698 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
699 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
700 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
701 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
702 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
703 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
704 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
705 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
706 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
707 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
708 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
709 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
710 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
711 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
712 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
713 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
714 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
715 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
716 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
717 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
718 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
719 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
720 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
721 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
722 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
723 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
724 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
725 2996887358 Rhizobium sp. R711 Isolate Nodule
726 2996893221 Rhizobium sp. R635 Isolate Nodule
727 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
728 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
729 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
730 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
731 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
732 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
733 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
734 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
735 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
736 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
737 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
738 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
739 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
740 8005258706 Rhizobium sp. R693 Isolate Nodule
741 8005275841 Rhizobium sp. N4311 Isolate Nodule
742 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
743 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
744 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
745 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
746 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
747 8005321885 Rhizobium sp. R72 Isolate Nodule
748 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
749 8005382845 Rhizobium sp. R634 Isolate Nodule
750 8005395548 Rhizobium sp. R339 Isolate Nodule
751 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
752 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
753 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
754 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
755 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
756 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
757 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
758 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
759 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
760 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
761 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
762 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
763 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
764 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
765 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
766 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
767 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
768 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
769 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
770 8018176218 Rhizobium sp. N122 Isolate Nodule
771 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
772 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
773 8024501048 Rhizobium sp. H4 Isolate Nodule
774 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
775 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
776 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
777 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
778 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
779 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
780 8056382006 Rhizobium croatiense 13T Isolate Nodule
781 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
782 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.97
Metatranscriptomes 0.1
Isolates 55.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.49
Bulb 0
Endosphere 17.19
Nodule 43.38
Rhizoplane 1.38
Rhizosphere 17.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013882 3300001979 Bacteria 2989
2 JGI25155J39150_1000001 3300002704 Bacteria 354543
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25162J39368_1000209 3300002737 Bacteria 61889
5 JGI25154J39366_1000011 3300002738 Bacteria 296007
6 JGI25158J39367_1000764 3300002739 Bacteria 6158
7 JGI25157J39369_1000030 3300002741 Bacteria 146112
8 JGI25152J39213_1000570 3300002773 Bacteria 20104
9 JGI25152J39213_1001028 3300002773 Bacteria 13358
10 JGI25152J39213_1014714 3300002773 Bacteria 1574
11 JGI25150J39212_1000326 3300002774 Bacteria 23479
12 JGI25150J39212_1005593 3300002774 Bacteria 2668
13 JGI25159J45721_1000078 3300002987 Bacteria 46708
14 JGI25159J45721_1000199 3300002987 Bacteria 27917
15 JGI25159J45721_1000530 3300002987 Bacteria 17359
16 JGI25151J46595_10000083 3300003187 Bacteria 130658
17 JGI25151J46595_10000723 3300003187 Bacteria 27441
18 JGI25151J46595_10002399 3300003187 Bacteria 11328
19 JGI25151J46595_10007403 3300003187 Bacteria 5387
20 JGI25151J46595_10021615 3300003187 Bacteria 2688
21 JGI25151J46595_10033472 3300003187 Bacteria 1980
22 JGI25165J46597_1000302 3300003214 Bacteria 61889
23 JGI25153J46596_10000377 3300003215 Bacteria 30499
24 JGI25153J46596_10005215 3300003215 Bacteria 6840
25 JGI25153J46596_10014602 3300003215 Bacteria 3254
26 rootH2_10132391 3300003320 Bacteria 1049
27 JGI25160J50197_1000087 3300003354 Bacteria 93379
28 JGI25160J50197_1000216 3300003354 Bacteria 46708
29 JGI25160J50197_1022289 3300003354 Bacteria 1860
30 JGI25161J50226_1000066 3300003374 Bacteria 94505
31 JGI25161J50226_1000207 3300003374 Bacteria 38350
32 JGI25161J50226_1000412 3300003374 Bacteria 20844
33 JGI25161J50226_1005029 3300003374 Bacteria 2652
34 Ga0055539_1005636 3300003752 Bacteria 1620
35 Ga0055526_1000594 3300003771 Bacteria 28489
36 Ga0055526_1007248 3300003771 Bacteria 5815
37 Ga0055526_1010689 3300003771 Bacteria 4238
38 Ga0055524_1001754 3300003775 Bacteria 11976
39 Ga0055524_1001805 3300003775 Bacteria 11731
40 Ga0055524_1010199 3300003775 Bacteria 3757
41 Ga0055536_1025789 3300003781 Bacteria 1665
42 Ga0055528_1000276 3300003790 Bacteria 43646
43 Ga0055528_1000331 3300003790 Bacteria 39811
44 Ga0055528_1000358 3300003790 Bacteria 37118
45 Ga0055530_10033082 3300003791 Bacteria 1337
46 Ga0055540_1000508 3300003792 Bacteria 29469
47 Ga0055540_1014435 3300003792 Bacteria 2350
48 Ga0055540_1034674 3300003792 Bacteria 1134
49 Ga0055531_10014529 3300003794 Bacteria 3538
50 Ga0058692_1000350 3300003856 Bacteria 22460
51 Ga0055543_1000053 3300004625 Bacteria 104589
52 Ga0055543_1000068 3300004625 Bacteria 94795
53 Ga0055543_1000301 3300004625 Bacteria 35189
54 Ga0055543_1001883 3300004625 Bacteria 7624
55 Ga0065165_1000717 3300005262 Bacteria 46746
56 Ga0065165_1000839 3300005262 Bacteria 40355
57 Ga0065165_1005533 3300005262 Bacteria 7050
58 Ga0065165_1007705 3300005262 Bacteria 5216
59 Ga0070666_10080111 3300005335 Bacteria 2231
60 Ga0070663_100069594 3300005455 Bacteria 2557
61 Ga0070665_100372853 3300005548 Bacteria 1434
62 Ga0068854_100046155 3300005578 Bacteria 3101
63 Ga0068856_100035514 3300005614 Bacteria 4886
64 Ga0075365_10000404 3300006038 Bacteria 15855
65 Ga0075365_10040694 3300006038 Bacteria 3032
66 Ga0075365_10041651 3300006038 Bacteria 3001
67 Ga0075365_10071578 3300006038 Bacteria 2335
68 Ga0075368_10040251 3300006042 Bacteria 1835
69 Ga0075363_100035648 3300006048 Bacteria 2605
70 Ga0075363_100257842 3300006048 Bacteria 1005
71 Ga0075364_10000320 3300006051 Bacteria 23654
72 Ga0075364_10232791 3300006051 Bacteria 1251
73 Ga0075362_10016243 3300006177 Bacteria 3044
74 Ga0075362_10057540 3300006177 Bacteria 1752
75 Ga0075367_10000761 3300006178 Bacteria 12596
76 Ga0075367_10006190 3300006178 Bacteria 6026
77 Ga0075367_10014267 3300006178 Bacteria 4297
78 Ga0075367_10241402 3300006178 Bacteria 1132
79 Ga0075369_10000812 3300006186 Bacteria 10265
80 Ga0075369_10000891 3300006186 Bacteria 9908
81 Ga0075369_10014994 3300006186 Bacteria 3103
82 Ga0075366_10013658 3300006195 Bacteria 4629
83 Ga0075370_10005768 3300006353 Bacteria 6186
84 Ga0075370_10019244 3300006353 Bacteria 3717
85 Ga0079104_1000610 3300006946 Bacteria 35237
86 Ga0079104_1005249 3300006946 Bacteria 5227
87 Ga0079104_1013531 3300006946 Bacteria 2509
88 Ga0099826_10000091 3300006948 Bacteria 44824
89 Ga0099826_10012274 3300006948 Bacteria 6455
90 Ga0099826_10153200 3300006948 Bacteria 1316
91 Ga0105240_10000005 3300009093 Bacteria 702630
92 Ga0105243_10023405 3300009148 Bacteria 4704
93 Ga0105248_10208894 3300009177 Bacteria 2200
94 Ga0105248_10544636 3300009177 Bacteria 1309
95 Ga0105237_10000766 3300009545 Bacteria 44044
96 Ga0123341_1020977 3300009765 Bacteria 5525
97 Ga0123341_1080942 3300009765 Bacteria 1272
98 Ga0123341_1080949 3300009765 Bacteria 1272
99 Ga0123342_1012633 3300009766 Bacteria 8735
100 Ga0105239_10001069 3300010375 Bacteria 38061
101 Ga0157373_10007245 3300013100 Bacteria 8273
102 Ga0157373_10187063 3300013100 Bacteria 1459
103 Ga0157371_10000015 3300013102 Bacteria 339838
104 Ga0157371_10007585 3300013102 Bacteria 8753
105 Ga0157370_10000046 3300013104 Bacteria 125612
106 Ga0157370_10000402 3300013104 Bacteria 54601
107 Ga0171463_1003 3300013249 Bacteria 695693
108 Ga0182007_10020300 3300015262 Bacteria 2377
109 Ga0182005_1015351 3300015265 Bacteria 2136
110 Ga0183365_10842 3300015684 Bacteria 1073
111 Ga0183363_1047 3300015690 Bacteria 39413
112 Ga0214544_1001682 3300021320 Bacteria 46508
113 Ga0214542_1001614 3300021321 Bacteria 46380
114 Ga0214542_1018957 3300021321 Bacteria 5621
115 Ga0214543_1000078 3300021327 Bacteria 119775
116 Ga0214543_1001395 3300021327 Bacteria 46435
117 Ga0228711_1000016 3300022739 Bacteria 126351
118 Ga0228710_1000013 3300022740 Bacteria 145976
119 Ga0209435_100012 3300025206 Bacteria 401621
120 Ga0209436_100085 3300025208 Bacteria 46798
121 Ga0209436_103034 3300025208 Bacteria 4648
122 Ga0209437_100047 3300025233 Bacteria 405163
123 Ga0207425_1000024 3300025245 Bacteria 328978
124 Ga0207425_1001564 3300025245 Bacteria 9306
125 Ga0209646_1000026 3300025246 Bacteria 401621
126 Ga0209646_1004852 3300025246 Bacteria 2409
127 Ga0209646_1008187 3300025246 Bacteria 1688
128 Ga0209026_1000014 3300025250 Bacteria 401621
129 Ga0209677_100656 3300025253 Bacteria 18202
130 Ga0209759_1000012 3300025256 Bacteria 401621
131 Ga0209129_1000069 3300025258 Bacteria 212790
132 Ga0209129_1000184 3300025258 Bacteria 87102
133 Ga0209129_1000703 3300025258 Bacteria 21754
134 Ga0209129_1009877 3300025258 Bacteria 2452
135 Ga0209233_1000048 3300025261 Bacteria 453669
136 Ga0209673_1000010 3300025273 Bacteria 596656
137 Ga0209673_1000384 3300025273 Bacteria 79540
138 Ga0209673_1000800 3300025273 Bacteria 41711
139 Ga0209673_1002846 3300025273 Bacteria 11085
140 Ga0209673_1003537 3300025273 Bacteria 9130
141 Ga0209673_1008196 3300025273 Bacteria 4689
142 Ga0209673_1026555 3300025273 Bacteria 1898
143 Ga0209130_1000021 3300025284 Bacteria 374278
144 Ga0209130_1000029 3300025284 Bacteria 323399
145 Ga0209130_1000081 3300025284 Bacteria 166440
146 Ga0209130_1005588 3300025284 Bacteria 4318
147 Ga0209676_1007095 3300025292 Bacteria 5362
148 Ga0209025_1000050 3300025294 Bacteria 331531
149 Ga0209025_1000058 3300025294 Bacteria 311398
150 Ga0209025_1000094 3300025294 Bacteria 241080
151 Ga0209025_1000119 3300025294 Bacteria 210606
152 Ga0209025_1000959 3300025294 Bacteria 43491
153 Ga0209025_1001225 3300025294 Bacteria 35824
154 Ga0209025_1003729 3300025294 Bacteria 13976
155 Ga0209025_1004412 3300025294 Bacteria 12242
156 Ga0209564_1000260 3300025295 Bacteria 112444
157 Ga0209564_1000278 3300025295 Bacteria 105405
158 Ga0209564_1000388 3300025295 Bacteria 79331
159 Ga0209564_1000458 3300025295 Bacteria 68749
160 Ga0209564_1023915 3300025295 Bacteria 2104
161 Ga0209564_1026939 3300025295 Bacteria 1882
162 Ga0209564_1035058 3300025295 Bacteria 1460
163 Ga0209758_1000083 3300025297 Bacteria 257283
164 Ga0209758_1000418 3300025297 Bacteria 72150
165 Ga0209758_1001270 3300025297 Bacteria 31259
166 Ga0209758_1001487 3300025297 Bacteria 27386
167 Ga0209758_1001756 3300025297 Bacteria 24054
168 Ga0209758_1001805 3300025297 Bacteria 23641
169 Ga0209758_1007127 3300025297 Bacteria 7727
170 Ga0209050_1009223 3300025298 Bacteria 5091
171 Ga0209256_1000042 3300025299 Bacteria 341821
172 Ga0209256_1000705 3300025299 Bacteria 44446
173 Ga0209256_1001127 3300025299 Bacteria 30457
174 Ga0209256_1001984 3300025299 Bacteria 18424
175 Ga0209256_1003234 3300025299 Bacteria 11741
176 Ga0209256_1003768 3300025299 Bacteria 10221
177 Ga0209256_1022779 3300025299 Bacteria 1888
178 Ga0207426_1000008 3300025302 Bacteria 848730
179 Ga0207426_1000010 3300025302 Bacteria 796003
180 Ga0207426_1000074 3300025302 Bacteria 323399
181 Ga0207426_1000952 3300025302 Bacteria 28571
182 Ga0207426_1001412 3300025302 Bacteria 20129
183 Ga0209051_1001051 3300025303 Bacteria 25929
184 Ga0209051_1002798 3300025303 Bacteria 12036
185 Ga0209051_1002923 3300025303 Bacteria 11715
186 Ga0209257_1001598 3300025304 Bacteria 25935
187 Ga0209257_1007766 3300025304 Bacteria 6371
188 Ga0207695_10000011 3300025913 Bacteria 910221
189 Ga0207671_10000241 3300025914 Bacteria 81847
190 Ga0207711_10342107 3300025941 Bacteria 1384
191 Ga0207711_10380908 3300025941 Bacteria 1309
192 Ga0207678_10082146 3300026067 Bacteria 2757
193 Ga0207702_10074236 3300026078 Bacteria 2935
194 Ga0209281_1000036 3300027111 Bacteria 369415
195 Ga0209281_1000047 3300027111 Bacteria 326514
196 Ga0209281_1000221 3300027111 Bacteria 122380
197 Ga0209281_1001134 3300027111 Bacteria 18934
198 Ga0209371_1000021 3300027312 Bacteria 555864
199 Ga0209282_1000041 3300027666 Bacteria 122268
200 Ga0209282_1000251 3300027666 Bacteria 26915
201 Ga0268266_10044251 3300028379 Bacteria 3806
202 Ga0268266_10110294 3300028379 Bacteria 2437
203 Ga0307515_10000023 3300028794 Bacteria 400846
204 Ga0307515_10013391 3300028794 Bacteria 15338
205 Ga0307515_10034938 3300028794 Bacteria 8201
206 Ga0307515_10084680 3300028794 Bacteria 4068
207 Ga0307515_10185340 3300028794 Bacteria 2013
208 Ga0268256_1000020 3300030500 Bacteria 557873
209 Ga0307513_10134623 3300031456 Bacteria 2409
210 Ga0307513_10139907 3300031456 Bacteria 2349
211 Ga0316575_10002907 3300031665 Bacteria 5831
212 Ga0307405_10008575 3300031731 Bacteria 5193
213 Ga0307413_10432426 3300031824 Bacteria 1040
214 Ga0307406_10194364 3300031901 Bacteria 1488
215 Ga0307412_10001992 3300031911 Bacteria 11311
216 Ga0307412_10029449 3300031911 Bacteria 3446
217 Ga0307412_10064336 3300031911 Bacteria 2478
218 Ga0315914_1005042 3300031967 Bacteria 19465
219 Ga0315913_1003257 3300033430 Bacteria 19465
220 Ga0315915_1000017 3300033464 Bacteria 148111
221 Ga0373944_0068257 3300035089 Bacteria 1153
222 Ga0373935_0025966 3300035692 Bacteria 3611
223 Ga0373927_0000178 3300035695 Bacteria 50343
224 Ga0316584_0192801 3300036712 Bacteria 1506
225 Ga0373925_0010945 3300037068 Bacteria 6583
226 Ga0395905_0002452 3300037471 Bacteria 20545
227 Ga0395905_0010948 3300037471 Bacteria 8778
228 Ga0395905_0199214 3300037471 Bacteria 1877
229 Ga0400483_071493 3300039062 Bacteria 2311
230 Ga0400483_080086 3300039062 Bacteria 1608
231 Ga0400483_107700 3300039062 Bacteria 2340
232 Ga0400483_278628 3300039062 Bacteria 1522
233 Ga0400483_282110 3300039062 Bacteria 1337
234 Ga0400487_47283 3300039110 Bacteria 1292
235 Ga0439436_0030059 3300041404 Bacteria 1580
236 Ga0439436_0031961 3300041404 Bacteria 1527
237 Ga0439438_045518 3300041405 Bacteria 1129
238 Ga0439465_0003881 3300041413 Bacteria 4879
239 Ga0451835_0083305 3300041492 Bacteria 1232
240 Ga0451837_0130519 3300041494 Bacteria 1994
241 Ga0451837_1837333 3300041494 Bacteria 1384
242 Ga0451839_0261576 3300041496 Bacteria 5053
243 Ga0451841_0575577 3300041498 Bacteria 2710
244 Ga0451847_0545570 3300041503 Bacteria 2374
245 Ga0451847_0891855 3300041503 Bacteria 2108
246 Ga0451849_0386776 3300041505 Bacteria 2345
247 Ga0451851_0185573 3300041507 Bacteria 3658
248 Ga0451855_0012851 3300041511 Bacteria 1387
249 Ga0451855_1944388 3300041511 Bacteria 1114
250 Ga0451853_2912743 3300041512 Bacteria 1084
251 Ga0451853_3363309 3300041512 Bacteria 2444
252 Ga0439432_063399 3300042006 Bacteria 1136
253 Ga0439449_0004143 3300042007 Bacteria 5607
254 Ga0450920_003834 3300042122 Bacteria 2617
255 Ga0450906_018103 3300042145 Bacteria 1265
256 Ga0450918_002471 3300042531 Bacteria 3490
257 Ga0466964_0170657 3300044706 Bacteria 1024
258 Ga0495638_0001984 3300046460 Bacteria 17461
259 Ga0495638_0177297 3300046460 Bacteria 1219
260 Ga0495650_0046649 3300046471 Bacteria 1817
261 Ga0495605_0015250 3300046474 Bacteria 4185
262 Ga0495605_0019164 3300046474 Bacteria 3660
263 Ga0495662_0010567 3300046476 Bacteria 4515
264 Ga0495585_0019158 3300046492 Bacteria 3949
265 Ga0495585_0099763 3300046492 Bacteria 1554
266 Ga0495607_0033766 3300046501 Bacteria 3111
267 Ga0495607_0166729 3300046501 Bacteria 1115
268 Ga0495606_0001613 3300046507 Bacteria 29410
269 Ga0495610_0002852 3300046512 Bacteria 14064
270 Ga0495610_0027460 3300046512 Bacteria 3023
271 Ga0495620_0034222 3300046515 Bacteria 2298
272 Ga0495620_0072044 3300046515 Bacteria 1411
273 Ga0495631_0005659 3300046518 Bacteria 6519
274 Ga0495631_0039188 3300046518 Bacteria 2104
275 Ga0495632_0016479 3300046519 Bacteria 4109
276 Ga0495643_0020602 3300046522 Bacteria 3799
277 Ga0495643_0051225 3300046522 Bacteria 2221
278 Ga0495643_0137695 3300046522 Bacteria 1220
279 Ga0495643_0141341 3300046522 Bacteria 1200
280 Ga0495648_0049155 3300046524 Bacteria 2588
281 Ga0495654_0000090 3300046530 Bacteria 101947
282 Ga0495654_0035092 3300046530 Bacteria 2528
283 Ga0495597_0069868 3300046542 Bacteria 1514
284 Ga0495622_0133913 3300046557 Bacteria 1127
285 Ga0495633_0015101 3300046558 Bacteria 4014
286 Ga0495656_0162555 3300046615 Bacteria 1086
287 Ga0495668_0020820 3300046616 Bacteria 3767
288 Ga0495625_0022466 3300046660 Bacteria 4837
289 Ga0495625_0031471 3300046660 Bacteria 3946
290 Ga0495625_0089047 3300046660 Bacteria 2137
291 Ga0495625_0141684 3300046660 Bacteria 1621
292 Ga0495588_0141123 3300046674 Bacteria 1273
293 Ga0495657_0024352 3300046675 Bacteria 4314
294 Ga0495658_0048653 3300046683 Bacteria 2392
295 Ga0495624_0046986 3300046690 Bacteria 2744
296 Ga0495670_0093823 3300046691 Bacteria 1538
297 Ga0495649_0122228 3300046694 Bacteria 1376
298 Ga0495649_0175124 3300046694 Bacteria 1121
299 Ga0495600_0027407 3300046809 Bacteria 3681
300 Ga0495660_0029052 3300046810 Bacteria 3121
301 Ga0495604_0008217 3300047317 Bacteria 8258
302 Ga0495636_0097656 3300047318 Bacteria 1281
303 Ga0495683_0031151 3300047323 Bacteria 2718
304 Ga0495687_051641 3300047443 Bacteria 1743
305 Ga0495687_057865 3300047443 Bacteria 1610
306 Ga0495681_0005741 3300047470 Bacteria 8255
307 Ga0495686_0003897 3300047472 Bacteria 12591
308 Ga0495686_0023787 3300047472 Bacteria 4033
309 Ga0496100_0017847 3300048903 Bacteria 4197
310 Ga0496101_0014967 3300048904 Bacteria 5220
311 Ga0496103_0008326 3300048906 Bacteria 6162
312 Ga0496104_0060690 3300048907 Bacteria 3582
313 Ga0496106_0000928 3300048909 Bacteria 21335
314 Ga0496110_0101120 3300048913 Bacteria 2584
315 Ga0496113_0076669 3300048916 Bacteria 2554
316 Ga0496116_0000232 3300048919 Bacteria 103015
317 Ga0496116_0005431 3300048919 Bacteria 11825
318 Ga0496116_0057331 3300048919 Bacteria 2547
319 Ga0496116_0067750 3300048919 Bacteria 2278
320 Ga0496117_0000002 3300048920 Bacteria 2483758
321 Ga0496117_0000353 3300048920 Bacteria 81061
322 Ga0496117_0006313 3300048920 Bacteria 12058
323 Ga0496117_0033172 3300048920 Bacteria 3908
324 Ga0496117_0036423 3300048920 Bacteria 3681
325 Ga0496117_0044531 3300048920 Bacteria 3214
326 Ga0496117_0110399 3300048920 Bacteria 1714
327 Ga0496118_0000204 3300048921 Bacteria 104260
328 Ga0496118_0000355 3300048921 Bacteria 77500
329 Ga0496118_0022010 3300048921 Bacteria 5590
330 Ga0496118_0032991 3300048921 Bacteria 4256
331 Ga0496118_0135283 3300048921 Bacteria 1574
332 Ga0496118_0217705 3300048921 Bacteria 1114
333 Ga0496119_0004804 3300048922 Bacteria 13257
334 Ga0496119_0014717 3300048922 Bacteria 6095
335 Ga0496119_0023483 3300048922 Bacteria 4370
336 Ga0496120_0000941 3300048923 Bacteria 40051
337 Ga0496120_0009779 3300048923 Bacteria 6762
338 Ga0496120_0012875 3300048923 Bacteria 5663
339 Ga0496120_0065320 3300048923 Bacteria 2017
340 Ga0496120_0083139 3300048923 Bacteria 1729
341 Ga0496120_0107478 3300048923 Bacteria 1463
342 Ga0496120_0173954 3300048923 Bacteria 1063
343 Ga0496121_0000001 3300048924 Bacteria 1830318
344 Ga0496121_0000363 3300048924 Bacteria 93101
345 Ga0496121_0000378 3300048924 Bacteria 91381
346 Ga0496121_0009399 3300048924 Bacteria 11245
347 Ga0496121_0063633 3300048924 Bacteria 3012
348 Ga0496121_0190957 3300048924 Bacteria 1468
349 Ga0496121_0202317 3300048924 Bacteria 1414
350 Ga0496121_0219166 3300048924 Bacteria 1341
351 Ga0496122_0000001 3300048925 Bacteria 1827766
352 Ga0496122_0000525 3300048925 Bacteria 79294
353 Ga0496122_0004665 3300048925 Bacteria 16828
354 Ga0496122_0008819 3300048925 Bacteria 10769
355 Ga0496122_0012544 3300048925 Bacteria 8418
356 Ga0496122_0035082 3300048925 Bacteria 4091
357 Ga0496122_0038357 3300048925 Bacteria 3841
358 Ga0496122_0058026 3300048925 Bacteria 2869
359 Ga0496122_0077924 3300048925 Bacteria 2324
360 Ga0496122_0129473 3300048925 Bacteria 1607
361 Ga0496123_0000001 3300048926 Bacteria 1831497
362 Ga0496123_0000054 3300048926 Bacteria 234046
363 Ga0496123_0001014 3300048926 Bacteria 42878
364 Ga0496123_0002174 3300048926 Bacteria 25015
365 Ga0496123_0002482 3300048926 Bacteria 22770
366 Ga0496123_0026934 3300048926 Bacteria 4294
367 Ga0496123_0030351 3300048926 Bacteria 3958
368 Ga0496123_0101190 3300048926 Bacteria 1676
369 Ga0496124_0001936 3300048927 Bacteria 28381
370 Ga0496124_0002257 3300048927 Bacteria 25595
371 Ga0496124_0010848 3300048927 Bacteria 9175
372 Ga0496124_0014592 3300048927 Bacteria 7589
373 Ga0496124_0040805 3300048927 Bacteria 4011
374 Ga0496124_0049824 3300048927 Bacteria 3571
375 Ga0496124_0119105 3300048927 Bacteria 2112
376 Ga0496124_0138039 3300048927 Bacteria 1928
377 Ga0496124_0187441 3300048927 Bacteria 1586
378 Ga0496124_0334114 3300048927 Bacteria 1079
379 Ga0496125_0000155 3300048928 Bacteria 151541
380 Ga0496125_0002081 3300048928 Bacteria 26974
381 Ga0496125_0011299 3300048928 Bacteria 8948
382 Ga0496125_0022186 3300048928 Bacteria 5900
383 Ga0496125_0024477 3300048928 Bacteria 5551
384 Ga0496125_0304124 3300048928 Bacteria 975
385 Ga0496126_0000703 3300048929 Bacteria 61100
386 Ga0496126_0001019 3300048929 Bacteria 47578
387 Ga0496126_0061193 3300048929 Bacteria 3383
388 Ga0496126_0336743 3300048929 Bacteria 1237
389 Ga0496126_0355967 3300048929 Bacteria 1196
390 Ga0501032_0244451 3300049569 Bacteria 1166
391 Ga0501033_0000167 3300049570 Bacteria 63051
392 Ga0501033_0033566 3300049570 Bacteria 3853
393 Ga0501033_0095579 3300049570 Bacteria 2172
394 Ga0501034_0000464 3300049571 Bacteria 67252
395 Ga0501034_0002538 3300049571 Bacteria 21830
396 Ga0501034_0143394 3300049571 Bacteria 2367
397 Ga0501036_0369096 3300049572 Bacteria 1198
398 Ga0501039_0194053 3300049575 Bacteria 1597
399 Ga0501039_0426383 3300049575 Bacteria 1042
400 Ga0501043_0027267 3300049579 Bacteria 4485
401 Ga0501043_0277095 3300049579 Bacteria 1286
402 Ga0501073_0160449 3300049589 Bacteria 1558
403 Ga0501035_0006797 3300049822 Bacteria 10686
404 Ga0501035_0198200 3300049822 Bacteria 1723
405 Ga0501044_0413523 3300049823 Bacteria 1260
406 nmdc:mga03683_2318_c1 3300050489 Bacteria 5888
407 nmdc:mga03683_34891_c1 3300050489 Bacteria 2037
408 nmdc:mga03n38_1786_c1 3300050490 Bacteria 6376
409 nmdc:mga00v17_2490_c1 3300050491 Bacteria 9419
410 nmdc:mga00v17_6_c1 3300050491 Bacteria 179509
411 nmdc:mga00v17_728_c1 3300050491 Bacteria 17963
412 nmdc:mga0yw44_33191_c1 3300050492 Bacteria 3014
413 nmdc:mga0yw44_35236_c1 3300050492 Bacteria 2939
414 nmdc:mga0yw44_38668_c1 3300050492 Bacteria 2825
415 nmdc:mga0k408_30414_c1 3300050493 Bacteria 3079
416 nmdc:mga06z11_817_c1 3300050494 Bacteria 11396
417 nmdc:mga07m45_928_c1 3300050496 Bacteria 12810
418 nmdc:mga0sz30_12802_c1 3300050516 Bacteria 3269
419 nmdc:mga0sz30_215_c2 3300050516 Bacteria 16156
420 nmdc:mga0sz30_708_c1 3300050516 Bacteria 12251
421 Ga0500610_0041889 3300053079 Bacteria 2369
422 Ga0500578_0283718 3300053086 Bacteria 987
423 Ga0500557_002118 3300053105 Bacteria 3540
424 Ga0500594_0003440 3300053118 Bacteria 3475
425 Ga0500618_000604 3300053125 Bacteria 22060
426 Ga0500618_008756 3300053125 Bacteria 2799
427 Ga0500618_018416 3300053125 Bacteria 1727
428 Ga0500652_115784 3300053131 Bacteria 1120
429 Ga0500658_0000945 3300053134 Bacteria 11858
430 Ga0500561_0000246 3300053137 Bacteria 9524
431 Ga0500568_0000365 3300053139 Bacteria 35007
432 Ga0500568_0001517 3300053139 Bacteria 14797
433 Ga0500568_0003015 3300053139 Bacteria 9631
434 Ga0500573_0000259 3300053140 Bacteria 22228
435 Ga0500573_0040542 3300053140 Bacteria 2689
436 Ga0500590_001701 3300053148 Bacteria 9215
437 Ga0500616_0000301 3300053153 Bacteria 71758
438 Ga0500616_0004349 3300053153 Bacteria 10137
439 Ga0500622_0001146 3300053156 Bacteria 22058
440 Ga0500627_0089285 3300053158 Bacteria 1379
441 Ga0500634_0001667 3300053161 Bacteria 8818
442 Ga0500636_0000153 3300053177 Bacteria 35853
443 Ga0500636_0001102 3300053177 Bacteria 14459
444 Ga0500636_0061021 3300053177 Bacteria 2201
445 Ga0587076_011008 3300059645 Bacteria 1320
446 Ga0501082_0367164 3300060353 Bacteria 1255
447 2840879234 2840878972 Bacteria 5483153
448 2509111388 2508501122 Bacteria 6292184
449 2509375673 2509276019 Bacteria 6802256
450 2509392199 2509276021 Bacteria 7634384
451 2509446849 2509276033 Bacteria 7180565
452 2510133801 2510065019 Bacteria 6903379
453 2510303299 2510065057 Bacteria 6649661
454 2510841076 2510461069 Bacteria 5505000
455 2511135222 2510917022 Bacteria 6504556
456 2511171677 2510917026 Bacteria 7046020
457 2511181651 2510917028 Bacteria 6185411
458 2511194380 2510917030 Bacteria 7460662
459 2511501960 2511231052 Bacteria 6974333
460 2512533331 2512047086 Bacteria 6850303
461 2512971114 2512875026 Bacteria 6861065
462 2513574158 2513237084 Bacteria 7231967
463 2513576806 2513237085 Bacteria 7695351
464 2513584744 2513237086 Bacteria 7265287
465 2513594687 2513237088 Bacteria 6927906
466 2513604529 2513237089 Bacteria 6553624
467 2513615452 2513237091 Bacteria 6900273
468 2513629548 2513237093 Bacteria 7545552
469 2513708189 2513237103 Bacteria 7647401
470 2513864755 2513237138 Bacteria 7368160
471 2513881240 2513237140 Bacteria 7076289
472 2513902372 2513237143 Bacteria 6664116
473 2513914101 2513237144 Bacteria 7530820
474 2513926076 2513237146 Bacteria 7166346
475 2513984612 2513237156 Bacteria 6402557
476 2513997075 2513237159 Bacteria 6810126
477 2514007582 2513237160 Bacteria 6650282
478 2515112847 2515075009 Bacteria 7288508
479 2515608750 2515154107 Bacteria 6795637
480 2515636466 2515154113 Bacteria 7807172
481 2515640818 2515154114 Bacteria 7848616
482 2515655498 2515154116 Bacteria 7552979
483 2515739344 2515154134 Bacteria 7220242
484 2516209681 2516143018 Bacteria 6951533
485 2516893255 2516653046 Bacteria 6989037
486 2517036554 2516653077 Bacteria 7555578
487 2517076924 2516653085 Bacteria 7346596
488 2517095686 2517093000 Bacteria 7412387
489 2517407250 2517287029 Bacteria 6905599
490 2517570002 2517487022 Bacteria 7227575
491 2520381516 2519899620 Bacteria 6499161
492 2524448843 2524023207 Bacteria 6813453
493 2524460168 2524023209 Bacteria 6679728
494 2530646156 2529292951 Bacteria 6916614
495 2535516600 2534681796 Bacteria 7146037
496 2537877727 2537561587 Bacteria 5425293
497 2551674934 2551306084 Bacteria 8942552
498 2551680188 2551306084 Bacteria 8942552
499 2551684835 2551306085 Bacteria 7347181
500 2551695935 2551306086 Bacteria 6843938
501 2551704473 2551306087 Bacteria 7351905
502 2551711462 2551306089 Bacteria 7162724
503 2551720833 2551306090 Bacteria 7953713
504 2551728685 2551306091 Bacteria 7086830
505 2551735014 2551306092 Bacteria 6992595
506 2551739436 2551306093 Bacteria 7064773
507 2554247611 2554235003 Bacteria 5877155
508 2558867989 2558860100 Bacteria 8458965
509 2559294744 2558860242 Bacteria 5568029
510 2561466427 2558860983 Bacteria 4133860
511 2585200280 2582581294 Bacteria 6626667
512 2585222623 2582581298 Bacteria 7315509
513 2585229900 2582581299 Bacteria 6518058
514 2585254866 2582581304 Bacteria 5831370
515 2585270959 2582581307 Bacteria 6597605
516 2585323520 2582581315 Bacteria 7318924
517 2585331655 2582581316 Bacteria 7774528
518 2585386733 2582581865 Bacteria 6644329
519 2585393039 2582581866 Bacteria 6859583
520 2585402117 2582581867 Bacteria 7184437
521 2585527302 2585427526 Bacteria 7258840
522 2585533957 2585427527 Bacteria 7273426
523 2585538039 2585427528 Bacteria 6842387
524 2585545206 2585427529 Bacteria 7395659
525 2585552192 2585427530 Bacteria 7383882
526 2585558683 2585427531 Bacteria 6992870
527 2585821902 2585427590 Bacteria 6824633
528 2585835987 2585427593 Bacteria 7141551
529 2585898048 2585427608 Bacteria 6544331
530 2585904347 2585427609 Bacteria 6667127
531 2585996019 2585427633 Bacteria 6413184
532 2586000623 2585427634 Bacteria 6455027
533 2587980536 2585428125 Bacteria 6662905
534 2599417549 2599185170 Bacteria 7295545
535 2599604008 2599185210 Bacteria 5624189
536 2600193101 2599185352 Bacteria 7228948
537 2600375709 2600254933 Bacteria 4750527
538 2601608264 2600255279 Bacteria 5605316
539 2601745038 2600255308 Bacteria 5611129
540 2616293519 2615840624 Bacteria 6557588
541 2616308687 2615840626 Bacteria 7921970
542 2616557009 2615840698 Bacteria 7319877
543 2617385783 2617270742 Bacteria 6808054
544 2643803600 2643221557 Bacteria 7184309
545 2643811648 2643221558 Bacteria 5460675
546 2643919231 2643221582 Bacteria 5804683
547 2644003869 2643221599 Bacteria 6292121
548 2644050747 2643221607 Bacteria 6314006
549 2644067568 2643221610 Bacteria 7480339
550 2644107715 2643221618 Bacteria 7717186
551 2644148614 2643221626 Bacteria 8069654
552 2644192606 2643221634 Bacteria 6705461
553 2644205221 2643221636 Bacteria 6583769
554 2644210234 2643221637 Bacteria 5345260
555 2644239676 2643221643 Bacteria 5749658
556 2644300353 2643221653 Bacteria 4569637
557 2644309109 2643221655 Bacteria 7722067
558 2644332936 2643221659 Bacteria 7890716
559 2644375247 2643221668 Bacteria 7306521
560 2644418621 2643221675 Bacteria 7473456
561 2644451988 2643221680 Bacteria 7473610
562 2644483665 2643221686 Bacteria 6310811
563 2644491792 2643221688 Bacteria 5260751
564 2644501338 2643221689 Bacteria 6042950
565 2644522137 2643221693 Bacteria 5513853
566 2644545892 2643221698 Bacteria 7756764
567 2644615051 2643221712 Bacteria 7729434
568 2644653786 2643221718 Bacteria 5345506
569 2644658577 2643221719 Bacteria 4568197
570 2644676587 2643221723 Bacteria 7095460
571 2644690750 2643221726 Bacteria 7455827
572 2657681177 2657244999 Bacteria 5946535
573 2671111616 2667528174 Bacteria 6435400
574 2692315857 2690316117 Bacteria 6800650
575 2719181657 2718217882 Bacteria 6556348
576 2719386190 2718217927 Bacteria 6972593
577 2719665998 2718217997 Bacteria 6740740
578 2719732321 2718218009 Bacteria 6478651
579 2720492418 2718218199 Bacteria 6740745
580 2720613773 2718218232 Bacteria 6720332
581 2720620561 2718218233 Bacteria 6662049
582 2720631986 2718218235 Bacteria 6630699
583 2720775714 2718218269 Bacteria 6906114
584 2721147749 2718218363 Bacteria 6524337
585 2721159197 2718218365 Bacteria 6274507
586 2721164584 2718218366 Bacteria 6425255
587 2721399972 2718218423 Bacteria 6438183
588 2722840754 2721755514 Bacteria 6424414
589 2723027321 2721755556 Bacteria 6745503
590 2723560940 2721755684 Bacteria 6859907
591 2723567533 2721755685 Bacteria 6704835
592 2724038785 2721755809 Bacteria 6438790
593 2724045077 2721755810 Bacteria 6479005
594 2724090321 2721755819 Bacteria 6906405
595 2724104798 2721755822 Bacteria 6726041
596 2724110599 2721755823 Bacteria 6752556
597 2725952707 2724679232 Bacteria 7646494
598 2730108257 2728369352 Bacteria 6745171
599 2730164892 2728369365 Bacteria 6555560
600 2730298829 2728369397 Bacteria 6274511
601 2738945434 2738541317 Bacteria 5340176
602 2739032696 2738541333 Bacteria 7106503
603 2753461853 2751185821 Bacteria 6189929
604 2766065723 2765235942 Bacteria 7445910
605 2778174119 2775507266 Bacteria 7392367
606 2792581773 2791355082 Bacteria 5973319
607 2792620158 2791355091 Bacteria 6135441
608 2792626422 2791355092 Bacteria 6248105
609 2792639370 2791355094 Bacteria 7011481
610 2793298713 2791355256 Bacteria 6798008
611 2793314683 2791355259 Bacteria 7254731
612 2793320519 2791355260 Bacteria 6598818
613 2793330441 2791355261 Bacteria 6661293
614 2793338336 2791355262 Bacteria 6774204
615 2793344285 2791355263 Bacteria 6872478
616 2793348729 2791355264 Bacteria 6429314
617 2793351980 2791355265 Bacteria 6539969
618 2793363845 2791355266 Bacteria 7116587
619 2793370333 2791355267 Bacteria 7222458
620 2802719497 2802428858 Bacteria 6636079
621 2802726910 2802428859 Bacteria 6667919
622 2802732231 2802428860 Bacteria 6525526
623 2802739834 2802428861 Bacteria 6534206
624 2802745340 2802428862 Bacteria 6633353
625 2802752732 2802428863 Bacteria 6410669
626 2804752376 2802429268 Bacteria 6094027
627 2805931003 2802429605 Bacteria 6875453
628 2805937982 2802429606 Bacteria 6346811
629 2806043676 2802429633 Bacteria 7341974
630 2806050393 2802429634 Bacteria 7083200
631 2806057210 2802429635 Bacteria 7650140
632 2806064591 2802429636 Bacteria 7597525
633 2806071858 2802429637 Bacteria 7067217
634 2808985487 2808606387 Bacteria 5697198
635 2819608968 2818991448 Bacteria 6772224
636 2819637804 2818991453 Bacteria 7181617
637 2821129485 2821123053 Bacteria 7836056
638 2834578249 2834578030 Bacteria 3530182
639 2837679769 2837678835 Bacteria 5252418
640 2838017814 2838016132 Bacteria 6577831
641 2838028591 2838022645 Bacteria 6494267
642 2838029987 2838029111 Bacteria 6603031
643 2838038239 2838035591 Bacteria 7166484
644 2838043825 2838042994 Bacteria 6046894
645 2838051894 2838048938 Bacteria 6044578
646 2838068486 2838061910 Bacteria 6794874
647 2838070304 2838068647 Bacteria 6208656
648 2838079601 2838074704 Bacteria 6785777
649 2838661884 2838661181 Bacteria 7385261
650 2838674156 2838668709 Bacteria 6671819
651 2838676335 2838675328 Bacteria 4909118
652 2838681755 2838680041 Bacteria 6545511
653 2838687196 2838686498 Bacteria 7807632
654 2838696327 2838694306 Bacteria 6853137
655 2838706598 2838701080 Bacteria 6669771
656 2838710434 2838707686 Bacteria 6619912
657 2838715218 2838714209 Bacteria 5525906
658 2838720982 2838719591 Bacteria 5523910
659 2838725976 2838724970 Bacteria 4908691
660 2838729832 2838729681 Bacteria 7400765
661 2838738483 2838736955 Bacteria 5760694
662 2838743153 2838742623 Bacteria 7396178
663 2841841148 2841840854 Bacteria 5761912
664 2841847940 2841846520 Bacteria 5345850
665 2841852639 2841851746 Bacteria 7532261
666 2841859508 2841859092 Bacteria 5436171
667 2841869940 2841864319 Bacteria 6742987
668 2842078608 2842077413 Bacteria 6508645
669 2842114834 2842110456 Bacteria 7656360
670 2842118883 2842118031 Bacteria 7033875
671 2842126030 2842124991 Bacteria 5346824
672 2842131229 2842130223 Bacteria 4909145
673 2842140926 2842140634 Bacteria 5759631
674 2842151333 2842146304 Bacteria 5957337
675 2842153601 2842152218 Bacteria 4908957
676 2842157901 2842156927 Bacteria 6894975
677 2842167550 2842163707 Bacteria 6916235
678 2842171461 2842170452 Bacteria 5525737
679 2842177221 2842175837 Bacteria 4908771
680 2842181520 2842180545 Bacteria 6888678
681 2842188326 2842187318 Bacteria 5524014
682 2842198419 2842192696 Bacteria 6147454
683 2842204619 2842198810 Bacteria 6608673
684 2842205634 2842205361 Bacteria 6340321
685 2842212637 2842211629 Bacteria 5523832
686 2842217784 2842217011 Bacteria 7497767
687 2842225744 2842224351 Bacteria 5524473
688 2842230429 2842229732 Bacteria 7475766
689 2842239846 2842237096 Bacteria 6620661
690 2842244331 2842243621 Bacteria 7421798
691 2842256350 2842250916 Bacteria 6579627
692 2842257583 2842257432 Bacteria 7401195
693 2842265646 2842264693 Bacteria 6472963
694 2842271266 2842271015 Bacteria 7807131
695 2842279091 2842278818 Bacteria 6340002
696 2842285754 2842285085 Bacteria 6011953
697 2842292270 2842291075 Bacteria 7076806
698 2842301928 2842298080 Bacteria 6123127
699 2842304894 2842304105 Bacteria 7023636
700 2842315070 2842311132 Bacteria 6616990
701 2842320554 2842317721 Bacteria 6793725
702 2842346313 2842341865 Bacteria 7003929
703 2842357606 2842357229 Bacteria 6485165
704 2842369108 2842363717 Bacteria 6844742
705 2842372322 2842370503 Bacteria 7038661
706 2842378667 2842377471 Bacteria 7140707
707 2842385393 2842384541 Bacteria 7057858
708 2842401925 2842395702 Bacteria 6780583
709 2842403114 2842402390 Bacteria 6681310
710 2842409513 2842409023 Bacteria 6687331
711 2842416166 2842415677 Bacteria 6596907
712 2842423918 2842422224 Bacteria 6239196
713 2842429717 2842428310 Bacteria 6767288
714 2842436330 2842434925 Bacteria 6502746
715 2842442677 2842441272 Bacteria 6769273
716 2842452935 2842447887 Bacteria 6754142
717 2842464138 2842462802 Bacteria 6588055
718 2842470659 2842469257 Bacteria 6752936
719 2842476728 2842475841 Bacteria 6603183
720 2842484732 2842482326 Bacteria 7212537
721 2842490426 2842489311 Bacteria 6620893
722 2842496982 2842495871 Bacteria 6820686
723 2842503515 2842502639 Bacteria 6604161
724 2842511320 2842509118 Bacteria 6850950
725 2842516293 2842515876 Bacteria 5436280
726 2842522683 2842521101 Bacteria 6569494
727 2842923970 2842922631 Bacteria 5824079
728 2844167572 2844163670 Bacteria 7266046
729 2844458562 2844454524 Bacteria 7952546
730 2847419078 2847417321 Bacteria 6913799
731 2848994109 2848992105 Bacteria 6810864
732 2850081151 2850079185 Bacteria 6848280
733 2852390013 2852387548 Bacteria 8025568
734 2854684775 2854681122 Bacteria 4548679
735 2854899350 2854896431 Bacteria 5869725
736 2855825981 2855825444 Bacteria 6785811
737 2855841327 2855839649 Bacteria 7135830
738 2855876754 2855872281 Bacteria 6964271
739 2857517583 2857516855 Bacteria 7787325
740 2857535113 2857531043 Bacteria 6754041
741 2858802308 2858800743 Bacteria 6603254
742 2889795853 2889790730 Bacteria 5689708
743 2889917770 2889914905 Bacteria 5702301
744 2891050902 2891048133 Bacteria 4447501
745 2891373152 2891373044 Bacteria 5202277
746 2896389944 2896384573 Bacteria 7700774
747 2899276544 2899275550 Bacteria 3958688
748 2899796305 2899792073 Bacteria 4926588
749 2899809005 2899803654 Bacteria 5577784
750 2899849471 2899845264 Bacteria 5672268
751 2913300846 2913295892 Bacteria 6333755
752 2913310140 2913308742 Bacteria 5350706
753 2915981910 2915980308 Bacteria 6624279
754 2915991353 2915986958 Bacteria 6739310
755 2915994371 2915993759 Bacteria 7016183
756 2916002201 2916000859 Bacteria 6865702
757 2916009177 2916007675 Bacteria 6898660
758 2916018207 2916014648 Bacteria 6946486
759 2916022726 2916021584 Bacteria 6854472
760 2916029425 2916028427 Bacteria 6748433
761 2916035987 2916035215 Bacteria 6755766
762 2916042530 2916041962 Bacteria 6820487
763 2916052270 2916048683 Bacteria 6543552
764 2916061454 2916055098 Bacteria 6758838
765 2916067596 2916061851 Bacteria 6737736
766 2916080857 2916076590 Bacteria 6596108
767 2919106506 2919100787 Bacteria 7710546
768 2919115310 2919114240 Bacteria 5700270
769 2919167841 2919166419 Bacteria 4952238
770 2919174970 2919171160 Bacteria 6499771
771 2919411587 2919408235 Bacteria 6149349
772 2920766101 2920760137 Bacteria 7427611
773 2920824712 2920822456 Bacteria 6897201
774 2921201944 2921201388 Bacteria 6926299
775 2921210483 2921208531 Bacteria 6745326
776 2921238982 2921237296 Bacteria 6876710
777 2921244568 2921244191 Bacteria 6568419
778 2921251193 2921250672 Bacteria 6677771
779 2921262480 2921257292 Bacteria 6808382
780 2921270816 2921263974 Bacteria 6864552
781 2921284315 2921282425 Bacteria 6826397
782 2921291262 2921289301 Bacteria 7316391
783 2921300804 2921296804 Bacteria 7176999
784 2923558036 2923556063 Bacteria 6793593
785 2924144443 2924144063 Bacteria 6883928
786 2924152329 2924150972 Bacteria 7169444
787 2924160757 2924158325 Bacteria 7188855
788 2924168070 2924165586 Bacteria 7260590
789 2924173631 2924172951 Bacteria 6749356
790 2924181192 2924179722 Bacteria 6843264
791 2924187732 2924186466 Bacteria 6876637
792 2924200435 2924193448 Bacteria 6955718
793 2924206870 2924200457 Bacteria 6757188
794 2924213966 2924207177 Bacteria 6917007
795 2924214961 2924214083 Bacteria 7080103
796 2924222980 2924221636 Bacteria 7113495
797 2924229324 2924228884 Bacteria 6633132
798 2926756356 2926754445 Bacteria 5964435
799 2926760578 2926760298 Bacteria 5505990
800 2929140443 2929138655 Bacteria 5810547
801 2932404506 2932401849 Bacteria 4262978
802 2933008244 2933006813 Bacteria 4912075
803 2933013065 2933011516 Bacteria 5439334
804 2933018391 2933016740 Bacteria 6355406
805 2933570702 2933570622 Bacteria 7023390
806 2933591206 2933586486 Bacteria 7667493
807 2933597750 2933594066 Bacteria 5594265
808 2933601109 2933599457 Bacteria 5858799
809 2935900668 2935894831 Bacteria 6620579
810 2935902099 2935901341 Bacteria 7341747
811 2936372190 2936367885 Bacteria 7324495
812 2936381007 2936375103 Bacteria 6652732
813 2936383039 2936381700 Bacteria 7006523
814 2937002093 2936996657 Bacteria 6298727
815 2937003432 2937002841 Bacteria 6934057
816 2937014131 2937009748 Bacteria 6746052
817 2937018626 2937016420 Bacteria 6782579
818 2937028960 2937023124 Bacteria 6815156
819 2937033429 2937029754 Bacteria 6424026
820 2937038604 2937036028 Bacteria 6846469
821 2937044352 2937042894 Bacteria 6741576
822 2937051072 2937049772 Bacteria 6757901
823 2937062331 2937056579 Bacteria 7107896
824 2937065236 2937063883 Bacteria 7199456
825 2937072408 2937071275 Bacteria 6984483
826 2937079778 2937078374 Bacteria 6610289
827 2937088083 2937084907 Bacteria 6618516
828 2937097582 2937091812 Bacteria 6979387
829 2937099529 2937098957 Bacteria 7249374
830 2937110003 2937106411 Bacteria 6947143
831 2937119018 2937113482 Bacteria 6505872
832 2937126052 2937119839 Bacteria 6597547
833 2937126843 2937126314 Bacteria 6771275
834 2941504986 2941499720 Bacteria 7599444
835 2957376563 2957375807 Bacteria 6425588
836 2957388455 2957382221 Bacteria 6737050
837 2957394838 2957388812 Bacteria 6778072
838 2957398282 2957395598 Bacteria 6822399
839 2957408799 2957402308 Bacteria 6741770
840 2957414739 2957408893 Bacteria 6558585
841 2957416012 2957415311 Bacteria 6991633
842 2957424208 2957422303 Bacteria 7172205
843 2957430988 2957430029 Bacteria 7022557
844 2957441244 2957437181 Bacteria 6568994
845 2957444982 2957443900 Bacteria 6869977
846 2957451403 2957450854 Bacteria 6765715
847 2957458671 2957457609 Bacteria 6967680
848 2957471102 2957464669 Bacteria 6568877
849 2957472069 2957471148 Bacteria 6797643
850 2957484436 2957478035 Bacteria 6756658
851 2957486193 2957484790 Bacteria 6703082
852 2957492020 2957491536 Bacteria 6695180
853 2957503696 2957498199 Bacteria 7126688
854 2957507115 2957505466 Bacteria 7253085
855 2960586188 2960584000 Bacteria 6864594
856 2960592737 2960591022 Bacteria 6622873
857 2960598010 2960597568 Bacteria 6550735
858 2960604776 2960603979 Bacteria 6898737
859 2960612414 2960610863 Bacteria 6691244
860 2960620020 2960617483 Bacteria 6727748
861 2960629234 2960624210 Bacteria 6875384
862 2960632855 2960631154 Bacteria 6732508
863 2960640062 2960637947 Bacteria 7296468
864 2960647100 2960645483 Bacteria 7211087
865 2960655288 2960652885 Bacteria 7083688
866 2960660856 2960660292 Bacteria 7041660
867 2960673782 2960667422 Bacteria 6763020
868 2960675558 2960674078 Bacteria 6609048
869 2960681839 2960680706 Bacteria 6624464
870 2960688008 2960687367 Bacteria 6535474
871 2960700549 2960693952 Bacteria 6749742
872 2964609703 2964607997 Bacteria 7101408
873 2964616564 2964615318 Bacteria 6809089
874 2964623733 2964621998 Bacteria 6834995
875 2964629432 2964628898 Bacteria 7083044
876 2964640940 2964636051 Bacteria 7091832
877 2964649047 2964643177 Bacteria 6820887
878 2964651793 2964649959 Bacteria 6675118
879 2964661017 2964656573 Bacteria 7100150
880 2964670788 2964663802 Bacteria 7019362
881 2964673623 2964670856 Bacteria 6851364
882 2964680023 2964678106 Bacteria 6792020
883 2964686268 2964685014 Bacteria 6839111
884 2964693087 2964691889 Bacteria 6802758
885 2964699849 2964698721 Bacteria 6765331
886 2964706092 2964705432 Bacteria 7114648
887 2964713944 2964712639 Bacteria 6695970
888 2964721499 2964719344 Bacteria 7286602
889 2967665507 2967664464 Bacteria 6948836
890 2967671981 2967671571 Bacteria 7021409
891 2967681863 2967678726 Bacteria 7264382
892 2967691680 2967686174 Bacteria 6678622
893 2967695261 2967693043 Bacteria 6804451
894 2967701917 2967699805 Bacteria 6854538
895 2967708232 2967706974 Bacteria 7186053
896 2967716655 2967714385 Bacteria 7000047
897 2967721656 2967721400 Bacteria 7073753
898 2967734963 2967728569 Bacteria 6641507
899 2967736854 2967735183 Bacteria 6827012
900 2967744348 2967742019 Bacteria 6794534
901 2967753311 2967748971 Bacteria 6733771
902 2967758737 2967755722 Bacteria 6814706
903 2967765373 2967762386 Bacteria 6923502
904 2967770965 2967769361 Bacteria 6587838
905 2967778385 2967775926 Bacteria 6738189
906 2970026525 2970019648 Bacteria 7072033
907 2970031032 2970026789 Bacteria 6785236
908 2970039714 2970033650 Bacteria 7118744
909 2970041322 2970040964 Bacteria 6731123
910 2970053628 2970047711 Bacteria 7088379
911 2970061210 2970054988 Bacteria 6611507
912 2970063308 2970061556 Bacteria 7099761
913 2970073007 2970068827 Bacteria 7123112
914 2970082722 2970076120 Bacteria 6697332
915 2970083734 2970082768 Bacteria 6183754
916 2970089291 2970088815 Bacteria 6933825
917 2970096768 2970095765 Bacteria 6936963
918 2970107487 2970102677 Bacteria 6812532
919 2970116096 2970109326 Bacteria 6863976
920 2970122172 2970116247 Bacteria 6501857
921 2970122960 2970122695 Bacteria 6625855
922 2970131677 2970129317 Bacteria 6806560
923 2970138450 2970136068 Bacteria 7207982
924 2970144120 2970143518 Bacteria 6446480
925 2970150822 2970149975 Bacteria 6779706
926 2970160144 2970156795 Bacteria 7168044
927 2970170386 2970164137 Bacteria 6861252
928 2970172640 2970170962 Bacteria 6876229
929 2970178383 2970177841 Bacteria 6768001
930 2970186170 2970184632 Bacteria 7054431
931 2970192272 2970191845 Bacteria 7032787
932 2977522409 2977516862 Bacteria 6940108
933 2977524374 2977523885 Bacteria 6960446
934 2977531649 2977530762 Bacteria 6951399
935 2977544333 2977537788 Bacteria 6929320
936 2977549064 2977544691 Bacteria 6875412
937 2977554424 2977551784 Bacteria 7125765
938 2977560893 2977558990 Bacteria 6863948
939 2977572655 2977565890 Bacteria 6901543
940 2977579611 2977572785 Bacteria 6763888
941 2977580167 2977579622 Bacteria 6772100
942 2978974293 2978969890 Bacteria 5400756
943 2979094142 2979089926 Bacteria 5670289
944 2979098477 2979095461 Bacteria 5669583
945 2979106094 2979100975 Bacteria 5423623
946 2984512117 2984509177 Bacteria 5274802
947 2984521522 2984518228 Bacteria 5277463
948 2984540816 2984537506 Bacteria 5277481
949 2984589635 2984587000 Bacteria 5263363
950 2984603084 2984601300 Bacteria 5455244
951 2989349410 2989349275 Bacteria 6349068
952 2989773852 2989771324 Bacteria 5605128
953 2989778696 2989776772 Bacteria 4843317
954 2995393084 2995392953 Bacteria 4539380
955 2996891813 2996887358 Bacteria 5795980
956 2996898687 2996893221 Bacteria 5823108
957 3000020159 3000017691 Bacteria 3772574
958 3003933772 3003930520 Bacteria 5667563
959 3005414986 3005409236 Bacteria 7188837
960 3005448242 3005445848 Bacteria 6906074
961 3005454350 3005452660 Bacteria 5889319
962 639649050 639633055 Bacteria 7751309
963 643825964 643692032 Bacteria 6891900
964 648741751 648276728 Bacteria 6968865
965 650739994 650716007 Bacteria 5573770
966 8003570993 8003570095 Bacteria 5747666
967 8003993836 8003992118 Bacteria 7266902
968 8004001373 8003999396 Bacteria 7063185
969 8005250730 8005246636 Bacteria 4933972
970 8005263144 8005258706 Bacteria 6184835
971 8005280979 8005275841 Bacteria 6929066
972 8005285148 8005282627 Bacteria 6675747
973 8005293487 8005289223 Bacteria 6634003
974 8005302962 8005301065 Bacteria 6614431
975 8005312689 8005307578 Bacteria 7395396
976 8005316950 8005314921 Bacteria 7072929
977 8005326340 8005321885 Bacteria 5795980
978 8005380778 8005376324 Bacteria 6590079
979 8005386503 8005382845 Bacteria 6732062
980 8005396279 8005395548 Bacteria 6806915
981 8005434992 8005430974 Bacteria 6689030
982 8005463521 8005460587 Bacteria 7157962
983 8005485252 8005484373 Bacteria 6297373
984 8005500731 8005497431 Bacteria 6477605
985 8005545258 8005542996 Bacteria 7077758
986 8005557163 8005556819 Bacteria 6908598
987 8005567842 8005563573 Bacteria 7153261
988 8005573613 8005570704 Bacteria 6957481
989 8005622107 8005619151 Bacteria 7030230
990 8005632411 8005626139 Bacteria 6534237
991 8005649763 8005645114 Bacteria 6950293
992 8005659256 8005658619 Bacteria 4500593
993 8005672150 8005668836 Bacteria 6953162
994 8005683080 8005682033 Bacteria 6726518
995 8005692269 8005688590 Bacteria 6610080
996 8005699732 8005695170 Bacteria 6912330
997 8018133927 8018127388 Bacteria 7351159
998 8018155576 8018150411 Bacteria 5549903
999 8018166242 8018163183 Bacteria 7277977
1000 8018181473 8018176218 Bacteria 6896178
1001 8023683314 8023680758 Bacteria 7729763
1002 8024492153 8024486573 Bacteria 6540512
1003 8024503916 8024501048 Bacteria 6427847
1004 8046770426 8046767195 Bacteria 7547379
1005 8049294951 8049293176 Bacteria 6128433
1006 8054462315 8054460903 Bacteria 4872905
1007 8054560251 8054558443 Bacteria 5204801
1008 8055435893 8055431914 Bacteria 4551896
1009 8056378365 8056375014 Bacteria 7006639
1010 8056386571 8056382006 Bacteria 6408074
1011 8056877774 8056875544 Bacteria 4355797
1012 8057877390 8057874678 Bacteria 7494653
1013 JGI24740J21852_10013882
1014 JGI25155J39150_1000001
1015 JGI25156J39149_1000001
1016 JGI25162J39368_1000209
1017 JGI25154J39366_1000011
1018 JGI25158J39367_1000764
1019 JGI25157J39369_1000030
1020 JGI25152J39213_1000570
1021 JGI25152J39213_1001028
1022 JGI25152J39213_1014714
1023 JGI25150J39212_1000326
1024 JGI25150J39212_1005593
1025 JGI25159J45721_1000078
1026 JGI25159J45721_1000199
1027 JGI25159J45721_1000530
1028 JGI25151J46595_10000083
1029 JGI25151J46595_10000723
1030 JGI25151J46595_10002399
1031 JGI25151J46595_10007403
1032 JGI25151J46595_10021615
1033 JGI25151J46595_10033472
1034 JGI25165J46597_1000302
1035 JGI25153J46596_10000377
1036 JGI25153J46596_10005215
1037 JGI25153J46596_10014602
1038 rootH2_10132391
1039 JGI25160J50197_1000087
1040 JGI25160J50197_1000216
1041 JGI25160J50197_1022289
1042 JGI25161J50226_1000066
1043 JGI25161J50226_1000207
1044 JGI25161J50226_1000412
1045 JGI25161J50226_1005029
1046 Ga0055539_1005636
1047 Ga0055526_1000594
1048 Ga0055526_1007248
1049 Ga0055526_1010689
1050 Ga0055524_1001754
1051 Ga0055524_1001805
1052 Ga0055524_1010199
1053 Ga0055536_1025789
1054 Ga0055528_1000276
1055 Ga0055528_1000331
1056 Ga0055528_1000358
1057 Ga0055530_10033082
1058 Ga0055540_1000508
1059 Ga0055540_1014435
1060 Ga0055540_1034674
1061 Ga0055531_10014529
1062 Ga0058692_1000350
1063 Ga0055543_1000053
1064 Ga0055543_1000068
1065 Ga0055543_1000301
1066 Ga0055543_1001883
1067 Ga0065165_1000717
1068 Ga0065165_1000839
1069 Ga0065165_1005533
1070 Ga0065165_1007705
1071 Ga0070666_10080111
1072 Ga0070663_100069594
1073 Ga0070665_100372853
1074 Ga0068854_100046155
1075 Ga0068856_100035514
1076 Ga0075365_10000404
1077 Ga0075365_10040694
1078 Ga0075365_10041651
1079 Ga0075365_10071578
1080 Ga0075368_10040251
1081 Ga0075363_100035648
1082 Ga0075363_100257842
1083 Ga0075364_10000320
1084 Ga0075364_10232791
1085 Ga0075362_10016243
1086 Ga0075362_10057540
1087 Ga0075367_10000761
1088 Ga0075367_10006190
1089 Ga0075367_10014267
1090 Ga0075367_10241402
1091 Ga0075369_10000812
1092 Ga0075369_10000891
1093 Ga0075369_10014994
1094 Ga0075366_10013658
1095 Ga0075370_10005768
1096 Ga0075370_10019244
1097 Ga0079104_1000610
1098 Ga0079104_1005249
1099 Ga0079104_1013531
1100 Ga0099826_10000091
1101 Ga0099826_10012274
1102 Ga0099826_10153200
1103 Ga0105240_10000005
1104 Ga0105243_10023405
1105 Ga0105248_10208894
1106 Ga0105248_10544636
1107 Ga0105237_10000766
1108 Ga0123341_1020977
1109 Ga0123341_1080942
1110 Ga0123341_1080949
1111 Ga0123342_1012633
1112 Ga0105239_10001069
1113 Ga0157373_10007245
1114 Ga0157373_10187063
1115 Ga0157371_10000015
1116 Ga0157371_10007585
1117 Ga0157370_10000046
1118 Ga0157370_10000402
1119 Ga0171463_1003
1120 Ga0182007_10020300
1121 Ga0182005_1015351
1122 Ga0183365_10842
1123 Ga0183363_1047
1124 Ga0214544_1001682
1125 Ga0214542_1001614
1126 Ga0214542_1018957
1127 Ga0214543_1000078
1128 Ga0214543_1001395
1129 Ga0228711_1000016
1130 Ga0228710_1000013
1131 Ga0209435_100012
1132 Ga0209436_100085
1133 Ga0209436_103034
1134 Ga0209437_100047
1135 Ga0207425_1000024
1136 Ga0207425_1001564
1137 Ga0209646_1000026
1138 Ga0209646_1004852
1139 Ga0209646_1008187
1140 Ga0209026_1000014
1141 Ga0209677_100656
1142 Ga0209759_1000012
1143 Ga0209129_1000069
1144 Ga0209129_1000184
1145 Ga0209129_1000703
1146 Ga0209129_1009877
1147 Ga0209233_1000048
1148 Ga0209673_1000010
1149 Ga0209673_1000384
1150 Ga0209673_1000800
1151 Ga0209673_1002846
1152 Ga0209673_1003537
1153 Ga0209673_1008196
1154 Ga0209673_1026555
1155 Ga0209130_1000021
1156 Ga0209130_1000029
1157 Ga0209130_1000081
1158 Ga0209130_1005588
1159 Ga0209676_1007095
1160 Ga0209025_1000050
1161 Ga0209025_1000058
1162 Ga0209025_1000094
1163 Ga0209025_1000119
1164 Ga0209025_1000959
1165 Ga0209025_1001225
1166 Ga0209025_1003729
1167 Ga0209025_1004412
1168 Ga0209564_1000260
1169 Ga0209564_1000278
1170 Ga0209564_1000388
1171 Ga0209564_1000458
1172 Ga0209564_1023915
1173 Ga0209564_1026939
1174 Ga0209564_1035058
1175 Ga0209758_1000083
1176 Ga0209758_1000418
1177 Ga0209758_1001270
1178 Ga0209758_1001487
1179 Ga0209758_1001756
1180 Ga0209758_1001805
1181 Ga0209758_1007127
1182 Ga0209050_1009223
1183 Ga0209256_1000042
1184 Ga0209256_1000705
1185 Ga0209256_1001127
1186 Ga0209256_1001984
1187 Ga0209256_1003234
1188 Ga0209256_1003768
1189 Ga0209256_1022779
1190 Ga0207426_1000008
1191 Ga0207426_1000010
1192 Ga0207426_1000074
1193 Ga0207426_1000952
1194 Ga0207426_1001412
1195 Ga0209051_1001051
1196 Ga0209051_1002798
1197 Ga0209051_1002923
1198 Ga0209257_1001598
1199 Ga0209257_1007766
1200 Ga0207695_10000011
1201 Ga0207671_10000241
1202 Ga0207711_10342107
1203 Ga0207711_10380908
1204 Ga0207678_10082146
1205 Ga0207702_10074236
1206 Ga0209281_1000036
1207 Ga0209281_1000047
1208 Ga0209281_1000221
1209 Ga0209281_1001134
1210 Ga0209371_1000021
1211 Ga0209282_1000041
1212 Ga0209282_1000251
1213 Ga0268266_10044251
1214 Ga0268266_10110294
1215 Ga0307515_10000023
1216 Ga0307515_10013391
1217 Ga0307515_10034938
1218 Ga0307515_10084680
1219 Ga0307515_10185340
1220 Ga0268256_1000020
1221 Ga0307513_10134623
1222 Ga0307513_10139907
1223 Ga0316575_10002907
1224 Ga0307405_10008575
1225 Ga0307413_10432426
1226 Ga0307406_10194364
1227 Ga0307412_10001992
1228 Ga0307412_10029449
1229 Ga0307412_10064336
1230 Ga0315914_1005042
1231 Ga0315913_1003257
1232 Ga0315915_1000017
1233 Ga0373944_0068257
1234 Ga0373935_0025966
1235 Ga0373927_0000178
1236 Ga0316584_0192801
1237 Ga0373925_0010945
1238 Ga0395905_0002452
1239 Ga0395905_0010948
1240 Ga0395905_0199214
1241 Ga0400483_071493
1242 Ga0400483_080086
1243 Ga0400483_107700
1244 Ga0400483_278628
1245 Ga0400483_282110
1246 Ga0400487_47283
1247 Ga0439436_0030059
1248 Ga0439436_0031961
1249 Ga0439438_045518
1250 Ga0439465_0003881
1251 Ga0451835_0083305
1252 Ga0451837_0130519
1253 Ga0451837_1837333
1254 Ga0451839_0261576
1255 Ga0451841_0575577
1256 Ga0451847_0545570
1257 Ga0451847_0891855
1258 Ga0451849_0386776
1259 Ga0451851_0185573
1260 Ga0451855_0012851
1261 Ga0451855_1944388
1262 Ga0451853_2912743
1263 Ga0451853_3363309
1264 Ga0439432_063399
1265 Ga0439449_0004143
1266 Ga0450920_003834
1267 Ga0450906_018103
1268 Ga0450918_002471
1269 Ga0466964_0170657
1270 Ga0495638_0001984
1271 Ga0495638_0177297
1272 Ga0495650_0046649
1273 Ga0495605_0015250
1274 Ga0495605_0019164
1275 Ga0495662_0010567
1276 Ga0495585_0019158
1277 Ga0495585_0099763
1278 Ga0495607_0033766
1279 Ga0495607_0166729
1280 Ga0495606_0001613
1281 Ga0495610_0002852
1282 Ga0495610_0027460
1283 Ga0495620_0034222
1284 Ga0495620_0072044
1285 Ga0495631_0005659
1286 Ga0495631_0039188
1287 Ga0495632_0016479
1288 Ga0495643_0020602
1289 Ga0495643_0051225
1290 Ga0495643_0137695
1291 Ga0495643_0141341
1292 Ga0495648_0049155
1293 Ga0495654_0000090
1294 Ga0495654_0035092
1295 Ga0495597_0069868
1296 Ga0495622_0133913
1297 Ga0495633_0015101
1298 Ga0495656_0162555
1299 Ga0495668_0020820
1300 Ga0495625_0022466
1301 Ga0495625_0031471
1302 Ga0495625_0089047
1303 Ga0495625_0141684
1304 Ga0495588_0141123
1305 Ga0495657_0024352
1306 Ga0495658_0048653
1307 Ga0495624_0046986
1308 Ga0495670_0093823
1309 Ga0495649_0122228
1310 Ga0495649_0175124
1311 Ga0495600_0027407
1312 Ga0495660_0029052
1313 Ga0495604_0008217
1314 Ga0495636_0097656
1315 Ga0495683_0031151
1316 Ga0495687_051641
1317 Ga0495687_057865
1318 Ga0495681_0005741
1319 Ga0495686_0003897
1320 Ga0495686_0023787
1321 Ga0496100_0017847
1322 Ga0496101_0014967
1323 Ga0496103_0008326
1324 Ga0496104_0060690
1325 Ga0496106_0000928
1326 Ga0496110_0101120
1327 Ga0496113_0076669
1328 Ga0496116_0000232
1329 Ga0496116_0005431
1330 Ga0496116_0057331
1331 Ga0496116_0067750
1332 Ga0496117_0000002
1333 Ga0496117_0000353
1334 Ga0496117_0006313
1335 Ga0496117_0033172
1336 Ga0496117_0036423
1337 Ga0496117_0044531
1338 Ga0496117_0110399
1339 Ga0496118_0000204
1340 Ga0496118_0000355
1341 Ga0496118_0022010
1342 Ga0496118_0032991
1343 Ga0496118_0135283
1344 Ga0496118_0217705
1345 Ga0496119_0004804
1346 Ga0496119_0014717
1347 Ga0496119_0023483
1348 Ga0496120_0000941
1349 Ga0496120_0009779
1350 Ga0496120_0012875
1351 Ga0496120_0065320
1352 Ga0496120_0083139
1353 Ga0496120_0107478
1354 Ga0496120_0173954
1355 Ga0496121_0000001
1356 Ga0496121_0000363
1357 Ga0496121_0000378
1358 Ga0496121_0009399
1359 Ga0496121_0063633
1360 Ga0496121_0190957
1361 Ga0496121_0202317
1362 Ga0496121_0219166
1363 Ga0496122_0000001
1364 Ga0496122_0000525
1365 Ga0496122_0004665
1366 Ga0496122_0008819
1367 Ga0496122_0012544
1368 Ga0496122_0035082
1369 Ga0496122_0038357
1370 Ga0496122_0058026
1371 Ga0496122_0077924
1372 Ga0496122_0129473
1373 Ga0496123_0000001
1374 Ga0496123_0000054
1375 Ga0496123_0001014
1376 Ga0496123_0002174
1377 Ga0496123_0002482
1378 Ga0496123_0026934
1379 Ga0496123_0030351
1380 Ga0496123_0101190
1381 Ga0496124_0001936
1382 Ga0496124_0002257
1383 Ga0496124_0010848
1384 Ga0496124_0014592
1385 Ga0496124_0040805
1386 Ga0496124_0049824
1387 Ga0496124_0119105
1388 Ga0496124_0138039
1389 Ga0496124_0187441
1390 Ga0496124_0334114
1391 Ga0496125_0000155
1392 Ga0496125_0002081
1393 Ga0496125_0011299
1394 Ga0496125_0022186
1395 Ga0496125_0024477
1396 Ga0496125_0304124
1397 Ga0496126_0000703
1398 Ga0496126_0001019
1399 Ga0496126_0061193
1400 Ga0496126_0336743
1401 Ga0496126_0355967
1402 Ga0501032_0244451
1403 Ga0501033_0000167
1404 Ga0501033_0033566
1405 Ga0501033_0095579
1406 Ga0501034_0000464
1407 Ga0501034_0002538
1408 Ga0501034_0143394
1409 Ga0501036_0369096
1410 Ga0501039_0194053
1411 Ga0501039_0426383
1412 Ga0501043_0027267
1413 Ga0501043_0277095
1414 Ga0501073_0160449
1415 Ga0501035_0006797
1416 Ga0501035_0198200
1417 Ga0501044_0413523
1418 nmdc:mga03683_2318_c1
1419 nmdc:mga03683_34891_c1
1420 nmdc:mga03n38_1786_c1
1421 nmdc:mga00v17_2490_c1
1422 nmdc:mga00v17_6_c1
1423 nmdc:mga00v17_728_c1
1424 nmdc:mga0yw44_33191_c1
1425 nmdc:mga0yw44_35236_c1
1426 nmdc:mga0yw44_38668_c1
1427 nmdc:mga0k408_30414_c1
1428 nmdc:mga06z11_817_c1
1429 nmdc:mga07m45_928_c1
1430 nmdc:mga0sz30_12802_c1
1431 nmdc:mga0sz30_215_c2
1432 nmdc:mga0sz30_708_c1
1433 Ga0500610_0041889
1434 Ga0500578_0283718
1435 Ga0500557_002118
1436 Ga0500594_0003440
1437 Ga0500618_000604
1438 Ga0500618_008756
1439 Ga0500618_018416
1440 Ga0500652_115784
1441 Ga0500658_0000945
1442 Ga0500561_0000246
1443 Ga0500568_0000365
1444 Ga0500568_0001517
1445 Ga0500568_0003015
1446 Ga0500573_0000259
1447 Ga0500573_0040542
1448 Ga0500590_001701
1449 Ga0500616_0000301
1450 Ga0500616_0004349
1451 Ga0500622_0001146
1452 Ga0500627_0089285
1453 Ga0500634_0001667
1454 Ga0500636_0000153
1455 Ga0500636_0001102
1456 Ga0500636_0061021
1457 Ga0587076_011008
1458 Ga0501082_0367164
1459 2840879234
1460 2509111388
1461 2509375673
1462 2509392199
1463 2509446849
1464 2510133801
1465 2510303299
1466 2510841076
1467 2511135222
1468 2511171677
1469 2511181651
1470 2511194380
1471 2511501960
1472 2512533331
1473 2512971114
1474 2513574158
1475 2513576806
1476 2513584744
1477 2513594687
1478 2513604529
1479 2513615452
1480 2513629548
1481 2513708189
1482 2513864755
1483 2513881240
1484 2513902372
1485 2513914101
1486 2513926076
1487 2513984612
1488 2513997075
1489 2514007582
1490 2515112847
1491 2515608750
1492 2515636466
1493 2515640818
1494 2515655498
1495 2515739344
1496 2516209681
1497 2516893255
1498 2517036554
1499 2517076924
1500 2517095686
1501 2517407250
1502 2517570002
1503 2520381516
1504 2524448843
1505 2524460168
1506 2530646156
1507 2535516600
1508 2537877727
1509 2551674934
1510 2551680188
1511 2551684835
1512 2551695935
1513 2551704473
1514 2551711462
1515 2551720833
1516 2551728685
1517 2551735014
1518 2551739436
1519 2554247611
1520 2558867989
1521 2559294744
1522 2561466427
1523 2585200280
1524 2585222623
1525 2585229900
1526 2585254866
1527 2585270959
1528 2585323520
1529 2585331655
1530 2585386733
1531 2585393039
1532 2585402117
1533 2585527302
1534 2585533957
1535 2585538039
1536 2585545206
1537 2585552192
1538 2585558683
1539 2585821902
1540 2585835987
1541 2585898048
1542 2585904347
1543 2585996019
1544 2586000623
1545 2587980536
1546 2599417549
1547 2599604008
1548 2600193101
1549 2600375709
1550 2601608264
1551 2601745038
1552 2616293519
1553 2616308687
1554 2616557009
1555 2617385783
1556 2643803600
1557 2643811648
1558 2643919231
1559 2644003869
1560 2644050747
1561 2644067568
1562 2644107715
1563 2644148614
1564 2644192606
1565 2644205221
1566 2644210234
1567 2644239676
1568 2644300353
1569 2644309109
1570 2644332936
1571 2644375247
1572 2644418621
1573 2644451988
1574 2644483665
1575 2644491792
1576 2644501338
1577 2644522137
1578 2644545892
1579 2644615051
1580 2644653786
1581 2644658577
1582 2644676587
1583 2644690750
1584 2657681177
1585 2671111616
1586 2692315857
1587 2719181657
1588 2719386190
1589 2719665998
1590 2719732321
1591 2720492418
1592 2720613773
1593 2720620561
1594 2720631986
1595 2720775714
1596 2721147749
1597 2721159197
1598 2721164584
1599 2721399972
1600 2722840754
1601 2723027321
1602 2723560940
1603 2723567533
1604 2724038785
1605 2724045077
1606 2724090321
1607 2724104798
1608 2724110599
1609 2725952707
1610 2730108257
1611 2730164892
1612 2730298829
1613 2738945434
1614 2739032696
1615 2753461853
1616 2766065723
1617 2778174119
1618 2792581773
1619 2792620158
1620 2792626422
1621 2792639370
1622 2793298713
1623 2793314683
1624 2793320519
1625 2793330441
1626 2793338336
1627 2793344285
1628 2793348729
1629 2793351980
1630 2793363845
1631 2793370333
1632 2802719497
1633 2802726910
1634 2802732231
1635 2802739834
1636 2802745340
1637 2802752732
1638 2804752376
1639 2805931003
1640 2805937982
1641 2806043676
1642 2806050393
1643 2806057210
1644 2806064591
1645 2806071858
1646 2808985487
1647 2819608968
1648 2819637804
1649 2821129485
1650 2834578249
1651 2837679769
1652 2838017814
1653 2838028591
1654 2838029987
1655 2838038239
1656 2838043825
1657 2838051894
1658 2838068486
1659 2838070304
1660 2838079601
1661 2838661884
1662 2838674156
1663 2838676335
1664 2838681755
1665 2838687196
1666 2838696327
1667 2838706598
1668 2838710434
1669 2838715218
1670 2838720982
1671 2838725976
1672 2838729832
1673 2838738483
1674 2838743153
1675 2841841148
1676 2841847940
1677 2841852639
1678 2841859508
1679 2841869940
1680 2842078608
1681 2842114834
1682 2842118883
1683 2842126030
1684 2842131229
1685 2842140926
1686 2842151333
1687 2842153601
1688 2842157901
1689 2842167550
1690 2842171461
1691 2842177221
1692 2842181520
1693 2842188326
1694 2842198419
1695 2842204619
1696 2842205634
1697 2842212637
1698 2842217784
1699 2842225744
1700 2842230429
1701 2842239846
1702 2842244331
1703 2842256350
1704 2842257583
1705 2842265646
1706 2842271266
1707 2842279091
1708 2842285754
1709 2842292270
1710 2842301928
1711 2842304894
1712 2842315070
1713 2842320554
1714 2842346313
1715 2842357606
1716 2842369108
1717 2842372322
1718 2842378667
1719 2842385393
1720 2842401925
1721 2842403114
1722 2842409513
1723 2842416166
1724 2842423918
1725 2842429717
1726 2842436330
1727 2842442677
1728 2842452935
1729 2842464138
1730 2842470659
1731 2842476728
1732 2842484732
1733 2842490426
1734 2842496982
1735 2842503515
1736 2842511320
1737 2842516293
1738 2842522683
1739 2842923970
1740 2844167572
1741 2844458562
1742 2847419078
1743 2848994109
1744 2850081151
1745 2852390013
1746 2854684775
1747 2854899350
1748 2855825981
1749 2855841327
1750 2855876754
1751 2857517583
1752 2857535113
1753 2858802308
1754 2889795853
1755 2889917770
1756 2891050902
1757 2891373152
1758 2896389944
1759 2899276544
1760 2899796305
1761 2899809005
1762 2899849471
1763 2913300846
1764 2913310140
1765 2915981910
1766 2915991353
1767 2915994371
1768 2916002201
1769 2916009177
1770 2916018207
1771 2916022726
1772 2916029425
1773 2916035987
1774 2916042530
1775 2916052270
1776 2916061454
1777 2916067596
1778 2916080857
1779 2919106506
1780 2919115310
1781 2919167841
1782 2919174970
1783 2919411587
1784 2920766101
1785 2920824712
1786 2921201944
1787 2921210483
1788 2921238982
1789 2921244568
1790 2921251193
1791 2921262480
1792 2921270816
1793 2921284315
1794 2921291262
1795 2921300804
1796 2923558036
1797 2924144443
1798 2924152329
1799 2924160757
1800 2924168070
1801 2924173631
1802 2924181192
1803 2924187732
1804 2924200435
1805 2924206870
1806 2924213966
1807 2924214961
1808 2924222980
1809 2924229324
1810 2926756356
1811 2926760578
1812 2929140443
1813 2932404506
1814 2933008244
1815 2933013065
1816 2933018391
1817 2933570702
1818 2933591206
1819 2933597750
1820 2933601109
1821 2935900668
1822 2935902099
1823 2936372190
1824 2936381007
1825 2936383039
1826 2937002093
1827 2937003432
1828 2937014131
1829 2937018626
1830 2937028960
1831 2937033429
1832 2937038604
1833 2937044352
1834 2937051072
1835 2937062331
1836 2937065236
1837 2937072408
1838 2937079778
1839 2937088083
1840 2937097582
1841 2937099529
1842 2937110003
1843 2937119018
1844 2937126052
1845 2937126843
1846 2941504986
1847 2957376563
1848 2957388455
1849 2957394838
1850 2957398282
1851 2957408799
1852 2957414739
1853 2957416012
1854 2957424208
1855 2957430988
1856 2957441244
1857 2957444982
1858 2957451403
1859 2957458671
1860 2957471102
1861 2957472069
1862 2957484436
1863 2957486193
1864 2957492020
1865 2957503696
1866 2957507115
1867 2960586188
1868 2960592737
1869 2960598010
1870 2960604776
1871 2960612414
1872 2960620020
1873 2960629234
1874 2960632855
1875 2960640062
1876 2960647100
1877 2960655288
1878 2960660856
1879 2960673782
1880 2960675558
1881 2960681839
1882 2960688008
1883 2960700549
1884 2964609703
1885 2964616564
1886 2964623733
1887 2964629432
1888 2964640940
1889 2964649047
1890 2964651793
1891 2964661017
1892 2964670788
1893 2964673623
1894 2964680023
1895 2964686268
1896 2964693087
1897 2964699849
1898 2964706092
1899 2964713944
1900 2964721499
1901 2967665507
1902 2967671981
1903 2967681863
1904 2967691680
1905 2967695261
1906 2967701917
1907 2967708232
1908 2967716655
1909 2967721656
1910 2967734963
1911 2967736854
1912 2967744348
1913 2967753311
1914 2967758737
1915 2967765373
1916 2967770965
1917 2967778385
1918 2970026525
1919 2970031032
1920 2970039714
1921 2970041322
1922 2970053628
1923 2970061210
1924 2970063308
1925 2970073007
1926 2970082722
1927 2970083734
1928 2970089291
1929 2970096768
1930 2970107487
1931 2970116096
1932 2970122172
1933 2970122960
1934 2970131677
1935 2970138450
1936 2970144120
1937 2970150822
1938 2970160144
1939 2970170386
1940 2970172640
1941 2970178383
1942 2970186170
1943 2970192272
1944 2977522409
1945 2977524374
1946 2977531649
1947 2977544333
1948 2977549064
1949 2977554424
1950 2977560893
1951 2977572655
1952 2977579611
1953 2977580167
1954 2978974293
1955 2979094142
1956 2979098477
1957 2979106094
1958 2984512117
1959 2984521522
1960 2984540816
1961 2984589635
1962 2984603084
1963 2989349410
1964 2989773852
1965 2989778696
1966 2995393084
1967 2996891813
1968 2996898687
1969 3000020159
1970 3003933772
1971 3005414986
1972 3005448242
1973 3005454350
1974 639649050
1975 643825964
1976 648741751
1977 650739994
1978 8003570993
1979 8003993836
1980 8004001373
1981 8005250730
1982 8005263144
1983 8005280979
1984 8005285148
1985 8005293487
1986 8005302962
1987 8005312689
1988 8005316950
1989 8005326340
1990 8005380778
1991 8005386503
1992 8005396279
1993 8005434992
1994 8005463521
1995 8005485252
1996 8005500731
1997 8005545258
1998 8005557163
1999 8005567842
2000 8005573613
2001 8005622107
2002 8005632411
2003 8005649763
2004 8005659256
2005 8005672150
2006 8005683080
2007 8005692269
2008 8005699732
2009 8018133927
2010 8018155576
2011 8018166242
2012 8018181473
2013 8023683314
2014 8024492153
2015 8024503916
2016 8046770426
2017 8049294951
2018 8054462315
2019 8054560251
2020 8055435893
2021 8056378365
2022 8056386571
2023 8056877774
2024 8057877390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

17

146

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g1u-assembly1.cif.gz_D x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.9058 13 225
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9009 10 225
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.8975 11 206
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.8932 9 211
2nq2-assembly1.cif.gz_C an inward-facing conformation of a putative metal-chelate type abc transporter. 0.8876 10 225
ID Description Score Start End Superfamily
af_P0A9X1_1_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9807 10 236 3.40.50.300
af_P0A9X1_1_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9722 10 236 3.40.50.300
4g1uC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.905 11 225 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9014 11 211 3.40.50.300
af_Q58283_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9012 13 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A496ZAI6-F1-model_v4 High-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG 0.9503 107 223 GO:0005524
GO:0005886
GO:0016887
AF-A0A378G4R5-F1-model_v4 High-affinity branched-chain amino acid transport ATP-binding protein LivG (LIV-I protein G) 0.9439 107 225 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-F9MWB5-F1-model_v4 deleted 0.9359 107 225
AF-A0A182A4U5-F1-model_v4 deleted 0.9279 13 227
AF-E4SMZ3-F1-model_v4 Zinc ABC transporter ATPase protein 0.9278 12 213 GO:0005524
GO:0016887

Map