F488189

General Info

Members Datasets Scaffolds Average Seq Length
1013 377 2026 463

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100051325|Ga0070711_1000513254
Length 452
Sequence MDFDPVLLARLQFAFTIIFHIIFPSFTIGLSAYIATLGALWLRSGEERHQLLMRFWVKIFAVSFAMGVVSGIVLSYQFGTNWSRFSVATGNVLGPLLGYEVLAAFFLEATFLGILLFGFNKVPPWLYVLSAIVVAIGTMTSAFWILAANSWMQTPAGHEFRDGVAYPLDWLHIVFNPSFPYRFAHMLNAAYLTTAFVVIAVGARYLIRTMLRMGIGLAAILAPLQLIIGDQHGLNTLAHQPLKVAAMEAHWDGSKPGDFHIFAWPDEKAGVNHFELSIPKGASLILTHKMNGLFPGLLSVPEADRPPVKVVFFGFRIMLGVGLFMIASALFGAFLWWRGTLFETRWYLRIMAQSWWVGFVAVIAGWVVTESGRQPWIVYGVMRTADATSPVPGATIAGTLALFVLAYGVVFSFGIYYMNRLIANGPDQGTETGGEFSGNPLSTTQDAGRGPL

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
84 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
85 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
86 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
90 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
140 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
219 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
220 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
221 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
222 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
226 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
227 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
228 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
230 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
231 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
232 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
233 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
234 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
235 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
241 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
244 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
247 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
248 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
262 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
263 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
277 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
278 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
279 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
280 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
285 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
286 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
287 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
288 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
289 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
290 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
291 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
295 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
339 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
340 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
341 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
342 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
343 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
354 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
355 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
356 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
357 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
358 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
359 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
360 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
361 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
362 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
363 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
366 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
367 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
368 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
369 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
370 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
376 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
377 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0
Isolates 0.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.68
Nodule 0
Rhizoplane 9.38
Rhizosphere 88.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100051325 3300005439 Bacteria 2832
2 2214745202 2209111006 Bacteria 16175
3 ARSoilYngRDRAFT_c00086 3300000042 Bacteria 15520
4 ARcpr5yngRDRAFT_c000084 3300000043 Bacteria 15520
5 ARSoilOldRDRAFT_c000050 3300000044 Bacteria 25074
6 ARCol0yngRDRAFT_1000023 3300000652 Bacteria 28722
7 JGI24739J22299_10000209 3300001989 Bacteria 19461
8 JGI24739J22299_10002430 3300001989 Bacteria 7191
9 JGI24737J22298_10000739 3300001990 Bacteria 11509
10 JGI24737J22298_10003173 3300001990 Bacteria 5839
11 JGI24750J21931_1000551 3300002070 Bacteria 5744
12 JGI24748J21848_1000695 3300002074 Bacteria 3616
13 JGI24738J21930_10001189 3300002075 Bacteria 7282
14 JGI24749J21850_1000283 3300002076 Bacteria 7793
15 JGI24744J21845_10000810 3300002077 Bacteria 5872
16 JGI24035J26624_1000365 3300002126 Bacteria 4267
17 JGI24742J22300_10000279 3300002244 Bacteria 7687
18 JGI25153J46596_10004383 3300003215 Bacteria 7615
19 JGI25404J52841_10002701 3300003659 Bacteria 3395
20 Ga0065714_10095322 3300005288 Bacteria 1790
21 Ga0065704_10073133 3300005289 Bacteria 7551
22 Ga0065712_10070789 3300005290 Bacteria 5705
23 Ga0065715_10000519 3300005293 Bacteria 20489
24 Ga0065715_10004456 3300005293 Bacteria 3808
25 Ga0070676_10002633 3300005328 Bacteria 9237
26 Ga0070676_10041250 3300005328 Bacteria 2675
27 Ga0070683_100010864 3300005329 Bacteria 7839
28 Ga0070683_100035491 3300005329 Bacteria 4558
29 Ga0070690_100001459 3300005330 Bacteria 12359
30 Ga0070670_100012949 3300005331 Bacteria 7141
31 Ga0070670_100027821 3300005331 Bacteria 4864
32 Ga0070677_10000109 3300005333 Bacteria 26990
33 Ga0068869_100004148 3300005334 Bacteria 8986
34 Ga0068869_100035836 3300005334 Bacteria 3520
35 Ga0068869_100146055 3300005334 Bacteria 1830
36 Ga0070680_100018038 3300005336 Bacteria 5574
37 Ga0070680_100019164 3300005336 Bacteria 5420
38 Ga0070680_100063179 3300005336 Bacteria 3032
39 Ga0070682_100000459 3300005337 Bacteria 25698
40 Ga0070682_100034055 3300005337 Bacteria 3099
41 Ga0070682_100040299 3300005337 Bacteria 2874
42 Ga0068868_100000443 3300005338 Bacteria 27815
43 Ga0068868_100006452 3300005338 Bacteria 8300
44 Ga0070660_100034923 3300005339 Bacteria 3802
45 Ga0070660_100046626 3300005339 Bacteria 3322
46 Ga0070689_100000423 3300005340 Bacteria 24943
47 Ga0070689_100001662 3300005340 Bacteria 14205
48 Ga0070689_100020869 3300005340 Bacteria 4868
49 Ga0070689_100043276 3300005340 Bacteria 3460
50 Ga0070689_100131548 3300005340 Bacteria 2007
51 Ga0070691_10001927 3300005341 Bacteria 9119
52 Ga0070691_10011614 3300005341 Bacteria 4023
53 Ga0070691_10011885 3300005341 Bacteria 3984
54 Ga0070691_10019580 3300005341 Bacteria 3125
55 Ga0070687_100000706 3300005343 Bacteria 11178
56 Ga0070687_100005176 3300005343 Bacteria 5266
57 Ga0070687_100006831 3300005343 Bacteria 4706
58 Ga0070687_100022617 3300005343 Bacteria 2976
59 Ga0070661_100001619 3300005344 Bacteria 15572
60 Ga0070692_10000262 3300005345 Bacteria 14685
61 Ga0070692_10046098 3300005345 Bacteria 2251
62 Ga0070668_100001027 3300005347 Bacteria 19571
63 Ga0070668_100051371 3300005347 Bacteria 3176
64 Ga0070668_100092303 3300005347 Bacteria 2388
65 Ga0070669_100002329 3300005353 Bacteria 13729
66 Ga0070669_100064546 3300005353 Bacteria 2697
67 Ga0070675_100040634 3300005354 Bacteria 3798
68 Ga0070671_100017038 3300005355 Bacteria 5877
69 Ga0070671_100019919 3300005355 Bacteria 5465
70 Ga0070671_100031446 3300005355 Bacteria 4384
71 Ga0070674_100001251 3300005356 Bacteria 13361
72 Ga0070674_100009547 3300005356 Bacteria 5810
73 Ga0070674_100027485 3300005356 Bacteria 3729
74 Ga0070674_100043841 3300005356 Bacteria 3045
75 Ga0070673_100000050 3300005364 Bacteria 49499
76 Ga0070673_100006576 3300005364 Bacteria 7565
77 Ga0070673_100016705 3300005364 Bacteria 5200
78 Ga0070688_100001640 3300005365 Bacteria 11206
79 Ga0070688_100007074 3300005365 Bacteria 6036
80 Ga0070688_100036737 3300005365 Bacteria 2981
81 Ga0070659_100012533 3300005366 Bacteria 6285
82 Ga0070659_100037940 3300005366 Bacteria 3756
83 Ga0070659_100039712 3300005366 Bacteria 3675
84 Ga0070659_100042832 3300005366 Bacteria 3540
85 Ga0070667_100006734 3300005367 Bacteria 9546
86 Ga0070667_100015429 3300005367 Bacteria 6316
87 Ga0070667_100033083 3300005367 Bacteria 4317
88 Ga0070703_10001729 3300005406 Bacteria 6477
89 Ga0070703_10002210 3300005406 Bacteria 5657
90 Ga0070709_10000525 3300005434 Bacteria 22547
91 Ga0070714_100005095 3300005435 Bacteria 9993
92 Ga0070713_100001754 3300005436 Bacteria 13984
93 Ga0070713_100178398 3300005436 Bacteria 1907
94 Ga0070710_10001598 3300005437 Bacteria 10686
95 Ga0070710_10069031 3300005437 Bacteria 2032
96 Ga0070701_10000093 3300005438 Bacteria 25004
97 Ga0070701_10021819 3300005438 Bacteria 3063
98 Ga0070701_10022612 3300005438 Bacteria 3015
99 Ga0070711_100016501 3300005439 Bacteria 4692
100 Ga0070705_100003411 3300005440 Bacteria 7790
101 Ga0070705_100009540 3300005440 Bacteria 4829
102 Ga0070705_100101189 3300005440 Bacteria 1820
103 Ga0070700_100009936 3300005441 Bacteria 5236
104 Ga0070700_100010471 3300005441 Bacteria 5122
105 Ga0070700_100014595 3300005441 Bacteria 4437
106 Ga0070700_100016882 3300005441 Bacteria 4165
107 Ga0070694_100009576 3300005444 Bacteria 5943
108 Ga0070694_100019701 3300005444 Bacteria 4293
109 Ga0070663_100030724 3300005455 Bacteria 3685
110 Ga0070663_100090611 3300005455 Bacteria 2265
111 Ga0070678_100001756 3300005456 Bacteria 11671
112 Ga0070678_100015618 3300005456 Bacteria 4832
113 Ga0070678_100133004 3300005456 Bacteria 1979
114 Ga0070662_100003987 3300005457 Bacteria 9250
115 Ga0070662_100009135 3300005457 Bacteria 6472
116 Ga0070681_10001525 3300005458 Bacteria 20520
117 Ga0070681_10001623 3300005458 Bacteria 20035
118 Ga0070681_10030838 3300005458 Bacteria 5381
119 Ga0070681_10149529 3300005458 Bacteria 2263
120 Ga0068867_100001138 3300005459 Bacteria 18176
121 Ga0068867_100012280 3300005459 Bacteria 6056
122 Ga0068867_100035703 3300005459 Bacteria 3606
123 Ga0070685_10000984 3300005466 Bacteria 15313
124 Ga0070685_10007517 3300005466 Bacteria 5578
125 Ga0070685_10017650 3300005466 Bacteria 3823
126 Ga0070685_10029019 3300005466 Bacteria 3071
127 Ga0070699_100001809 3300005518 Bacteria 19434
128 Ga0070679_100012735 3300005530 Bacteria 8043
129 Ga0070679_100054193 3300005530 Bacteria 3992
130 Ga0070679_100091379 3300005530 Bacteria 3032
131 Ga0070679_100139212 3300005530 Bacteria 2407
132 Ga0070684_100029522 3300005535 Bacteria 4648
133 Ga0070684_100035117 3300005535 Bacteria 4289
134 Ga0070684_100067827 3300005535 Bacteria 3134
135 Ga0070684_100076688 3300005535 Bacteria 2951
136 Ga0070684_100086779 3300005535 Bacteria 2778
137 Ga0070684_100090738 3300005535 Bacteria 2718
138 Ga0068853_100002995 3300005539 Bacteria 12889
139 Ga0068853_100073321 3300005539 Bacteria 2984
140 Ga0070672_100003943 3300005543 Bacteria 9675
141 Ga0070686_100009031 3300005544 Bacteria 5590
142 Ga0070686_100016714 3300005544 Bacteria 4272
143 Ga0070686_100021350 3300005544 Bacteria 3847
144 Ga0070695_100000824 3300005545 Bacteria 16725
145 Ga0070695_100002921 3300005545 Bacteria 9944
146 Ga0070695_100017465 3300005545 Bacteria 4351
147 Ga0070696_100000856 3300005546 Bacteria 19655
148 Ga0070693_100001975 3300005547 Bacteria 9380
149 Ga0070665_100244531 3300005548 Bacteria 1795
150 Ga0070704_100002335 3300005549 Bacteria 10635
151 Ga0070704_100002836 3300005549 Bacteria 9819
152 Ga0070704_100006569 3300005549 Bacteria 6858
153 Ga0070704_100039281 3300005549 Bacteria 3248
154 Ga0068855_100015755 3300005563 Bacteria 9093
155 Ga0070664_100024583 3300005564 Bacteria 4985
156 Ga0070664_100037892 3300005564 Bacteria 4055
157 Ga0070664_100079318 3300005564 Bacteria 2826
158 Ga0068857_100008305 3300005577 Bacteria 8971
159 Ga0068857_100043792 3300005577 Bacteria 3970
160 Ga0068854_100003868 3300005578 Bacteria 9383
161 Ga0068854_100015449 3300005578 Bacteria 5057
162 Ga0068854_100063690 3300005578 Bacteria 2677
163 Ga0068854_100072375 3300005578 Bacteria 2524
164 Ga0068856_100003821 3300005614 Bacteria 15095
165 Ga0068856_100058666 3300005614 Bacteria 3801
166 Ga0070702_100000497 3300005615 Bacteria 14109
167 Ga0070702_100006109 3300005615 Bacteria 5676
168 Ga0070702_100084461 3300005615 Bacteria 1909
169 Ga0068852_100001222 3300005616 Bacteria 17091
170 Ga0068852_100063725 3300005616 Bacteria 3210
171 Ga0068859_100021148 3300005617 Bacteria 6529
172 Ga0068859_100023550 3300005617 Bacteria 6179
173 Ga0068859_100025814 3300005617 Bacteria 5895
174 Ga0068859_100034357 3300005617 Bacteria 5089
175 Ga0068859_100038671 3300005617 Bacteria 4786
176 Ga0068864_100001074 3300005618 Bacteria 22938
177 Ga0068864_100006339 3300005618 Bacteria 9703
178 Ga0068864_100012258 3300005618 Bacteria 7084
179 Ga0068864_100042649 3300005618 Bacteria 3883
180 Ga0068864_100048003 3300005618 Bacteria 3670
181 Ga0068864_100157672 3300005618 Bacteria 2061
182 Ga0068866_10005659 3300005718 Bacteria 5176
183 Ga0068866_10006999 3300005718 Bacteria 4713
184 Ga0068866_10068047 3300005718 Bacteria 1871
185 Ga0068861_100001328 3300005719 Bacteria 15509
186 Ga0068861_100016726 3300005719 Bacteria 5195
187 Ga0068861_100017632 3300005719 Bacteria 5074
188 Ga0068870_10000051 3300005840 Bacteria 36782
189 Ga0068870_10015842 3300005840 Bacteria 3587
190 Ga0068863_100008364 3300005841 Bacteria 10106
191 Ga0068863_100013387 3300005841 Bacteria 7909
192 Ga0068863_100026590 3300005841 Bacteria 5518
193 Ga0068863_100075045 3300005841 Bacteria 3199
194 Ga0068858_100005147 3300005842 Bacteria 12813
195 Ga0068858_100006251 3300005842 Bacteria 11604
196 Ga0068858_100034414 3300005842 Bacteria 4699
197 Ga0068858_100092885 3300005842 Bacteria 2809
198 Ga0068860_100001825 3300005843 Bacteria 22684
199 Ga0068860_100008760 3300005843 Bacteria 10078
200 Ga0068860_100010661 3300005843 Bacteria 9077
201 Ga0068860_100023546 3300005843 Bacteria 5951
202 Ga0068860_100104445 3300005843 Bacteria 2705
203 Ga0068860_100144787 3300005843 Bacteria 2286
204 Ga0068862_100001949 3300005844 Bacteria 18707
205 Ga0068862_100016670 3300005844 Bacteria 6117
206 Ga0068862_100039768 3300005844 Bacteria 3996
207 Ga0081455_10000081 3300005937 Bacteria 103752
208 Ga0081455_10002198 3300005937 Bacteria 23233
209 Ga0081538_10059304 3300005981 Bacteria 2211
210 Ga0081538_10081004 3300005981 Bacteria 1729
211 Ga0081540_1000007 3300005983 Bacteria 205328
212 Ga0081540_1004024 3300005983 Bacteria 11383
213 Ga0075365_10126900 3300006038 Bacteria 1763
214 Ga0075368_10005879 3300006042 Bacteria 4248
215 Ga0075368_10014120 3300006042 Bacteria 2945
216 Ga0070715_10000551 3300006163 Bacteria 9852
217 Ga0070716_100001287 3300006173 Bacteria 11081
218 Ga0070712_100004737 3300006175 Bacteria 8411
219 Ga0075367_10018956 3300006178 Bacteria 3806
220 Ga0075427_10000603 3300006194 Bacteria 4197
221 Ga0075366_10012326 3300006195 Bacteria 4847
222 Ga0097621_100001496 3300006237 Bacteria 16030
223 Ga0075370_10042438 3300006353 Bacteria 2570
224 Ga0068871_100003134 3300006358 Bacteria 11345
225 Ga0068871_100023904 3300006358 Bacteria 4735
226 Ga0068871_100065268 3300006358 Bacteria 2981
227 Ga0068871_100081876 3300006358 Bacteria 2675
228 Ga0068871_100251808 3300006358 Bacteria 1539
229 Ga0075428_100000740 3300006844 Bacteria 33927
230 Ga0075428_100024539 3300006844 Bacteria 6672
231 Ga0075430_100006097 3300006846 Bacteria 10161
232 Ga0075430_100013350 3300006846 Bacteria 7000
233 Ga0075430_100016809 3300006846 Bacteria 6231
234 Ga0075431_100000870 3300006847 Bacteria 26533
235 Ga0075431_100001076 3300006847 Bacteria 24422
236 Ga0075431_100007719 3300006847 Bacteria 10714
237 Ga0075431_100042948 3300006847 Bacteria 4664
238 Ga0075431_100149874 3300006847 Bacteria 2402
239 Ga0075431_100195337 3300006847 Bacteria 2072
240 Ga0075433_10000012 3300006852 Bacteria 71065
241 Ga0075433_10025668 3300006852 Bacteria 4983
242 Ga0075434_100003201 3300006871 Bacteria 14596
243 Ga0075434_100007032 3300006871 Bacteria 10380
244 Ga0075434_100008056 3300006871 Bacteria 9773
245 Ga0075434_100012519 3300006871 Bacteria 8046
246 Ga0075434_100054628 3300006871 Bacteria 3967
247 Ga0075429_100000098 3300006880 Bacteria 47888
248 Ga0075429_100004032 3300006880 Bacteria 12577
249 Ga0068865_100003854 3300006881 Bacteria 8992
250 Ga0068865_100016325 3300006881 Bacteria 4750
251 Ga0097620_100021146 3300006931 Bacteria 6529
252 Ga0097620_100023550 3300006931 Bacteria 6179
253 Ga0097620_100025814 3300006931 Bacteria 5895
254 Ga0097620_100034355 3300006931 Bacteria 5089
255 Ga0097620_100038673 3300006931 Bacteria 4786
256 Ga0075435_100028671 3300007076 Bacteria 4367
257 Ga0075435_100069072 3300007076 Bacteria 2880
258 Ga0105250_10040014 3300009092 Bacteria 1880
259 Ga0111539_10000757 3300009094 Bacteria 42016
260 Ga0111539_10001671 3300009094 Bacteria 29561
261 Ga0111539_10005127 3300009094 Bacteria 16990
262 Ga0111539_10008480 3300009094 Bacteria 13063
263 Ga0111539_10051044 3300009094 Bacteria 4927
264 Ga0111539_10100128 3300009094 Bacteria 3403
265 Ga0111539_10150020 3300009094 Bacteria 2729
266 Ga0105245_10002488 3300009098 Bacteria 16638
267 Ga0105245_10050094 3300009098 Bacteria 3741
268 Ga0105245_10182552 3300009098 Bacteria 2005
269 Ga0105247_10006103 3300009101 Bacteria 7490
270 Ga0105247_10008404 3300009101 Bacteria 6293
271 Ga0105247_10016894 3300009101 Bacteria 4375
272 Ga0105247_10036684 3300009101 Bacteria 2988
273 Ga0114129_10000025 3300009147 Bacteria 116480
274 Ga0114129_10008949 3300009147 Bacteria 14268
275 Ga0114129_10016369 3300009147 Bacteria 10556
276 Ga0114129_10019966 3300009147 Bacteria 9538
277 Ga0114129_10023567 3300009147 Bacteria 8725
278 Ga0114129_10050640 3300009147 Bacteria 5833
279 Ga0114129_10233598 3300009147 Bacteria 2476
280 Ga0105243_10003214 3300009148 Bacteria 13370
281 Ga0105243_10009303 3300009148 Bacteria 7494
282 Ga0105243_10031611 3300009148 Bacteria 4081
283 Ga0105241_10004876 3300009174 Bacteria 9894
284 Ga0105241_10005826 3300009174 Bacteria 9097
285 Ga0105241_10065776 3300009174 Bacteria 2802
286 Ga0105242_10002016 3300009176 Bacteria 15990
287 Ga0105242_10003519 3300009176 Bacteria 12173
288 Ga0105242_10041795 3300009176 Bacteria 3699
289 Ga0105242_10069916 3300009176 Bacteria 2909
290 Ga0105242_10108685 3300009176 Bacteria 2361
291 Ga0105248_10003871 3300009177 Bacteria 16548
292 Ga0105248_10099691 3300009177 Bacteria 3273
293 Ga0105248_10315006 3300009177 Bacteria 1762
294 Ga0105237_10006016 3300009545 Bacteria 13574
295 Ga0105237_10043192 3300009545 Bacteria 4542
296 Ga0105237_10078801 3300009545 Bacteria 3284
297 Ga0105237_10095030 3300009545 Bacteria 2970
298 Ga0105238_10054187 3300009551 Bacteria 4029
299 Ga0105238_10054673 3300009551 Bacteria 4008
300 Ga0105249_10001193 3300009553 Bacteria 22912
301 Ga0105249_10001979 3300009553 Bacteria 17784
302 Ga0105249_10108889 3300009553 Bacteria 2616
303 Ga0105239_10027649 3300010375 Bacteria 6241
304 Ga0105239_10035856 3300010375 Bacteria 5446
305 Ga0105239_10038572 3300010375 Bacteria 5236
306 Ga0105239_10041876 3300010375 Bacteria 5019
307 Ga0105246_10000231 3300011119 Bacteria 28580
308 Ga0105246_10015760 3300011119 Bacteria 4778
309 Ga0105246_10117462 3300011119 Bacteria 1965
310 Ga0157373_10010248 3300013100 Bacteria 6904
311 Ga0157373_10102676 3300013100 Bacteria 2012
312 Ga0157373_10111698 3300013100 Bacteria 1921
313 Ga0157371_10025479 3300013102 Bacteria 4310
314 Ga0157370_10150497 3300013104 Bacteria 2166
315 Ga0157374_10003239 3300013296 Bacteria 13672
316 Ga0157374_10013309 3300013296 Bacteria 7178
317 Ga0157374_10017421 3300013296 Bacteria 6324
318 Ga0157374_10031696 3300013296 Bacteria 4807
319 Ga0157378_10004453 3300013297 Bacteria 12317
320 Ga0157378_10010612 3300013297 Bacteria 8051
321 Ga0157378_10020673 3300013297 Bacteria 5790
322 Ga0157378_10021915 3300013297 Bacteria 5619
323 Ga0163162_10006149 3300013306 Bacteria 11621
324 Ga0163162_10020738 3300013306 Bacteria 6461
325 Ga0163162_10026579 3300013306 Bacteria 5722
326 Ga0157372_10025465 3300013307 Bacteria 6433
327 Ga0157372_10121031 3300013307 Bacteria 3006
328 Ga0157375_10006518 3300013308 Bacteria 10160
329 Ga0157375_10033972 3300013308 Bacteria 4853
330 Ga0157375_10053687 3300013308 Bacteria 3967
331 Ga0157375_10100999 3300013308 Bacteria 2966
332 Ga0157375_10119222 3300013308 Bacteria 2746
333 Ga0157375_10237394 3300013308 Bacteria 1982
334 Ga0163163_10001320 3300014325 Bacteria 20935
335 Ga0163163_10015790 3300014325 Bacteria 6993
336 Ga0163163_10051326 3300014325 Bacteria 4067
337 Ga0163163_10093775 3300014325 Bacteria 3019
338 Ga0163163_10168581 3300014325 Bacteria 2236
339 Ga0157380_10002744 3300014326 Bacteria 11948
340 Ga0157380_10065721 3300014326 Bacteria 2916
341 Ga0157380_10195500 3300014326 Bacteria 1790
342 Ga0157377_10000164 3300014745 Bacteria 39592
343 Ga0157379_10020078 3300014968 Bacteria 5905
344 Ga0157379_10030909 3300014968 Bacteria 4770
345 Ga0157379_10061490 3300014968 Bacteria 3358
346 Ga0157379_10064966 3300014968 Bacteria 3261
347 Ga0157376_10002102 3300014969 Bacteria 13394
348 Ga0157376_10036456 3300014969 Bacteria 3984
349 Ga0157376_10036479 3300014969 Bacteria 3983
350 Ga0157376_10088277 3300014969 Bacteria 2678
351 Ga0157376_10204657 3300014969 Bacteria 1819
352 Ga0163161_10002837 3300017792 Bacteria 12295
353 Ga0163161_10114468 3300017792 Bacteria 2020
354 Ga0163161_10131060 3300017792 Bacteria 1891
355 Ga0213876_10025328 3300021384 Bacteria 3130
356 Ga0207666_1000051 3300025271 Bacteria 21813
357 Ga0209758_1000125 3300025297 Bacteria 189869
358 Ga0207697_10000662 3300025315 Bacteria 19563
359 Ga0207653_10000546 3300025885 Bacteria 13918
360 Ga0207653_10001467 3300025885 Bacteria 7655
361 Ga0207682_10000072 3300025893 Bacteria 44659
362 Ga0207692_10002147 3300025898 Bacteria 7536
363 Ga0207642_10001909 3300025899 Bacteria 6431
364 Ga0207642_10039428 3300025899 Bacteria 2052
365 Ga0207710_10000558 3300025900 Bacteria 22251
366 Ga0207710_10004313 3300025900 Bacteria 6228
367 Ga0207710_10035227 3300025900 Bacteria 2202
368 Ga0207688_10000229 3300025901 Bacteria 25389
369 Ga0207688_10000998 3300025901 Bacteria 14427
370 Ga0207688_10004677 3300025901 Bacteria 7461
371 Ga0207680_10001283 3300025903 Bacteria 11893
372 Ga0207680_10092650 3300025903 Bacteria 1925
373 Ga0207647_10003353 3300025904 Bacteria 12014
374 Ga0207647_10010679 3300025904 Bacteria 6473
375 Ga0207647_10011089 3300025904 Bacteria 6334
376 Ga0207685_10001607 3300025905 Bacteria 4832
377 Ga0207685_10003975 3300025905 Bacteria 3682
378 Ga0207699_10002080 3300025906 Bacteria 9455
379 Ga0207699_10015546 3300025906 Bacteria 3956
380 Ga0207645_10000966 3300025907 Bacteria 23780
381 Ga0207645_10007388 3300025907 Bacteria 7770
382 Ga0207645_10023155 3300025907 Bacteria 4037
383 Ga0207645_10059737 3300025907 Bacteria 2435
384 Ga0207643_10000004 3300025908 Bacteria 187006
385 Ga0207643_10000794 3300025908 Bacteria 19261
386 Ga0207643_10004896 3300025908 Bacteria 7167
387 Ga0207643_10031046 3300025908 Bacteria 2977
388 Ga0207643_10065728 3300025908 Bacteria 2078
389 Ga0207654_10001472 3300025911 Bacteria 12448
390 Ga0207654_10007425 3300025911 Bacteria 5521
391 Ga0207707_10007028 3300025912 Bacteria 9814
392 Ga0207707_10065564 3300025912 Bacteria 3163
393 Ga0207671_10013159 3300025914 Bacteria 6607
394 Ga0207671_10020766 3300025914 Bacteria 4995
395 Ga0207671_10048003 3300025914 Bacteria 3159
396 Ga0207693_10006880 3300025915 Bacteria 9393
397 Ga0207693_10027450 3300025915 Bacteria 4501
398 Ga0207693_10161096 3300025915 Bacteria 1765
399 Ga0207663_10010875 3300025916 Bacteria 4861
400 Ga0207663_10017354 3300025916 Bacteria 4009
401 Ga0207660_10000648 3300025917 Bacteria 23454
402 Ga0207660_10092613 3300025917 Bacteria 2243
403 Ga0207662_10000317 3300025918 Bacteria 21877
404 Ga0207662_10000424 3300025918 Bacteria 18665
405 Ga0207662_10013378 3300025918 Bacteria 4589
406 Ga0207662_10023881 3300025918 Bacteria 3515
407 Ga0207662_10032770 3300025918 Bacteria 3026
408 Ga0207662_10064039 3300025918 Bacteria 2211
409 Ga0207662_10091114 3300025918 Bacteria 1875
410 Ga0207657_10002047 3300025919 Bacteria 21819
411 Ga0207657_10028849 3300025919 Bacteria 5056
412 Ga0207649_10000262 3300025920 Bacteria 41689
413 Ga0207649_10090257 3300025920 Bacteria 2005
414 Ga0207652_10000911 3300025921 Bacteria 27891
415 Ga0207652_10067950 3300025921 Bacteria 3091
416 Ga0207681_10010634 3300025923 Bacteria 5643
417 Ga0207694_10024208 3300025924 Bacteria 4609
418 Ga0207650_10013694 3300025925 Bacteria 5623
419 Ga0207650_10019548 3300025925 Bacteria 4762
420 Ga0207659_10001684 3300025926 Bacteria 13118
421 Ga0207659_10012218 3300025926 Bacteria 5451
422 Ga0207659_10024969 3300025926 Bacteria 4011
423 Ga0207687_10001501 3300025927 Bacteria 15981
424 Ga0207687_10006389 3300025927 Bacteria 7789
425 Ga0207687_10017936 3300025927 Bacteria 4670
426 Ga0207700_10001264 3300025928 Bacteria 14408
427 Ga0207700_10218925 3300025928 Bacteria 1613
428 Ga0207664_10002547 3300025929 Bacteria 12049
429 Ga0207664_10183287 3300025929 Bacteria 1798
430 Ga0207644_10000467 3300025931 Bacteria 26087
431 Ga0207644_10001961 3300025931 Bacteria 13297
432 Ga0207644_10015484 3300025931 Bacteria 5120
433 Ga0207644_10025194 3300025931 Bacteria 4089
434 Ga0207644_10092872 3300025931 Bacteria 2252
435 Ga0207690_10001228 3300025932 Bacteria 16182
436 Ga0207690_10009138 3300025932 Bacteria 5883
437 Ga0207690_10137132 3300025932 Bacteria 1798
438 Ga0207706_10001679 3300025933 Bacteria 21866
439 Ga0207706_10007881 3300025933 Bacteria 9829
440 Ga0207706_10018822 3300025933 Bacteria 6211
441 Ga0207706_10054074 3300025933 Bacteria 3543
442 Ga0207706_10203437 3300025933 Bacteria 1736
443 Ga0207686_10002040 3300025934 Bacteria 11131
444 Ga0207686_10009318 3300025934 Bacteria 5323
445 Ga0207686_10017951 3300025934 Bacteria 3998
446 Ga0207686_10099188 3300025934 Bacteria 1941
447 Ga0207709_10035318 3300025935 Bacteria 2954
448 Ga0207709_10102649 3300025935 Bacteria 1894
449 Ga0207670_10000377 3300025936 Bacteria 25697
450 Ga0207670_10002370 3300025936 Bacteria 9867
451 Ga0207670_10003054 3300025936 Bacteria 8831
452 Ga0207670_10037467 3300025936 Bacteria 3160
453 Ga0207670_10170453 3300025936 Bacteria 1632
454 Ga0207669_10001912 3300025937 Bacteria 8835
455 Ga0207669_10015439 3300025937 Bacteria 3851
456 Ga0207669_10017896 3300025937 Bacteria 3648
457 Ga0207669_10031185 3300025937 Bacteria 2975
458 Ga0207704_10002613 3300025938 Bacteria 8128
459 Ga0207704_10174333 3300025938 Bacteria 1546
460 Ga0207665_10001035 3300025939 Bacteria 18728
461 Ga0207665_10043619 3300025939 Bacteria 2999
462 Ga0207665_10056180 3300025939 Bacteria 2657
463 Ga0207665_10067562 3300025939 Bacteria 2434
464 Ga0207691_10002691 3300025940 Bacteria 17379
465 Ga0207691_10002874 3300025940 Bacteria 16780
466 Ga0207711_10003410 3300025941 Bacteria 13758
467 Ga0207711_10006776 3300025941 Bacteria 9628
468 Ga0207711_10022868 3300025941 Bacteria 5232
469 Ga0207711_10030274 3300025941 Bacteria 4565
470 Ga0207689_10000203 3300025942 Bacteria 52425
471 Ga0207689_10022711 3300025942 Bacteria 5270
472 Ga0207689_10044138 3300025942 Bacteria 3685
473 Ga0207689_10045948 3300025942 Bacteria 3610
474 Ga0207661_10002165 3300025944 Bacteria 13530
475 Ga0207661_10014563 3300025944 Bacteria 5769
476 Ga0207679_10000157 3300025945 Bacteria 56166
477 Ga0207679_10015012 3300025945 Bacteria 5106
478 Ga0207679_10158473 3300025945 Bacteria 1851
479 Ga0207667_10220437 3300025949 Bacteria 1943
480 Ga0207651_10008897 3300025960 Bacteria 5454
481 Ga0207712_10002224 3300025961 Bacteria 12622
482 Ga0207712_10003965 3300025961 Bacteria 9349
483 Ga0207712_10039070 3300025961 Bacteria 3250
484 Ga0207668_10017144 3300025972 Bacteria 4532
485 Ga0207668_10055993 3300025972 Bacteria 2744
486 Ga0207668_10109409 3300025972 Bacteria 2070
487 Ga0207640_10043680 3300025981 Bacteria 2866
488 Ga0207658_10005748 3300025986 Bacteria 8483
489 Ga0207658_10008052 3300025986 Bacteria 7181
490 Ga0207658_10048495 3300025986 Bacteria 3114
491 Ga0207658_10167123 3300025986 Bacteria 1808
492 Ga0207677_10001675 3300026023 Bacteria 11738
493 Ga0207677_10006260 3300026023 Bacteria 6510
494 Ga0207703_10001346 3300026035 Bacteria 22503
495 Ga0207703_10001852 3300026035 Bacteria 18819
496 Ga0207703_10032158 3300026035 Bacteria 4151
497 Ga0207639_10008211 3300026041 Bacteria 7147
498 Ga0207678_10001809 3300026067 Bacteria 19589
499 Ga0207678_10001884 3300026067 Bacteria 19130
500 Ga0207678_10011488 3300026067 Bacteria 7777
501 Ga0207678_10013053 3300026067 Bacteria 7289
502 Ga0207678_10034212 3300026067 Bacteria 4426
503 Ga0207678_10034731 3300026067 Bacteria 4391
504 Ga0207678_10041672 3300026067 Bacteria 3981
505 Ga0207708_10000784 3300026075 Bacteria 23952
506 Ga0207708_10001199 3300026075 Bacteria 19559
507 Ga0207708_10003067 3300026075 Bacteria 12308
508 Ga0207708_10004901 3300026075 Bacteria 9865
509 Ga0207708_10014093 3300026075 Bacteria 5974
510 Ga0207702_10003404 3300026078 Bacteria 14557
511 Ga0207702_10068697 3300026078 Bacteria 3045
512 Ga0207641_10006871 3300026088 Bacteria 9524
513 Ga0207641_10011257 3300026088 Bacteria 7337
514 Ga0207641_10041334 3300026088 Bacteria 3863
515 Ga0207648_10002073 3300026089 Bacteria 21861
516 Ga0207648_10002310 3300026089 Bacteria 20581
517 Ga0207648_10016984 3300026089 Bacteria 6632
518 Ga0207648_10027663 3300026089 Bacteria 5032
519 Ga0207676_10000990 3300026095 Bacteria 21882
520 Ga0207676_10002295 3300026095 Bacteria 13719
521 Ga0207676_10002940 3300026095 Bacteria 12143
522 Ga0207676_10048845 3300026095 Bacteria 3287
523 Ga0207676_10184700 3300026095 Bacteria 1829
524 Ga0207674_10000897 3300026116 Bacteria 38907
525 Ga0207674_10011740 3300026116 Bacteria 9828
526 Ga0207675_100001726 3300026118 Bacteria 21899
527 Ga0207675_100002371 3300026118 Bacteria 18651
528 Ga0207675_100005453 3300026118 Bacteria 12188
529 Ga0207683_10000824 3300026121 Bacteria 28453
530 Ga0207683_10001176 3300026121 Bacteria 23694
531 Ga0207683_10014019 3300026121 Bacteria 6834
532 Ga0207683_10018096 3300026121 Bacteria 6008
533 Ga0207683_10081706 3300026121 Bacteria 2869
534 Ga0207683_10185428 3300026121 Bacteria 1888
535 Ga0207698_10003743 3300026142 Bacteria 9193
536 Ga0207698_10024746 3300026142 Bacteria 4219
537 Ga0210002_1003362 3300027617 Bacteria 2352
538 Ga0209966_1000247 3300027695 Bacteria 19895
539 Ga0209998_10000255 3300027717 Bacteria 17497
540 Ga0209998_10001128 3300027717 Bacteria 6625
541 Ga0209974_10001489 3300027876 Bacteria 8511
542 Ga0207428_10000137 3300027907 Bacteria 98535
543 Ga0207428_10000792 3300027907 Bacteria 35769
544 Ga0207428_10003106 3300027907 Bacteria 16320
545 Ga0207428_10004572 3300027907 Bacteria 13115
546 Ga0207428_10033074 3300027907 Bacteria 4249
547 Ga0207428_10072105 3300027907 Bacteria 2712
548 Ga0268266_10005095 3300028379 Bacteria 12383
549 Ga0268266_10023244 3300028379 Bacteria 5278
550 Ga0268266_10046625 3300028379 Bacteria 3710
551 Ga0268265_10012344 3300028380 Bacteria 5788
552 Ga0268265_10029470 3300028380 Bacteria 3939
553 Ga0268265_10085418 3300028380 Bacteria 2504
554 Ga0268264_10002039 3300028381 Bacteria 18053
555 Ga0268264_10016623 3300028381 Bacteria 6024
556 Ga0268264_10062447 3300028381 Bacteria 3128
557 Ga0268264_10081157 3300028381 Bacteria 2771
558 Ga0265330_10047685 3300031235 Bacteria 1885
559 Ga0265325_10000073 3300031241 Bacteria 70109
560 Ga0265325_10000234 3300031241 Bacteria 39472
561 Ga0265325_10002177 3300031241 Bacteria 13332
562 Ga0265325_10004094 3300031241 Bacteria 9289
563 Ga0265340_10021850 3300031247 Bacteria 3277
564 Ga0265339_10001513 3300031249 Bacteria 17175
565 Ga0265316_10024489 3300031344 Bacteria 5056
566 Ga0265313_10000326 3300031595 Bacteria 51836
567 Ga0265313_10008870 3300031595 Bacteria 6619
568 Ga0265313_10040748 3300031595 Bacteria 2293
569 Ga0373948_0000061 3300034817 Bacteria 11538
570 Ga0373958_0000048 3300034819 Bacteria 11955
571 Ga0373958_0001634 3300034819 Bacteria 3043
572 Ga0373926_0003985 3300035083 Bacteria 4827
573 Ga0373928_0000291 3300035084 Bacteria 9922
574 Ga0373928_0008797 3300035084 Bacteria 1965
575 Ga0373929_0000564 3300035085 Bacteria 7143
576 Ga0373929_0005244 3300035085 Bacteria 2331
577 Ga0373934_0020853 3300035086 Bacteria 2522
578 Ga0373940_0000023 3300035088 Bacteria 16767
579 Ga0373940_0010533 3300035088 Bacteria 2176
580 Ga0373940_0012296 3300035088 Bacteria 2049
581 Ga0373949_0001146 3300035090 Bacteria 7970
582 Ga0373951_0000876 3300035091 Bacteria 8125
583 Ga0373951_0005478 3300035091 Bacteria 2948
584 Ga0373923_0000851 3300035111 Bacteria 8076
585 Ga0373923_0003216 3300035111 Bacteria 5195
586 Ga0373936_0001660 3300035113 Bacteria 8158
587 Ga0373939_0000663 3300035114 Bacteria 8540
588 Ga0373939_0002651 3300035114 Bacteria 4201
589 Ga0373941_0000309 3300035115 Bacteria 9451
590 Ga0373945_0000277 3300035116 Bacteria 14473
591 Ga0373945_0001390 3300035116 Bacteria 7348
592 Ga0373953_0068438 3300035117 Bacteria 1461
593 Ga0373954_0005333 3300035118 Bacteria 5557
594 Ga0373954_0014688 3300035118 Bacteria 3493
595 Ga0373960_0001082 3300035121 Bacteria 5885
596 Ga0373960_0003571 3300035121 Bacteria 3527
597 Ga0373960_0003751 3300035121 Bacteria 3453
598 Ga0373943_0004971 3300035170 Bacteria 6002
599 Ga0373943_0005512 3300035170 Bacteria 5690
600 Ga0373943_0009916 3300035170 Bacteria 4268
601 Ga0373946_0001856 3300035171 Bacteria 7374
602 Ga0373946_0002330 3300035171 Bacteria 6718
603 Ga0373955_0002403 3300035172 Bacteria 8160
604 Ga0373942_0000081 3300035207 Bacteria 20661
605 Ga0373942_0003417 3300035207 Bacteria 3733
606 Ga0373942_0009249 3300035207 Bacteria 2304
607 Ga0373942_0016658 3300035207 Bacteria 1805
608 Ga0373961_0000743 3300035241 Bacteria 11267
609 Ga0373961_0002954 3300035241 Bacteria 4297
610 Ga0373961_0032726 3300035241 Bacteria 1460
611 Ga0373962_0000194 3300035242 Bacteria 12882
612 Ga0373924_0000490 3300035410 Bacteria 12118
613 Ga0373924_0004810 3300035410 Bacteria 4747
614 Ga0373931_0001008 3300035691 Bacteria 11924
615 Ga0373931_0001564 3300035691 Bacteria 9881
616 Ga0373931_0002975 3300035691 Bacteria 7569
617 Ga0373931_0007918 3300035691 Bacteria 5027
618 Ga0373931_0016578 3300035691 Bacteria 3629
619 Ga0373935_0000291 3300035692 Bacteria 24802
620 Ga0373935_0013547 3300035692 Bacteria 4922
621 Ga0373935_0057106 3300035692 Bacteria 2490
622 Ga0373927_0005343 3300035695 Bacteria 8880
623 Ga0373927_0009000 3300035695 Bacteria 6703
624 Ga0373927_0034546 3300035695 Bacteria 3289
625 Ga0373927_0051606 3300035695 Bacteria 2659
626 Ga0373927_0054373 3300035695 Bacteria 2590
627 Ga0373927_0055119 3300035695 Bacteria 2571
628 Ga0373933_0010185 3300035724 Bacteria 5149
629 Ga0373933_0012833 3300035724 Bacteria 4633
630 Ga0373947_0000424 3300035725 Bacteria 23999
631 Ga0373947_0005730 3300035725 Bacteria 7243
632 Ga0373947_0010154 3300035725 Bacteria 5407
633 Ga0373947_0041253 3300035725 Bacteria 2751
634 Ga0373947_0048954 3300035725 Bacteria 2537
635 Ga0373937_0000004 3300036401 Bacteria 212269
636 Ga0373937_0003680 3300036401 Bacteria 12949
637 Ga0373937_0005263 3300036401 Bacteria 11048
638 Ga0373937_0006030 3300036401 Bacteria 10436
639 Ga0373925_0000460 3300037068 Bacteria 41057
640 Ga0373925_0003391 3300037068 Bacteria 12354
641 Ga0373925_0017524 3300037068 Bacteria 5192
642 Ga0373925_0127647 3300037068 Bacteria 1980
643 Ga0436365_0349099 3300039437 Bacteria 3604
644 Ga0436365_1169665 3300039437 Bacteria 1720
645 Ga0439464_0005396 3300042439 Bacteria 3304
646 Ga0451576_0006650 3300045051 Bacteria 14107
647 Ga0495592_0000029 3300046454 Bacteria 131879
648 Ga0495592_0001215 3300046454 Bacteria 17883
649 Ga0495592_0005508 3300046454 Bacteria 9360
650 Ga0495592_0136552 3300046454 Bacteria 1710
651 Ga0495592_0149021 3300046454 Bacteria 1620
652 Ga0495590_0028653 3300046457 Bacteria 1953
653 Ga0495629_0000447 3300046459 Bacteria 34326
654 Ga0495629_0016571 3300046459 Bacteria 5290
655 Ga0495629_0016805 3300046459 Bacteria 5251
656 Ga0495638_0028434 3300046460 Bacteria 3611
657 Ga0495641_0001697 3300046461 Bacteria 18404
658 Ga0495641_0015734 3300046461 Bacteria 4019
659 Ga0495641_0027911 3300046461 Bacteria 2737
660 Ga0495651_0002424 3300046462 Bacteria 14396
661 Ga0495651_0038986 3300046462 Bacteria 3699
662 Ga0495653_0000012 3300046463 Bacteria 266880
663 Ga0495653_0003231 3300046463 Bacteria 13066
664 Ga0495653_0006931 3300046463 Bacteria 9309
665 Ga0495653_0078354 3300046463 Bacteria 2451
666 Ga0495580_0006747 3300046472 Bacteria 9313
667 Ga0495580_0085877 3300046472 Bacteria 2191
668 Ga0495582_0007072 3300046473 Bacteria 6234
669 Ga0495582_0010997 3300046473 Bacteria 4982
670 Ga0495582_0013202 3300046473 Bacteria 4545
671 Ga0495639_0006165 3300046475 Bacteria 5148
672 Ga0495662_0003904 3300046476 Bacteria 7520
673 Ga0495662_0010406 3300046476 Bacteria 4557
674 Ga0495664_0000004 3300046477 Bacteria 489411
675 Ga0495664_0009959 3300046477 Bacteria 5332
676 Ga0495664_0105171 3300046477 Bacteria 1702
677 Ga0495584_0002735 3300046491 Bacteria 9877
678 Ga0495584_0056557 3300046491 Bacteria 1974
679 Ga0495585_0003199 3300046492 Bacteria 11181
680 Ga0495585_0073720 3300046492 Bacteria 1858
681 Ga0495594_0013045 3300046499 Bacteria 4333
682 Ga0495594_0021869 3300046499 Bacteria 3416
683 Ga0495607_0029184 3300046501 Bacteria 3397
684 Ga0495608_0000017 3300046511 Bacteria 192929
685 Ga0495618_0000006 3300046514 Bacteria 229906
686 Ga0495628_0000001 3300046516 Bacteria 917742
687 Ga0495628_0009640 3300046516 Bacteria 8239
688 Ga0495628_0019168 3300046516 Bacteria 5658
689 Ga0495628_0035835 3300046516 Bacteria 3985
690 Ga0495630_0008370 3300046517 Bacteria 7424
691 Ga0495637_0042998 3300046520 Bacteria 1931
692 Ga0495644_0002426 3300046523 Bacteria 7434
693 Ga0495666_0001305 3300046526 Bacteria 12056
694 Ga0495652_0000002 3300046529 Bacteria 946606
695 Ga0495652_0018154 3300046529 Bacteria 6278
696 Ga0495665_0004009 3300046531 Bacteria 7939
697 Ga0495665_0025407 3300046531 Bacteria 3182
698 Ga0495640_0000001 3300046533 Bacteria 853827
699 Ga0495640_0017355 3300046533 Bacteria 5366
700 Ga0495586_0007089 3300046535 Bacteria 5973
701 Ga0495587_0000008 3300046536 Bacteria 271097
702 Ga0495587_0001490 3300046536 Bacteria 15605
703 Ga0495598_0001556 3300046537 Bacteria 4597
704 Ga0495645_0000002 3300046543 Bacteria 651644
705 Ga0495645_0000954 3300046543 Bacteria 19779
706 Ga0495645_0050356 3300046543 Bacteria 3032
707 Ga0495633_0014899 3300046558 Bacteria 4044
708 Ga0495667_0000029 3300046559 Bacteria 151568
709 Ga0495667_0014263 3300046559 Bacteria 5367
710 Ga0495667_0043731 3300046559 Bacteria 2967
711 Ga0495656_0000941 3300046615 Bacteria 9423
712 Ga0495634_0006280 3300046642 Bacteria 9051
713 Ga0495634_0035463 3300046642 Bacteria 3416
714 Ga0495634_0058157 3300046642 Bacteria 2578
715 Ga0495611_0005829 3300046648 Bacteria 5256
716 Ga0495635_0000002 3300046663 Bacteria 490490
717 Ga0495635_0013015 3300046663 Bacteria 5824
718 Ga0495588_0000318 3300046674 Bacteria 32296
719 Ga0495588_0012717 3300046674 Bacteria 3987
720 Ga0495588_0029685 3300046674 Bacteria 2745
721 Ga0495657_0000459 3300046675 Bacteria 38116
722 Ga0495657_0086718 3300046675 Bacteria 2016
723 Ga0495599_0000104 3300046678 Bacteria 59442
724 Ga0495599_0001047 3300046678 Bacteria 15552
725 Ga0495599_0034637 3300046678 Bacteria 3171
726 Ga0495623_0000691 3300046679 Bacteria 22400
727 Ga0495623_0003897 3300046679 Bacteria 9840
728 Ga0495646_0000064 3300046680 Bacteria 50992
729 Ga0495646_0005442 3300046680 Bacteria 8047
730 Ga0495646_0006507 3300046680 Bacteria 7412
731 Ga0495647_0001576 3300046681 Bacteria 7039
732 Ga0495658_0007929 3300046683 Bacteria 5258
733 Ga0495658_0008212 3300046683 Bacteria 5170
734 Ga0495658_0008346 3300046683 Bacteria 5130
735 Ga0495658_0035592 3300046683 Bacteria 2741
736 Ga0495613_0000793 3300046689 Bacteria 24573
737 Ga0495613_0047786 3300046689 Bacteria 3161
738 Ga0495624_0023831 3300046690 Bacteria 4032
739 Ga0495600_0000010 3300046809 Bacteria 143675
740 Ga0495600_0032708 3300046809 Bacteria 3375
741 Ga0495581_0002305 3300047315 Bacteria 10746
742 Ga0495604_0000009 3300047317 Bacteria 326341
743 Ga0495604_0003660 3300047317 Bacteria 12247
744 Ga0495604_0017295 3300047317 Bacteria 5770
745 Ga0495604_0017691 3300047317 Bacteria 5705
746 Ga0495674_0000002 3300047319 Bacteria 642785
747 Ga0495674_0042474 3300047319 Bacteria 4055
748 Ga0495674_0080853 3300047319 Bacteria 2788
749 Ga0495676_0084271 3300047321 Bacteria 2398
750 Ga0495676_0178846 3300047321 Bacteria 1488
751 Ga0495680_0000752 3300047322 Bacteria 36296
752 Ga0495680_0014315 3300047322 Bacteria 6877
753 Ga0495680_0014551 3300047322 Bacteria 6811
754 Ga0495680_0022273 3300047322 Bacteria 5284
755 Ga0495680_0028687 3300047322 Bacteria 4562
756 Ga0495675_0000028 3300047444 Bacteria 105848
757 Ga0495675_0026696 3300047444 Bacteria 3682
758 Ga0495684_0000006 3300047471 Bacteria 247568
759 Ga0495684_0003934 3300047471 Bacteria 11578
760 Ga0495593_0008360 3300047673 Bacteria 6022
761 Ga0495602_0000005 3300048088 Bacteria 325957
762 Ga0495602_0000776 3300048088 Bacteria 30394
763 Ga0495602_0002995 3300048088 Bacteria 17317
764 Ga0495614_0004539 3300048089 Bacteria 6257
765 Ga0496100_0002107 3300048903 Bacteria 10021
766 Ga0496100_0008177 3300048903 Bacteria 5824
767 Ga0496100_0008677 3300048903 Bacteria 5676
768 Ga0496100_0010419 3300048903 Bacteria 5260
769 Ga0496100_0057614 3300048903 Bacteria 2545
770 Ga0496101_0002976 3300048904 Bacteria 10437
771 Ga0496101_0005170 3300048904 Bacteria 8300
772 Ga0496101_0005327 3300048904 Bacteria 8192
773 Ga0496101_0028769 3300048904 Bacteria 3882
774 Ga0496101_0045004 3300048904 Bacteria 3159
775 Ga0496101_0099036 3300048904 Bacteria 2179
776 Ga0496102_0008464 3300048905 Bacteria 8820
777 Ga0496102_0009880 3300048905 Bacteria 8205
778 Ga0496102_0017733 3300048905 Bacteria 6241
779 Ga0496102_0024215 3300048905 Bacteria 5395
780 Ga0496102_0029685 3300048905 Bacteria 4893
781 Ga0496102_0097214 3300048905 Bacteria 2731
782 Ga0496103_0001696 3300048906 Bacteria 14405
783 Ga0496103_0005658 3300048906 Bacteria 7469
784 Ga0496103_0005922 3300048906 Bacteria 7307
785 Ga0496103_0011431 3300048906 Bacteria 5262
786 Ga0496103_0036194 3300048906 Bacteria 3022
787 Ga0496103_0076217 3300048906 Bacteria 2104
788 Ga0496104_0000092 3300048907 Bacteria 87232
789 Ga0496104_0004402 3300048907 Bacteria 12265
790 Ga0496104_0013405 3300048907 Bacteria 7385
791 Ga0496104_0033638 3300048907 Bacteria 4777
792 Ga0496104_0069565 3300048907 Bacteria 3345
793 Ga0496104_0112817 3300048907 Bacteria 2607
794 Ga0496104_0269510 3300048907 Bacteria 1615
795 Ga0496105_0001436 3300048908 Bacteria 16761
796 Ga0496105_0001736 3300048908 Bacteria 15574
797 Ga0496105_0002164 3300048908 Bacteria 14224
798 Ga0496105_0002208 3300048908 Bacteria 14097
799 Ga0496105_0018426 3300048908 Bacteria 5611
800 Ga0496105_0125052 3300048908 Bacteria 2120
801 Ga0496105_0125239 3300048908 Bacteria 2118
802 Ga0496106_0003134 3300048909 Bacteria 12340
803 Ga0496106_0006593 3300048909 Bacteria 8594
804 Ga0496106_0019784 3300048909 Bacteria 4992
805 Ga0496106_0026317 3300048909 Bacteria 4330
806 Ga0496106_0043487 3300048909 Bacteria 3370
807 Ga0496106_0149234 3300048909 Bacteria 1843
808 Ga0496107_0000809 3300048910 Bacteria 18171
809 Ga0496107_0003490 3300048910 Bacteria 10516
810 Ga0496107_0007194 3300048910 Bacteria 7667
811 Ga0496107_0012097 3300048910 Bacteria 6018
812 Ga0496107_0013417 3300048910 Bacteria 5726
813 Ga0496107_0026710 3300048910 Bacteria 4095
814 Ga0496107_0029822 3300048910 Bacteria 3884
815 Ga0496108_0003371 3300048911 Bacteria 12827
816 Ga0496108_0005285 3300048911 Bacteria 10421
817 Ga0496108_0012368 3300048911 Bacteria 6944
818 Ga0496108_0014164 3300048911 Bacteria 6506
819 Ga0496108_0082309 3300048911 Bacteria 2729
820 Ga0496108_0090770 3300048911 Bacteria 2597
821 Ga0496108_0097512 3300048911 Bacteria 2505
822 Ga0496109_0000543 3300048912 Bacteria 31945
823 Ga0496109_0016420 3300048912 Bacteria 6472
824 Ga0496109_0026427 3300048912 Bacteria 5177
825 Ga0496109_0031491 3300048912 Bacteria 4759
826 Ga0496109_0118773 3300048912 Bacteria 2461
827 Ga0496109_0200601 3300048912 Bacteria 1875
828 Ga0496110_0004426 3300048913 Bacteria 10885
829 Ga0496110_0015744 3300048913 Bacteria 6301
830 Ga0496110_0053918 3300048913 Bacteria 3536
831 Ga0496110_0112154 3300048913 Bacteria 2451
832 Ga0496110_0190509 3300048913 Bacteria 1862
833 Ga0496111_0000388 3300048914 Bacteria 21996
834 Ga0496111_0002814 3300048914 Bacteria 10601
835 Ga0496111_0010441 3300048914 Bacteria 6231
836 Ga0496111_0012071 3300048914 Bacteria 5841
837 Ga0496111_0028753 3300048914 Bacteria 3940
838 Ga0496112_0003072 3300048915 Bacteria 13667
839 Ga0496112_0009140 3300048915 Bacteria 8904
840 Ga0496112_0014688 3300048915 Bacteria 7278
841 Ga0496112_0061370 3300048915 Bacteria 3705
842 Ga0496112_0195521 3300048915 Bacteria 1983
843 Ga0496113_0000043 3300048916 Bacteria 52544
844 Ga0496113_0003436 3300048916 Bacteria 9480
845 Ga0496113_0004954 3300048916 Bacteria 8248
846 Ga0496113_0015314 3300048916 Bacteria 5266
847 Ga0496113_0047129 3300048916 Bacteria 3202
848 Ga0496113_0133408 3300048916 Bacteria 1950
849 Ga0496113_0189022 3300048916 Bacteria 1634
850 Ga0496114_0003641 3300048917 Bacteria 11847
851 Ga0496114_0013464 3300048917 Bacteria 6558
852 Ga0496114_0023885 3300048917 Bacteria 4988
853 Ga0496114_0040439 3300048917 Bacteria 3860
854 Ga0496114_0052998 3300048917 Bacteria 3381
855 Ga0496115_0009341 3300048918 Bacteria 7286
856 Ga0496115_0018321 3300048918 Bacteria 5373
857 Ga0496115_0046900 3300048918 Bacteria 3455
858 Ga0496115_0054203 3300048918 Bacteria 3220
859 Ga0496115_0109009 3300048918 Bacteria 2273
860 Ga0501031_0022932 3300049568 Bacteria 4071
861 Ga0501032_0028467 3300049569 Bacteria 3839
862 Ga0501032_0049939 3300049569 Bacteria 2821
863 Ga0501033_0011567 3300049570 Bacteria 6751
864 Ga0501033_0017357 3300049570 Bacteria 5439
865 Ga0501033_0038589 3300049570 Bacteria 3569
866 Ga0501034_0006205 3300049571 Bacteria 12870
867 Ga0501034_0008624 3300049571 Bacteria 10756
868 Ga0501034_0018337 3300049571 Bacteria 7180
869 Ga0501034_0086671 3300049571 Bacteria 3132
870 Ga0501034_0105165 3300049571 Bacteria 2816
871 Ga0501034_0157288 3300049571 Bacteria 2246
872 Ga0501034_0304648 3300049571 Bacteria 1529
873 Ga0501036_0000372 3300049572 Bacteria 31588
874 Ga0501036_0017605 3300049572 Bacteria 5977
875 Ga0501036_0025867 3300049572 Bacteria 4952
876 Ga0501036_0055564 3300049572 Bacteria 3354
877 Ga0501037_0008325 3300049573 Bacteria 7601
878 Ga0501037_0020689 3300049573 Bacteria 4858
879 Ga0501037_0020812 3300049573 Bacteria 4843
880 Ga0501037_0026077 3300049573 Bacteria 4319
881 Ga0501038_0017530 3300049574 Bacteria 6472
882 Ga0501038_0026512 3300049574 Bacteria 5161
883 Ga0501038_0031263 3300049574 Bacteria 4705
884 Ga0501038_0062127 3300049574 Bacteria 3192
885 Ga0501038_0096680 3300049574 Bacteria 2464
886 Ga0501039_0015326 3300049575 Bacteria 5867
887 Ga0501043_0005267 3300049579 Bacteria 10454
888 Ga0501043_0023206 3300049579 Bacteria 4866
889 Ga0501043_0030487 3300049579 Bacteria 4239
890 Ga0501046_0066195 3300049580 Bacteria 2817
891 Ga0501046_0066278 3300049580 Bacteria 2814
892 Ga0501047_0000164 3300049581 Bacteria 81200
893 Ga0501047_0025565 3300049581 Bacteria 5676
894 Ga0501047_0079486 3300049581 Bacteria 3153
895 Ga0501047_0087179 3300049581 Bacteria 2999
896 Ga0501047_0109023 3300049581 Bacteria 2651
897 Ga0501047_0110282 3300049581 Bacteria 2634
898 Ga0501048_0003459 3300049582 Bacteria 12003
899 Ga0501067_0006409 3300049583 Bacteria 6519
900 Ga0501069_0000561 3300049585 Bacteria 17113
901 Ga0501070_0003220 3300049586 Bacteria 14202
902 Ga0501070_0020311 3300049586 Bacteria 5572
903 Ga0501070_0020404 3300049586 Bacteria 5560
904 Ga0501070_0021489 3300049586 Bacteria 5414
905 Ga0501070_0022513 3300049586 Bacteria 5278
906 Ga0501070_0035382 3300049586 Bacteria 4173
907 Ga0501070_0044117 3300049586 Bacteria 3711
908 Ga0501070_0143033 3300049586 Bacteria 1975
909 Ga0501070_0162714 3300049586 Bacteria 1839
910 Ga0501071_0054311 3300049587 Bacteria 2891
911 Ga0501072_0065822 3300049588 Bacteria 2858
912 Ga0501072_0147428 3300049588 Bacteria 1876
913 Ga0501073_0026466 3300049589 Bacteria 4156
914 Ga0501074_0014496 3300049590 Bacteria 5735
915 Ga0501074_0016572 3300049590 Bacteria 5349
916 Ga0501074_0184462 3300049590 Bacteria 1488
917 Ga0501075_0044258 3300049591 Bacteria 3340
918 Ga0501076_0118405 3300049592 Bacteria 2144
919 Ga0501076_0167041 3300049592 Bacteria 1794
920 Ga0501077_0025278 3300049593 Bacteria 3772
921 Ga0501079_0004533 3300049741 Bacteria 10304
922 Ga0501079_0047540 3300049741 Bacteria 3310
923 Ga0501079_0047569 3300049741 Bacteria 3309
924 Ga0501079_0096901 3300049741 Bacteria 2287
925 Ga0501080_0000235 3300049742 Bacteria 41534
926 Ga0501080_0043320 3300049742 Bacteria 4191
927 Ga0501080_0048885 3300049742 Bacteria 3935
928 Ga0501081_0034408 3300049743 Bacteria 3447
929 Ga0501083_0016539 3300049744 Bacteria 5159
930 Ga0501083_0022677 3300049744 Bacteria 4356
931 Ga0501083_0066250 3300049744 Bacteria 2405
932 Ga0501035_0016521 3300049822 Bacteria 6805
933 Ga0501035_0046252 3300049822 Bacteria 3914
934 Ga0501044_0000707 3300049823 Bacteria 40284
935 Ga0501044_0004015 3300049823 Bacteria 16492
936 Ga0501044_0033812 3300049823 Bacteria 5368
937 Ga0501044_0043740 3300049823 Bacteria 4651
938 Ga0501044_0127556 3300049823 Bacteria 2540
939 Ga0501044_0144177 3300049823 Bacteria 2368
940 Ga0501044_0293820 3300049823 Bacteria 1556
941 Ga0501044_0310905 3300049823 Bacteria 1502
942 nmdc:mga0yw44_46679_c1 3300050492 Bacteria 2602
943 nmdc:mga0k408_5532_c1 3300050493 Bacteria 6726
944 nmdc:mga06z11_72629_c1 3300050494 Bacteria 1824
945 nmdc:mga05p37_143795_c1 3300050507 Bacteria 2921
946 nmdc:mga05p37_201_c1 3300050507 Bacteria 59705
947 nmdc:mga05p37_309031_c1 3300050507 Bacteria 1875
948 nmdc:mga05p37_44522_c1 3300050507 Bacteria 5460
949 nmdc:mga05p37_62368_c1 3300050507 Bacteria 4587
950 nmdc:mga05p37_6242_c1 3300050507 Bacteria 14032
951 nmdc:mga05p37_66_c1 3300050507 Bacteria 91764
952 nmdc:mga05p37_92206_c1 3300050507 Bacteria 3733
953 nmdc:mga09592_30035_c1 3300050508 Bacteria 4523
954 nmdc:mga09592_7876_c1 3300050508 Bacteria 8660
955 nmdc:mga0qj67_24563_c1 3300050509 Bacteria 4647
956 nmdc:mga0qj67_26699_c1 3300050509 Bacteria 4471
957 nmdc:mga0qj67_512_c1 3300050509 Bacteria 26543
958 nmdc:mga0qj67_7_c1 3300050509 Bacteria 146944
959 nmdc:mga06r32_177654_c1 3300050510 Bacteria 2114
960 nmdc:mga06r32_25746_c1 3300050510 Bacteria 3867
961 nmdc:mga06r32_451_c1 3300050510 Bacteria 34946
962 nmdc:mga06r32_7326_c1 3300050510 Bacteria 9931
963 nmdc:mga06r32_7911_c1 3300050510 Bacteria 9557
964 nmdc:mga08y16_1809_c1 3300050511 Bacteria 21689
965 nmdc:mga08y16_253276_c1 3300050511 Bacteria 1819
966 nmdc:mga08y16_31568_c1 3300050511 Bacteria 5571
967 nmdc:mga08y16_4145_c1 3300050511 Bacteria 15133
968 nmdc:mga08y16_48_c1 3300050511 Bacteria 111306
969 nmdc:mga08y16_56670_c1 3300050511 Bacteria 4095
970 nmdc:mga0n895_43_c1 3300050512 Bacteria 74924
971 nmdc:mga0n895_74467_c1 3300050512 Bacteria 3373
972 nmdc:mga0n895_78577_c1 3300050512 Bacteria 3284
973 nmdc:mga0n895_82465_c1 3300050512 Bacteria 3206
974 nmdc:mga0rr50_21285_c1 3300050513 Bacteria 4423
975 nmdc:mga0rr50_43928_c1 3300050513 Bacteria 3274
976 nmdc:mga0rr50_5412_c1 3300050513 Bacteria 7612
977 nmdc:mga0a205_13273_c1 3300050515 Bacteria 7662
978 nmdc:mga0a205_2982_c1 3300050515 Bacteria 15012
979 nmdc:mga0a205_3268_c1 3300050515 Bacteria 14416
980 Ga0495601_0000002 3300053077 Bacteria 528704
981 Ga0495601_0000107 3300053077 Bacteria 45730
982 Ga0495601_0005039 3300053077 Bacteria 7668
983 Ga0495601_0027688 3300053077 Bacteria 3505
984 Ga0495601_0035231 3300053077 Bacteria 3123
985 Ga0495601_0122728 3300053077 Bacteria 1688
986 Ga0495612_0000010 3300053078 Bacteria 227618
987 Ga0495612_0001623 3300053078 Bacteria 9246
988 Ga0495612_0002221 3300053078 Bacteria 7987
989 Ga0495612_0005028 3300053078 Bacteria 5475
990 Ga0495595_0000777 3300053084 Bacteria 12093
991 Ga0495595_0004037 3300053084 Bacteria 5874
992 Ga0495595_0010557 3300053084 Bacteria 3840
993 Ga0495595_0019908 3300053084 Bacteria 2915
994 Ga0495619_0000019 3300053085 Bacteria 209518
995 Ga0495619_0000045 3300053085 Bacteria 108543
996 Ga0495619_0002374 3300053085 Bacteria 12380
997 Ga0495619_0002899 3300053085 Bacteria 11139
998 Ga0495619_0004604 3300053085 Bacteria 8803
999 Ga0495619_0044260 3300053085 Bacteria 2922
1000 Ga0495619_0110761 3300053085 Bacteria 1876
1001 Ga0500644_0001293 3300053088 Bacteria 6806
1002 Ga0500651_0006213 3300053093 Bacteria 6869
1003 Ga0500595_000002 3300053119 Bacteria 1074388
1004 Ga0500616_0000002 3300053153 Bacteria 1611257
1005 Ga0500616_0007357 3300053153 Bacteria 7014
1006 Ga0500645_000099 3300053730 Bacteria 68426
1007 Ga0501084_0126233 3300054114 Bacteria 2153
1008 Ga0501082_0000074 3300060353 Bacteria 73246
1009 Ga0501082_0040262 3300060353 Bacteria 4031
1010 Ga0501082_0043132 3300060353 Bacteria 3888
1011 Ga0530510_0045710 3300061734 Bacteria 3163
1012 2643757269 2643221547 Bacteria 4740017
1013 2889918179 2889914905 Bacteria 5702301
1014 Ga0070711_100051325
1015 2214745202
1016 ARSoilYngRDRAFT_c00086
1017 ARcpr5yngRDRAFT_c000084
1018 ARSoilOldRDRAFT_c000050
1019 ARCol0yngRDRAFT_1000023
1020 JGI24739J22299_10000209
1021 JGI24739J22299_10002430
1022 JGI24737J22298_10000739
1023 JGI24737J22298_10003173
1024 JGI24750J21931_1000551
1025 JGI24748J21848_1000695
1026 JGI24738J21930_10001189
1027 JGI24749J21850_1000283
1028 JGI24744J21845_10000810
1029 JGI24035J26624_1000365
1030 JGI24742J22300_10000279
1031 JGI25153J46596_10004383
1032 JGI25404J52841_10002701
1033 Ga0065714_10095322
1034 Ga0065704_10073133
1035 Ga0065712_10070789
1036 Ga0065715_10000519
1037 Ga0065715_10004456
1038 Ga0070676_10002633
1039 Ga0070676_10041250
1040 Ga0070683_100010864
1041 Ga0070683_100035491
1042 Ga0070690_100001459
1043 Ga0070670_100012949
1044 Ga0070670_100027821
1045 Ga0070677_10000109
1046 Ga0068869_100004148
1047 Ga0068869_100035836
1048 Ga0068869_100146055
1049 Ga0070680_100018038
1050 Ga0070680_100019164
1051 Ga0070680_100063179
1052 Ga0070682_100000459
1053 Ga0070682_100034055
1054 Ga0070682_100040299
1055 Ga0068868_100000443
1056 Ga0068868_100006452
1057 Ga0070660_100034923
1058 Ga0070660_100046626
1059 Ga0070689_100000423
1060 Ga0070689_100001662
1061 Ga0070689_100020869
1062 Ga0070689_100043276
1063 Ga0070689_100131548
1064 Ga0070691_10001927
1065 Ga0070691_10011614
1066 Ga0070691_10011885
1067 Ga0070691_10019580
1068 Ga0070687_100000706
1069 Ga0070687_100005176
1070 Ga0070687_100006831
1071 Ga0070687_100022617
1072 Ga0070661_100001619
1073 Ga0070692_10000262
1074 Ga0070692_10046098
1075 Ga0070668_100001027
1076 Ga0070668_100051371
1077 Ga0070668_100092303
1078 Ga0070669_100002329
1079 Ga0070669_100064546
1080 Ga0070675_100040634
1081 Ga0070671_100017038
1082 Ga0070671_100019919
1083 Ga0070671_100031446
1084 Ga0070674_100001251
1085 Ga0070674_100009547
1086 Ga0070674_100027485
1087 Ga0070674_100043841
1088 Ga0070673_100000050
1089 Ga0070673_100006576
1090 Ga0070673_100016705
1091 Ga0070688_100001640
1092 Ga0070688_100007074
1093 Ga0070688_100036737
1094 Ga0070659_100012533
1095 Ga0070659_100037940
1096 Ga0070659_100039712
1097 Ga0070659_100042832
1098 Ga0070667_100006734
1099 Ga0070667_100015429
1100 Ga0070667_100033083
1101 Ga0070703_10001729
1102 Ga0070703_10002210
1103 Ga0070709_10000525
1104 Ga0070714_100005095
1105 Ga0070713_100001754
1106 Ga0070713_100178398
1107 Ga0070710_10001598
1108 Ga0070710_10069031
1109 Ga0070701_10000093
1110 Ga0070701_10021819
1111 Ga0070701_10022612
1112 Ga0070711_100016501
1113 Ga0070705_100003411
1114 Ga0070705_100009540
1115 Ga0070705_100101189
1116 Ga0070700_100009936
1117 Ga0070700_100010471
1118 Ga0070700_100014595
1119 Ga0070700_100016882
1120 Ga0070694_100009576
1121 Ga0070694_100019701
1122 Ga0070663_100030724
1123 Ga0070663_100090611
1124 Ga0070678_100001756
1125 Ga0070678_100015618
1126 Ga0070678_100133004
1127 Ga0070662_100003987
1128 Ga0070662_100009135
1129 Ga0070681_10001525
1130 Ga0070681_10001623
1131 Ga0070681_10030838
1132 Ga0070681_10149529
1133 Ga0068867_100001138
1134 Ga0068867_100012280
1135 Ga0068867_100035703
1136 Ga0070685_10000984
1137 Ga0070685_10007517
1138 Ga0070685_10017650
1139 Ga0070685_10029019
1140 Ga0070699_100001809
1141 Ga0070679_100012735
1142 Ga0070679_100054193
1143 Ga0070679_100091379
1144 Ga0070679_100139212
1145 Ga0070684_100029522
1146 Ga0070684_100035117
1147 Ga0070684_100067827
1148 Ga0070684_100076688
1149 Ga0070684_100086779
1150 Ga0070684_100090738
1151 Ga0068853_100002995
1152 Ga0068853_100073321
1153 Ga0070672_100003943
1154 Ga0070686_100009031
1155 Ga0070686_100016714
1156 Ga0070686_100021350
1157 Ga0070695_100000824
1158 Ga0070695_100002921
1159 Ga0070695_100017465
1160 Ga0070696_100000856
1161 Ga0070693_100001975
1162 Ga0070665_100244531
1163 Ga0070704_100002335
1164 Ga0070704_100002836
1165 Ga0070704_100006569
1166 Ga0070704_100039281
1167 Ga0068855_100015755
1168 Ga0070664_100024583
1169 Ga0070664_100037892
1170 Ga0070664_100079318
1171 Ga0068857_100008305
1172 Ga0068857_100043792
1173 Ga0068854_100003868
1174 Ga0068854_100015449
1175 Ga0068854_100063690
1176 Ga0068854_100072375
1177 Ga0068856_100003821
1178 Ga0068856_100058666
1179 Ga0070702_100000497
1180 Ga0070702_100006109
1181 Ga0070702_100084461
1182 Ga0068852_100001222
1183 Ga0068852_100063725
1184 Ga0068859_100021148
1185 Ga0068859_100023550
1186 Ga0068859_100025814
1187 Ga0068859_100034357
1188 Ga0068859_100038671
1189 Ga0068864_100001074
1190 Ga0068864_100006339
1191 Ga0068864_100012258
1192 Ga0068864_100042649
1193 Ga0068864_100048003
1194 Ga0068864_100157672
1195 Ga0068866_10005659
1196 Ga0068866_10006999
1197 Ga0068866_10068047
1198 Ga0068861_100001328
1199 Ga0068861_100016726
1200 Ga0068861_100017632
1201 Ga0068870_10000051
1202 Ga0068870_10015842
1203 Ga0068863_100008364
1204 Ga0068863_100013387
1205 Ga0068863_100026590
1206 Ga0068863_100075045
1207 Ga0068858_100005147
1208 Ga0068858_100006251
1209 Ga0068858_100034414
1210 Ga0068858_100092885
1211 Ga0068860_100001825
1212 Ga0068860_100008760
1213 Ga0068860_100010661
1214 Ga0068860_100023546
1215 Ga0068860_100104445
1216 Ga0068860_100144787
1217 Ga0068862_100001949
1218 Ga0068862_100016670
1219 Ga0068862_100039768
1220 Ga0081455_10000081
1221 Ga0081455_10002198
1222 Ga0081538_10059304
1223 Ga0081538_10081004
1224 Ga0081540_1000007
1225 Ga0081540_1004024
1226 Ga0075365_10126900
1227 Ga0075368_10005879
1228 Ga0075368_10014120
1229 Ga0070715_10000551
1230 Ga0070716_100001287
1231 Ga0070712_100004737
1232 Ga0075367_10018956
1233 Ga0075427_10000603
1234 Ga0075366_10012326
1235 Ga0097621_100001496
1236 Ga0075370_10042438
1237 Ga0068871_100003134
1238 Ga0068871_100023904
1239 Ga0068871_100065268
1240 Ga0068871_100081876
1241 Ga0068871_100251808
1242 Ga0075428_100000740
1243 Ga0075428_100024539
1244 Ga0075430_100006097
1245 Ga0075430_100013350
1246 Ga0075430_100016809
1247 Ga0075431_100000870
1248 Ga0075431_100001076
1249 Ga0075431_100007719
1250 Ga0075431_100042948
1251 Ga0075431_100149874
1252 Ga0075431_100195337
1253 Ga0075433_10000012
1254 Ga0075433_10025668
1255 Ga0075434_100003201
1256 Ga0075434_100007032
1257 Ga0075434_100008056
1258 Ga0075434_100012519
1259 Ga0075434_100054628
1260 Ga0075429_100000098
1261 Ga0075429_100004032
1262 Ga0068865_100003854
1263 Ga0068865_100016325
1264 Ga0097620_100021146
1265 Ga0097620_100023550
1266 Ga0097620_100025814
1267 Ga0097620_100034355
1268 Ga0097620_100038673
1269 Ga0075435_100028671
1270 Ga0075435_100069072
1271 Ga0105250_10040014
1272 Ga0111539_10000757
1273 Ga0111539_10001671
1274 Ga0111539_10005127
1275 Ga0111539_10008480
1276 Ga0111539_10051044
1277 Ga0111539_10100128
1278 Ga0111539_10150020
1279 Ga0105245_10002488
1280 Ga0105245_10050094
1281 Ga0105245_10182552
1282 Ga0105247_10006103
1283 Ga0105247_10008404
1284 Ga0105247_10016894
1285 Ga0105247_10036684
1286 Ga0114129_10000025
1287 Ga0114129_10008949
1288 Ga0114129_10016369
1289 Ga0114129_10019966
1290 Ga0114129_10023567
1291 Ga0114129_10050640
1292 Ga0114129_10233598
1293 Ga0105243_10003214
1294 Ga0105243_10009303
1295 Ga0105243_10031611
1296 Ga0105241_10004876
1297 Ga0105241_10005826
1298 Ga0105241_10065776
1299 Ga0105242_10002016
1300 Ga0105242_10003519
1301 Ga0105242_10041795
1302 Ga0105242_10069916
1303 Ga0105242_10108685
1304 Ga0105248_10003871
1305 Ga0105248_10099691
1306 Ga0105248_10315006
1307 Ga0105237_10006016
1308 Ga0105237_10043192
1309 Ga0105237_10078801
1310 Ga0105237_10095030
1311 Ga0105238_10054187
1312 Ga0105238_10054673
1313 Ga0105249_10001193
1314 Ga0105249_10001979
1315 Ga0105249_10108889
1316 Ga0105239_10027649
1317 Ga0105239_10035856
1318 Ga0105239_10038572
1319 Ga0105239_10041876
1320 Ga0105246_10000231
1321 Ga0105246_10015760
1322 Ga0105246_10117462
1323 Ga0157373_10010248
1324 Ga0157373_10102676
1325 Ga0157373_10111698
1326 Ga0157371_10025479
1327 Ga0157370_10150497
1328 Ga0157374_10003239
1329 Ga0157374_10013309
1330 Ga0157374_10017421
1331 Ga0157374_10031696
1332 Ga0157378_10004453
1333 Ga0157378_10010612
1334 Ga0157378_10020673
1335 Ga0157378_10021915
1336 Ga0163162_10006149
1337 Ga0163162_10020738
1338 Ga0163162_10026579
1339 Ga0157372_10025465
1340 Ga0157372_10121031
1341 Ga0157375_10006518
1342 Ga0157375_10033972
1343 Ga0157375_10053687
1344 Ga0157375_10100999
1345 Ga0157375_10119222
1346 Ga0157375_10237394
1347 Ga0163163_10001320
1348 Ga0163163_10015790
1349 Ga0163163_10051326
1350 Ga0163163_10093775
1351 Ga0163163_10168581
1352 Ga0157380_10002744
1353 Ga0157380_10065721
1354 Ga0157380_10195500
1355 Ga0157377_10000164
1356 Ga0157379_10020078
1357 Ga0157379_10030909
1358 Ga0157379_10061490
1359 Ga0157379_10064966
1360 Ga0157376_10002102
1361 Ga0157376_10036456
1362 Ga0157376_10036479
1363 Ga0157376_10088277
1364 Ga0157376_10204657
1365 Ga0163161_10002837
1366 Ga0163161_10114468
1367 Ga0163161_10131060
1368 Ga0213876_10025328
1369 Ga0207666_1000051
1370 Ga0209758_1000125
1371 Ga0207697_10000662
1372 Ga0207653_10000546
1373 Ga0207653_10001467
1374 Ga0207682_10000072
1375 Ga0207692_10002147
1376 Ga0207642_10001909
1377 Ga0207642_10039428
1378 Ga0207710_10000558
1379 Ga0207710_10004313
1380 Ga0207710_10035227
1381 Ga0207688_10000229
1382 Ga0207688_10000998
1383 Ga0207688_10004677
1384 Ga0207680_10001283
1385 Ga0207680_10092650
1386 Ga0207647_10003353
1387 Ga0207647_10010679
1388 Ga0207647_10011089
1389 Ga0207685_10001607
1390 Ga0207685_10003975
1391 Ga0207699_10002080
1392 Ga0207699_10015546
1393 Ga0207645_10000966
1394 Ga0207645_10007388
1395 Ga0207645_10023155
1396 Ga0207645_10059737
1397 Ga0207643_10000004
1398 Ga0207643_10000794
1399 Ga0207643_10004896
1400 Ga0207643_10031046
1401 Ga0207643_10065728
1402 Ga0207654_10001472
1403 Ga0207654_10007425
1404 Ga0207707_10007028
1405 Ga0207707_10065564
1406 Ga0207671_10013159
1407 Ga0207671_10020766
1408 Ga0207671_10048003
1409 Ga0207693_10006880
1410 Ga0207693_10027450
1411 Ga0207693_10161096
1412 Ga0207663_10010875
1413 Ga0207663_10017354
1414 Ga0207660_10000648
1415 Ga0207660_10092613
1416 Ga0207662_10000317
1417 Ga0207662_10000424
1418 Ga0207662_10013378
1419 Ga0207662_10023881
1420 Ga0207662_10032770
1421 Ga0207662_10064039
1422 Ga0207662_10091114
1423 Ga0207657_10002047
1424 Ga0207657_10028849
1425 Ga0207649_10000262
1426 Ga0207649_10090257
1427 Ga0207652_10000911
1428 Ga0207652_10067950
1429 Ga0207681_10010634
1430 Ga0207694_10024208
1431 Ga0207650_10013694
1432 Ga0207650_10019548
1433 Ga0207659_10001684
1434 Ga0207659_10012218
1435 Ga0207659_10024969
1436 Ga0207687_10001501
1437 Ga0207687_10006389
1438 Ga0207687_10017936
1439 Ga0207700_10001264
1440 Ga0207700_10218925
1441 Ga0207664_10002547
1442 Ga0207664_10183287
1443 Ga0207644_10000467
1444 Ga0207644_10001961
1445 Ga0207644_10015484
1446 Ga0207644_10025194
1447 Ga0207644_10092872
1448 Ga0207690_10001228
1449 Ga0207690_10009138
1450 Ga0207690_10137132
1451 Ga0207706_10001679
1452 Ga0207706_10007881
1453 Ga0207706_10018822
1454 Ga0207706_10054074
1455 Ga0207706_10203437
1456 Ga0207686_10002040
1457 Ga0207686_10009318
1458 Ga0207686_10017951
1459 Ga0207686_10099188
1460 Ga0207709_10035318
1461 Ga0207709_10102649
1462 Ga0207670_10000377
1463 Ga0207670_10002370
1464 Ga0207670_10003054
1465 Ga0207670_10037467
1466 Ga0207670_10170453
1467 Ga0207669_10001912
1468 Ga0207669_10015439
1469 Ga0207669_10017896
1470 Ga0207669_10031185
1471 Ga0207704_10002613
1472 Ga0207704_10174333
1473 Ga0207665_10001035
1474 Ga0207665_10043619
1475 Ga0207665_10056180
1476 Ga0207665_10067562
1477 Ga0207691_10002691
1478 Ga0207691_10002874
1479 Ga0207711_10003410
1480 Ga0207711_10006776
1481 Ga0207711_10022868
1482 Ga0207711_10030274
1483 Ga0207689_10000203
1484 Ga0207689_10022711
1485 Ga0207689_10044138
1486 Ga0207689_10045948
1487 Ga0207661_10002165
1488 Ga0207661_10014563
1489 Ga0207679_10000157
1490 Ga0207679_10015012
1491 Ga0207679_10158473
1492 Ga0207667_10220437
1493 Ga0207651_10008897
1494 Ga0207712_10002224
1495 Ga0207712_10003965
1496 Ga0207712_10039070
1497 Ga0207668_10017144
1498 Ga0207668_10055993
1499 Ga0207668_10109409
1500 Ga0207640_10043680
1501 Ga0207658_10005748
1502 Ga0207658_10008052
1503 Ga0207658_10048495
1504 Ga0207658_10167123
1505 Ga0207677_10001675
1506 Ga0207677_10006260
1507 Ga0207703_10001346
1508 Ga0207703_10001852
1509 Ga0207703_10032158
1510 Ga0207639_10008211
1511 Ga0207678_10001809
1512 Ga0207678_10001884
1513 Ga0207678_10011488
1514 Ga0207678_10013053
1515 Ga0207678_10034212
1516 Ga0207678_10034731
1517 Ga0207678_10041672
1518 Ga0207708_10000784
1519 Ga0207708_10001199
1520 Ga0207708_10003067
1521 Ga0207708_10004901
1522 Ga0207708_10014093
1523 Ga0207702_10003404
1524 Ga0207702_10068697
1525 Ga0207641_10006871
1526 Ga0207641_10011257
1527 Ga0207641_10041334
1528 Ga0207648_10002073
1529 Ga0207648_10002310
1530 Ga0207648_10016984
1531 Ga0207648_10027663
1532 Ga0207676_10000990
1533 Ga0207676_10002295
1534 Ga0207676_10002940
1535 Ga0207676_10048845
1536 Ga0207676_10184700
1537 Ga0207674_10000897
1538 Ga0207674_10011740
1539 Ga0207675_100001726
1540 Ga0207675_100002371
1541 Ga0207675_100005453
1542 Ga0207683_10000824
1543 Ga0207683_10001176
1544 Ga0207683_10014019
1545 Ga0207683_10018096
1546 Ga0207683_10081706
1547 Ga0207683_10185428
1548 Ga0207698_10003743
1549 Ga0207698_10024746
1550 Ga0210002_1003362
1551 Ga0209966_1000247
1552 Ga0209998_10000255
1553 Ga0209998_10001128
1554 Ga0209974_10001489
1555 Ga0207428_10000137
1556 Ga0207428_10000792
1557 Ga0207428_10003106
1558 Ga0207428_10004572
1559 Ga0207428_10033074
1560 Ga0207428_10072105
1561 Ga0268266_10005095
1562 Ga0268266_10023244
1563 Ga0268266_10046625
1564 Ga0268265_10012344
1565 Ga0268265_10029470
1566 Ga0268265_10085418
1567 Ga0268264_10002039
1568 Ga0268264_10016623
1569 Ga0268264_10062447
1570 Ga0268264_10081157
1571 Ga0265330_10047685
1572 Ga0265325_10000073
1573 Ga0265325_10000234
1574 Ga0265325_10002177
1575 Ga0265325_10004094
1576 Ga0265340_10021850
1577 Ga0265339_10001513
1578 Ga0265316_10024489
1579 Ga0265313_10000326
1580 Ga0265313_10008870
1581 Ga0265313_10040748
1582 Ga0373948_0000061
1583 Ga0373958_0000048
1584 Ga0373958_0001634
1585 Ga0373926_0003985
1586 Ga0373928_0000291
1587 Ga0373928_0008797
1588 Ga0373929_0000564
1589 Ga0373929_0005244
1590 Ga0373934_0020853
1591 Ga0373940_0000023
1592 Ga0373940_0010533
1593 Ga0373940_0012296
1594 Ga0373949_0001146
1595 Ga0373951_0000876
1596 Ga0373951_0005478
1597 Ga0373923_0000851
1598 Ga0373923_0003216
1599 Ga0373936_0001660
1600 Ga0373939_0000663
1601 Ga0373939_0002651
1602 Ga0373941_0000309
1603 Ga0373945_0000277
1604 Ga0373945_0001390
1605 Ga0373953_0068438
1606 Ga0373954_0005333
1607 Ga0373954_0014688
1608 Ga0373960_0001082
1609 Ga0373960_0003571
1610 Ga0373960_0003751
1611 Ga0373943_0004971
1612 Ga0373943_0005512
1613 Ga0373943_0009916
1614 Ga0373946_0001856
1615 Ga0373946_0002330
1616 Ga0373955_0002403
1617 Ga0373942_0000081
1618 Ga0373942_0003417
1619 Ga0373942_0009249
1620 Ga0373942_0016658
1621 Ga0373961_0000743
1622 Ga0373961_0002954
1623 Ga0373961_0032726
1624 Ga0373962_0000194
1625 Ga0373924_0000490
1626 Ga0373924_0004810
1627 Ga0373931_0001008
1628 Ga0373931_0001564
1629 Ga0373931_0002975
1630 Ga0373931_0007918
1631 Ga0373931_0016578
1632 Ga0373935_0000291
1633 Ga0373935_0013547
1634 Ga0373935_0057106
1635 Ga0373927_0005343
1636 Ga0373927_0009000
1637 Ga0373927_0034546
1638 Ga0373927_0051606
1639 Ga0373927_0054373
1640 Ga0373927_0055119
1641 Ga0373933_0010185
1642 Ga0373933_0012833
1643 Ga0373947_0000424
1644 Ga0373947_0005730
1645 Ga0373947_0010154
1646 Ga0373947_0041253
1647 Ga0373947_0048954
1648 Ga0373937_0000004
1649 Ga0373937_0003680
1650 Ga0373937_0005263
1651 Ga0373937_0006030
1652 Ga0373925_0000460
1653 Ga0373925_0003391
1654 Ga0373925_0017524
1655 Ga0373925_0127647
1656 Ga0436365_0349099
1657 Ga0436365_1169665
1658 Ga0439464_0005396
1659 Ga0451576_0006650
1660 Ga0495592_0000029
1661 Ga0495592_0001215
1662 Ga0495592_0005508
1663 Ga0495592_0136552
1664 Ga0495592_0149021
1665 Ga0495590_0028653
1666 Ga0495629_0000447
1667 Ga0495629_0016571
1668 Ga0495629_0016805
1669 Ga0495638_0028434
1670 Ga0495641_0001697
1671 Ga0495641_0015734
1672 Ga0495641_0027911
1673 Ga0495651_0002424
1674 Ga0495651_0038986
1675 Ga0495653_0000012
1676 Ga0495653_0003231
1677 Ga0495653_0006931
1678 Ga0495653_0078354
1679 Ga0495580_0006747
1680 Ga0495580_0085877
1681 Ga0495582_0007072
1682 Ga0495582_0010997
1683 Ga0495582_0013202
1684 Ga0495639_0006165
1685 Ga0495662_0003904
1686 Ga0495662_0010406
1687 Ga0495664_0000004
1688 Ga0495664_0009959
1689 Ga0495664_0105171
1690 Ga0495584_0002735
1691 Ga0495584_0056557
1692 Ga0495585_0003199
1693 Ga0495585_0073720
1694 Ga0495594_0013045
1695 Ga0495594_0021869
1696 Ga0495607_0029184
1697 Ga0495608_0000017
1698 Ga0495618_0000006
1699 Ga0495628_0000001
1700 Ga0495628_0009640
1701 Ga0495628_0019168
1702 Ga0495628_0035835
1703 Ga0495630_0008370
1704 Ga0495637_0042998
1705 Ga0495644_0002426
1706 Ga0495666_0001305
1707 Ga0495652_0000002
1708 Ga0495652_0018154
1709 Ga0495665_0004009
1710 Ga0495665_0025407
1711 Ga0495640_0000001
1712 Ga0495640_0017355
1713 Ga0495586_0007089
1714 Ga0495587_0000008
1715 Ga0495587_0001490
1716 Ga0495598_0001556
1717 Ga0495645_0000002
1718 Ga0495645_0000954
1719 Ga0495645_0050356
1720 Ga0495633_0014899
1721 Ga0495667_0000029
1722 Ga0495667_0014263
1723 Ga0495667_0043731
1724 Ga0495656_0000941
1725 Ga0495634_0006280
1726 Ga0495634_0035463
1727 Ga0495634_0058157
1728 Ga0495611_0005829
1729 Ga0495635_0000002
1730 Ga0495635_0013015
1731 Ga0495588_0000318
1732 Ga0495588_0012717
1733 Ga0495588_0029685
1734 Ga0495657_0000459
1735 Ga0495657_0086718
1736 Ga0495599_0000104
1737 Ga0495599_0001047
1738 Ga0495599_0034637
1739 Ga0495623_0000691
1740 Ga0495623_0003897
1741 Ga0495646_0000064
1742 Ga0495646_0005442
1743 Ga0495646_0006507
1744 Ga0495647_0001576
1745 Ga0495658_0007929
1746 Ga0495658_0008212
1747 Ga0495658_0008346
1748 Ga0495658_0035592
1749 Ga0495613_0000793
1750 Ga0495613_0047786
1751 Ga0495624_0023831
1752 Ga0495600_0000010
1753 Ga0495600_0032708
1754 Ga0495581_0002305
1755 Ga0495604_0000009
1756 Ga0495604_0003660
1757 Ga0495604_0017295
1758 Ga0495604_0017691
1759 Ga0495674_0000002
1760 Ga0495674_0042474
1761 Ga0495674_0080853
1762 Ga0495676_0084271
1763 Ga0495676_0178846
1764 Ga0495680_0000752
1765 Ga0495680_0014315
1766 Ga0495680_0014551
1767 Ga0495680_0022273
1768 Ga0495680_0028687
1769 Ga0495675_0000028
1770 Ga0495675_0026696
1771 Ga0495684_0000006
1772 Ga0495684_0003934
1773 Ga0495593_0008360
1774 Ga0495602_0000005
1775 Ga0495602_0000776
1776 Ga0495602_0002995
1777 Ga0495614_0004539
1778 Ga0496100_0002107
1779 Ga0496100_0008177
1780 Ga0496100_0008677
1781 Ga0496100_0010419
1782 Ga0496100_0057614
1783 Ga0496101_0002976
1784 Ga0496101_0005170
1785 Ga0496101_0005327
1786 Ga0496101_0028769
1787 Ga0496101_0045004
1788 Ga0496101_0099036
1789 Ga0496102_0008464
1790 Ga0496102_0009880
1791 Ga0496102_0017733
1792 Ga0496102_0024215
1793 Ga0496102_0029685
1794 Ga0496102_0097214
1795 Ga0496103_0001696
1796 Ga0496103_0005658
1797 Ga0496103_0005922
1798 Ga0496103_0011431
1799 Ga0496103_0036194
1800 Ga0496103_0076217
1801 Ga0496104_0000092
1802 Ga0496104_0004402
1803 Ga0496104_0013405
1804 Ga0496104_0033638
1805 Ga0496104_0069565
1806 Ga0496104_0112817
1807 Ga0496104_0269510
1808 Ga0496105_0001436
1809 Ga0496105_0001736
1810 Ga0496105_0002164
1811 Ga0496105_0002208
1812 Ga0496105_0018426
1813 Ga0496105_0125052
1814 Ga0496105_0125239
1815 Ga0496106_0003134
1816 Ga0496106_0006593
1817 Ga0496106_0019784
1818 Ga0496106_0026317
1819 Ga0496106_0043487
1820 Ga0496106_0149234
1821 Ga0496107_0000809
1822 Ga0496107_0003490
1823 Ga0496107_0007194
1824 Ga0496107_0012097
1825 Ga0496107_0013417
1826 Ga0496107_0026710
1827 Ga0496107_0029822
1828 Ga0496108_0003371
1829 Ga0496108_0005285
1830 Ga0496108_0012368
1831 Ga0496108_0014164
1832 Ga0496108_0082309
1833 Ga0496108_0090770
1834 Ga0496108_0097512
1835 Ga0496109_0000543
1836 Ga0496109_0016420
1837 Ga0496109_0026427
1838 Ga0496109_0031491
1839 Ga0496109_0118773
1840 Ga0496109_0200601
1841 Ga0496110_0004426
1842 Ga0496110_0015744
1843 Ga0496110_0053918
1844 Ga0496110_0112154
1845 Ga0496110_0190509
1846 Ga0496111_0000388
1847 Ga0496111_0002814
1848 Ga0496111_0010441
1849 Ga0496111_0012071
1850 Ga0496111_0028753
1851 Ga0496112_0003072
1852 Ga0496112_0009140
1853 Ga0496112_0014688
1854 Ga0496112_0061370
1855 Ga0496112_0195521
1856 Ga0496113_0000043
1857 Ga0496113_0003436
1858 Ga0496113_0004954
1859 Ga0496113_0015314
1860 Ga0496113_0047129
1861 Ga0496113_0133408
1862 Ga0496113_0189022
1863 Ga0496114_0003641
1864 Ga0496114_0013464
1865 Ga0496114_0023885
1866 Ga0496114_0040439
1867 Ga0496114_0052998
1868 Ga0496115_0009341
1869 Ga0496115_0018321
1870 Ga0496115_0046900
1871 Ga0496115_0054203
1872 Ga0496115_0109009
1873 Ga0501031_0022932
1874 Ga0501032_0028467
1875 Ga0501032_0049939
1876 Ga0501033_0011567
1877 Ga0501033_0017357
1878 Ga0501033_0038589
1879 Ga0501034_0006205
1880 Ga0501034_0008624
1881 Ga0501034_0018337
1882 Ga0501034_0086671
1883 Ga0501034_0105165
1884 Ga0501034_0157288
1885 Ga0501034_0304648
1886 Ga0501036_0000372
1887 Ga0501036_0017605
1888 Ga0501036_0025867
1889 Ga0501036_0055564
1890 Ga0501037_0008325
1891 Ga0501037_0020689
1892 Ga0501037_0020812
1893 Ga0501037_0026077
1894 Ga0501038_0017530
1895 Ga0501038_0026512
1896 Ga0501038_0031263
1897 Ga0501038_0062127
1898 Ga0501038_0096680
1899 Ga0501039_0015326
1900 Ga0501043_0005267
1901 Ga0501043_0023206
1902 Ga0501043_0030487
1903 Ga0501046_0066195
1904 Ga0501046_0066278
1905 Ga0501047_0000164
1906 Ga0501047_0025565
1907 Ga0501047_0079486
1908 Ga0501047_0087179
1909 Ga0501047_0109023
1910 Ga0501047_0110282
1911 Ga0501048_0003459
1912 Ga0501067_0006409
1913 Ga0501069_0000561
1914 Ga0501070_0003220
1915 Ga0501070_0020311
1916 Ga0501070_0020404
1917 Ga0501070_0021489
1918 Ga0501070_0022513
1919 Ga0501070_0035382
1920 Ga0501070_0044117
1921 Ga0501070_0143033
1922 Ga0501070_0162714
1923 Ga0501071_0054311
1924 Ga0501072_0065822
1925 Ga0501072_0147428
1926 Ga0501073_0026466
1927 Ga0501074_0014496
1928 Ga0501074_0016572
1929 Ga0501074_0184462
1930 Ga0501075_0044258
1931 Ga0501076_0118405
1932 Ga0501076_0167041
1933 Ga0501077_0025278
1934 Ga0501079_0004533
1935 Ga0501079_0047540
1936 Ga0501079_0047569
1937 Ga0501079_0096901
1938 Ga0501080_0000235
1939 Ga0501080_0043320
1940 Ga0501080_0048885
1941 Ga0501081_0034408
1942 Ga0501083_0016539
1943 Ga0501083_0022677
1944 Ga0501083_0066250
1945 Ga0501035_0016521
1946 Ga0501035_0046252
1947 Ga0501044_0000707
1948 Ga0501044_0004015
1949 Ga0501044_0033812
1950 Ga0501044_0043740
1951 Ga0501044_0127556
1952 Ga0501044_0144177
1953 Ga0501044_0293820
1954 Ga0501044_0310905
1955 nmdc:mga0yw44_46679_c1
1956 nmdc:mga0k408_5532_c1
1957 nmdc:mga06z11_72629_c1
1958 nmdc:mga05p37_143795_c1
1959 nmdc:mga05p37_201_c1
1960 nmdc:mga05p37_309031_c1
1961 nmdc:mga05p37_44522_c1
1962 nmdc:mga05p37_62368_c1
1963 nmdc:mga05p37_6242_c1
1964 nmdc:mga05p37_66_c1
1965 nmdc:mga05p37_92206_c1
1966 nmdc:mga09592_30035_c1
1967 nmdc:mga09592_7876_c1
1968 nmdc:mga0qj67_24563_c1
1969 nmdc:mga0qj67_26699_c1
1970 nmdc:mga0qj67_512_c1
1971 nmdc:mga0qj67_7_c1
1972 nmdc:mga06r32_177654_c1
1973 nmdc:mga06r32_25746_c1
1974 nmdc:mga06r32_451_c1
1975 nmdc:mga06r32_7326_c1
1976 nmdc:mga06r32_7911_c1
1977 nmdc:mga08y16_1809_c1
1978 nmdc:mga08y16_253276_c1
1979 nmdc:mga08y16_31568_c1
1980 nmdc:mga08y16_4145_c1
1981 nmdc:mga08y16_48_c1
1982 nmdc:mga08y16_56670_c1
1983 nmdc:mga0n895_43_c1
1984 nmdc:mga0n895_74467_c1
1985 nmdc:mga0n895_78577_c1
1986 nmdc:mga0n895_82465_c1
1987 nmdc:mga0rr50_21285_c1
1988 nmdc:mga0rr50_43928_c1
1989 nmdc:mga0rr50_5412_c1
1990 nmdc:mga0a205_13273_c1
1991 nmdc:mga0a205_2982_c1
1992 nmdc:mga0a205_3268_c1
1993 Ga0495601_0000002
1994 Ga0495601_0000107
1995 Ga0495601_0005039
1996 Ga0495601_0027688
1997 Ga0495601_0035231
1998 Ga0495601_0122728
1999 Ga0495612_0000010
2000 Ga0495612_0001623
2001 Ga0495612_0002221
2002 Ga0495612_0005028
2003 Ga0495595_0000777
2004 Ga0495595_0004037
2005 Ga0495595_0010557
2006 Ga0495595_0019908
2007 Ga0495619_0000019
2008 Ga0495619_0000045
2009 Ga0495619_0002374
2010 Ga0495619_0002899
2011 Ga0495619_0004604
2012 Ga0495619_0044260
2013 Ga0495619_0110761
2014 Ga0500644_0001293
2015 Ga0500651_0006213
2016 Ga0500595_000002
2017 Ga0500616_0000002
2018 Ga0500616_0007357
2019 Ga0500645_000099
2020 Ga0501084_0126233
2021 Ga0501082_0000074
2022 Ga0501082_0040262
2023 Ga0501082_0043132
2024 Ga0530510_0045710
2025 2643757269
2026 2889918179

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

8

426

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.9557 4 434
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.9351 1 434
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.9205 1 434
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.9184 1 434
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8916 1 434
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5457 13 377 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5334 13 377 1.20.1630.10
af_Q54YB8_113_357_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4232 9 225 1.20.1250.20
2cmrA00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.423 12 240 1.20.58.1860
af_A4I2W7_8_252_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4145 122 382 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A0K6IUC4-F1-model_v4 Bacterial Cytochrome Ubiquinol Oxidase 0.9911 143 256 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A366GMK4-F1-model_v4 Cytochrome bd-I ubiquinol oxidase subunit 1 apoprotein 0.9893 1 398 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A5N7YB97-F1-model_v4 deleted 0.9872 1 429
AF-A0A329P241-F1-model_v4 deleted 0.9869 64 413
AF-A0A7C4N6J7-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9866 4 434 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069

Map