F488189
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1013 | 377 | 2026 | 463 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100051325|Ga0070711_1000513254 |
| Length | 452 |
| Sequence | MDFDPVLLARLQFAFTIIFHIIFPSFTIGLSAYIATLGALWLRSGEERHQLLMRFWVKIFAVSFAMGVVSGIVLSYQFGTNWSRFSVATGNVLGPLLGYEVLAAFFLEATFLGILLFGFNKVPPWLYVLSAIVVAIGTMTSAFWILAANSWMQTPAGHEFRDGVAYPLDWLHIVFNPSFPYRFAHMLNAAYLTTAFVVIAVGARYLIRTMLRMGIGLAAILAPLQLIIGDQHGLNTLAHQPLKVAAMEAHWDGSKPGDFHIFAWPDEKAGVNHFELSIPKGASLILTHKMNGLFPGLLSVPEADRPPVKVVFFGFRIMLGVGLFMIASALFGAFLWWRGTLFETRWYLRIMAQSWWVGFVAVIAGWVVTESGRQPWIVYGVMRTADATSPVPGATIAGTLALFVLAYGVVFSFGIYYMNRLIANGPDQGTETGGEFSGNPLSTTQDAGRGPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 84 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 85 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 86 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 90 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 93 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 140 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 220 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 222 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 224 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 230 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 242 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 244 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 245 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 246 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 248 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 251 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 312 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 322 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 354 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 355 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 370 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 371 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 376 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 377 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.68 |
| Nodule | 0 |
| Rhizoplane | 9.38 |
| Rhizosphere | 88.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070711_100051325 | 3300005439 | Bacteria | 2832 |
| 2 | 2214745202 | 2209111006 | Bacteria | 16175 |
| 3 | ARSoilYngRDRAFT_c00086 | 3300000042 | Bacteria | 15520 |
| 4 | ARcpr5yngRDRAFT_c000084 | 3300000043 | Bacteria | 15520 |
| 5 | ARSoilOldRDRAFT_c000050 | 3300000044 | Bacteria | 25074 |
| 6 | ARCol0yngRDRAFT_1000023 | 3300000652 | Bacteria | 28722 |
| 7 | JGI24739J22299_10000209 | 3300001989 | Bacteria | 19461 |
| 8 | JGI24739J22299_10002430 | 3300001989 | Bacteria | 7191 |
| 9 | JGI24737J22298_10000739 | 3300001990 | Bacteria | 11509 |
| 10 | JGI24737J22298_10003173 | 3300001990 | Bacteria | 5839 |
| 11 | JGI24750J21931_1000551 | 3300002070 | Bacteria | 5744 |
| 12 | JGI24748J21848_1000695 | 3300002074 | Bacteria | 3616 |
| 13 | JGI24738J21930_10001189 | 3300002075 | Bacteria | 7282 |
| 14 | JGI24749J21850_1000283 | 3300002076 | Bacteria | 7793 |
| 15 | JGI24744J21845_10000810 | 3300002077 | Bacteria | 5872 |
| 16 | JGI24035J26624_1000365 | 3300002126 | Bacteria | 4267 |
| 17 | JGI24742J22300_10000279 | 3300002244 | Bacteria | 7687 |
| 18 | JGI25153J46596_10004383 | 3300003215 | Bacteria | 7615 |
| 19 | JGI25404J52841_10002701 | 3300003659 | Bacteria | 3395 |
| 20 | Ga0065714_10095322 | 3300005288 | Bacteria | 1790 |
| 21 | Ga0065704_10073133 | 3300005289 | Bacteria | 7551 |
| 22 | Ga0065712_10070789 | 3300005290 | Bacteria | 5705 |
| 23 | Ga0065715_10000519 | 3300005293 | Bacteria | 20489 |
| 24 | Ga0065715_10004456 | 3300005293 | Bacteria | 3808 |
| 25 | Ga0070676_10002633 | 3300005328 | Bacteria | 9237 |
| 26 | Ga0070676_10041250 | 3300005328 | Bacteria | 2675 |
| 27 | Ga0070683_100010864 | 3300005329 | Bacteria | 7839 |
| 28 | Ga0070683_100035491 | 3300005329 | Bacteria | 4558 |
| 29 | Ga0070690_100001459 | 3300005330 | Bacteria | 12359 |
| 30 | Ga0070670_100012949 | 3300005331 | Bacteria | 7141 |
| 31 | Ga0070670_100027821 | 3300005331 | Bacteria | 4864 |
| 32 | Ga0070677_10000109 | 3300005333 | Bacteria | 26990 |
| 33 | Ga0068869_100004148 | 3300005334 | Bacteria | 8986 |
| 34 | Ga0068869_100035836 | 3300005334 | Bacteria | 3520 |
| 35 | Ga0068869_100146055 | 3300005334 | Bacteria | 1830 |
| 36 | Ga0070680_100018038 | 3300005336 | Bacteria | 5574 |
| 37 | Ga0070680_100019164 | 3300005336 | Bacteria | 5420 |
| 38 | Ga0070680_100063179 | 3300005336 | Bacteria | 3032 |
| 39 | Ga0070682_100000459 | 3300005337 | Bacteria | 25698 |
| 40 | Ga0070682_100034055 | 3300005337 | Bacteria | 3099 |
| 41 | Ga0070682_100040299 | 3300005337 | Bacteria | 2874 |
| 42 | Ga0068868_100000443 | 3300005338 | Bacteria | 27815 |
| 43 | Ga0068868_100006452 | 3300005338 | Bacteria | 8300 |
| 44 | Ga0070660_100034923 | 3300005339 | Bacteria | 3802 |
| 45 | Ga0070660_100046626 | 3300005339 | Bacteria | 3322 |
| 46 | Ga0070689_100000423 | 3300005340 | Bacteria | 24943 |
| 47 | Ga0070689_100001662 | 3300005340 | Bacteria | 14205 |
| 48 | Ga0070689_100020869 | 3300005340 | Bacteria | 4868 |
| 49 | Ga0070689_100043276 | 3300005340 | Bacteria | 3460 |
| 50 | Ga0070689_100131548 | 3300005340 | Bacteria | 2007 |
| 51 | Ga0070691_10001927 | 3300005341 | Bacteria | 9119 |
| 52 | Ga0070691_10011614 | 3300005341 | Bacteria | 4023 |
| 53 | Ga0070691_10011885 | 3300005341 | Bacteria | 3984 |
| 54 | Ga0070691_10019580 | 3300005341 | Bacteria | 3125 |
| 55 | Ga0070687_100000706 | 3300005343 | Bacteria | 11178 |
| 56 | Ga0070687_100005176 | 3300005343 | Bacteria | 5266 |
| 57 | Ga0070687_100006831 | 3300005343 | Bacteria | 4706 |
| 58 | Ga0070687_100022617 | 3300005343 | Bacteria | 2976 |
| 59 | Ga0070661_100001619 | 3300005344 | Bacteria | 15572 |
| 60 | Ga0070692_10000262 | 3300005345 | Bacteria | 14685 |
| 61 | Ga0070692_10046098 | 3300005345 | Bacteria | 2251 |
| 62 | Ga0070668_100001027 | 3300005347 | Bacteria | 19571 |
| 63 | Ga0070668_100051371 | 3300005347 | Bacteria | 3176 |
| 64 | Ga0070668_100092303 | 3300005347 | Bacteria | 2388 |
| 65 | Ga0070669_100002329 | 3300005353 | Bacteria | 13729 |
| 66 | Ga0070669_100064546 | 3300005353 | Bacteria | 2697 |
| 67 | Ga0070675_100040634 | 3300005354 | Bacteria | 3798 |
| 68 | Ga0070671_100017038 | 3300005355 | Bacteria | 5877 |
| 69 | Ga0070671_100019919 | 3300005355 | Bacteria | 5465 |
| 70 | Ga0070671_100031446 | 3300005355 | Bacteria | 4384 |
| 71 | Ga0070674_100001251 | 3300005356 | Bacteria | 13361 |
| 72 | Ga0070674_100009547 | 3300005356 | Bacteria | 5810 |
| 73 | Ga0070674_100027485 | 3300005356 | Bacteria | 3729 |
| 74 | Ga0070674_100043841 | 3300005356 | Bacteria | 3045 |
| 75 | Ga0070673_100000050 | 3300005364 | Bacteria | 49499 |
| 76 | Ga0070673_100006576 | 3300005364 | Bacteria | 7565 |
| 77 | Ga0070673_100016705 | 3300005364 | Bacteria | 5200 |
| 78 | Ga0070688_100001640 | 3300005365 | Bacteria | 11206 |
| 79 | Ga0070688_100007074 | 3300005365 | Bacteria | 6036 |
| 80 | Ga0070688_100036737 | 3300005365 | Bacteria | 2981 |
| 81 | Ga0070659_100012533 | 3300005366 | Bacteria | 6285 |
| 82 | Ga0070659_100037940 | 3300005366 | Bacteria | 3756 |
| 83 | Ga0070659_100039712 | 3300005366 | Bacteria | 3675 |
| 84 | Ga0070659_100042832 | 3300005366 | Bacteria | 3540 |
| 85 | Ga0070667_100006734 | 3300005367 | Bacteria | 9546 |
| 86 | Ga0070667_100015429 | 3300005367 | Bacteria | 6316 |
| 87 | Ga0070667_100033083 | 3300005367 | Bacteria | 4317 |
| 88 | Ga0070703_10001729 | 3300005406 | Bacteria | 6477 |
| 89 | Ga0070703_10002210 | 3300005406 | Bacteria | 5657 |
| 90 | Ga0070709_10000525 | 3300005434 | Bacteria | 22547 |
| 91 | Ga0070714_100005095 | 3300005435 | Bacteria | 9993 |
| 92 | Ga0070713_100001754 | 3300005436 | Bacteria | 13984 |
| 93 | Ga0070713_100178398 | 3300005436 | Bacteria | 1907 |
| 94 | Ga0070710_10001598 | 3300005437 | Bacteria | 10686 |
| 95 | Ga0070710_10069031 | 3300005437 | Bacteria | 2032 |
| 96 | Ga0070701_10000093 | 3300005438 | Bacteria | 25004 |
| 97 | Ga0070701_10021819 | 3300005438 | Bacteria | 3063 |
| 98 | Ga0070701_10022612 | 3300005438 | Bacteria | 3015 |
| 99 | Ga0070711_100016501 | 3300005439 | Bacteria | 4692 |
| 100 | Ga0070705_100003411 | 3300005440 | Bacteria | 7790 |
| 101 | Ga0070705_100009540 | 3300005440 | Bacteria | 4829 |
| 102 | Ga0070705_100101189 | 3300005440 | Bacteria | 1820 |
| 103 | Ga0070700_100009936 | 3300005441 | Bacteria | 5236 |
| 104 | Ga0070700_100010471 | 3300005441 | Bacteria | 5122 |
| 105 | Ga0070700_100014595 | 3300005441 | Bacteria | 4437 |
| 106 | Ga0070700_100016882 | 3300005441 | Bacteria | 4165 |
| 107 | Ga0070694_100009576 | 3300005444 | Bacteria | 5943 |
| 108 | Ga0070694_100019701 | 3300005444 | Bacteria | 4293 |
| 109 | Ga0070663_100030724 | 3300005455 | Bacteria | 3685 |
| 110 | Ga0070663_100090611 | 3300005455 | Bacteria | 2265 |
| 111 | Ga0070678_100001756 | 3300005456 | Bacteria | 11671 |
| 112 | Ga0070678_100015618 | 3300005456 | Bacteria | 4832 |
| 113 | Ga0070678_100133004 | 3300005456 | Bacteria | 1979 |
| 114 | Ga0070662_100003987 | 3300005457 | Bacteria | 9250 |
| 115 | Ga0070662_100009135 | 3300005457 | Bacteria | 6472 |
| 116 | Ga0070681_10001525 | 3300005458 | Bacteria | 20520 |
| 117 | Ga0070681_10001623 | 3300005458 | Bacteria | 20035 |
| 118 | Ga0070681_10030838 | 3300005458 | Bacteria | 5381 |
| 119 | Ga0070681_10149529 | 3300005458 | Bacteria | 2263 |
| 120 | Ga0068867_100001138 | 3300005459 | Bacteria | 18176 |
| 121 | Ga0068867_100012280 | 3300005459 | Bacteria | 6056 |
| 122 | Ga0068867_100035703 | 3300005459 | Bacteria | 3606 |
| 123 | Ga0070685_10000984 | 3300005466 | Bacteria | 15313 |
| 124 | Ga0070685_10007517 | 3300005466 | Bacteria | 5578 |
| 125 | Ga0070685_10017650 | 3300005466 | Bacteria | 3823 |
| 126 | Ga0070685_10029019 | 3300005466 | Bacteria | 3071 |
| 127 | Ga0070699_100001809 | 3300005518 | Bacteria | 19434 |
| 128 | Ga0070679_100012735 | 3300005530 | Bacteria | 8043 |
| 129 | Ga0070679_100054193 | 3300005530 | Bacteria | 3992 |
| 130 | Ga0070679_100091379 | 3300005530 | Bacteria | 3032 |
| 131 | Ga0070679_100139212 | 3300005530 | Bacteria | 2407 |
| 132 | Ga0070684_100029522 | 3300005535 | Bacteria | 4648 |
| 133 | Ga0070684_100035117 | 3300005535 | Bacteria | 4289 |
| 134 | Ga0070684_100067827 | 3300005535 | Bacteria | 3134 |
| 135 | Ga0070684_100076688 | 3300005535 | Bacteria | 2951 |
| 136 | Ga0070684_100086779 | 3300005535 | Bacteria | 2778 |
| 137 | Ga0070684_100090738 | 3300005535 | Bacteria | 2718 |
| 138 | Ga0068853_100002995 | 3300005539 | Bacteria | 12889 |
| 139 | Ga0068853_100073321 | 3300005539 | Bacteria | 2984 |
| 140 | Ga0070672_100003943 | 3300005543 | Bacteria | 9675 |
| 141 | Ga0070686_100009031 | 3300005544 | Bacteria | 5590 |
| 142 | Ga0070686_100016714 | 3300005544 | Bacteria | 4272 |
| 143 | Ga0070686_100021350 | 3300005544 | Bacteria | 3847 |
| 144 | Ga0070695_100000824 | 3300005545 | Bacteria | 16725 |
| 145 | Ga0070695_100002921 | 3300005545 | Bacteria | 9944 |
| 146 | Ga0070695_100017465 | 3300005545 | Bacteria | 4351 |
| 147 | Ga0070696_100000856 | 3300005546 | Bacteria | 19655 |
| 148 | Ga0070693_100001975 | 3300005547 | Bacteria | 9380 |
| 149 | Ga0070665_100244531 | 3300005548 | Bacteria | 1795 |
| 150 | Ga0070704_100002335 | 3300005549 | Bacteria | 10635 |
| 151 | Ga0070704_100002836 | 3300005549 | Bacteria | 9819 |
| 152 | Ga0070704_100006569 | 3300005549 | Bacteria | 6858 |
| 153 | Ga0070704_100039281 | 3300005549 | Bacteria | 3248 |
| 154 | Ga0068855_100015755 | 3300005563 | Bacteria | 9093 |
| 155 | Ga0070664_100024583 | 3300005564 | Bacteria | 4985 |
| 156 | Ga0070664_100037892 | 3300005564 | Bacteria | 4055 |
| 157 | Ga0070664_100079318 | 3300005564 | Bacteria | 2826 |
| 158 | Ga0068857_100008305 | 3300005577 | Bacteria | 8971 |
| 159 | Ga0068857_100043792 | 3300005577 | Bacteria | 3970 |
| 160 | Ga0068854_100003868 | 3300005578 | Bacteria | 9383 |
| 161 | Ga0068854_100015449 | 3300005578 | Bacteria | 5057 |
| 162 | Ga0068854_100063690 | 3300005578 | Bacteria | 2677 |
| 163 | Ga0068854_100072375 | 3300005578 | Bacteria | 2524 |
| 164 | Ga0068856_100003821 | 3300005614 | Bacteria | 15095 |
| 165 | Ga0068856_100058666 | 3300005614 | Bacteria | 3801 |
| 166 | Ga0070702_100000497 | 3300005615 | Bacteria | 14109 |
| 167 | Ga0070702_100006109 | 3300005615 | Bacteria | 5676 |
| 168 | Ga0070702_100084461 | 3300005615 | Bacteria | 1909 |
| 169 | Ga0068852_100001222 | 3300005616 | Bacteria | 17091 |
| 170 | Ga0068852_100063725 | 3300005616 | Bacteria | 3210 |
| 171 | Ga0068859_100021148 | 3300005617 | Bacteria | 6529 |
| 172 | Ga0068859_100023550 | 3300005617 | Bacteria | 6179 |
| 173 | Ga0068859_100025814 | 3300005617 | Bacteria | 5895 |
| 174 | Ga0068859_100034357 | 3300005617 | Bacteria | 5089 |
| 175 | Ga0068859_100038671 | 3300005617 | Bacteria | 4786 |
| 176 | Ga0068864_100001074 | 3300005618 | Bacteria | 22938 |
| 177 | Ga0068864_100006339 | 3300005618 | Bacteria | 9703 |
| 178 | Ga0068864_100012258 | 3300005618 | Bacteria | 7084 |
| 179 | Ga0068864_100042649 | 3300005618 | Bacteria | 3883 |
| 180 | Ga0068864_100048003 | 3300005618 | Bacteria | 3670 |
| 181 | Ga0068864_100157672 | 3300005618 | Bacteria | 2061 |
| 182 | Ga0068866_10005659 | 3300005718 | Bacteria | 5176 |
| 183 | Ga0068866_10006999 | 3300005718 | Bacteria | 4713 |
| 184 | Ga0068866_10068047 | 3300005718 | Bacteria | 1871 |
| 185 | Ga0068861_100001328 | 3300005719 | Bacteria | 15509 |
| 186 | Ga0068861_100016726 | 3300005719 | Bacteria | 5195 |
| 187 | Ga0068861_100017632 | 3300005719 | Bacteria | 5074 |
| 188 | Ga0068870_10000051 | 3300005840 | Bacteria | 36782 |
| 189 | Ga0068870_10015842 | 3300005840 | Bacteria | 3587 |
| 190 | Ga0068863_100008364 | 3300005841 | Bacteria | 10106 |
| 191 | Ga0068863_100013387 | 3300005841 | Bacteria | 7909 |
| 192 | Ga0068863_100026590 | 3300005841 | Bacteria | 5518 |
| 193 | Ga0068863_100075045 | 3300005841 | Bacteria | 3199 |
| 194 | Ga0068858_100005147 | 3300005842 | Bacteria | 12813 |
| 195 | Ga0068858_100006251 | 3300005842 | Bacteria | 11604 |
| 196 | Ga0068858_100034414 | 3300005842 | Bacteria | 4699 |
| 197 | Ga0068858_100092885 | 3300005842 | Bacteria | 2809 |
| 198 | Ga0068860_100001825 | 3300005843 | Bacteria | 22684 |
| 199 | Ga0068860_100008760 | 3300005843 | Bacteria | 10078 |
| 200 | Ga0068860_100010661 | 3300005843 | Bacteria | 9077 |
| 201 | Ga0068860_100023546 | 3300005843 | Bacteria | 5951 |
| 202 | Ga0068860_100104445 | 3300005843 | Bacteria | 2705 |
| 203 | Ga0068860_100144787 | 3300005843 | Bacteria | 2286 |
| 204 | Ga0068862_100001949 | 3300005844 | Bacteria | 18707 |
| 205 | Ga0068862_100016670 | 3300005844 | Bacteria | 6117 |
| 206 | Ga0068862_100039768 | 3300005844 | Bacteria | 3996 |
| 207 | Ga0081455_10000081 | 3300005937 | Bacteria | 103752 |
| 208 | Ga0081455_10002198 | 3300005937 | Bacteria | 23233 |
| 209 | Ga0081538_10059304 | 3300005981 | Bacteria | 2211 |
| 210 | Ga0081538_10081004 | 3300005981 | Bacteria | 1729 |
| 211 | Ga0081540_1000007 | 3300005983 | Bacteria | 205328 |
| 212 | Ga0081540_1004024 | 3300005983 | Bacteria | 11383 |
| 213 | Ga0075365_10126900 | 3300006038 | Bacteria | 1763 |
| 214 | Ga0075368_10005879 | 3300006042 | Bacteria | 4248 |
| 215 | Ga0075368_10014120 | 3300006042 | Bacteria | 2945 |
| 216 | Ga0070715_10000551 | 3300006163 | Bacteria | 9852 |
| 217 | Ga0070716_100001287 | 3300006173 | Bacteria | 11081 |
| 218 | Ga0070712_100004737 | 3300006175 | Bacteria | 8411 |
| 219 | Ga0075367_10018956 | 3300006178 | Bacteria | 3806 |
| 220 | Ga0075427_10000603 | 3300006194 | Bacteria | 4197 |
| 221 | Ga0075366_10012326 | 3300006195 | Bacteria | 4847 |
| 222 | Ga0097621_100001496 | 3300006237 | Bacteria | 16030 |
| 223 | Ga0075370_10042438 | 3300006353 | Bacteria | 2570 |
| 224 | Ga0068871_100003134 | 3300006358 | Bacteria | 11345 |
| 225 | Ga0068871_100023904 | 3300006358 | Bacteria | 4735 |
| 226 | Ga0068871_100065268 | 3300006358 | Bacteria | 2981 |
| 227 | Ga0068871_100081876 | 3300006358 | Bacteria | 2675 |
| 228 | Ga0068871_100251808 | 3300006358 | Bacteria | 1539 |
| 229 | Ga0075428_100000740 | 3300006844 | Bacteria | 33927 |
| 230 | Ga0075428_100024539 | 3300006844 | Bacteria | 6672 |
| 231 | Ga0075430_100006097 | 3300006846 | Bacteria | 10161 |
| 232 | Ga0075430_100013350 | 3300006846 | Bacteria | 7000 |
| 233 | Ga0075430_100016809 | 3300006846 | Bacteria | 6231 |
| 234 | Ga0075431_100000870 | 3300006847 | Bacteria | 26533 |
| 235 | Ga0075431_100001076 | 3300006847 | Bacteria | 24422 |
| 236 | Ga0075431_100007719 | 3300006847 | Bacteria | 10714 |
| 237 | Ga0075431_100042948 | 3300006847 | Bacteria | 4664 |
| 238 | Ga0075431_100149874 | 3300006847 | Bacteria | 2402 |
| 239 | Ga0075431_100195337 | 3300006847 | Bacteria | 2072 |
| 240 | Ga0075433_10000012 | 3300006852 | Bacteria | 71065 |
| 241 | Ga0075433_10025668 | 3300006852 | Bacteria | 4983 |
| 242 | Ga0075434_100003201 | 3300006871 | Bacteria | 14596 |
| 243 | Ga0075434_100007032 | 3300006871 | Bacteria | 10380 |
| 244 | Ga0075434_100008056 | 3300006871 | Bacteria | 9773 |
| 245 | Ga0075434_100012519 | 3300006871 | Bacteria | 8046 |
| 246 | Ga0075434_100054628 | 3300006871 | Bacteria | 3967 |
| 247 | Ga0075429_100000098 | 3300006880 | Bacteria | 47888 |
| 248 | Ga0075429_100004032 | 3300006880 | Bacteria | 12577 |
| 249 | Ga0068865_100003854 | 3300006881 | Bacteria | 8992 |
| 250 | Ga0068865_100016325 | 3300006881 | Bacteria | 4750 |
| 251 | Ga0097620_100021146 | 3300006931 | Bacteria | 6529 |
| 252 | Ga0097620_100023550 | 3300006931 | Bacteria | 6179 |
| 253 | Ga0097620_100025814 | 3300006931 | Bacteria | 5895 |
| 254 | Ga0097620_100034355 | 3300006931 | Bacteria | 5089 |
| 255 | Ga0097620_100038673 | 3300006931 | Bacteria | 4786 |
| 256 | Ga0075435_100028671 | 3300007076 | Bacteria | 4367 |
| 257 | Ga0075435_100069072 | 3300007076 | Bacteria | 2880 |
| 258 | Ga0105250_10040014 | 3300009092 | Bacteria | 1880 |
| 259 | Ga0111539_10000757 | 3300009094 | Bacteria | 42016 |
| 260 | Ga0111539_10001671 | 3300009094 | Bacteria | 29561 |
| 261 | Ga0111539_10005127 | 3300009094 | Bacteria | 16990 |
| 262 | Ga0111539_10008480 | 3300009094 | Bacteria | 13063 |
| 263 | Ga0111539_10051044 | 3300009094 | Bacteria | 4927 |
| 264 | Ga0111539_10100128 | 3300009094 | Bacteria | 3403 |
| 265 | Ga0111539_10150020 | 3300009094 | Bacteria | 2729 |
| 266 | Ga0105245_10002488 | 3300009098 | Bacteria | 16638 |
| 267 | Ga0105245_10050094 | 3300009098 | Bacteria | 3741 |
| 268 | Ga0105245_10182552 | 3300009098 | Bacteria | 2005 |
| 269 | Ga0105247_10006103 | 3300009101 | Bacteria | 7490 |
| 270 | Ga0105247_10008404 | 3300009101 | Bacteria | 6293 |
| 271 | Ga0105247_10016894 | 3300009101 | Bacteria | 4375 |
| 272 | Ga0105247_10036684 | 3300009101 | Bacteria | 2988 |
| 273 | Ga0114129_10000025 | 3300009147 | Bacteria | 116480 |
| 274 | Ga0114129_10008949 | 3300009147 | Bacteria | 14268 |
| 275 | Ga0114129_10016369 | 3300009147 | Bacteria | 10556 |
| 276 | Ga0114129_10019966 | 3300009147 | Bacteria | 9538 |
| 277 | Ga0114129_10023567 | 3300009147 | Bacteria | 8725 |
| 278 | Ga0114129_10050640 | 3300009147 | Bacteria | 5833 |
| 279 | Ga0114129_10233598 | 3300009147 | Bacteria | 2476 |
| 280 | Ga0105243_10003214 | 3300009148 | Bacteria | 13370 |
| 281 | Ga0105243_10009303 | 3300009148 | Bacteria | 7494 |
| 282 | Ga0105243_10031611 | 3300009148 | Bacteria | 4081 |
| 283 | Ga0105241_10004876 | 3300009174 | Bacteria | 9894 |
| 284 | Ga0105241_10005826 | 3300009174 | Bacteria | 9097 |
| 285 | Ga0105241_10065776 | 3300009174 | Bacteria | 2802 |
| 286 | Ga0105242_10002016 | 3300009176 | Bacteria | 15990 |
| 287 | Ga0105242_10003519 | 3300009176 | Bacteria | 12173 |
| 288 | Ga0105242_10041795 | 3300009176 | Bacteria | 3699 |
| 289 | Ga0105242_10069916 | 3300009176 | Bacteria | 2909 |
| 290 | Ga0105242_10108685 | 3300009176 | Bacteria | 2361 |
| 291 | Ga0105248_10003871 | 3300009177 | Bacteria | 16548 |
| 292 | Ga0105248_10099691 | 3300009177 | Bacteria | 3273 |
| 293 | Ga0105248_10315006 | 3300009177 | Bacteria | 1762 |
| 294 | Ga0105237_10006016 | 3300009545 | Bacteria | 13574 |
| 295 | Ga0105237_10043192 | 3300009545 | Bacteria | 4542 |
| 296 | Ga0105237_10078801 | 3300009545 | Bacteria | 3284 |
| 297 | Ga0105237_10095030 | 3300009545 | Bacteria | 2970 |
| 298 | Ga0105238_10054187 | 3300009551 | Bacteria | 4029 |
| 299 | Ga0105238_10054673 | 3300009551 | Bacteria | 4008 |
| 300 | Ga0105249_10001193 | 3300009553 | Bacteria | 22912 |
| 301 | Ga0105249_10001979 | 3300009553 | Bacteria | 17784 |
| 302 | Ga0105249_10108889 | 3300009553 | Bacteria | 2616 |
| 303 | Ga0105239_10027649 | 3300010375 | Bacteria | 6241 |
| 304 | Ga0105239_10035856 | 3300010375 | Bacteria | 5446 |
| 305 | Ga0105239_10038572 | 3300010375 | Bacteria | 5236 |
| 306 | Ga0105239_10041876 | 3300010375 | Bacteria | 5019 |
| 307 | Ga0105246_10000231 | 3300011119 | Bacteria | 28580 |
| 308 | Ga0105246_10015760 | 3300011119 | Bacteria | 4778 |
| 309 | Ga0105246_10117462 | 3300011119 | Bacteria | 1965 |
| 310 | Ga0157373_10010248 | 3300013100 | Bacteria | 6904 |
| 311 | Ga0157373_10102676 | 3300013100 | Bacteria | 2012 |
| 312 | Ga0157373_10111698 | 3300013100 | Bacteria | 1921 |
| 313 | Ga0157371_10025479 | 3300013102 | Bacteria | 4310 |
| 314 | Ga0157370_10150497 | 3300013104 | Bacteria | 2166 |
| 315 | Ga0157374_10003239 | 3300013296 | Bacteria | 13672 |
| 316 | Ga0157374_10013309 | 3300013296 | Bacteria | 7178 |
| 317 | Ga0157374_10017421 | 3300013296 | Bacteria | 6324 |
| 318 | Ga0157374_10031696 | 3300013296 | Bacteria | 4807 |
| 319 | Ga0157378_10004453 | 3300013297 | Bacteria | 12317 |
| 320 | Ga0157378_10010612 | 3300013297 | Bacteria | 8051 |
| 321 | Ga0157378_10020673 | 3300013297 | Bacteria | 5790 |
| 322 | Ga0157378_10021915 | 3300013297 | Bacteria | 5619 |
| 323 | Ga0163162_10006149 | 3300013306 | Bacteria | 11621 |
| 324 | Ga0163162_10020738 | 3300013306 | Bacteria | 6461 |
| 325 | Ga0163162_10026579 | 3300013306 | Bacteria | 5722 |
| 326 | Ga0157372_10025465 | 3300013307 | Bacteria | 6433 |
| 327 | Ga0157372_10121031 | 3300013307 | Bacteria | 3006 |
| 328 | Ga0157375_10006518 | 3300013308 | Bacteria | 10160 |
| 329 | Ga0157375_10033972 | 3300013308 | Bacteria | 4853 |
| 330 | Ga0157375_10053687 | 3300013308 | Bacteria | 3967 |
| 331 | Ga0157375_10100999 | 3300013308 | Bacteria | 2966 |
| 332 | Ga0157375_10119222 | 3300013308 | Bacteria | 2746 |
| 333 | Ga0157375_10237394 | 3300013308 | Bacteria | 1982 |
| 334 | Ga0163163_10001320 | 3300014325 | Bacteria | 20935 |
| 335 | Ga0163163_10015790 | 3300014325 | Bacteria | 6993 |
| 336 | Ga0163163_10051326 | 3300014325 | Bacteria | 4067 |
| 337 | Ga0163163_10093775 | 3300014325 | Bacteria | 3019 |
| 338 | Ga0163163_10168581 | 3300014325 | Bacteria | 2236 |
| 339 | Ga0157380_10002744 | 3300014326 | Bacteria | 11948 |
| 340 | Ga0157380_10065721 | 3300014326 | Bacteria | 2916 |
| 341 | Ga0157380_10195500 | 3300014326 | Bacteria | 1790 |
| 342 | Ga0157377_10000164 | 3300014745 | Bacteria | 39592 |
| 343 | Ga0157379_10020078 | 3300014968 | Bacteria | 5905 |
| 344 | Ga0157379_10030909 | 3300014968 | Bacteria | 4770 |
| 345 | Ga0157379_10061490 | 3300014968 | Bacteria | 3358 |
| 346 | Ga0157379_10064966 | 3300014968 | Bacteria | 3261 |
| 347 | Ga0157376_10002102 | 3300014969 | Bacteria | 13394 |
| 348 | Ga0157376_10036456 | 3300014969 | Bacteria | 3984 |
| 349 | Ga0157376_10036479 | 3300014969 | Bacteria | 3983 |
| 350 | Ga0157376_10088277 | 3300014969 | Bacteria | 2678 |
| 351 | Ga0157376_10204657 | 3300014969 | Bacteria | 1819 |
| 352 | Ga0163161_10002837 | 3300017792 | Bacteria | 12295 |
| 353 | Ga0163161_10114468 | 3300017792 | Bacteria | 2020 |
| 354 | Ga0163161_10131060 | 3300017792 | Bacteria | 1891 |
| 355 | Ga0213876_10025328 | 3300021384 | Bacteria | 3130 |
| 356 | Ga0207666_1000051 | 3300025271 | Bacteria | 21813 |
| 357 | Ga0209758_1000125 | 3300025297 | Bacteria | 189869 |
| 358 | Ga0207697_10000662 | 3300025315 | Bacteria | 19563 |
| 359 | Ga0207653_10000546 | 3300025885 | Bacteria | 13918 |
| 360 | Ga0207653_10001467 | 3300025885 | Bacteria | 7655 |
| 361 | Ga0207682_10000072 | 3300025893 | Bacteria | 44659 |
| 362 | Ga0207692_10002147 | 3300025898 | Bacteria | 7536 |
| 363 | Ga0207642_10001909 | 3300025899 | Bacteria | 6431 |
| 364 | Ga0207642_10039428 | 3300025899 | Bacteria | 2052 |
| 365 | Ga0207710_10000558 | 3300025900 | Bacteria | 22251 |
| 366 | Ga0207710_10004313 | 3300025900 | Bacteria | 6228 |
| 367 | Ga0207710_10035227 | 3300025900 | Bacteria | 2202 |
| 368 | Ga0207688_10000229 | 3300025901 | Bacteria | 25389 |
| 369 | Ga0207688_10000998 | 3300025901 | Bacteria | 14427 |
| 370 | Ga0207688_10004677 | 3300025901 | Bacteria | 7461 |
| 371 | Ga0207680_10001283 | 3300025903 | Bacteria | 11893 |
| 372 | Ga0207680_10092650 | 3300025903 | Bacteria | 1925 |
| 373 | Ga0207647_10003353 | 3300025904 | Bacteria | 12014 |
| 374 | Ga0207647_10010679 | 3300025904 | Bacteria | 6473 |
| 375 | Ga0207647_10011089 | 3300025904 | Bacteria | 6334 |
| 376 | Ga0207685_10001607 | 3300025905 | Bacteria | 4832 |
| 377 | Ga0207685_10003975 | 3300025905 | Bacteria | 3682 |
| 378 | Ga0207699_10002080 | 3300025906 | Bacteria | 9455 |
| 379 | Ga0207699_10015546 | 3300025906 | Bacteria | 3956 |
| 380 | Ga0207645_10000966 | 3300025907 | Bacteria | 23780 |
| 381 | Ga0207645_10007388 | 3300025907 | Bacteria | 7770 |
| 382 | Ga0207645_10023155 | 3300025907 | Bacteria | 4037 |
| 383 | Ga0207645_10059737 | 3300025907 | Bacteria | 2435 |
| 384 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 385 | Ga0207643_10000794 | 3300025908 | Bacteria | 19261 |
| 386 | Ga0207643_10004896 | 3300025908 | Bacteria | 7167 |
| 387 | Ga0207643_10031046 | 3300025908 | Bacteria | 2977 |
| 388 | Ga0207643_10065728 | 3300025908 | Bacteria | 2078 |
| 389 | Ga0207654_10001472 | 3300025911 | Bacteria | 12448 |
| 390 | Ga0207654_10007425 | 3300025911 | Bacteria | 5521 |
| 391 | Ga0207707_10007028 | 3300025912 | Bacteria | 9814 |
| 392 | Ga0207707_10065564 | 3300025912 | Bacteria | 3163 |
| 393 | Ga0207671_10013159 | 3300025914 | Bacteria | 6607 |
| 394 | Ga0207671_10020766 | 3300025914 | Bacteria | 4995 |
| 395 | Ga0207671_10048003 | 3300025914 | Bacteria | 3159 |
| 396 | Ga0207693_10006880 | 3300025915 | Bacteria | 9393 |
| 397 | Ga0207693_10027450 | 3300025915 | Bacteria | 4501 |
| 398 | Ga0207693_10161096 | 3300025915 | Bacteria | 1765 |
| 399 | Ga0207663_10010875 | 3300025916 | Bacteria | 4861 |
| 400 | Ga0207663_10017354 | 3300025916 | Bacteria | 4009 |
| 401 | Ga0207660_10000648 | 3300025917 | Bacteria | 23454 |
| 402 | Ga0207660_10092613 | 3300025917 | Bacteria | 2243 |
| 403 | Ga0207662_10000317 | 3300025918 | Bacteria | 21877 |
| 404 | Ga0207662_10000424 | 3300025918 | Bacteria | 18665 |
| 405 | Ga0207662_10013378 | 3300025918 | Bacteria | 4589 |
| 406 | Ga0207662_10023881 | 3300025918 | Bacteria | 3515 |
| 407 | Ga0207662_10032770 | 3300025918 | Bacteria | 3026 |
| 408 | Ga0207662_10064039 | 3300025918 | Bacteria | 2211 |
| 409 | Ga0207662_10091114 | 3300025918 | Bacteria | 1875 |
| 410 | Ga0207657_10002047 | 3300025919 | Bacteria | 21819 |
| 411 | Ga0207657_10028849 | 3300025919 | Bacteria | 5056 |
| 412 | Ga0207649_10000262 | 3300025920 | Bacteria | 41689 |
| 413 | Ga0207649_10090257 | 3300025920 | Bacteria | 2005 |
| 414 | Ga0207652_10000911 | 3300025921 | Bacteria | 27891 |
| 415 | Ga0207652_10067950 | 3300025921 | Bacteria | 3091 |
| 416 | Ga0207681_10010634 | 3300025923 | Bacteria | 5643 |
| 417 | Ga0207694_10024208 | 3300025924 | Bacteria | 4609 |
| 418 | Ga0207650_10013694 | 3300025925 | Bacteria | 5623 |
| 419 | Ga0207650_10019548 | 3300025925 | Bacteria | 4762 |
| 420 | Ga0207659_10001684 | 3300025926 | Bacteria | 13118 |
| 421 | Ga0207659_10012218 | 3300025926 | Bacteria | 5451 |
| 422 | Ga0207659_10024969 | 3300025926 | Bacteria | 4011 |
| 423 | Ga0207687_10001501 | 3300025927 | Bacteria | 15981 |
| 424 | Ga0207687_10006389 | 3300025927 | Bacteria | 7789 |
| 425 | Ga0207687_10017936 | 3300025927 | Bacteria | 4670 |
| 426 | Ga0207700_10001264 | 3300025928 | Bacteria | 14408 |
| 427 | Ga0207700_10218925 | 3300025928 | Bacteria | 1613 |
| 428 | Ga0207664_10002547 | 3300025929 | Bacteria | 12049 |
| 429 | Ga0207664_10183287 | 3300025929 | Bacteria | 1798 |
| 430 | Ga0207644_10000467 | 3300025931 | Bacteria | 26087 |
| 431 | Ga0207644_10001961 | 3300025931 | Bacteria | 13297 |
| 432 | Ga0207644_10015484 | 3300025931 | Bacteria | 5120 |
| 433 | Ga0207644_10025194 | 3300025931 | Bacteria | 4089 |
| 434 | Ga0207644_10092872 | 3300025931 | Bacteria | 2252 |
| 435 | Ga0207690_10001228 | 3300025932 | Bacteria | 16182 |
| 436 | Ga0207690_10009138 | 3300025932 | Bacteria | 5883 |
| 437 | Ga0207690_10137132 | 3300025932 | Bacteria | 1798 |
| 438 | Ga0207706_10001679 | 3300025933 | Bacteria | 21866 |
| 439 | Ga0207706_10007881 | 3300025933 | Bacteria | 9829 |
| 440 | Ga0207706_10018822 | 3300025933 | Bacteria | 6211 |
| 441 | Ga0207706_10054074 | 3300025933 | Bacteria | 3543 |
| 442 | Ga0207706_10203437 | 3300025933 | Bacteria | 1736 |
| 443 | Ga0207686_10002040 | 3300025934 | Bacteria | 11131 |
| 444 | Ga0207686_10009318 | 3300025934 | Bacteria | 5323 |
| 445 | Ga0207686_10017951 | 3300025934 | Bacteria | 3998 |
| 446 | Ga0207686_10099188 | 3300025934 | Bacteria | 1941 |
| 447 | Ga0207709_10035318 | 3300025935 | Bacteria | 2954 |
| 448 | Ga0207709_10102649 | 3300025935 | Bacteria | 1894 |
| 449 | Ga0207670_10000377 | 3300025936 | Bacteria | 25697 |
| 450 | Ga0207670_10002370 | 3300025936 | Bacteria | 9867 |
| 451 | Ga0207670_10003054 | 3300025936 | Bacteria | 8831 |
| 452 | Ga0207670_10037467 | 3300025936 | Bacteria | 3160 |
| 453 | Ga0207670_10170453 | 3300025936 | Bacteria | 1632 |
| 454 | Ga0207669_10001912 | 3300025937 | Bacteria | 8835 |
| 455 | Ga0207669_10015439 | 3300025937 | Bacteria | 3851 |
| 456 | Ga0207669_10017896 | 3300025937 | Bacteria | 3648 |
| 457 | Ga0207669_10031185 | 3300025937 | Bacteria | 2975 |
| 458 | Ga0207704_10002613 | 3300025938 | Bacteria | 8128 |
| 459 | Ga0207704_10174333 | 3300025938 | Bacteria | 1546 |
| 460 | Ga0207665_10001035 | 3300025939 | Bacteria | 18728 |
| 461 | Ga0207665_10043619 | 3300025939 | Bacteria | 2999 |
| 462 | Ga0207665_10056180 | 3300025939 | Bacteria | 2657 |
| 463 | Ga0207665_10067562 | 3300025939 | Bacteria | 2434 |
| 464 | Ga0207691_10002691 | 3300025940 | Bacteria | 17379 |
| 465 | Ga0207691_10002874 | 3300025940 | Bacteria | 16780 |
| 466 | Ga0207711_10003410 | 3300025941 | Bacteria | 13758 |
| 467 | Ga0207711_10006776 | 3300025941 | Bacteria | 9628 |
| 468 | Ga0207711_10022868 | 3300025941 | Bacteria | 5232 |
| 469 | Ga0207711_10030274 | 3300025941 | Bacteria | 4565 |
| 470 | Ga0207689_10000203 | 3300025942 | Bacteria | 52425 |
| 471 | Ga0207689_10022711 | 3300025942 | Bacteria | 5270 |
| 472 | Ga0207689_10044138 | 3300025942 | Bacteria | 3685 |
| 473 | Ga0207689_10045948 | 3300025942 | Bacteria | 3610 |
| 474 | Ga0207661_10002165 | 3300025944 | Bacteria | 13530 |
| 475 | Ga0207661_10014563 | 3300025944 | Bacteria | 5769 |
| 476 | Ga0207679_10000157 | 3300025945 | Bacteria | 56166 |
| 477 | Ga0207679_10015012 | 3300025945 | Bacteria | 5106 |
| 478 | Ga0207679_10158473 | 3300025945 | Bacteria | 1851 |
| 479 | Ga0207667_10220437 | 3300025949 | Bacteria | 1943 |
| 480 | Ga0207651_10008897 | 3300025960 | Bacteria | 5454 |
| 481 | Ga0207712_10002224 | 3300025961 | Bacteria | 12622 |
| 482 | Ga0207712_10003965 | 3300025961 | Bacteria | 9349 |
| 483 | Ga0207712_10039070 | 3300025961 | Bacteria | 3250 |
| 484 | Ga0207668_10017144 | 3300025972 | Bacteria | 4532 |
| 485 | Ga0207668_10055993 | 3300025972 | Bacteria | 2744 |
| 486 | Ga0207668_10109409 | 3300025972 | Bacteria | 2070 |
| 487 | Ga0207640_10043680 | 3300025981 | Bacteria | 2866 |
| 488 | Ga0207658_10005748 | 3300025986 | Bacteria | 8483 |
| 489 | Ga0207658_10008052 | 3300025986 | Bacteria | 7181 |
| 490 | Ga0207658_10048495 | 3300025986 | Bacteria | 3114 |
| 491 | Ga0207658_10167123 | 3300025986 | Bacteria | 1808 |
| 492 | Ga0207677_10001675 | 3300026023 | Bacteria | 11738 |
| 493 | Ga0207677_10006260 | 3300026023 | Bacteria | 6510 |
| 494 | Ga0207703_10001346 | 3300026035 | Bacteria | 22503 |
| 495 | Ga0207703_10001852 | 3300026035 | Bacteria | 18819 |
| 496 | Ga0207703_10032158 | 3300026035 | Bacteria | 4151 |
| 497 | Ga0207639_10008211 | 3300026041 | Bacteria | 7147 |
| 498 | Ga0207678_10001809 | 3300026067 | Bacteria | 19589 |
| 499 | Ga0207678_10001884 | 3300026067 | Bacteria | 19130 |
| 500 | Ga0207678_10011488 | 3300026067 | Bacteria | 7777 |
| 501 | Ga0207678_10013053 | 3300026067 | Bacteria | 7289 |
| 502 | Ga0207678_10034212 | 3300026067 | Bacteria | 4426 |
| 503 | Ga0207678_10034731 | 3300026067 | Bacteria | 4391 |
| 504 | Ga0207678_10041672 | 3300026067 | Bacteria | 3981 |
| 505 | Ga0207708_10000784 | 3300026075 | Bacteria | 23952 |
| 506 | Ga0207708_10001199 | 3300026075 | Bacteria | 19559 |
| 507 | Ga0207708_10003067 | 3300026075 | Bacteria | 12308 |
| 508 | Ga0207708_10004901 | 3300026075 | Bacteria | 9865 |
| 509 | Ga0207708_10014093 | 3300026075 | Bacteria | 5974 |
| 510 | Ga0207702_10003404 | 3300026078 | Bacteria | 14557 |
| 511 | Ga0207702_10068697 | 3300026078 | Bacteria | 3045 |
| 512 | Ga0207641_10006871 | 3300026088 | Bacteria | 9524 |
| 513 | Ga0207641_10011257 | 3300026088 | Bacteria | 7337 |
| 514 | Ga0207641_10041334 | 3300026088 | Bacteria | 3863 |
| 515 | Ga0207648_10002073 | 3300026089 | Bacteria | 21861 |
| 516 | Ga0207648_10002310 | 3300026089 | Bacteria | 20581 |
| 517 | Ga0207648_10016984 | 3300026089 | Bacteria | 6632 |
| 518 | Ga0207648_10027663 | 3300026089 | Bacteria | 5032 |
| 519 | Ga0207676_10000990 | 3300026095 | Bacteria | 21882 |
| 520 | Ga0207676_10002295 | 3300026095 | Bacteria | 13719 |
| 521 | Ga0207676_10002940 | 3300026095 | Bacteria | 12143 |
| 522 | Ga0207676_10048845 | 3300026095 | Bacteria | 3287 |
| 523 | Ga0207676_10184700 | 3300026095 | Bacteria | 1829 |
| 524 | Ga0207674_10000897 | 3300026116 | Bacteria | 38907 |
| 525 | Ga0207674_10011740 | 3300026116 | Bacteria | 9828 |
| 526 | Ga0207675_100001726 | 3300026118 | Bacteria | 21899 |
| 527 | Ga0207675_100002371 | 3300026118 | Bacteria | 18651 |
| 528 | Ga0207675_100005453 | 3300026118 | Bacteria | 12188 |
| 529 | Ga0207683_10000824 | 3300026121 | Bacteria | 28453 |
| 530 | Ga0207683_10001176 | 3300026121 | Bacteria | 23694 |
| 531 | Ga0207683_10014019 | 3300026121 | Bacteria | 6834 |
| 532 | Ga0207683_10018096 | 3300026121 | Bacteria | 6008 |
| 533 | Ga0207683_10081706 | 3300026121 | Bacteria | 2869 |
| 534 | Ga0207683_10185428 | 3300026121 | Bacteria | 1888 |
| 535 | Ga0207698_10003743 | 3300026142 | Bacteria | 9193 |
| 536 | Ga0207698_10024746 | 3300026142 | Bacteria | 4219 |
| 537 | Ga0210002_1003362 | 3300027617 | Bacteria | 2352 |
| 538 | Ga0209966_1000247 | 3300027695 | Bacteria | 19895 |
| 539 | Ga0209998_10000255 | 3300027717 | Bacteria | 17497 |
| 540 | Ga0209998_10001128 | 3300027717 | Bacteria | 6625 |
| 541 | Ga0209974_10001489 | 3300027876 | Bacteria | 8511 |
| 542 | Ga0207428_10000137 | 3300027907 | Bacteria | 98535 |
| 543 | Ga0207428_10000792 | 3300027907 | Bacteria | 35769 |
| 544 | Ga0207428_10003106 | 3300027907 | Bacteria | 16320 |
| 545 | Ga0207428_10004572 | 3300027907 | Bacteria | 13115 |
| 546 | Ga0207428_10033074 | 3300027907 | Bacteria | 4249 |
| 547 | Ga0207428_10072105 | 3300027907 | Bacteria | 2712 |
| 548 | Ga0268266_10005095 | 3300028379 | Bacteria | 12383 |
| 549 | Ga0268266_10023244 | 3300028379 | Bacteria | 5278 |
| 550 | Ga0268266_10046625 | 3300028379 | Bacteria | 3710 |
| 551 | Ga0268265_10012344 | 3300028380 | Bacteria | 5788 |
| 552 | Ga0268265_10029470 | 3300028380 | Bacteria | 3939 |
| 553 | Ga0268265_10085418 | 3300028380 | Bacteria | 2504 |
| 554 | Ga0268264_10002039 | 3300028381 | Bacteria | 18053 |
| 555 | Ga0268264_10016623 | 3300028381 | Bacteria | 6024 |
| 556 | Ga0268264_10062447 | 3300028381 | Bacteria | 3128 |
| 557 | Ga0268264_10081157 | 3300028381 | Bacteria | 2771 |
| 558 | Ga0265330_10047685 | 3300031235 | Bacteria | 1885 |
| 559 | Ga0265325_10000073 | 3300031241 | Bacteria | 70109 |
| 560 | Ga0265325_10000234 | 3300031241 | Bacteria | 39472 |
| 561 | Ga0265325_10002177 | 3300031241 | Bacteria | 13332 |
| 562 | Ga0265325_10004094 | 3300031241 | Bacteria | 9289 |
| 563 | Ga0265340_10021850 | 3300031247 | Bacteria | 3277 |
| 564 | Ga0265339_10001513 | 3300031249 | Bacteria | 17175 |
| 565 | Ga0265316_10024489 | 3300031344 | Bacteria | 5056 |
| 566 | Ga0265313_10000326 | 3300031595 | Bacteria | 51836 |
| 567 | Ga0265313_10008870 | 3300031595 | Bacteria | 6619 |
| 568 | Ga0265313_10040748 | 3300031595 | Bacteria | 2293 |
| 569 | Ga0373948_0000061 | 3300034817 | Bacteria | 11538 |
| 570 | Ga0373958_0000048 | 3300034819 | Bacteria | 11955 |
| 571 | Ga0373958_0001634 | 3300034819 | Bacteria | 3043 |
| 572 | Ga0373926_0003985 | 3300035083 | Bacteria | 4827 |
| 573 | Ga0373928_0000291 | 3300035084 | Bacteria | 9922 |
| 574 | Ga0373928_0008797 | 3300035084 | Bacteria | 1965 |
| 575 | Ga0373929_0000564 | 3300035085 | Bacteria | 7143 |
| 576 | Ga0373929_0005244 | 3300035085 | Bacteria | 2331 |
| 577 | Ga0373934_0020853 | 3300035086 | Bacteria | 2522 |
| 578 | Ga0373940_0000023 | 3300035088 | Bacteria | 16767 |
| 579 | Ga0373940_0010533 | 3300035088 | Bacteria | 2176 |
| 580 | Ga0373940_0012296 | 3300035088 | Bacteria | 2049 |
| 581 | Ga0373949_0001146 | 3300035090 | Bacteria | 7970 |
| 582 | Ga0373951_0000876 | 3300035091 | Bacteria | 8125 |
| 583 | Ga0373951_0005478 | 3300035091 | Bacteria | 2948 |
| 584 | Ga0373923_0000851 | 3300035111 | Bacteria | 8076 |
| 585 | Ga0373923_0003216 | 3300035111 | Bacteria | 5195 |
| 586 | Ga0373936_0001660 | 3300035113 | Bacteria | 8158 |
| 587 | Ga0373939_0000663 | 3300035114 | Bacteria | 8540 |
| 588 | Ga0373939_0002651 | 3300035114 | Bacteria | 4201 |
| 589 | Ga0373941_0000309 | 3300035115 | Bacteria | 9451 |
| 590 | Ga0373945_0000277 | 3300035116 | Bacteria | 14473 |
| 591 | Ga0373945_0001390 | 3300035116 | Bacteria | 7348 |
| 592 | Ga0373953_0068438 | 3300035117 | Bacteria | 1461 |
| 593 | Ga0373954_0005333 | 3300035118 | Bacteria | 5557 |
| 594 | Ga0373954_0014688 | 3300035118 | Bacteria | 3493 |
| 595 | Ga0373960_0001082 | 3300035121 | Bacteria | 5885 |
| 596 | Ga0373960_0003571 | 3300035121 | Bacteria | 3527 |
| 597 | Ga0373960_0003751 | 3300035121 | Bacteria | 3453 |
| 598 | Ga0373943_0004971 | 3300035170 | Bacteria | 6002 |
| 599 | Ga0373943_0005512 | 3300035170 | Bacteria | 5690 |
| 600 | Ga0373943_0009916 | 3300035170 | Bacteria | 4268 |
| 601 | Ga0373946_0001856 | 3300035171 | Bacteria | 7374 |
| 602 | Ga0373946_0002330 | 3300035171 | Bacteria | 6718 |
| 603 | Ga0373955_0002403 | 3300035172 | Bacteria | 8160 |
| 604 | Ga0373942_0000081 | 3300035207 | Bacteria | 20661 |
| 605 | Ga0373942_0003417 | 3300035207 | Bacteria | 3733 |
| 606 | Ga0373942_0009249 | 3300035207 | Bacteria | 2304 |
| 607 | Ga0373942_0016658 | 3300035207 | Bacteria | 1805 |
| 608 | Ga0373961_0000743 | 3300035241 | Bacteria | 11267 |
| 609 | Ga0373961_0002954 | 3300035241 | Bacteria | 4297 |
| 610 | Ga0373961_0032726 | 3300035241 | Bacteria | 1460 |
| 611 | Ga0373962_0000194 | 3300035242 | Bacteria | 12882 |
| 612 | Ga0373924_0000490 | 3300035410 | Bacteria | 12118 |
| 613 | Ga0373924_0004810 | 3300035410 | Bacteria | 4747 |
| 614 | Ga0373931_0001008 | 3300035691 | Bacteria | 11924 |
| 615 | Ga0373931_0001564 | 3300035691 | Bacteria | 9881 |
| 616 | Ga0373931_0002975 | 3300035691 | Bacteria | 7569 |
| 617 | Ga0373931_0007918 | 3300035691 | Bacteria | 5027 |
| 618 | Ga0373931_0016578 | 3300035691 | Bacteria | 3629 |
| 619 | Ga0373935_0000291 | 3300035692 | Bacteria | 24802 |
| 620 | Ga0373935_0013547 | 3300035692 | Bacteria | 4922 |
| 621 | Ga0373935_0057106 | 3300035692 | Bacteria | 2490 |
| 622 | Ga0373927_0005343 | 3300035695 | Bacteria | 8880 |
| 623 | Ga0373927_0009000 | 3300035695 | Bacteria | 6703 |
| 624 | Ga0373927_0034546 | 3300035695 | Bacteria | 3289 |
| 625 | Ga0373927_0051606 | 3300035695 | Bacteria | 2659 |
| 626 | Ga0373927_0054373 | 3300035695 | Bacteria | 2590 |
| 627 | Ga0373927_0055119 | 3300035695 | Bacteria | 2571 |
| 628 | Ga0373933_0010185 | 3300035724 | Bacteria | 5149 |
| 629 | Ga0373933_0012833 | 3300035724 | Bacteria | 4633 |
| 630 | Ga0373947_0000424 | 3300035725 | Bacteria | 23999 |
| 631 | Ga0373947_0005730 | 3300035725 | Bacteria | 7243 |
| 632 | Ga0373947_0010154 | 3300035725 | Bacteria | 5407 |
| 633 | Ga0373947_0041253 | 3300035725 | Bacteria | 2751 |
| 634 | Ga0373947_0048954 | 3300035725 | Bacteria | 2537 |
| 635 | Ga0373937_0000004 | 3300036401 | Bacteria | 212269 |
| 636 | Ga0373937_0003680 | 3300036401 | Bacteria | 12949 |
| 637 | Ga0373937_0005263 | 3300036401 | Bacteria | 11048 |
| 638 | Ga0373937_0006030 | 3300036401 | Bacteria | 10436 |
| 639 | Ga0373925_0000460 | 3300037068 | Bacteria | 41057 |
| 640 | Ga0373925_0003391 | 3300037068 | Bacteria | 12354 |
| 641 | Ga0373925_0017524 | 3300037068 | Bacteria | 5192 |
| 642 | Ga0373925_0127647 | 3300037068 | Bacteria | 1980 |
| 643 | Ga0436365_0349099 | 3300039437 | Bacteria | 3604 |
| 644 | Ga0436365_1169665 | 3300039437 | Bacteria | 1720 |
| 645 | Ga0439464_0005396 | 3300042439 | Bacteria | 3304 |
| 646 | Ga0451576_0006650 | 3300045051 | Bacteria | 14107 |
| 647 | Ga0495592_0000029 | 3300046454 | Bacteria | 131879 |
| 648 | Ga0495592_0001215 | 3300046454 | Bacteria | 17883 |
| 649 | Ga0495592_0005508 | 3300046454 | Bacteria | 9360 |
| 650 | Ga0495592_0136552 | 3300046454 | Bacteria | 1710 |
| 651 | Ga0495592_0149021 | 3300046454 | Bacteria | 1620 |
| 652 | Ga0495590_0028653 | 3300046457 | Bacteria | 1953 |
| 653 | Ga0495629_0000447 | 3300046459 | Bacteria | 34326 |
| 654 | Ga0495629_0016571 | 3300046459 | Bacteria | 5290 |
| 655 | Ga0495629_0016805 | 3300046459 | Bacteria | 5251 |
| 656 | Ga0495638_0028434 | 3300046460 | Bacteria | 3611 |
| 657 | Ga0495641_0001697 | 3300046461 | Bacteria | 18404 |
| 658 | Ga0495641_0015734 | 3300046461 | Bacteria | 4019 |
| 659 | Ga0495641_0027911 | 3300046461 | Bacteria | 2737 |
| 660 | Ga0495651_0002424 | 3300046462 | Bacteria | 14396 |
| 661 | Ga0495651_0038986 | 3300046462 | Bacteria | 3699 |
| 662 | Ga0495653_0000012 | 3300046463 | Bacteria | 266880 |
| 663 | Ga0495653_0003231 | 3300046463 | Bacteria | 13066 |
| 664 | Ga0495653_0006931 | 3300046463 | Bacteria | 9309 |
| 665 | Ga0495653_0078354 | 3300046463 | Bacteria | 2451 |
| 666 | Ga0495580_0006747 | 3300046472 | Bacteria | 9313 |
| 667 | Ga0495580_0085877 | 3300046472 | Bacteria | 2191 |
| 668 | Ga0495582_0007072 | 3300046473 | Bacteria | 6234 |
| 669 | Ga0495582_0010997 | 3300046473 | Bacteria | 4982 |
| 670 | Ga0495582_0013202 | 3300046473 | Bacteria | 4545 |
| 671 | Ga0495639_0006165 | 3300046475 | Bacteria | 5148 |
| 672 | Ga0495662_0003904 | 3300046476 | Bacteria | 7520 |
| 673 | Ga0495662_0010406 | 3300046476 | Bacteria | 4557 |
| 674 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 675 | Ga0495664_0009959 | 3300046477 | Bacteria | 5332 |
| 676 | Ga0495664_0105171 | 3300046477 | Bacteria | 1702 |
| 677 | Ga0495584_0002735 | 3300046491 | Bacteria | 9877 |
| 678 | Ga0495584_0056557 | 3300046491 | Bacteria | 1974 |
| 679 | Ga0495585_0003199 | 3300046492 | Bacteria | 11181 |
| 680 | Ga0495585_0073720 | 3300046492 | Bacteria | 1858 |
| 681 | Ga0495594_0013045 | 3300046499 | Bacteria | 4333 |
| 682 | Ga0495594_0021869 | 3300046499 | Bacteria | 3416 |
| 683 | Ga0495607_0029184 | 3300046501 | Bacteria | 3397 |
| 684 | Ga0495608_0000017 | 3300046511 | Bacteria | 192929 |
| 685 | Ga0495618_0000006 | 3300046514 | Bacteria | 229906 |
| 686 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 687 | Ga0495628_0009640 | 3300046516 | Bacteria | 8239 |
| 688 | Ga0495628_0019168 | 3300046516 | Bacteria | 5658 |
| 689 | Ga0495628_0035835 | 3300046516 | Bacteria | 3985 |
| 690 | Ga0495630_0008370 | 3300046517 | Bacteria | 7424 |
| 691 | Ga0495637_0042998 | 3300046520 | Bacteria | 1931 |
| 692 | Ga0495644_0002426 | 3300046523 | Bacteria | 7434 |
| 693 | Ga0495666_0001305 | 3300046526 | Bacteria | 12056 |
| 694 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 695 | Ga0495652_0018154 | 3300046529 | Bacteria | 6278 |
| 696 | Ga0495665_0004009 | 3300046531 | Bacteria | 7939 |
| 697 | Ga0495665_0025407 | 3300046531 | Bacteria | 3182 |
| 698 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 699 | Ga0495640_0017355 | 3300046533 | Bacteria | 5366 |
| 700 | Ga0495586_0007089 | 3300046535 | Bacteria | 5973 |
| 701 | Ga0495587_0000008 | 3300046536 | Bacteria | 271097 |
| 702 | Ga0495587_0001490 | 3300046536 | Bacteria | 15605 |
| 703 | Ga0495598_0001556 | 3300046537 | Bacteria | 4597 |
| 704 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 705 | Ga0495645_0000954 | 3300046543 | Bacteria | 19779 |
| 706 | Ga0495645_0050356 | 3300046543 | Bacteria | 3032 |
| 707 | Ga0495633_0014899 | 3300046558 | Bacteria | 4044 |
| 708 | Ga0495667_0000029 | 3300046559 | Bacteria | 151568 |
| 709 | Ga0495667_0014263 | 3300046559 | Bacteria | 5367 |
| 710 | Ga0495667_0043731 | 3300046559 | Bacteria | 2967 |
| 711 | Ga0495656_0000941 | 3300046615 | Bacteria | 9423 |
| 712 | Ga0495634_0006280 | 3300046642 | Bacteria | 9051 |
| 713 | Ga0495634_0035463 | 3300046642 | Bacteria | 3416 |
| 714 | Ga0495634_0058157 | 3300046642 | Bacteria | 2578 |
| 715 | Ga0495611_0005829 | 3300046648 | Bacteria | 5256 |
| 716 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 717 | Ga0495635_0013015 | 3300046663 | Bacteria | 5824 |
| 718 | Ga0495588_0000318 | 3300046674 | Bacteria | 32296 |
| 719 | Ga0495588_0012717 | 3300046674 | Bacteria | 3987 |
| 720 | Ga0495588_0029685 | 3300046674 | Bacteria | 2745 |
| 721 | Ga0495657_0000459 | 3300046675 | Bacteria | 38116 |
| 722 | Ga0495657_0086718 | 3300046675 | Bacteria | 2016 |
| 723 | Ga0495599_0000104 | 3300046678 | Bacteria | 59442 |
| 724 | Ga0495599_0001047 | 3300046678 | Bacteria | 15552 |
| 725 | Ga0495599_0034637 | 3300046678 | Bacteria | 3171 |
| 726 | Ga0495623_0000691 | 3300046679 | Bacteria | 22400 |
| 727 | Ga0495623_0003897 | 3300046679 | Bacteria | 9840 |
| 728 | Ga0495646_0000064 | 3300046680 | Bacteria | 50992 |
| 729 | Ga0495646_0005442 | 3300046680 | Bacteria | 8047 |
| 730 | Ga0495646_0006507 | 3300046680 | Bacteria | 7412 |
| 731 | Ga0495647_0001576 | 3300046681 | Bacteria | 7039 |
| 732 | Ga0495658_0007929 | 3300046683 | Bacteria | 5258 |
| 733 | Ga0495658_0008212 | 3300046683 | Bacteria | 5170 |
| 734 | Ga0495658_0008346 | 3300046683 | Bacteria | 5130 |
| 735 | Ga0495658_0035592 | 3300046683 | Bacteria | 2741 |
| 736 | Ga0495613_0000793 | 3300046689 | Bacteria | 24573 |
| 737 | Ga0495613_0047786 | 3300046689 | Bacteria | 3161 |
| 738 | Ga0495624_0023831 | 3300046690 | Bacteria | 4032 |
| 739 | Ga0495600_0000010 | 3300046809 | Bacteria | 143675 |
| 740 | Ga0495600_0032708 | 3300046809 | Bacteria | 3375 |
| 741 | Ga0495581_0002305 | 3300047315 | Bacteria | 10746 |
| 742 | Ga0495604_0000009 | 3300047317 | Bacteria | 326341 |
| 743 | Ga0495604_0003660 | 3300047317 | Bacteria | 12247 |
| 744 | Ga0495604_0017295 | 3300047317 | Bacteria | 5770 |
| 745 | Ga0495604_0017691 | 3300047317 | Bacteria | 5705 |
| 746 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 747 | Ga0495674_0042474 | 3300047319 | Bacteria | 4055 |
| 748 | Ga0495674_0080853 | 3300047319 | Bacteria | 2788 |
| 749 | Ga0495676_0084271 | 3300047321 | Bacteria | 2398 |
| 750 | Ga0495676_0178846 | 3300047321 | Bacteria | 1488 |
| 751 | Ga0495680_0000752 | 3300047322 | Bacteria | 36296 |
| 752 | Ga0495680_0014315 | 3300047322 | Bacteria | 6877 |
| 753 | Ga0495680_0014551 | 3300047322 | Bacteria | 6811 |
| 754 | Ga0495680_0022273 | 3300047322 | Bacteria | 5284 |
| 755 | Ga0495680_0028687 | 3300047322 | Bacteria | 4562 |
| 756 | Ga0495675_0000028 | 3300047444 | Bacteria | 105848 |
| 757 | Ga0495675_0026696 | 3300047444 | Bacteria | 3682 |
| 758 | Ga0495684_0000006 | 3300047471 | Bacteria | 247568 |
| 759 | Ga0495684_0003934 | 3300047471 | Bacteria | 11578 |
| 760 | Ga0495593_0008360 | 3300047673 | Bacteria | 6022 |
| 761 | Ga0495602_0000005 | 3300048088 | Bacteria | 325957 |
| 762 | Ga0495602_0000776 | 3300048088 | Bacteria | 30394 |
| 763 | Ga0495602_0002995 | 3300048088 | Bacteria | 17317 |
| 764 | Ga0495614_0004539 | 3300048089 | Bacteria | 6257 |
| 765 | Ga0496100_0002107 | 3300048903 | Bacteria | 10021 |
| 766 | Ga0496100_0008177 | 3300048903 | Bacteria | 5824 |
| 767 | Ga0496100_0008677 | 3300048903 | Bacteria | 5676 |
| 768 | Ga0496100_0010419 | 3300048903 | Bacteria | 5260 |
| 769 | Ga0496100_0057614 | 3300048903 | Bacteria | 2545 |
| 770 | Ga0496101_0002976 | 3300048904 | Bacteria | 10437 |
| 771 | Ga0496101_0005170 | 3300048904 | Bacteria | 8300 |
| 772 | Ga0496101_0005327 | 3300048904 | Bacteria | 8192 |
| 773 | Ga0496101_0028769 | 3300048904 | Bacteria | 3882 |
| 774 | Ga0496101_0045004 | 3300048904 | Bacteria | 3159 |
| 775 | Ga0496101_0099036 | 3300048904 | Bacteria | 2179 |
| 776 | Ga0496102_0008464 | 3300048905 | Bacteria | 8820 |
| 777 | Ga0496102_0009880 | 3300048905 | Bacteria | 8205 |
| 778 | Ga0496102_0017733 | 3300048905 | Bacteria | 6241 |
| 779 | Ga0496102_0024215 | 3300048905 | Bacteria | 5395 |
| 780 | Ga0496102_0029685 | 3300048905 | Bacteria | 4893 |
| 781 | Ga0496102_0097214 | 3300048905 | Bacteria | 2731 |
| 782 | Ga0496103_0001696 | 3300048906 | Bacteria | 14405 |
| 783 | Ga0496103_0005658 | 3300048906 | Bacteria | 7469 |
| 784 | Ga0496103_0005922 | 3300048906 | Bacteria | 7307 |
| 785 | Ga0496103_0011431 | 3300048906 | Bacteria | 5262 |
| 786 | Ga0496103_0036194 | 3300048906 | Bacteria | 3022 |
| 787 | Ga0496103_0076217 | 3300048906 | Bacteria | 2104 |
| 788 | Ga0496104_0000092 | 3300048907 | Bacteria | 87232 |
| 789 | Ga0496104_0004402 | 3300048907 | Bacteria | 12265 |
| 790 | Ga0496104_0013405 | 3300048907 | Bacteria | 7385 |
| 791 | Ga0496104_0033638 | 3300048907 | Bacteria | 4777 |
| 792 | Ga0496104_0069565 | 3300048907 | Bacteria | 3345 |
| 793 | Ga0496104_0112817 | 3300048907 | Bacteria | 2607 |
| 794 | Ga0496104_0269510 | 3300048907 | Bacteria | 1615 |
| 795 | Ga0496105_0001436 | 3300048908 | Bacteria | 16761 |
| 796 | Ga0496105_0001736 | 3300048908 | Bacteria | 15574 |
| 797 | Ga0496105_0002164 | 3300048908 | Bacteria | 14224 |
| 798 | Ga0496105_0002208 | 3300048908 | Bacteria | 14097 |
| 799 | Ga0496105_0018426 | 3300048908 | Bacteria | 5611 |
| 800 | Ga0496105_0125052 | 3300048908 | Bacteria | 2120 |
| 801 | Ga0496105_0125239 | 3300048908 | Bacteria | 2118 |
| 802 | Ga0496106_0003134 | 3300048909 | Bacteria | 12340 |
| 803 | Ga0496106_0006593 | 3300048909 | Bacteria | 8594 |
| 804 | Ga0496106_0019784 | 3300048909 | Bacteria | 4992 |
| 805 | Ga0496106_0026317 | 3300048909 | Bacteria | 4330 |
| 806 | Ga0496106_0043487 | 3300048909 | Bacteria | 3370 |
| 807 | Ga0496106_0149234 | 3300048909 | Bacteria | 1843 |
| 808 | Ga0496107_0000809 | 3300048910 | Bacteria | 18171 |
| 809 | Ga0496107_0003490 | 3300048910 | Bacteria | 10516 |
| 810 | Ga0496107_0007194 | 3300048910 | Bacteria | 7667 |
| 811 | Ga0496107_0012097 | 3300048910 | Bacteria | 6018 |
| 812 | Ga0496107_0013417 | 3300048910 | Bacteria | 5726 |
| 813 | Ga0496107_0026710 | 3300048910 | Bacteria | 4095 |
| 814 | Ga0496107_0029822 | 3300048910 | Bacteria | 3884 |
| 815 | Ga0496108_0003371 | 3300048911 | Bacteria | 12827 |
| 816 | Ga0496108_0005285 | 3300048911 | Bacteria | 10421 |
| 817 | Ga0496108_0012368 | 3300048911 | Bacteria | 6944 |
| 818 | Ga0496108_0014164 | 3300048911 | Bacteria | 6506 |
| 819 | Ga0496108_0082309 | 3300048911 | Bacteria | 2729 |
| 820 | Ga0496108_0090770 | 3300048911 | Bacteria | 2597 |
| 821 | Ga0496108_0097512 | 3300048911 | Bacteria | 2505 |
| 822 | Ga0496109_0000543 | 3300048912 | Bacteria | 31945 |
| 823 | Ga0496109_0016420 | 3300048912 | Bacteria | 6472 |
| 824 | Ga0496109_0026427 | 3300048912 | Bacteria | 5177 |
| 825 | Ga0496109_0031491 | 3300048912 | Bacteria | 4759 |
| 826 | Ga0496109_0118773 | 3300048912 | Bacteria | 2461 |
| 827 | Ga0496109_0200601 | 3300048912 | Bacteria | 1875 |
| 828 | Ga0496110_0004426 | 3300048913 | Bacteria | 10885 |
| 829 | Ga0496110_0015744 | 3300048913 | Bacteria | 6301 |
| 830 | Ga0496110_0053918 | 3300048913 | Bacteria | 3536 |
| 831 | Ga0496110_0112154 | 3300048913 | Bacteria | 2451 |
| 832 | Ga0496110_0190509 | 3300048913 | Bacteria | 1862 |
| 833 | Ga0496111_0000388 | 3300048914 | Bacteria | 21996 |
| 834 | Ga0496111_0002814 | 3300048914 | Bacteria | 10601 |
| 835 | Ga0496111_0010441 | 3300048914 | Bacteria | 6231 |
| 836 | Ga0496111_0012071 | 3300048914 | Bacteria | 5841 |
| 837 | Ga0496111_0028753 | 3300048914 | Bacteria | 3940 |
| 838 | Ga0496112_0003072 | 3300048915 | Bacteria | 13667 |
| 839 | Ga0496112_0009140 | 3300048915 | Bacteria | 8904 |
| 840 | Ga0496112_0014688 | 3300048915 | Bacteria | 7278 |
| 841 | Ga0496112_0061370 | 3300048915 | Bacteria | 3705 |
| 842 | Ga0496112_0195521 | 3300048915 | Bacteria | 1983 |
| 843 | Ga0496113_0000043 | 3300048916 | Bacteria | 52544 |
| 844 | Ga0496113_0003436 | 3300048916 | Bacteria | 9480 |
| 845 | Ga0496113_0004954 | 3300048916 | Bacteria | 8248 |
| 846 | Ga0496113_0015314 | 3300048916 | Bacteria | 5266 |
| 847 | Ga0496113_0047129 | 3300048916 | Bacteria | 3202 |
| 848 | Ga0496113_0133408 | 3300048916 | Bacteria | 1950 |
| 849 | Ga0496113_0189022 | 3300048916 | Bacteria | 1634 |
| 850 | Ga0496114_0003641 | 3300048917 | Bacteria | 11847 |
| 851 | Ga0496114_0013464 | 3300048917 | Bacteria | 6558 |
| 852 | Ga0496114_0023885 | 3300048917 | Bacteria | 4988 |
| 853 | Ga0496114_0040439 | 3300048917 | Bacteria | 3860 |
| 854 | Ga0496114_0052998 | 3300048917 | Bacteria | 3381 |
| 855 | Ga0496115_0009341 | 3300048918 | Bacteria | 7286 |
| 856 | Ga0496115_0018321 | 3300048918 | Bacteria | 5373 |
| 857 | Ga0496115_0046900 | 3300048918 | Bacteria | 3455 |
| 858 | Ga0496115_0054203 | 3300048918 | Bacteria | 3220 |
| 859 | Ga0496115_0109009 | 3300048918 | Bacteria | 2273 |
| 860 | Ga0501031_0022932 | 3300049568 | Bacteria | 4071 |
| 861 | Ga0501032_0028467 | 3300049569 | Bacteria | 3839 |
| 862 | Ga0501032_0049939 | 3300049569 | Bacteria | 2821 |
| 863 | Ga0501033_0011567 | 3300049570 | Bacteria | 6751 |
| 864 | Ga0501033_0017357 | 3300049570 | Bacteria | 5439 |
| 865 | Ga0501033_0038589 | 3300049570 | Bacteria | 3569 |
| 866 | Ga0501034_0006205 | 3300049571 | Bacteria | 12870 |
| 867 | Ga0501034_0008624 | 3300049571 | Bacteria | 10756 |
| 868 | Ga0501034_0018337 | 3300049571 | Bacteria | 7180 |
| 869 | Ga0501034_0086671 | 3300049571 | Bacteria | 3132 |
| 870 | Ga0501034_0105165 | 3300049571 | Bacteria | 2816 |
| 871 | Ga0501034_0157288 | 3300049571 | Bacteria | 2246 |
| 872 | Ga0501034_0304648 | 3300049571 | Bacteria | 1529 |
| 873 | Ga0501036_0000372 | 3300049572 | Bacteria | 31588 |
| 874 | Ga0501036_0017605 | 3300049572 | Bacteria | 5977 |
| 875 | Ga0501036_0025867 | 3300049572 | Bacteria | 4952 |
| 876 | Ga0501036_0055564 | 3300049572 | Bacteria | 3354 |
| 877 | Ga0501037_0008325 | 3300049573 | Bacteria | 7601 |
| 878 | Ga0501037_0020689 | 3300049573 | Bacteria | 4858 |
| 879 | Ga0501037_0020812 | 3300049573 | Bacteria | 4843 |
| 880 | Ga0501037_0026077 | 3300049573 | Bacteria | 4319 |
| 881 | Ga0501038_0017530 | 3300049574 | Bacteria | 6472 |
| 882 | Ga0501038_0026512 | 3300049574 | Bacteria | 5161 |
| 883 | Ga0501038_0031263 | 3300049574 | Bacteria | 4705 |
| 884 | Ga0501038_0062127 | 3300049574 | Bacteria | 3192 |
| 885 | Ga0501038_0096680 | 3300049574 | Bacteria | 2464 |
| 886 | Ga0501039_0015326 | 3300049575 | Bacteria | 5867 |
| 887 | Ga0501043_0005267 | 3300049579 | Bacteria | 10454 |
| 888 | Ga0501043_0023206 | 3300049579 | Bacteria | 4866 |
| 889 | Ga0501043_0030487 | 3300049579 | Bacteria | 4239 |
| 890 | Ga0501046_0066195 | 3300049580 | Bacteria | 2817 |
| 891 | Ga0501046_0066278 | 3300049580 | Bacteria | 2814 |
| 892 | Ga0501047_0000164 | 3300049581 | Bacteria | 81200 |
| 893 | Ga0501047_0025565 | 3300049581 | Bacteria | 5676 |
| 894 | Ga0501047_0079486 | 3300049581 | Bacteria | 3153 |
| 895 | Ga0501047_0087179 | 3300049581 | Bacteria | 2999 |
| 896 | Ga0501047_0109023 | 3300049581 | Bacteria | 2651 |
| 897 | Ga0501047_0110282 | 3300049581 | Bacteria | 2634 |
| 898 | Ga0501048_0003459 | 3300049582 | Bacteria | 12003 |
| 899 | Ga0501067_0006409 | 3300049583 | Bacteria | 6519 |
| 900 | Ga0501069_0000561 | 3300049585 | Bacteria | 17113 |
| 901 | Ga0501070_0003220 | 3300049586 | Bacteria | 14202 |
| 902 | Ga0501070_0020311 | 3300049586 | Bacteria | 5572 |
| 903 | Ga0501070_0020404 | 3300049586 | Bacteria | 5560 |
| 904 | Ga0501070_0021489 | 3300049586 | Bacteria | 5414 |
| 905 | Ga0501070_0022513 | 3300049586 | Bacteria | 5278 |
| 906 | Ga0501070_0035382 | 3300049586 | Bacteria | 4173 |
| 907 | Ga0501070_0044117 | 3300049586 | Bacteria | 3711 |
| 908 | Ga0501070_0143033 | 3300049586 | Bacteria | 1975 |
| 909 | Ga0501070_0162714 | 3300049586 | Bacteria | 1839 |
| 910 | Ga0501071_0054311 | 3300049587 | Bacteria | 2891 |
| 911 | Ga0501072_0065822 | 3300049588 | Bacteria | 2858 |
| 912 | Ga0501072_0147428 | 3300049588 | Bacteria | 1876 |
| 913 | Ga0501073_0026466 | 3300049589 | Bacteria | 4156 |
| 914 | Ga0501074_0014496 | 3300049590 | Bacteria | 5735 |
| 915 | Ga0501074_0016572 | 3300049590 | Bacteria | 5349 |
| 916 | Ga0501074_0184462 | 3300049590 | Bacteria | 1488 |
| 917 | Ga0501075_0044258 | 3300049591 | Bacteria | 3340 |
| 918 | Ga0501076_0118405 | 3300049592 | Bacteria | 2144 |
| 919 | Ga0501076_0167041 | 3300049592 | Bacteria | 1794 |
| 920 | Ga0501077_0025278 | 3300049593 | Bacteria | 3772 |
| 921 | Ga0501079_0004533 | 3300049741 | Bacteria | 10304 |
| 922 | Ga0501079_0047540 | 3300049741 | Bacteria | 3310 |
| 923 | Ga0501079_0047569 | 3300049741 | Bacteria | 3309 |
| 924 | Ga0501079_0096901 | 3300049741 | Bacteria | 2287 |
| 925 | Ga0501080_0000235 | 3300049742 | Bacteria | 41534 |
| 926 | Ga0501080_0043320 | 3300049742 | Bacteria | 4191 |
| 927 | Ga0501080_0048885 | 3300049742 | Bacteria | 3935 |
| 928 | Ga0501081_0034408 | 3300049743 | Bacteria | 3447 |
| 929 | Ga0501083_0016539 | 3300049744 | Bacteria | 5159 |
| 930 | Ga0501083_0022677 | 3300049744 | Bacteria | 4356 |
| 931 | Ga0501083_0066250 | 3300049744 | Bacteria | 2405 |
| 932 | Ga0501035_0016521 | 3300049822 | Bacteria | 6805 |
| 933 | Ga0501035_0046252 | 3300049822 | Bacteria | 3914 |
| 934 | Ga0501044_0000707 | 3300049823 | Bacteria | 40284 |
| 935 | Ga0501044_0004015 | 3300049823 | Bacteria | 16492 |
| 936 | Ga0501044_0033812 | 3300049823 | Bacteria | 5368 |
| 937 | Ga0501044_0043740 | 3300049823 | Bacteria | 4651 |
| 938 | Ga0501044_0127556 | 3300049823 | Bacteria | 2540 |
| 939 | Ga0501044_0144177 | 3300049823 | Bacteria | 2368 |
| 940 | Ga0501044_0293820 | 3300049823 | Bacteria | 1556 |
| 941 | Ga0501044_0310905 | 3300049823 | Bacteria | 1502 |
| 942 | nmdc:mga0yw44_46679_c1 | 3300050492 | Bacteria | 2602 |
| 943 | nmdc:mga0k408_5532_c1 | 3300050493 | Bacteria | 6726 |
| 944 | nmdc:mga06z11_72629_c1 | 3300050494 | Bacteria | 1824 |
| 945 | nmdc:mga05p37_143795_c1 | 3300050507 | Bacteria | 2921 |
| 946 | nmdc:mga05p37_201_c1 | 3300050507 | Bacteria | 59705 |
| 947 | nmdc:mga05p37_309031_c1 | 3300050507 | Bacteria | 1875 |
| 948 | nmdc:mga05p37_44522_c1 | 3300050507 | Bacteria | 5460 |
| 949 | nmdc:mga05p37_62368_c1 | 3300050507 | Bacteria | 4587 |
| 950 | nmdc:mga05p37_6242_c1 | 3300050507 | Bacteria | 14032 |
| 951 | nmdc:mga05p37_66_c1 | 3300050507 | Bacteria | 91764 |
| 952 | nmdc:mga05p37_92206_c1 | 3300050507 | Bacteria | 3733 |
| 953 | nmdc:mga09592_30035_c1 | 3300050508 | Bacteria | 4523 |
| 954 | nmdc:mga09592_7876_c1 | 3300050508 | Bacteria | 8660 |
| 955 | nmdc:mga0qj67_24563_c1 | 3300050509 | Bacteria | 4647 |
| 956 | nmdc:mga0qj67_26699_c1 | 3300050509 | Bacteria | 4471 |
| 957 | nmdc:mga0qj67_512_c1 | 3300050509 | Bacteria | 26543 |
| 958 | nmdc:mga0qj67_7_c1 | 3300050509 | Bacteria | 146944 |
| 959 | nmdc:mga06r32_177654_c1 | 3300050510 | Bacteria | 2114 |
| 960 | nmdc:mga06r32_25746_c1 | 3300050510 | Bacteria | 3867 |
| 961 | nmdc:mga06r32_451_c1 | 3300050510 | Bacteria | 34946 |
| 962 | nmdc:mga06r32_7326_c1 | 3300050510 | Bacteria | 9931 |
| 963 | nmdc:mga06r32_7911_c1 | 3300050510 | Bacteria | 9557 |
| 964 | nmdc:mga08y16_1809_c1 | 3300050511 | Bacteria | 21689 |
| 965 | nmdc:mga08y16_253276_c1 | 3300050511 | Bacteria | 1819 |
| 966 | nmdc:mga08y16_31568_c1 | 3300050511 | Bacteria | 5571 |
| 967 | nmdc:mga08y16_4145_c1 | 3300050511 | Bacteria | 15133 |
| 968 | nmdc:mga08y16_48_c1 | 3300050511 | Bacteria | 111306 |
| 969 | nmdc:mga08y16_56670_c1 | 3300050511 | Bacteria | 4095 |
| 970 | nmdc:mga0n895_43_c1 | 3300050512 | Bacteria | 74924 |
| 971 | nmdc:mga0n895_74467_c1 | 3300050512 | Bacteria | 3373 |
| 972 | nmdc:mga0n895_78577_c1 | 3300050512 | Bacteria | 3284 |
| 973 | nmdc:mga0n895_82465_c1 | 3300050512 | Bacteria | 3206 |
| 974 | nmdc:mga0rr50_21285_c1 | 3300050513 | Bacteria | 4423 |
| 975 | nmdc:mga0rr50_43928_c1 | 3300050513 | Bacteria | 3274 |
| 976 | nmdc:mga0rr50_5412_c1 | 3300050513 | Bacteria | 7612 |
| 977 | nmdc:mga0a205_13273_c1 | 3300050515 | Bacteria | 7662 |
| 978 | nmdc:mga0a205_2982_c1 | 3300050515 | Bacteria | 15012 |
| 979 | nmdc:mga0a205_3268_c1 | 3300050515 | Bacteria | 14416 |
| 980 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 981 | Ga0495601_0000107 | 3300053077 | Bacteria | 45730 |
| 982 | Ga0495601_0005039 | 3300053077 | Bacteria | 7668 |
| 983 | Ga0495601_0027688 | 3300053077 | Bacteria | 3505 |
| 984 | Ga0495601_0035231 | 3300053077 | Bacteria | 3123 |
| 985 | Ga0495601_0122728 | 3300053077 | Bacteria | 1688 |
| 986 | Ga0495612_0000010 | 3300053078 | Bacteria | 227618 |
| 987 | Ga0495612_0001623 | 3300053078 | Bacteria | 9246 |
| 988 | Ga0495612_0002221 | 3300053078 | Bacteria | 7987 |
| 989 | Ga0495612_0005028 | 3300053078 | Bacteria | 5475 |
| 990 | Ga0495595_0000777 | 3300053084 | Bacteria | 12093 |
| 991 | Ga0495595_0004037 | 3300053084 | Bacteria | 5874 |
| 992 | Ga0495595_0010557 | 3300053084 | Bacteria | 3840 |
| 993 | Ga0495595_0019908 | 3300053084 | Bacteria | 2915 |
| 994 | Ga0495619_0000019 | 3300053085 | Bacteria | 209518 |
| 995 | Ga0495619_0000045 | 3300053085 | Bacteria | 108543 |
| 996 | Ga0495619_0002374 | 3300053085 | Bacteria | 12380 |
| 997 | Ga0495619_0002899 | 3300053085 | Bacteria | 11139 |
| 998 | Ga0495619_0004604 | 3300053085 | Bacteria | 8803 |
| 999 | Ga0495619_0044260 | 3300053085 | Bacteria | 2922 |
| 1000 | Ga0495619_0110761 | 3300053085 | Bacteria | 1876 |
| 1001 | Ga0500644_0001293 | 3300053088 | Bacteria | 6806 |
| 1002 | Ga0500651_0006213 | 3300053093 | Bacteria | 6869 |
| 1003 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1004 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1005 | Ga0500616_0007357 | 3300053153 | Bacteria | 7014 |
| 1006 | Ga0500645_000099 | 3300053730 | Bacteria | 68426 |
| 1007 | Ga0501084_0126233 | 3300054114 | Bacteria | 2153 |
| 1008 | Ga0501082_0000074 | 3300060353 | Bacteria | 73246 |
| 1009 | Ga0501082_0040262 | 3300060353 | Bacteria | 4031 |
| 1010 | Ga0501082_0043132 | 3300060353 | Bacteria | 3888 |
| 1011 | Ga0530510_0045710 | 3300061734 | Bacteria | 3163 |
| 1012 | 2643757269 | 2643221547 | Bacteria | 4740017 |
| 1013 | 2889918179 | 2889914905 | Bacteria | 5702301 |
| 1014 | Ga0070711_100051325 | |||
| 1015 | 2214745202 | |||
| 1016 | ARSoilYngRDRAFT_c00086 | |||
| 1017 | ARcpr5yngRDRAFT_c000084 | |||
| 1018 | ARSoilOldRDRAFT_c000050 | |||
| 1019 | ARCol0yngRDRAFT_1000023 | |||
| 1020 | JGI24739J22299_10000209 | |||
| 1021 | JGI24739J22299_10002430 | |||
| 1022 | JGI24737J22298_10000739 | |||
| 1023 | JGI24737J22298_10003173 | |||
| 1024 | JGI24750J21931_1000551 | |||
| 1025 | JGI24748J21848_1000695 | |||
| 1026 | JGI24738J21930_10001189 | |||
| 1027 | JGI24749J21850_1000283 | |||
| 1028 | JGI24744J21845_10000810 | |||
| 1029 | JGI24035J26624_1000365 | |||
| 1030 | JGI24742J22300_10000279 | |||
| 1031 | JGI25153J46596_10004383 | |||
| 1032 | JGI25404J52841_10002701 | |||
| 1033 | Ga0065714_10095322 | |||
| 1034 | Ga0065704_10073133 | |||
| 1035 | Ga0065712_10070789 | |||
| 1036 | Ga0065715_10000519 | |||
| 1037 | Ga0065715_10004456 | |||
| 1038 | Ga0070676_10002633 | |||
| 1039 | Ga0070676_10041250 | |||
| 1040 | Ga0070683_100010864 | |||
| 1041 | Ga0070683_100035491 | |||
| 1042 | Ga0070690_100001459 | |||
| 1043 | Ga0070670_100012949 | |||
| 1044 | Ga0070670_100027821 | |||
| 1045 | Ga0070677_10000109 | |||
| 1046 | Ga0068869_100004148 | |||
| 1047 | Ga0068869_100035836 | |||
| 1048 | Ga0068869_100146055 | |||
| 1049 | Ga0070680_100018038 | |||
| 1050 | Ga0070680_100019164 | |||
| 1051 | Ga0070680_100063179 | |||
| 1052 | Ga0070682_100000459 | |||
| 1053 | Ga0070682_100034055 | |||
| 1054 | Ga0070682_100040299 | |||
| 1055 | Ga0068868_100000443 | |||
| 1056 | Ga0068868_100006452 | |||
| 1057 | Ga0070660_100034923 | |||
| 1058 | Ga0070660_100046626 | |||
| 1059 | Ga0070689_100000423 | |||
| 1060 | Ga0070689_100001662 | |||
| 1061 | Ga0070689_100020869 | |||
| 1062 | Ga0070689_100043276 | |||
| 1063 | Ga0070689_100131548 | |||
| 1064 | Ga0070691_10001927 | |||
| 1065 | Ga0070691_10011614 | |||
| 1066 | Ga0070691_10011885 | |||
| 1067 | Ga0070691_10019580 | |||
| 1068 | Ga0070687_100000706 | |||
| 1069 | Ga0070687_100005176 | |||
| 1070 | Ga0070687_100006831 | |||
| 1071 | Ga0070687_100022617 | |||
| 1072 | Ga0070661_100001619 | |||
| 1073 | Ga0070692_10000262 | |||
| 1074 | Ga0070692_10046098 | |||
| 1075 | Ga0070668_100001027 | |||
| 1076 | Ga0070668_100051371 | |||
| 1077 | Ga0070668_100092303 | |||
| 1078 | Ga0070669_100002329 | |||
| 1079 | Ga0070669_100064546 | |||
| 1080 | Ga0070675_100040634 | |||
| 1081 | Ga0070671_100017038 | |||
| 1082 | Ga0070671_100019919 | |||
| 1083 | Ga0070671_100031446 | |||
| 1084 | Ga0070674_100001251 | |||
| 1085 | Ga0070674_100009547 | |||
| 1086 | Ga0070674_100027485 | |||
| 1087 | Ga0070674_100043841 | |||
| 1088 | Ga0070673_100000050 | |||
| 1089 | Ga0070673_100006576 | |||
| 1090 | Ga0070673_100016705 | |||
| 1091 | Ga0070688_100001640 | |||
| 1092 | Ga0070688_100007074 | |||
| 1093 | Ga0070688_100036737 | |||
| 1094 | Ga0070659_100012533 | |||
| 1095 | Ga0070659_100037940 | |||
| 1096 | Ga0070659_100039712 | |||
| 1097 | Ga0070659_100042832 | |||
| 1098 | Ga0070667_100006734 | |||
| 1099 | Ga0070667_100015429 | |||
| 1100 | Ga0070667_100033083 | |||
| 1101 | Ga0070703_10001729 | |||
| 1102 | Ga0070703_10002210 | |||
| 1103 | Ga0070709_10000525 | |||
| 1104 | Ga0070714_100005095 | |||
| 1105 | Ga0070713_100001754 | |||
| 1106 | Ga0070713_100178398 | |||
| 1107 | Ga0070710_10001598 | |||
| 1108 | Ga0070710_10069031 | |||
| 1109 | Ga0070701_10000093 | |||
| 1110 | Ga0070701_10021819 | |||
| 1111 | Ga0070701_10022612 | |||
| 1112 | Ga0070711_100016501 | |||
| 1113 | Ga0070705_100003411 | |||
| 1114 | Ga0070705_100009540 | |||
| 1115 | Ga0070705_100101189 | |||
| 1116 | Ga0070700_100009936 | |||
| 1117 | Ga0070700_100010471 | |||
| 1118 | Ga0070700_100014595 | |||
| 1119 | Ga0070700_100016882 | |||
| 1120 | Ga0070694_100009576 | |||
| 1121 | Ga0070694_100019701 | |||
| 1122 | Ga0070663_100030724 | |||
| 1123 | Ga0070663_100090611 | |||
| 1124 | Ga0070678_100001756 | |||
| 1125 | Ga0070678_100015618 | |||
| 1126 | Ga0070678_100133004 | |||
| 1127 | Ga0070662_100003987 | |||
| 1128 | Ga0070662_100009135 | |||
| 1129 | Ga0070681_10001525 | |||
| 1130 | Ga0070681_10001623 | |||
| 1131 | Ga0070681_10030838 | |||
| 1132 | Ga0070681_10149529 | |||
| 1133 | Ga0068867_100001138 | |||
| 1134 | Ga0068867_100012280 | |||
| 1135 | Ga0068867_100035703 | |||
| 1136 | Ga0070685_10000984 | |||
| 1137 | Ga0070685_10007517 | |||
| 1138 | Ga0070685_10017650 | |||
| 1139 | Ga0070685_10029019 | |||
| 1140 | Ga0070699_100001809 | |||
| 1141 | Ga0070679_100012735 | |||
| 1142 | Ga0070679_100054193 | |||
| 1143 | Ga0070679_100091379 | |||
| 1144 | Ga0070679_100139212 | |||
| 1145 | Ga0070684_100029522 | |||
| 1146 | Ga0070684_100035117 | |||
| 1147 | Ga0070684_100067827 | |||
| 1148 | Ga0070684_100076688 | |||
| 1149 | Ga0070684_100086779 | |||
| 1150 | Ga0070684_100090738 | |||
| 1151 | Ga0068853_100002995 | |||
| 1152 | Ga0068853_100073321 | |||
| 1153 | Ga0070672_100003943 | |||
| 1154 | Ga0070686_100009031 | |||
| 1155 | Ga0070686_100016714 | |||
| 1156 | Ga0070686_100021350 | |||
| 1157 | Ga0070695_100000824 | |||
| 1158 | Ga0070695_100002921 | |||
| 1159 | Ga0070695_100017465 | |||
| 1160 | Ga0070696_100000856 | |||
| 1161 | Ga0070693_100001975 | |||
| 1162 | Ga0070665_100244531 | |||
| 1163 | Ga0070704_100002335 | |||
| 1164 | Ga0070704_100002836 | |||
| 1165 | Ga0070704_100006569 | |||
| 1166 | Ga0070704_100039281 | |||
| 1167 | Ga0068855_100015755 | |||
| 1168 | Ga0070664_100024583 | |||
| 1169 | Ga0070664_100037892 | |||
| 1170 | Ga0070664_100079318 | |||
| 1171 | Ga0068857_100008305 | |||
| 1172 | Ga0068857_100043792 | |||
| 1173 | Ga0068854_100003868 | |||
| 1174 | Ga0068854_100015449 | |||
| 1175 | Ga0068854_100063690 | |||
| 1176 | Ga0068854_100072375 | |||
| 1177 | Ga0068856_100003821 | |||
| 1178 | Ga0068856_100058666 | |||
| 1179 | Ga0070702_100000497 | |||
| 1180 | Ga0070702_100006109 | |||
| 1181 | Ga0070702_100084461 | |||
| 1182 | Ga0068852_100001222 | |||
| 1183 | Ga0068852_100063725 | |||
| 1184 | Ga0068859_100021148 | |||
| 1185 | Ga0068859_100023550 | |||
| 1186 | Ga0068859_100025814 | |||
| 1187 | Ga0068859_100034357 | |||
| 1188 | Ga0068859_100038671 | |||
| 1189 | Ga0068864_100001074 | |||
| 1190 | Ga0068864_100006339 | |||
| 1191 | Ga0068864_100012258 | |||
| 1192 | Ga0068864_100042649 | |||
| 1193 | Ga0068864_100048003 | |||
| 1194 | Ga0068864_100157672 | |||
| 1195 | Ga0068866_10005659 | |||
| 1196 | Ga0068866_10006999 | |||
| 1197 | Ga0068866_10068047 | |||
| 1198 | Ga0068861_100001328 | |||
| 1199 | Ga0068861_100016726 | |||
| 1200 | Ga0068861_100017632 | |||
| 1201 | Ga0068870_10000051 | |||
| 1202 | Ga0068870_10015842 | |||
| 1203 | Ga0068863_100008364 | |||
| 1204 | Ga0068863_100013387 | |||
| 1205 | Ga0068863_100026590 | |||
| 1206 | Ga0068863_100075045 | |||
| 1207 | Ga0068858_100005147 | |||
| 1208 | Ga0068858_100006251 | |||
| 1209 | Ga0068858_100034414 | |||
| 1210 | Ga0068858_100092885 | |||
| 1211 | Ga0068860_100001825 | |||
| 1212 | Ga0068860_100008760 | |||
| 1213 | Ga0068860_100010661 | |||
| 1214 | Ga0068860_100023546 | |||
| 1215 | Ga0068860_100104445 | |||
| 1216 | Ga0068860_100144787 | |||
| 1217 | Ga0068862_100001949 | |||
| 1218 | Ga0068862_100016670 | |||
| 1219 | Ga0068862_100039768 | |||
| 1220 | Ga0081455_10000081 | |||
| 1221 | Ga0081455_10002198 | |||
| 1222 | Ga0081538_10059304 | |||
| 1223 | Ga0081538_10081004 | |||
| 1224 | Ga0081540_1000007 | |||
| 1225 | Ga0081540_1004024 | |||
| 1226 | Ga0075365_10126900 | |||
| 1227 | Ga0075368_10005879 | |||
| 1228 | Ga0075368_10014120 | |||
| 1229 | Ga0070715_10000551 | |||
| 1230 | Ga0070716_100001287 | |||
| 1231 | Ga0070712_100004737 | |||
| 1232 | Ga0075367_10018956 | |||
| 1233 | Ga0075427_10000603 | |||
| 1234 | Ga0075366_10012326 | |||
| 1235 | Ga0097621_100001496 | |||
| 1236 | Ga0075370_10042438 | |||
| 1237 | Ga0068871_100003134 | |||
| 1238 | Ga0068871_100023904 | |||
| 1239 | Ga0068871_100065268 | |||
| 1240 | Ga0068871_100081876 | |||
| 1241 | Ga0068871_100251808 | |||
| 1242 | Ga0075428_100000740 | |||
| 1243 | Ga0075428_100024539 | |||
| 1244 | Ga0075430_100006097 | |||
| 1245 | Ga0075430_100013350 | |||
| 1246 | Ga0075430_100016809 | |||
| 1247 | Ga0075431_100000870 | |||
| 1248 | Ga0075431_100001076 | |||
| 1249 | Ga0075431_100007719 | |||
| 1250 | Ga0075431_100042948 | |||
| 1251 | Ga0075431_100149874 | |||
| 1252 | Ga0075431_100195337 | |||
| 1253 | Ga0075433_10000012 | |||
| 1254 | Ga0075433_10025668 | |||
| 1255 | Ga0075434_100003201 | |||
| 1256 | Ga0075434_100007032 | |||
| 1257 | Ga0075434_100008056 | |||
| 1258 | Ga0075434_100012519 | |||
| 1259 | Ga0075434_100054628 | |||
| 1260 | Ga0075429_100000098 | |||
| 1261 | Ga0075429_100004032 | |||
| 1262 | Ga0068865_100003854 | |||
| 1263 | Ga0068865_100016325 | |||
| 1264 | Ga0097620_100021146 | |||
| 1265 | Ga0097620_100023550 | |||
| 1266 | Ga0097620_100025814 | |||
| 1267 | Ga0097620_100034355 | |||
| 1268 | Ga0097620_100038673 | |||
| 1269 | Ga0075435_100028671 | |||
| 1270 | Ga0075435_100069072 | |||
| 1271 | Ga0105250_10040014 | |||
| 1272 | Ga0111539_10000757 | |||
| 1273 | Ga0111539_10001671 | |||
| 1274 | Ga0111539_10005127 | |||
| 1275 | Ga0111539_10008480 | |||
| 1276 | Ga0111539_10051044 | |||
| 1277 | Ga0111539_10100128 | |||
| 1278 | Ga0111539_10150020 | |||
| 1279 | Ga0105245_10002488 | |||
| 1280 | Ga0105245_10050094 | |||
| 1281 | Ga0105245_10182552 | |||
| 1282 | Ga0105247_10006103 | |||
| 1283 | Ga0105247_10008404 | |||
| 1284 | Ga0105247_10016894 | |||
| 1285 | Ga0105247_10036684 | |||
| 1286 | Ga0114129_10000025 | |||
| 1287 | Ga0114129_10008949 | |||
| 1288 | Ga0114129_10016369 | |||
| 1289 | Ga0114129_10019966 | |||
| 1290 | Ga0114129_10023567 | |||
| 1291 | Ga0114129_10050640 | |||
| 1292 | Ga0114129_10233598 | |||
| 1293 | Ga0105243_10003214 | |||
| 1294 | Ga0105243_10009303 | |||
| 1295 | Ga0105243_10031611 | |||
| 1296 | Ga0105241_10004876 | |||
| 1297 | Ga0105241_10005826 | |||
| 1298 | Ga0105241_10065776 | |||
| 1299 | Ga0105242_10002016 | |||
| 1300 | Ga0105242_10003519 | |||
| 1301 | Ga0105242_10041795 | |||
| 1302 | Ga0105242_10069916 | |||
| 1303 | Ga0105242_10108685 | |||
| 1304 | Ga0105248_10003871 | |||
| 1305 | Ga0105248_10099691 | |||
| 1306 | Ga0105248_10315006 | |||
| 1307 | Ga0105237_10006016 | |||
| 1308 | Ga0105237_10043192 | |||
| 1309 | Ga0105237_10078801 | |||
| 1310 | Ga0105237_10095030 | |||
| 1311 | Ga0105238_10054187 | |||
| 1312 | Ga0105238_10054673 | |||
| 1313 | Ga0105249_10001193 | |||
| 1314 | Ga0105249_10001979 | |||
| 1315 | Ga0105249_10108889 | |||
| 1316 | Ga0105239_10027649 | |||
| 1317 | Ga0105239_10035856 | |||
| 1318 | Ga0105239_10038572 | |||
| 1319 | Ga0105239_10041876 | |||
| 1320 | Ga0105246_10000231 | |||
| 1321 | Ga0105246_10015760 | |||
| 1322 | Ga0105246_10117462 | |||
| 1323 | Ga0157373_10010248 | |||
| 1324 | Ga0157373_10102676 | |||
| 1325 | Ga0157373_10111698 | |||
| 1326 | Ga0157371_10025479 | |||
| 1327 | Ga0157370_10150497 | |||
| 1328 | Ga0157374_10003239 | |||
| 1329 | Ga0157374_10013309 | |||
| 1330 | Ga0157374_10017421 | |||
| 1331 | Ga0157374_10031696 | |||
| 1332 | Ga0157378_10004453 | |||
| 1333 | Ga0157378_10010612 | |||
| 1334 | Ga0157378_10020673 | |||
| 1335 | Ga0157378_10021915 | |||
| 1336 | Ga0163162_10006149 | |||
| 1337 | Ga0163162_10020738 | |||
| 1338 | Ga0163162_10026579 | |||
| 1339 | Ga0157372_10025465 | |||
| 1340 | Ga0157372_10121031 | |||
| 1341 | Ga0157375_10006518 | |||
| 1342 | Ga0157375_10033972 | |||
| 1343 | Ga0157375_10053687 | |||
| 1344 | Ga0157375_10100999 | |||
| 1345 | Ga0157375_10119222 | |||
| 1346 | Ga0157375_10237394 | |||
| 1347 | Ga0163163_10001320 | |||
| 1348 | Ga0163163_10015790 | |||
| 1349 | Ga0163163_10051326 | |||
| 1350 | Ga0163163_10093775 | |||
| 1351 | Ga0163163_10168581 | |||
| 1352 | Ga0157380_10002744 | |||
| 1353 | Ga0157380_10065721 | |||
| 1354 | Ga0157380_10195500 | |||
| 1355 | Ga0157377_10000164 | |||
| 1356 | Ga0157379_10020078 | |||
| 1357 | Ga0157379_10030909 | |||
| 1358 | Ga0157379_10061490 | |||
| 1359 | Ga0157379_10064966 | |||
| 1360 | Ga0157376_10002102 | |||
| 1361 | Ga0157376_10036456 | |||
| 1362 | Ga0157376_10036479 | |||
| 1363 | Ga0157376_10088277 | |||
| 1364 | Ga0157376_10204657 | |||
| 1365 | Ga0163161_10002837 | |||
| 1366 | Ga0163161_10114468 | |||
| 1367 | Ga0163161_10131060 | |||
| 1368 | Ga0213876_10025328 | |||
| 1369 | Ga0207666_1000051 | |||
| 1370 | Ga0209758_1000125 | |||
| 1371 | Ga0207697_10000662 | |||
| 1372 | Ga0207653_10000546 | |||
| 1373 | Ga0207653_10001467 | |||
| 1374 | Ga0207682_10000072 | |||
| 1375 | Ga0207692_10002147 | |||
| 1376 | Ga0207642_10001909 | |||
| 1377 | Ga0207642_10039428 | |||
| 1378 | Ga0207710_10000558 | |||
| 1379 | Ga0207710_10004313 | |||
| 1380 | Ga0207710_10035227 | |||
| 1381 | Ga0207688_10000229 | |||
| 1382 | Ga0207688_10000998 | |||
| 1383 | Ga0207688_10004677 | |||
| 1384 | Ga0207680_10001283 | |||
| 1385 | Ga0207680_10092650 | |||
| 1386 | Ga0207647_10003353 | |||
| 1387 | Ga0207647_10010679 | |||
| 1388 | Ga0207647_10011089 | |||
| 1389 | Ga0207685_10001607 | |||
| 1390 | Ga0207685_10003975 | |||
| 1391 | Ga0207699_10002080 | |||
| 1392 | Ga0207699_10015546 | |||
| 1393 | Ga0207645_10000966 | |||
| 1394 | Ga0207645_10007388 | |||
| 1395 | Ga0207645_10023155 | |||
| 1396 | Ga0207645_10059737 | |||
| 1397 | Ga0207643_10000004 | |||
| 1398 | Ga0207643_10000794 | |||
| 1399 | Ga0207643_10004896 | |||
| 1400 | Ga0207643_10031046 | |||
| 1401 | Ga0207643_10065728 | |||
| 1402 | Ga0207654_10001472 | |||
| 1403 | Ga0207654_10007425 | |||
| 1404 | Ga0207707_10007028 | |||
| 1405 | Ga0207707_10065564 | |||
| 1406 | Ga0207671_10013159 | |||
| 1407 | Ga0207671_10020766 | |||
| 1408 | Ga0207671_10048003 | |||
| 1409 | Ga0207693_10006880 | |||
| 1410 | Ga0207693_10027450 | |||
| 1411 | Ga0207693_10161096 | |||
| 1412 | Ga0207663_10010875 | |||
| 1413 | Ga0207663_10017354 | |||
| 1414 | Ga0207660_10000648 | |||
| 1415 | Ga0207660_10092613 | |||
| 1416 | Ga0207662_10000317 | |||
| 1417 | Ga0207662_10000424 | |||
| 1418 | Ga0207662_10013378 | |||
| 1419 | Ga0207662_10023881 | |||
| 1420 | Ga0207662_10032770 | |||
| 1421 | Ga0207662_10064039 | |||
| 1422 | Ga0207662_10091114 | |||
| 1423 | Ga0207657_10002047 | |||
| 1424 | Ga0207657_10028849 | |||
| 1425 | Ga0207649_10000262 | |||
| 1426 | Ga0207649_10090257 | |||
| 1427 | Ga0207652_10000911 | |||
| 1428 | Ga0207652_10067950 | |||
| 1429 | Ga0207681_10010634 | |||
| 1430 | Ga0207694_10024208 | |||
| 1431 | Ga0207650_10013694 | |||
| 1432 | Ga0207650_10019548 | |||
| 1433 | Ga0207659_10001684 | |||
| 1434 | Ga0207659_10012218 | |||
| 1435 | Ga0207659_10024969 | |||
| 1436 | Ga0207687_10001501 | |||
| 1437 | Ga0207687_10006389 | |||
| 1438 | Ga0207687_10017936 | |||
| 1439 | Ga0207700_10001264 | |||
| 1440 | Ga0207700_10218925 | |||
| 1441 | Ga0207664_10002547 | |||
| 1442 | Ga0207664_10183287 | |||
| 1443 | Ga0207644_10000467 | |||
| 1444 | Ga0207644_10001961 | |||
| 1445 | Ga0207644_10015484 | |||
| 1446 | Ga0207644_10025194 | |||
| 1447 | Ga0207644_10092872 | |||
| 1448 | Ga0207690_10001228 | |||
| 1449 | Ga0207690_10009138 | |||
| 1450 | Ga0207690_10137132 | |||
| 1451 | Ga0207706_10001679 | |||
| 1452 | Ga0207706_10007881 | |||
| 1453 | Ga0207706_10018822 | |||
| 1454 | Ga0207706_10054074 | |||
| 1455 | Ga0207706_10203437 | |||
| 1456 | Ga0207686_10002040 | |||
| 1457 | Ga0207686_10009318 | |||
| 1458 | Ga0207686_10017951 | |||
| 1459 | Ga0207686_10099188 | |||
| 1460 | Ga0207709_10035318 | |||
| 1461 | Ga0207709_10102649 | |||
| 1462 | Ga0207670_10000377 | |||
| 1463 | Ga0207670_10002370 | |||
| 1464 | Ga0207670_10003054 | |||
| 1465 | Ga0207670_10037467 | |||
| 1466 | Ga0207670_10170453 | |||
| 1467 | Ga0207669_10001912 | |||
| 1468 | Ga0207669_10015439 | |||
| 1469 | Ga0207669_10017896 | |||
| 1470 | Ga0207669_10031185 | |||
| 1471 | Ga0207704_10002613 | |||
| 1472 | Ga0207704_10174333 | |||
| 1473 | Ga0207665_10001035 | |||
| 1474 | Ga0207665_10043619 | |||
| 1475 | Ga0207665_10056180 | |||
| 1476 | Ga0207665_10067562 | |||
| 1477 | Ga0207691_10002691 | |||
| 1478 | Ga0207691_10002874 | |||
| 1479 | Ga0207711_10003410 | |||
| 1480 | Ga0207711_10006776 | |||
| 1481 | Ga0207711_10022868 | |||
| 1482 | Ga0207711_10030274 | |||
| 1483 | Ga0207689_10000203 | |||
| 1484 | Ga0207689_10022711 | |||
| 1485 | Ga0207689_10044138 | |||
| 1486 | Ga0207689_10045948 | |||
| 1487 | Ga0207661_10002165 | |||
| 1488 | Ga0207661_10014563 | |||
| 1489 | Ga0207679_10000157 | |||
| 1490 | Ga0207679_10015012 | |||
| 1491 | Ga0207679_10158473 | |||
| 1492 | Ga0207667_10220437 | |||
| 1493 | Ga0207651_10008897 | |||
| 1494 | Ga0207712_10002224 | |||
| 1495 | Ga0207712_10003965 | |||
| 1496 | Ga0207712_10039070 | |||
| 1497 | Ga0207668_10017144 | |||
| 1498 | Ga0207668_10055993 | |||
| 1499 | Ga0207668_10109409 | |||
| 1500 | Ga0207640_10043680 | |||
| 1501 | Ga0207658_10005748 | |||
| 1502 | Ga0207658_10008052 | |||
| 1503 | Ga0207658_10048495 | |||
| 1504 | Ga0207658_10167123 | |||
| 1505 | Ga0207677_10001675 | |||
| 1506 | Ga0207677_10006260 | |||
| 1507 | Ga0207703_10001346 | |||
| 1508 | Ga0207703_10001852 | |||
| 1509 | Ga0207703_10032158 | |||
| 1510 | Ga0207639_10008211 | |||
| 1511 | Ga0207678_10001809 | |||
| 1512 | Ga0207678_10001884 | |||
| 1513 | Ga0207678_10011488 | |||
| 1514 | Ga0207678_10013053 | |||
| 1515 | Ga0207678_10034212 | |||
| 1516 | Ga0207678_10034731 | |||
| 1517 | Ga0207678_10041672 | |||
| 1518 | Ga0207708_10000784 | |||
| 1519 | Ga0207708_10001199 | |||
| 1520 | Ga0207708_10003067 | |||
| 1521 | Ga0207708_10004901 | |||
| 1522 | Ga0207708_10014093 | |||
| 1523 | Ga0207702_10003404 | |||
| 1524 | Ga0207702_10068697 | |||
| 1525 | Ga0207641_10006871 | |||
| 1526 | Ga0207641_10011257 | |||
| 1527 | Ga0207641_10041334 | |||
| 1528 | Ga0207648_10002073 | |||
| 1529 | Ga0207648_10002310 | |||
| 1530 | Ga0207648_10016984 | |||
| 1531 | Ga0207648_10027663 | |||
| 1532 | Ga0207676_10000990 | |||
| 1533 | Ga0207676_10002295 | |||
| 1534 | Ga0207676_10002940 | |||
| 1535 | Ga0207676_10048845 | |||
| 1536 | Ga0207676_10184700 | |||
| 1537 | Ga0207674_10000897 | |||
| 1538 | Ga0207674_10011740 | |||
| 1539 | Ga0207675_100001726 | |||
| 1540 | Ga0207675_100002371 | |||
| 1541 | Ga0207675_100005453 | |||
| 1542 | Ga0207683_10000824 | |||
| 1543 | Ga0207683_10001176 | |||
| 1544 | Ga0207683_10014019 | |||
| 1545 | Ga0207683_10018096 | |||
| 1546 | Ga0207683_10081706 | |||
| 1547 | Ga0207683_10185428 | |||
| 1548 | Ga0207698_10003743 | |||
| 1549 | Ga0207698_10024746 | |||
| 1550 | Ga0210002_1003362 | |||
| 1551 | Ga0209966_1000247 | |||
| 1552 | Ga0209998_10000255 | |||
| 1553 | Ga0209998_10001128 | |||
| 1554 | Ga0209974_10001489 | |||
| 1555 | Ga0207428_10000137 | |||
| 1556 | Ga0207428_10000792 | |||
| 1557 | Ga0207428_10003106 | |||
| 1558 | Ga0207428_10004572 | |||
| 1559 | Ga0207428_10033074 | |||
| 1560 | Ga0207428_10072105 | |||
| 1561 | Ga0268266_10005095 | |||
| 1562 | Ga0268266_10023244 | |||
| 1563 | Ga0268266_10046625 | |||
| 1564 | Ga0268265_10012344 | |||
| 1565 | Ga0268265_10029470 | |||
| 1566 | Ga0268265_10085418 | |||
| 1567 | Ga0268264_10002039 | |||
| 1568 | Ga0268264_10016623 | |||
| 1569 | Ga0268264_10062447 | |||
| 1570 | Ga0268264_10081157 | |||
| 1571 | Ga0265330_10047685 | |||
| 1572 | Ga0265325_10000073 | |||
| 1573 | Ga0265325_10000234 | |||
| 1574 | Ga0265325_10002177 | |||
| 1575 | Ga0265325_10004094 | |||
| 1576 | Ga0265340_10021850 | |||
| 1577 | Ga0265339_10001513 | |||
| 1578 | Ga0265316_10024489 | |||
| 1579 | Ga0265313_10000326 | |||
| 1580 | Ga0265313_10008870 | |||
| 1581 | Ga0265313_10040748 | |||
| 1582 | Ga0373948_0000061 | |||
| 1583 | Ga0373958_0000048 | |||
| 1584 | Ga0373958_0001634 | |||
| 1585 | Ga0373926_0003985 | |||
| 1586 | Ga0373928_0000291 | |||
| 1587 | Ga0373928_0008797 | |||
| 1588 | Ga0373929_0000564 | |||
| 1589 | Ga0373929_0005244 | |||
| 1590 | Ga0373934_0020853 | |||
| 1591 | Ga0373940_0000023 | |||
| 1592 | Ga0373940_0010533 | |||
| 1593 | Ga0373940_0012296 | |||
| 1594 | Ga0373949_0001146 | |||
| 1595 | Ga0373951_0000876 | |||
| 1596 | Ga0373951_0005478 | |||
| 1597 | Ga0373923_0000851 | |||
| 1598 | Ga0373923_0003216 | |||
| 1599 | Ga0373936_0001660 | |||
| 1600 | Ga0373939_0000663 | |||
| 1601 | Ga0373939_0002651 | |||
| 1602 | Ga0373941_0000309 | |||
| 1603 | Ga0373945_0000277 | |||
| 1604 | Ga0373945_0001390 | |||
| 1605 | Ga0373953_0068438 | |||
| 1606 | Ga0373954_0005333 | |||
| 1607 | Ga0373954_0014688 | |||
| 1608 | Ga0373960_0001082 | |||
| 1609 | Ga0373960_0003571 | |||
| 1610 | Ga0373960_0003751 | |||
| 1611 | Ga0373943_0004971 | |||
| 1612 | Ga0373943_0005512 | |||
| 1613 | Ga0373943_0009916 | |||
| 1614 | Ga0373946_0001856 | |||
| 1615 | Ga0373946_0002330 | |||
| 1616 | Ga0373955_0002403 | |||
| 1617 | Ga0373942_0000081 | |||
| 1618 | Ga0373942_0003417 | |||
| 1619 | Ga0373942_0009249 | |||
| 1620 | Ga0373942_0016658 | |||
| 1621 | Ga0373961_0000743 | |||
| 1622 | Ga0373961_0002954 | |||
| 1623 | Ga0373961_0032726 | |||
| 1624 | Ga0373962_0000194 | |||
| 1625 | Ga0373924_0000490 | |||
| 1626 | Ga0373924_0004810 | |||
| 1627 | Ga0373931_0001008 | |||
| 1628 | Ga0373931_0001564 | |||
| 1629 | Ga0373931_0002975 | |||
| 1630 | Ga0373931_0007918 | |||
| 1631 | Ga0373931_0016578 | |||
| 1632 | Ga0373935_0000291 | |||
| 1633 | Ga0373935_0013547 | |||
| 1634 | Ga0373935_0057106 | |||
| 1635 | Ga0373927_0005343 | |||
| 1636 | Ga0373927_0009000 | |||
| 1637 | Ga0373927_0034546 | |||
| 1638 | Ga0373927_0051606 | |||
| 1639 | Ga0373927_0054373 | |||
| 1640 | Ga0373927_0055119 | |||
| 1641 | Ga0373933_0010185 | |||
| 1642 | Ga0373933_0012833 | |||
| 1643 | Ga0373947_0000424 | |||
| 1644 | Ga0373947_0005730 | |||
| 1645 | Ga0373947_0010154 | |||
| 1646 | Ga0373947_0041253 | |||
| 1647 | Ga0373947_0048954 | |||
| 1648 | Ga0373937_0000004 | |||
| 1649 | Ga0373937_0003680 | |||
| 1650 | Ga0373937_0005263 | |||
| 1651 | Ga0373937_0006030 | |||
| 1652 | Ga0373925_0000460 | |||
| 1653 | Ga0373925_0003391 | |||
| 1654 | Ga0373925_0017524 | |||
| 1655 | Ga0373925_0127647 | |||
| 1656 | Ga0436365_0349099 | |||
| 1657 | Ga0436365_1169665 | |||
| 1658 | Ga0439464_0005396 | |||
| 1659 | Ga0451576_0006650 | |||
| 1660 | Ga0495592_0000029 | |||
| 1661 | Ga0495592_0001215 | |||
| 1662 | Ga0495592_0005508 | |||
| 1663 | Ga0495592_0136552 | |||
| 1664 | Ga0495592_0149021 | |||
| 1665 | Ga0495590_0028653 | |||
| 1666 | Ga0495629_0000447 | |||
| 1667 | Ga0495629_0016571 | |||
| 1668 | Ga0495629_0016805 | |||
| 1669 | Ga0495638_0028434 | |||
| 1670 | Ga0495641_0001697 | |||
| 1671 | Ga0495641_0015734 | |||
| 1672 | Ga0495641_0027911 | |||
| 1673 | Ga0495651_0002424 | |||
| 1674 | Ga0495651_0038986 | |||
| 1675 | Ga0495653_0000012 | |||
| 1676 | Ga0495653_0003231 | |||
| 1677 | Ga0495653_0006931 | |||
| 1678 | Ga0495653_0078354 | |||
| 1679 | Ga0495580_0006747 | |||
| 1680 | Ga0495580_0085877 | |||
| 1681 | Ga0495582_0007072 | |||
| 1682 | Ga0495582_0010997 | |||
| 1683 | Ga0495582_0013202 | |||
| 1684 | Ga0495639_0006165 | |||
| 1685 | Ga0495662_0003904 | |||
| 1686 | Ga0495662_0010406 | |||
| 1687 | Ga0495664_0000004 | |||
| 1688 | Ga0495664_0009959 | |||
| 1689 | Ga0495664_0105171 | |||
| 1690 | Ga0495584_0002735 | |||
| 1691 | Ga0495584_0056557 | |||
| 1692 | Ga0495585_0003199 | |||
| 1693 | Ga0495585_0073720 | |||
| 1694 | Ga0495594_0013045 | |||
| 1695 | Ga0495594_0021869 | |||
| 1696 | Ga0495607_0029184 | |||
| 1697 | Ga0495608_0000017 | |||
| 1698 | Ga0495618_0000006 | |||
| 1699 | Ga0495628_0000001 | |||
| 1700 | Ga0495628_0009640 | |||
| 1701 | Ga0495628_0019168 | |||
| 1702 | Ga0495628_0035835 | |||
| 1703 | Ga0495630_0008370 | |||
| 1704 | Ga0495637_0042998 | |||
| 1705 | Ga0495644_0002426 | |||
| 1706 | Ga0495666_0001305 | |||
| 1707 | Ga0495652_0000002 | |||
| 1708 | Ga0495652_0018154 | |||
| 1709 | Ga0495665_0004009 | |||
| 1710 | Ga0495665_0025407 | |||
| 1711 | Ga0495640_0000001 | |||
| 1712 | Ga0495640_0017355 | |||
| 1713 | Ga0495586_0007089 | |||
| 1714 | Ga0495587_0000008 | |||
| 1715 | Ga0495587_0001490 | |||
| 1716 | Ga0495598_0001556 | |||
| 1717 | Ga0495645_0000002 | |||
| 1718 | Ga0495645_0000954 | |||
| 1719 | Ga0495645_0050356 | |||
| 1720 | Ga0495633_0014899 | |||
| 1721 | Ga0495667_0000029 | |||
| 1722 | Ga0495667_0014263 | |||
| 1723 | Ga0495667_0043731 | |||
| 1724 | Ga0495656_0000941 | |||
| 1725 | Ga0495634_0006280 | |||
| 1726 | Ga0495634_0035463 | |||
| 1727 | Ga0495634_0058157 | |||
| 1728 | Ga0495611_0005829 | |||
| 1729 | Ga0495635_0000002 | |||
| 1730 | Ga0495635_0013015 | |||
| 1731 | Ga0495588_0000318 | |||
| 1732 | Ga0495588_0012717 | |||
| 1733 | Ga0495588_0029685 | |||
| 1734 | Ga0495657_0000459 | |||
| 1735 | Ga0495657_0086718 | |||
| 1736 | Ga0495599_0000104 | |||
| 1737 | Ga0495599_0001047 | |||
| 1738 | Ga0495599_0034637 | |||
| 1739 | Ga0495623_0000691 | |||
| 1740 | Ga0495623_0003897 | |||
| 1741 | Ga0495646_0000064 | |||
| 1742 | Ga0495646_0005442 | |||
| 1743 | Ga0495646_0006507 | |||
| 1744 | Ga0495647_0001576 | |||
| 1745 | Ga0495658_0007929 | |||
| 1746 | Ga0495658_0008212 | |||
| 1747 | Ga0495658_0008346 | |||
| 1748 | Ga0495658_0035592 | |||
| 1749 | Ga0495613_0000793 | |||
| 1750 | Ga0495613_0047786 | |||
| 1751 | Ga0495624_0023831 | |||
| 1752 | Ga0495600_0000010 | |||
| 1753 | Ga0495600_0032708 | |||
| 1754 | Ga0495581_0002305 | |||
| 1755 | Ga0495604_0000009 | |||
| 1756 | Ga0495604_0003660 | |||
| 1757 | Ga0495604_0017295 | |||
| 1758 | Ga0495604_0017691 | |||
| 1759 | Ga0495674_0000002 | |||
| 1760 | Ga0495674_0042474 | |||
| 1761 | Ga0495674_0080853 | |||
| 1762 | Ga0495676_0084271 | |||
| 1763 | Ga0495676_0178846 | |||
| 1764 | Ga0495680_0000752 | |||
| 1765 | Ga0495680_0014315 | |||
| 1766 | Ga0495680_0014551 | |||
| 1767 | Ga0495680_0022273 | |||
| 1768 | Ga0495680_0028687 | |||
| 1769 | Ga0495675_0000028 | |||
| 1770 | Ga0495675_0026696 | |||
| 1771 | Ga0495684_0000006 | |||
| 1772 | Ga0495684_0003934 | |||
| 1773 | Ga0495593_0008360 | |||
| 1774 | Ga0495602_0000005 | |||
| 1775 | Ga0495602_0000776 | |||
| 1776 | Ga0495602_0002995 | |||
| 1777 | Ga0495614_0004539 | |||
| 1778 | Ga0496100_0002107 | |||
| 1779 | Ga0496100_0008177 | |||
| 1780 | Ga0496100_0008677 | |||
| 1781 | Ga0496100_0010419 | |||
| 1782 | Ga0496100_0057614 | |||
| 1783 | Ga0496101_0002976 | |||
| 1784 | Ga0496101_0005170 | |||
| 1785 | Ga0496101_0005327 | |||
| 1786 | Ga0496101_0028769 | |||
| 1787 | Ga0496101_0045004 | |||
| 1788 | Ga0496101_0099036 | |||
| 1789 | Ga0496102_0008464 | |||
| 1790 | Ga0496102_0009880 | |||
| 1791 | Ga0496102_0017733 | |||
| 1792 | Ga0496102_0024215 | |||
| 1793 | Ga0496102_0029685 | |||
| 1794 | Ga0496102_0097214 | |||
| 1795 | Ga0496103_0001696 | |||
| 1796 | Ga0496103_0005658 | |||
| 1797 | Ga0496103_0005922 | |||
| 1798 | Ga0496103_0011431 | |||
| 1799 | Ga0496103_0036194 | |||
| 1800 | Ga0496103_0076217 | |||
| 1801 | Ga0496104_0000092 | |||
| 1802 | Ga0496104_0004402 | |||
| 1803 | Ga0496104_0013405 | |||
| 1804 | Ga0496104_0033638 | |||
| 1805 | Ga0496104_0069565 | |||
| 1806 | Ga0496104_0112817 | |||
| 1807 | Ga0496104_0269510 | |||
| 1808 | Ga0496105_0001436 | |||
| 1809 | Ga0496105_0001736 | |||
| 1810 | Ga0496105_0002164 | |||
| 1811 | Ga0496105_0002208 | |||
| 1812 | Ga0496105_0018426 | |||
| 1813 | Ga0496105_0125052 | |||
| 1814 | Ga0496105_0125239 | |||
| 1815 | Ga0496106_0003134 | |||
| 1816 | Ga0496106_0006593 | |||
| 1817 | Ga0496106_0019784 | |||
| 1818 | Ga0496106_0026317 | |||
| 1819 | Ga0496106_0043487 | |||
| 1820 | Ga0496106_0149234 | |||
| 1821 | Ga0496107_0000809 | |||
| 1822 | Ga0496107_0003490 | |||
| 1823 | Ga0496107_0007194 | |||
| 1824 | Ga0496107_0012097 | |||
| 1825 | Ga0496107_0013417 | |||
| 1826 | Ga0496107_0026710 | |||
| 1827 | Ga0496107_0029822 | |||
| 1828 | Ga0496108_0003371 | |||
| 1829 | Ga0496108_0005285 | |||
| 1830 | Ga0496108_0012368 | |||
| 1831 | Ga0496108_0014164 | |||
| 1832 | Ga0496108_0082309 | |||
| 1833 | Ga0496108_0090770 | |||
| 1834 | Ga0496108_0097512 | |||
| 1835 | Ga0496109_0000543 | |||
| 1836 | Ga0496109_0016420 | |||
| 1837 | Ga0496109_0026427 | |||
| 1838 | Ga0496109_0031491 | |||
| 1839 | Ga0496109_0118773 | |||
| 1840 | Ga0496109_0200601 | |||
| 1841 | Ga0496110_0004426 | |||
| 1842 | Ga0496110_0015744 | |||
| 1843 | Ga0496110_0053918 | |||
| 1844 | Ga0496110_0112154 | |||
| 1845 | Ga0496110_0190509 | |||
| 1846 | Ga0496111_0000388 | |||
| 1847 | Ga0496111_0002814 | |||
| 1848 | Ga0496111_0010441 | |||
| 1849 | Ga0496111_0012071 | |||
| 1850 | Ga0496111_0028753 | |||
| 1851 | Ga0496112_0003072 | |||
| 1852 | Ga0496112_0009140 | |||
| 1853 | Ga0496112_0014688 | |||
| 1854 | Ga0496112_0061370 | |||
| 1855 | Ga0496112_0195521 | |||
| 1856 | Ga0496113_0000043 | |||
| 1857 | Ga0496113_0003436 | |||
| 1858 | Ga0496113_0004954 | |||
| 1859 | Ga0496113_0015314 | |||
| 1860 | Ga0496113_0047129 | |||
| 1861 | Ga0496113_0133408 | |||
| 1862 | Ga0496113_0189022 | |||
| 1863 | Ga0496114_0003641 | |||
| 1864 | Ga0496114_0013464 | |||
| 1865 | Ga0496114_0023885 | |||
| 1866 | Ga0496114_0040439 | |||
| 1867 | Ga0496114_0052998 | |||
| 1868 | Ga0496115_0009341 | |||
| 1869 | Ga0496115_0018321 | |||
| 1870 | Ga0496115_0046900 | |||
| 1871 | Ga0496115_0054203 | |||
| 1872 | Ga0496115_0109009 | |||
| 1873 | Ga0501031_0022932 | |||
| 1874 | Ga0501032_0028467 | |||
| 1875 | Ga0501032_0049939 | |||
| 1876 | Ga0501033_0011567 | |||
| 1877 | Ga0501033_0017357 | |||
| 1878 | Ga0501033_0038589 | |||
| 1879 | Ga0501034_0006205 | |||
| 1880 | Ga0501034_0008624 | |||
| 1881 | Ga0501034_0018337 | |||
| 1882 | Ga0501034_0086671 | |||
| 1883 | Ga0501034_0105165 | |||
| 1884 | Ga0501034_0157288 | |||
| 1885 | Ga0501034_0304648 | |||
| 1886 | Ga0501036_0000372 | |||
| 1887 | Ga0501036_0017605 | |||
| 1888 | Ga0501036_0025867 | |||
| 1889 | Ga0501036_0055564 | |||
| 1890 | Ga0501037_0008325 | |||
| 1891 | Ga0501037_0020689 | |||
| 1892 | Ga0501037_0020812 | |||
| 1893 | Ga0501037_0026077 | |||
| 1894 | Ga0501038_0017530 | |||
| 1895 | Ga0501038_0026512 | |||
| 1896 | Ga0501038_0031263 | |||
| 1897 | Ga0501038_0062127 | |||
| 1898 | Ga0501038_0096680 | |||
| 1899 | Ga0501039_0015326 | |||
| 1900 | Ga0501043_0005267 | |||
| 1901 | Ga0501043_0023206 | |||
| 1902 | Ga0501043_0030487 | |||
| 1903 | Ga0501046_0066195 | |||
| 1904 | Ga0501046_0066278 | |||
| 1905 | Ga0501047_0000164 | |||
| 1906 | Ga0501047_0025565 | |||
| 1907 | Ga0501047_0079486 | |||
| 1908 | Ga0501047_0087179 | |||
| 1909 | Ga0501047_0109023 | |||
| 1910 | Ga0501047_0110282 | |||
| 1911 | Ga0501048_0003459 | |||
| 1912 | Ga0501067_0006409 | |||
| 1913 | Ga0501069_0000561 | |||
| 1914 | Ga0501070_0003220 | |||
| 1915 | Ga0501070_0020311 | |||
| 1916 | Ga0501070_0020404 | |||
| 1917 | Ga0501070_0021489 | |||
| 1918 | Ga0501070_0022513 | |||
| 1919 | Ga0501070_0035382 | |||
| 1920 | Ga0501070_0044117 | |||
| 1921 | Ga0501070_0143033 | |||
| 1922 | Ga0501070_0162714 | |||
| 1923 | Ga0501071_0054311 | |||
| 1924 | Ga0501072_0065822 | |||
| 1925 | Ga0501072_0147428 | |||
| 1926 | Ga0501073_0026466 | |||
| 1927 | Ga0501074_0014496 | |||
| 1928 | Ga0501074_0016572 | |||
| 1929 | Ga0501074_0184462 | |||
| 1930 | Ga0501075_0044258 | |||
| 1931 | Ga0501076_0118405 | |||
| 1932 | Ga0501076_0167041 | |||
| 1933 | Ga0501077_0025278 | |||
| 1934 | Ga0501079_0004533 | |||
| 1935 | Ga0501079_0047540 | |||
| 1936 | Ga0501079_0047569 | |||
| 1937 | Ga0501079_0096901 | |||
| 1938 | Ga0501080_0000235 | |||
| 1939 | Ga0501080_0043320 | |||
| 1940 | Ga0501080_0048885 | |||
| 1941 | Ga0501081_0034408 | |||
| 1942 | Ga0501083_0016539 | |||
| 1943 | Ga0501083_0022677 | |||
| 1944 | Ga0501083_0066250 | |||
| 1945 | Ga0501035_0016521 | |||
| 1946 | Ga0501035_0046252 | |||
| 1947 | Ga0501044_0000707 | |||
| 1948 | Ga0501044_0004015 | |||
| 1949 | Ga0501044_0033812 | |||
| 1950 | Ga0501044_0043740 | |||
| 1951 | Ga0501044_0127556 | |||
| 1952 | Ga0501044_0144177 | |||
| 1953 | Ga0501044_0293820 | |||
| 1954 | Ga0501044_0310905 | |||
| 1955 | nmdc:mga0yw44_46679_c1 | |||
| 1956 | nmdc:mga0k408_5532_c1 | |||
| 1957 | nmdc:mga06z11_72629_c1 | |||
| 1958 | nmdc:mga05p37_143795_c1 | |||
| 1959 | nmdc:mga05p37_201_c1 | |||
| 1960 | nmdc:mga05p37_309031_c1 | |||
| 1961 | nmdc:mga05p37_44522_c1 | |||
| 1962 | nmdc:mga05p37_62368_c1 | |||
| 1963 | nmdc:mga05p37_6242_c1 | |||
| 1964 | nmdc:mga05p37_66_c1 | |||
| 1965 | nmdc:mga05p37_92206_c1 | |||
| 1966 | nmdc:mga09592_30035_c1 | |||
| 1967 | nmdc:mga09592_7876_c1 | |||
| 1968 | nmdc:mga0qj67_24563_c1 | |||
| 1969 | nmdc:mga0qj67_26699_c1 | |||
| 1970 | nmdc:mga0qj67_512_c1 | |||
| 1971 | nmdc:mga0qj67_7_c1 | |||
| 1972 | nmdc:mga06r32_177654_c1 | |||
| 1973 | nmdc:mga06r32_25746_c1 | |||
| 1974 | nmdc:mga06r32_451_c1 | |||
| 1975 | nmdc:mga06r32_7326_c1 | |||
| 1976 | nmdc:mga06r32_7911_c1 | |||
| 1977 | nmdc:mga08y16_1809_c1 | |||
| 1978 | nmdc:mga08y16_253276_c1 | |||
| 1979 | nmdc:mga08y16_31568_c1 | |||
| 1980 | nmdc:mga08y16_4145_c1 | |||
| 1981 | nmdc:mga08y16_48_c1 | |||
| 1982 | nmdc:mga08y16_56670_c1 | |||
| 1983 | nmdc:mga0n895_43_c1 | |||
| 1984 | nmdc:mga0n895_74467_c1 | |||
| 1985 | nmdc:mga0n895_78577_c1 | |||
| 1986 | nmdc:mga0n895_82465_c1 | |||
| 1987 | nmdc:mga0rr50_21285_c1 | |||
| 1988 | nmdc:mga0rr50_43928_c1 | |||
| 1989 | nmdc:mga0rr50_5412_c1 | |||
| 1990 | nmdc:mga0a205_13273_c1 | |||
| 1991 | nmdc:mga0a205_2982_c1 | |||
| 1992 | nmdc:mga0a205_3268_c1 | |||
| 1993 | Ga0495601_0000002 | |||
| 1994 | Ga0495601_0000107 | |||
| 1995 | Ga0495601_0005039 | |||
| 1996 | Ga0495601_0027688 | |||
| 1997 | Ga0495601_0035231 | |||
| 1998 | Ga0495601_0122728 | |||
| 1999 | Ga0495612_0000010 | |||
| 2000 | Ga0495612_0001623 | |||
| 2001 | Ga0495612_0002221 | |||
| 2002 | Ga0495612_0005028 | |||
| 2003 | Ga0495595_0000777 | |||
| 2004 | Ga0495595_0004037 | |||
| 2005 | Ga0495595_0010557 | |||
| 2006 | Ga0495595_0019908 | |||
| 2007 | Ga0495619_0000019 | |||
| 2008 | Ga0495619_0000045 | |||
| 2009 | Ga0495619_0002374 | |||
| 2010 | Ga0495619_0002899 | |||
| 2011 | Ga0495619_0004604 | |||
| 2012 | Ga0495619_0044260 | |||
| 2013 | Ga0495619_0110761 | |||
| 2014 | Ga0500644_0001293 | |||
| 2015 | Ga0500651_0006213 | |||
| 2016 | Ga0500595_000002 | |||
| 2017 | Ga0500616_0000002 | |||
| 2018 | Ga0500616_0007357 | |||
| 2019 | Ga0500645_000099 | |||
| 2020 | Ga0501084_0126233 | |||
| 2021 | Ga0501082_0000074 | |||
| 2022 | Ga0501082_0040262 | |||
| 2023 | Ga0501082_0043132 | |||
| 2024 | Ga0530510_0045710 | |||
| 2025 | 2643757269 | |||
| 2026 | 2889918179 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ose-assembly1.cif.gz_D | cytochrome bd-ii type oxidase with bound aurachin d | 0.9557 | 4 | 434 |
| 7nkz-assembly1.cif.gz_A | cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution | 0.9351 | 1 | 434 |
| 5ir6-assembly1.cif.gz_A | the structure of bd oxidase from geobacillus thermodenitrificans | 0.9205 | 1 | 434 |
| 5ir6-assembly1.cif.gz_A | the structure of bd oxidase from geobacillus thermodenitrificans | 0.9184 | 1 | 434 |
| 7nkz-assembly1.cif.gz_A | cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution | 0.8916 | 1 | 434 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76173_1_274_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.5457 | 13 | 377 | 1.20.1630.10 |
| af_P76173_1_274_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.5334 | 13 | 377 | 1.20.1630.10 |
| af_Q54YB8_113_357_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.4232 | 9 | 225 | 1.20.1250.20 |
| 2cmrA00 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.423 | 12 | 240 | 1.20.58.1860 |
| af_A4I2W7_8_252_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.4145 | 122 | 382 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K6IUC4-F1-model_v4 | Bacterial Cytochrome Ubiquinol Oxidase | 0.9911 | 143 | 256 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A366GMK4-F1-model_v4 | Cytochrome bd-I ubiquinol oxidase subunit 1 apoprotein | 0.9893 | 1 | 398 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |
| AF-A0A5N7YB97-F1-model_v4 | deleted | 0.9872 | 1 | 429 |
|
| AF-A0A329P241-F1-model_v4 | deleted | 0.9869 | 64 | 413 |
|
| AF-A0A7C4N6J7-F1-model_v4 | Cytochrome ubiquinol oxidase subunit I | 0.9866 | 4 | 434 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0020037 GO:0046872 GO:0070069 |