F488191
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1013 | 381 | 2026 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100077363|Ga0070665_1000773632 |
| Length | 239 |
| Sequence | MVATQTPGPVNADPAELAKFSALAHRWWDPTSEFRPLHEINPLRLAHIENLAGGLAGKRVLDVGCGGGILAEAMAASGAQVTGIDLAEKPLQVATLHKIETGSSVEYRLVAAEALAEEMPGAFDVVTCMEMLEHVPEPASIVRAVAKLAKPGGHAFFSTINRNPKSFLFAIVGAEYVLNLLPRGTHEYAKFITPSELAAFCRASGLEPNDLTGMTYNPLTKVYALGRDVDVNYLMACRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 7 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 94 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 175 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 178 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 184 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 185 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 186 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 187 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 188 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 189 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 190 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 191 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 192 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 193 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 194 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 195 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 196 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 197 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 198 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 201 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 202 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 203 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 207 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 297 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 303 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 304 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 307 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 311 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 320 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 329 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 330 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 332 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 333 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 335 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 339 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 340 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 341 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 342 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 343 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 344 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 345 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 346 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 347 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 348 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 349 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 350 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 351 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 352 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 353 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 354 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 355 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 356 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 357 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 358 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 359 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 360 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 361 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 362 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 363 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 364 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 365 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 366 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 367 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 368 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 369 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 370 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 371 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 372 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 373 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 374 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 375 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 376 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 377 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 378 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 379 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 380 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 381 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.46 |
| Metatranscriptomes | 0.3 |
| Isolates | 4.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.96 |
| Nodule | 0.2 |
| Rhizoplane | 2.57 |
| Rhizosphere | 78.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070665_100077363 | 3300005548 | Bacteria | 3333 |
| 2 | JGI25155J39150_1000685 | 3300002704 | Bacteria | 6321 |
| 3 | JGI25156J39149_1013612 | 3300002705 | Bacteria | 1717 |
| 4 | JGI25154J39366_1001901 | 3300002738 | Bacteria | 6321 |
| 5 | JGI25157J39369_1001234 | 3300002741 | Bacteria | 10597 |
| 6 | JGI25152J39213_1001691 | 3300002773 | Bacteria | 9086 |
| 7 | JGI25150J39212_1004735 | 3300002774 | Bacteria | 2986 |
| 8 | JGI25150J39212_1004776 | 3300002774 | Bacteria | 2970 |
| 9 | JGI25159J45721_1005656 | 3300002987 | Bacteria | 3886 |
| 10 | JGI25159J45721_1006490 | 3300002987 | Bacteria | 3493 |
| 11 | JGI25153J46596_10018512 | 3300003215 | Bacteria | 2702 |
| 12 | JGI25153J46596_10019612 | 3300003215 | Bacteria | 2584 |
| 13 | rootL2_10030810 | 3300003322 | Bacteria | 18010 |
| 14 | JGI25161J50226_1002935 | 3300003374 | Bacteria | 4133 |
| 15 | Ga0055532_1000077 | 3300003758 | Bacteria | 122193 |
| 16 | Ga0055525_1000074 | 3300003759 | Bacteria | 178058 |
| 17 | Ga0055529_1000119 | 3300003763 | Bacteria | 115765 |
| 18 | Ga0055526_1000096 | 3300003771 | Bacteria | 80897 |
| 19 | Ga0055526_1000176 | 3300003771 | Bacteria | 56708 |
| 20 | Ga0055526_1005549 | 3300003771 | Bacteria | 7207 |
| 21 | Ga0055526_1012194 | 3300003771 | Bacteria | 3776 |
| 22 | Ga0055537_1002012 | 3300003773 | Bacteria | 7223 |
| 23 | Ga0055537_1007195 | 3300003773 | Bacteria | 2716 |
| 24 | Ga0055524_1000049 | 3300003775 | Bacteria | 149383 |
| 25 | Ga0055524_1006247 | 3300003775 | Bacteria | 5194 |
| 26 | Ga0055524_1009250 | 3300003775 | Bacteria | 4029 |
| 27 | Ga0055524_1010025 | 3300003775 | Bacteria | 3804 |
| 28 | Ga0055524_1010467 | 3300003775 | Bacteria | 3691 |
| 29 | Ga0055534_1002464 | 3300003784 | Bacteria | 6391 |
| 30 | Ga0055534_1007631 | 3300003784 | Bacteria | 2550 |
| 31 | Ga0055528_1000378 | 3300003790 | Bacteria | 36269 |
| 32 | Ga0055528_1010121 | 3300003790 | Bacteria | 3872 |
| 33 | Ga0055530_10007632 | 3300003791 | Bacteria | 4512 |
| 34 | Ga0055531_10014242 | 3300003794 | Bacteria | 3598 |
| 35 | Ga0055543_1000154 | 3300004625 | Bacteria | 57352 |
| 36 | Ga0055543_1007921 | 3300004625 | Bacteria | 2406 |
| 37 | Ga0065165_1000571 | 3300005262 | Bacteria | 54679 |
| 38 | Ga0065165_1001586 | 3300005262 | Bacteria | 23398 |
| 39 | Ga0065165_1005416 | 3300005262 | Bacteria | 7192 |
| 40 | Ga0070658_10397592 | 3300005327 | Bacteria | 1183 |
| 41 | Ga0070676_10079006 | 3300005328 | Bacteria | 1991 |
| 42 | Ga0070683_100023896 | 3300005329 | Bacteria | 5472 |
| 43 | Ga0070690_100006127 | 3300005330 | Bacteria | 6806 |
| 44 | Ga0070690_100054139 | 3300005330 | Bacteria | 2568 |
| 45 | Ga0070677_10024701 | 3300005333 | Bacteria | 2237 |
| 46 | Ga0068869_100005370 | 3300005334 | Bacteria | 8053 |
| 47 | Ga0068869_100246471 | 3300005334 | Bacteria | 1425 |
| 48 | Ga0070666_10182683 | 3300005335 | Bacteria | 1471 |
| 49 | Ga0070680_100099705 | 3300005336 | Bacteria | 2411 |
| 50 | Ga0070682_100336628 | 3300005337 | Bacteria | 1120 |
| 51 | Ga0070660_100005785 | 3300005339 | Bacteria | 8565 |
| 52 | Ga0070660_100053782 | 3300005339 | Bacteria | 3106 |
| 53 | Ga0070689_100100855 | 3300005340 | Bacteria | 2284 |
| 54 | Ga0070687_100017933 | 3300005343 | Bacteria | 3265 |
| 55 | Ga0070687_100255533 | 3300005343 | Bacteria | 1091 |
| 56 | Ga0070661_100018767 | 3300005344 | Bacteria | 4922 |
| 57 | Ga0070661_100405395 | 3300005344 | Bacteria | 1079 |
| 58 | Ga0070692_10119362 | 3300005345 | Bacteria | 1469 |
| 59 | Ga0070668_100046395 | 3300005347 | Bacteria | 3336 |
| 60 | Ga0070674_100002988 | 3300005356 | Bacteria | 9393 |
| 61 | Ga0070688_100004034 | 3300005365 | Bacteria | 7618 |
| 62 | Ga0070659_100000840 | 3300005366 | Bacteria | 22393 |
| 63 | Ga0070659_100143807 | 3300005366 | Bacteria | 1942 |
| 64 | Ga0070659_100338332 | 3300005366 | Bacteria | 1260 |
| 65 | Ga0070659_100368219 | 3300005366 | Bacteria | 1208 |
| 66 | Ga0070667_100257863 | 3300005367 | Bacteria | 1560 |
| 67 | Ga0070714_100191894 | 3300005435 | Bacteria | 1865 |
| 68 | Ga0070701_10007677 | 3300005438 | Bacteria | 4626 |
| 69 | Ga0070700_100075096 | 3300005441 | Bacteria | 2167 |
| 70 | Ga0070663_100435731 | 3300005455 | Bacteria | 1078 |
| 71 | Ga0070685_10061804 | 3300005466 | Bacteria | 2194 |
| 72 | Ga0070684_100064719 | 3300005535 | Bacteria | 3208 |
| 73 | Ga0070672_100158970 | 3300005543 | Bacteria | 1873 |
| 74 | Ga0070665_100092707 | 3300005548 | Bacteria | 3025 |
| 75 | Ga0068855_100096508 | 3300005563 | Bacteria | 3405 |
| 76 | Ga0068855_100266261 | 3300005563 | Bacteria | 1907 |
| 77 | Ga0070664_100007438 | 3300005564 | Bacteria | 8840 |
| 78 | Ga0070664_100071288 | 3300005564 | Bacteria | 2977 |
| 79 | Ga0068857_100134900 | 3300005577 | Bacteria | 2229 |
| 80 | Ga0068857_100323239 | 3300005577 | Bacteria | 1425 |
| 81 | Ga0068856_100085329 | 3300005614 | Bacteria | 3136 |
| 82 | Ga0070702_100054252 | 3300005615 | Bacteria | 2305 |
| 83 | Ga0068861_100068057 | 3300005719 | Bacteria | 2750 |
| 84 | Ga0068858_100029744 | 3300005842 | Bacteria | 5074 |
| 85 | Ga0068858_100255506 | 3300005842 | Bacteria | 1665 |
| 86 | Ga0068860_100114608 | 3300005843 | Bacteria | 2577 |
| 87 | Ga0068862_100156567 | 3300005844 | Bacteria | 2031 |
| 88 | Ga0081539_10017768 | 3300005985 | Bacteria | 4972 |
| 89 | Ga0075368_10045034 | 3300006042 | Bacteria | 1742 |
| 90 | Ga0075363_100012995 | 3300006048 | Bacteria | 4022 |
| 91 | Ga0070712_100021576 | 3300006175 | Bacteria | 4232 |
| 92 | Ga0075362_10095140 | 3300006177 | Bacteria | 1387 |
| 93 | Ga0075369_10022138 | 3300006186 | Bacteria | 2619 |
| 94 | Ga0075369_10037445 | 3300006186 | Bacteria | 2066 |
| 95 | Ga0075366_10002692 | 3300006195 | Bacteria | 9166 |
| 96 | Ga0075366_10125788 | 3300006195 | Bacteria | 1546 |
| 97 | Ga0075366_10264188 | 3300006195 | Bacteria | 1051 |
| 98 | Ga0097621_100015682 | 3300006237 | Bacteria | 5710 |
| 99 | Ga0075370_10038106 | 3300006353 | Bacteria | 2705 |
| 100 | Ga0068871_100000638 | 3300006358 | Bacteria | 24082 |
| 101 | Ga0068865_100702973 | 3300006881 | Bacteria | 864 |
| 102 | Ga0099826_10000005 | 3300006948 | Bacteria | 465206 |
| 103 | Ga0105251_10035840 | 3300009011 | Bacteria | 2445 |
| 104 | Ga0105244_10008754 | 3300009036 | Bacteria | 6293 |
| 105 | Ga0105244_10008940 | 3300009036 | Bacteria | 6201 |
| 106 | Ga0105240_10035812 | 3300009093 | Bacteria | 6392 |
| 107 | Ga0105240_10193821 | 3300009093 | Bacteria | 2388 |
| 108 | Ga0105240_10534436 | 3300009093 | Bacteria | 1299 |
| 109 | Ga0111539_10309447 | 3300009094 | Bacteria | 1838 |
| 110 | Ga0105245_10039862 | 3300009098 | Bacteria | 4182 |
| 111 | Ga0105245_10099696 | 3300009098 | Bacteria | 2686 |
| 112 | Ga0105243_10023507 | 3300009148 | Bacteria | 4694 |
| 113 | Ga0105241_10004455 | 3300009174 | Bacteria | 10358 |
| 114 | Ga0105242_10145097 | 3300009176 | Bacteria | 2064 |
| 115 | Ga0105238_10082619 | 3300009551 | Bacteria | 3202 |
| 116 | Ga0105246_10106875 | 3300011119 | Bacteria | 2048 |
| 117 | Ga0157371_10000014 | 3300013102 | Bacteria | 347490 |
| 118 | Ga0157371_10252115 | 3300013102 | Bacteria | 1271 |
| 119 | Ga0157370_10042640 | 3300013104 | Bacteria | 4371 |
| 120 | Ga0157370_10620228 | 3300013104 | Bacteria | 990 |
| 121 | Ga0157378_10002428 | 3300013297 | Bacteria | 16569 |
| 122 | Ga0157378_10091197 | 3300013297 | Bacteria | 2770 |
| 123 | Ga0163162_10019684 | 3300013306 | Bacteria | 6625 |
| 124 | Ga0163162_10033542 | 3300013306 | Bacteria | 5102 |
| 125 | Ga0163162_10518733 | 3300013306 | Bacteria | 1321 |
| 126 | Ga0157380_10272704 | 3300014326 | Bacteria | 1543 |
| 127 | Ga0182008_10000231 | 3300014497 | Bacteria | 43471 |
| 128 | Ga0157379_10025665 | 3300014968 | Bacteria | 5236 |
| 129 | Ga0157379_10054399 | 3300014968 | Bacteria | 3576 |
| 130 | Ga0157379_10547118 | 3300014968 | Bacteria | 1077 |
| 131 | Ga0157376_10024502 | 3300014969 | Bacteria | 4739 |
| 132 | Ga0182006_1000004 | 3300015261 | Bacteria | 622190 |
| 133 | Ga0182006_1000176 | 3300015261 | Bacteria | 67387 |
| 134 | Ga0182006_1029981 | 3300015261 | Bacteria | 2201 |
| 135 | Ga0182006_1144869 | 3300015261 | Bacteria | 809 |
| 136 | Ga0182007_10001618 | 3300015262 | Bacteria | 11961 |
| 137 | Ga0182005_1000005 | 3300015265 | Bacteria | 537378 |
| 138 | Ga0182005_1000030 | 3300015265 | Bacteria | 213092 |
| 139 | Ga0163161_10028570 | 3300017792 | Bacteria | 3961 |
| 140 | Ga0163161_10029767 | 3300017792 | Bacteria | 3881 |
| 141 | Ga0163161_10071615 | 3300017792 | Bacteria | 2537 |
| 142 | Ga0213872_10000504 | 3300021361 | Bacteria | 30966 |
| 143 | Ga0213872_10001863 | 3300021361 | Bacteria | 13043 |
| 144 | Ga0213872_10010875 | 3300021361 | Bacteria | 4319 |
| 145 | Ga0209435_100048 | 3300025206 | Bacteria | 92746 |
| 146 | Ga0209435_100225 | 3300025206 | Bacteria | 15779 |
| 147 | Ga0209436_100090 | 3300025208 | Bacteria | 45531 |
| 148 | Ga0209436_101258 | 3300025208 | Bacteria | 9115 |
| 149 | Ga0209147_100122 | 3300025229 | Bacteria | 138553 |
| 150 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 151 | Ga0209437_100081 | 3300025233 | Bacteria | 271072 |
| 152 | Ga0209437_104536 | 3300025233 | Bacteria | 2438 |
| 153 | Ga0209258_100230 | 3300025242 | Bacteria | 104468 |
| 154 | Ga0207425_1000017 | 3300025245 | Bacteria | 423851 |
| 155 | Ga0207425_1000341 | 3300025245 | Bacteria | 32384 |
| 156 | Ga0207425_1000397 | 3300025245 | Bacteria | 29297 |
| 157 | Ga0207425_1033144 | 3300025245 | Bacteria | 1019 |
| 158 | Ga0209646_1000036 | 3300025246 | Bacteria | 358864 |
| 159 | Ga0209646_1000130 | 3300025246 | Bacteria | 128556 |
| 160 | Ga0209646_1000152 | 3300025246 | Bacteria | 97484 |
| 161 | Ga0209026_1000126 | 3300025250 | Bacteria | 122422 |
| 162 | Ga0209026_1003081 | 3300025250 | Bacteria | 5695 |
| 163 | Ga0209677_115509 | 3300025253 | Bacteria | 1002 |
| 164 | Ga0209148_1001208 | 3300025254 | Bacteria | 14673 |
| 165 | Ga0209759_1000193 | 3300025256 | Bacteria | 97484 |
| 166 | Ga0209759_1001123 | 3300025256 | Bacteria | 17232 |
| 167 | Ga0209129_1000039 | 3300025258 | Bacteria | 322444 |
| 168 | Ga0209129_1000088 | 3300025258 | Bacteria | 179071 |
| 169 | Ga0209129_1010411 | 3300025258 | Bacteria | 2321 |
| 170 | Ga0209565_1000018 | 3300025263 | Bacteria | 460940 |
| 171 | Ga0209565_1001328 | 3300025263 | Bacteria | 11325 |
| 172 | Ga0209565_1004071 | 3300025263 | Bacteria | 4555 |
| 173 | Ga0209565_1004755 | 3300025263 | Bacteria | 4076 |
| 174 | Ga0209565_1013248 | 3300025263 | Bacteria | 1934 |
| 175 | Ga0209565_1020726 | 3300025263 | Bacteria | 1384 |
| 176 | Ga0209565_1023630 | 3300025263 | Bacteria | 1261 |
| 177 | Ga0209455_1000047 | 3300025272 | Bacteria | 379709 |
| 178 | Ga0209455_1006928 | 3300025272 | Bacteria | 3279 |
| 179 | Ga0209673_1000090 | 3300025273 | Bacteria | 202223 |
| 180 | Ga0209130_1001116 | 3300025284 | Bacteria | 19716 |
| 181 | Ga0209130_1001315 | 3300025284 | Bacteria | 16986 |
| 182 | Ga0209130_1003207 | 3300025284 | Bacteria | 7206 |
| 183 | Ga0209675_1000005 | 3300025291 | Bacteria | 849192 |
| 184 | Ga0209675_1001071 | 3300025291 | Bacteria | 16951 |
| 185 | Ga0209675_1008948 | 3300025291 | Bacteria | 3600 |
| 186 | Ga0209025_1011979 | 3300025294 | Bacteria | 5626 |
| 187 | Ga0209564_1000060 | 3300025295 | Bacteria | 325890 |
| 188 | Ga0209564_1000078 | 3300025295 | Bacteria | 275766 |
| 189 | Ga0209564_1000348 | 3300025295 | Bacteria | 86984 |
| 190 | Ga0209564_1000626 | 3300025295 | Bacteria | 53912 |
| 191 | Ga0209564_1008728 | 3300025295 | Bacteria | 4945 |
| 192 | Ga0209564_1030211 | 3300025295 | Bacteria | 1683 |
| 193 | Ga0209758_1000137 | 3300025297 | Bacteria | 176734 |
| 194 | Ga0209758_1000895 | 3300025297 | Bacteria | 40555 |
| 195 | Ga0209050_1000598 | 3300025298 | Bacteria | 57505 |
| 196 | Ga0209050_1003979 | 3300025298 | Bacteria | 10424 |
| 197 | Ga0209050_1004001 | 3300025298 | Bacteria | 10390 |
| 198 | Ga0209256_1000040 | 3300025299 | Bacteria | 366839 |
| 199 | Ga0209256_1000189 | 3300025299 | Bacteria | 117922 |
| 200 | Ga0209256_1000601 | 3300025299 | Bacteria | 49925 |
| 201 | Ga0209256_1003275 | 3300025299 | Bacteria | 11590 |
| 202 | Ga0209256_1008841 | 3300025299 | Bacteria | 4557 |
| 203 | Ga0207426_1002086 | 3300025302 | Bacteria | 13819 |
| 204 | Ga0209051_1016883 | 3300025303 | Bacteria | 3280 |
| 205 | Ga0209257_1010731 | 3300025304 | Bacteria | 4561 |
| 206 | Ga0207697_10010078 | 3300025315 | Bacteria | 4058 |
| 207 | Ga0207655_1001915 | 3300025728 | Bacteria | 17866 |
| 208 | Ga0207655_1033252 | 3300025728 | Bacteria | 2340 |
| 209 | Ga0207682_10000396 | 3300025893 | Bacteria | 20033 |
| 210 | Ga0207642_10007487 | 3300025899 | Bacteria | 3692 |
| 211 | Ga0207688_10013245 | 3300025901 | Bacteria | 4482 |
| 212 | Ga0207680_10142283 | 3300025903 | Bacteria | 1591 |
| 213 | Ga0207645_10004613 | 3300025907 | Bacteria | 10153 |
| 214 | Ga0207643_10117333 | 3300025908 | Bacteria | 1573 |
| 215 | Ga0207705_10011718 | 3300025909 | Bacteria | 6335 |
| 216 | Ga0207695_10007570 | 3300025913 | Bacteria | 13769 |
| 217 | Ga0207695_10014717 | 3300025913 | Bacteria | 9252 |
| 218 | Ga0207693_10416849 | 3300025915 | Bacteria | 1050 |
| 219 | Ga0207660_10094647 | 3300025917 | Bacteria | 2221 |
| 220 | Ga0207662_10002632 | 3300025918 | Bacteria | 9056 |
| 221 | Ga0207662_10196206 | 3300025918 | Bacteria | 1305 |
| 222 | Ga0207657_10003671 | 3300025919 | Bacteria | 16325 |
| 223 | Ga0207657_10050467 | 3300025919 | Bacteria | 3621 |
| 224 | Ga0207657_10167012 | 3300025919 | Bacteria | 1784 |
| 225 | Ga0207649_10139865 | 3300025920 | Bacteria | 1655 |
| 226 | Ga0207649_10269949 | 3300025920 | Bacteria | 1232 |
| 227 | Ga0207694_10055883 | 3300025924 | Bacteria | 3065 |
| 228 | Ga0207650_10210439 | 3300025925 | Bacteria | 1561 |
| 229 | Ga0207687_10055772 | 3300025927 | Bacteria | 2770 |
| 230 | Ga0207687_10083746 | 3300025927 | Bacteria | 2310 |
| 231 | Ga0207664_10081013 | 3300025929 | Bacteria | 2640 |
| 232 | Ga0207706_10010122 | 3300025933 | Bacteria | 8635 |
| 233 | Ga0207686_10342305 | 3300025934 | Bacteria | 1123 |
| 234 | Ga0207709_10017824 | 3300025935 | Bacteria | 3969 |
| 235 | Ga0207709_10043577 | 3300025935 | Bacteria | 2706 |
| 236 | Ga0207669_10070171 | 3300025937 | Bacteria | 2195 |
| 237 | Ga0207669_10143380 | 3300025937 | Bacteria | 1662 |
| 238 | Ga0207711_10213364 | 3300025941 | Bacteria | 1764 |
| 239 | Ga0207689_10040563 | 3300025942 | Bacteria | 3853 |
| 240 | Ga0207661_10025986 | 3300025944 | Bacteria | 4457 |
| 241 | Ga0207679_10002872 | 3300025945 | Bacteria | 10685 |
| 242 | Ga0207679_10341225 | 3300025945 | Bacteria | 1303 |
| 243 | Ga0207667_10044688 | 3300025949 | Bacteria | 4693 |
| 244 | Ga0207667_10200117 | 3300025949 | Bacteria | 2049 |
| 245 | Ga0207658_10105280 | 3300025986 | Bacteria | 2218 |
| 246 | Ga0207677_10075788 | 3300026023 | Bacteria | 2392 |
| 247 | Ga0207703_10011138 | 3300026035 | Bacteria | 7002 |
| 248 | Ga0207678_10249299 | 3300026067 | Bacteria | 1521 |
| 249 | Ga0207708_10001740 | 3300026075 | Bacteria | 16079 |
| 250 | Ga0207702_10098293 | 3300026078 | Bacteria | 2578 |
| 251 | Ga0207702_10482459 | 3300026078 | Bacteria | 1206 |
| 252 | Ga0207641_10045680 | 3300026088 | Bacteria | 3689 |
| 253 | Ga0207648_10002465 | 3300026089 | Bacteria | 19880 |
| 254 | Ga0207674_10071261 | 3300026116 | Bacteria | 3492 |
| 255 | Ga0207675_100057588 | 3300026118 | Bacteria | 3626 |
| 256 | Ga0207698_10043065 | 3300026142 | Bacteria | 3379 |
| 257 | Ga0209969_1001118 | 3300027360 | Bacteria | 3677 |
| 258 | Ga0209996_1006507 | 3300027395 | Bacteria | 1510 |
| 259 | Ga0209995_1002583 | 3300027471 | Bacteria | 2865 |
| 260 | Ga0209983_1015344 | 3300027665 | Bacteria | 1580 |
| 261 | Ga0209282_1000003 | 3300027666 | Bacteria | 856377 |
| 262 | Ga0209971_1004552 | 3300027682 | Bacteria | 3290 |
| 263 | Ga0209974_10023418 | 3300027876 | Bacteria | 2044 |
| 264 | Ga0268266_10162250 | 3300028379 | Bacteria | 2023 |
| 265 | Ga0268265_10534379 | 3300028380 | Bacteria | 1110 |
| 266 | Ga0268264_10239639 | 3300028381 | Bacteria | 1679 |
| 267 | Ga0307515_10294504 | 3300028794 | Bacteria | 1315 |
| 268 | Ga0265324_10055303 | 3300029957 | Bacteria | 1361 |
| 269 | Ga0265331_10000237 | 3300031250 | Bacteria | 66600 |
| 270 | Ga0265327_10000517 | 3300031251 | Bacteria | 66613 |
| 271 | Ga0265327_10100303 | 3300031251 | Bacteria | 1398 |
| 272 | Ga0307408_100000511 | 3300031548 | Bacteria | 33537 |
| 273 | Ga0307408_100000604 | 3300031548 | Bacteria | 30833 |
| 274 | Ga0307408_100034763 | 3300031548 | Bacteria | 3532 |
| 275 | Ga0307408_100053643 | 3300031548 | Bacteria | 2912 |
| 276 | Ga0316579_10029788 | 3300031691 | Bacteria | 2491 |
| 277 | Ga0307518_10023324 | 3300031838 | Bacteria | 4458 |
| 278 | Ga0307416_100504644 | 3300032002 | Bacteria | 1275 |
| 279 | Ga0316583_10010274 | 3300032133 | Bacteria | 3373 |
| 280 | Ga0373932_0039320 | 3300035112 | Bacteria | 1356 |
| 281 | Ga0373960_0144401 | 3300035121 | Bacteria | 808 |
| 282 | Ga0316574_0069730 | 3300035398 | Bacteria | 2219 |
| 283 | Ga0373937_0537079 | 3300036401 | Bacteria | 1111 |
| 284 | Ga0373925_0768015 | 3300037068 | Bacteria | 795 |
| 285 | Ga0395899_0000161 | 3300037312 | Bacteria | 102608 |
| 286 | Ga0395899_0001217 | 3300037312 | Bacteria | 22538 |
| 287 | Ga0395899_0002963 | 3300037312 | Bacteria | 13588 |
| 288 | Ga0395899_0039203 | 3300037312 | Bacteria | 3547 |
| 289 | Ga0395899_0097538 | 3300037312 | Bacteria | 2124 |
| 290 | Ga0395899_0104936 | 3300037312 | Bacteria | 2036 |
| 291 | Ga0395899_0133806 | 3300037312 | Bacteria | 1768 |
| 292 | Ga0395899_0390940 | 3300037312 | Bacteria | 922 |
| 293 | Ga0395900_0003402 | 3300037418 | Bacteria | 17187 |
| 294 | Ga0395900_0004563 | 3300037418 | Bacteria | 14631 |
| 295 | Ga0395900_0007120 | 3300037418 | Bacteria | 11589 |
| 296 | Ga0395900_0035585 | 3300037418 | Bacteria | 5129 |
| 297 | Ga0395900_0186012 | 3300037418 | Bacteria | 2108 |
| 298 | Ga0395900_0341275 | 3300037418 | Bacteria | 1473 |
| 299 | Ga0395900_0363190 | 3300037418 | Bacteria | 1419 |
| 300 | Ga0395898_0003439 | 3300037466 | Bacteria | 17699 |
| 301 | Ga0395898_0160098 | 3300037466 | Bacteria | 2153 |
| 302 | Ga0395898_0171946 | 3300037466 | Bacteria | 2071 |
| 303 | Ga0395898_0324532 | 3300037466 | Bacteria | 1468 |
| 304 | Ga0395898_0411362 | 3300037466 | Bacteria | 1289 |
| 305 | Ga0395905_0000137 | 3300037471 | Bacteria | 120800 |
| 306 | Ga0395905_0010634 | 3300037471 | Bacteria | 8928 |
| 307 | Ga0395905_0023218 | 3300037471 | Bacteria | 5862 |
| 308 | Ga0395905_0053658 | 3300037471 | Bacteria | 3772 |
| 309 | Ga0395905_0174378 | 3300037471 | Bacteria | 2019 |
| 310 | Ga0395905_0327650 | 3300037471 | Bacteria | 1422 |
| 311 | Ga0395905_0371050 | 3300037471 | Bacteria | 1324 |
| 312 | Ga0395905_0401898 | 3300037471 | Bacteria | 1265 |
| 313 | Ga0395905_0555299 | 3300037471 | Bacteria | 1049 |
| 314 | Ga0395901_0001241 | 3300038443 | Bacteria | 27240 |
| 315 | Ga0395901_0001265 | 3300038443 | Bacteria | 26801 |
| 316 | Ga0395901_0035568 | 3300038443 | Bacteria | 5147 |
| 317 | Ga0395901_0061313 | 3300038443 | Bacteria | 3913 |
| 318 | Ga0395901_0061841 | 3300038443 | Bacteria | 3896 |
| 319 | Ga0395901_0124271 | 3300038443 | Bacteria | 2711 |
| 320 | Ga0395901_0134427 | 3300038443 | Bacteria | 2599 |
| 321 | Ga0395901_0152351 | 3300038443 | Bacteria | 2429 |
| 322 | Ga0436361_0067343 | 3300039447 | Bacteria | 3918 |
| 323 | Ga0436361_0557931 | 3300039447 | Bacteria | 973 |
| 324 | Ga0436361_0674923 | 3300039447 | Bacteria | 2496 |
| 325 | Ga0436361_1070108 | 3300039447 | Bacteria | 31324 |
| 326 | Ga0436361_1096226 | 3300039447 | Bacteria | 9055 |
| 327 | Ga0439465_0027121 | 3300041413 | Bacteria | 1813 |
| 328 | Ga0439441_001947 | 3300042001 | Bacteria | 2833 |
| 329 | Ga0439448_0010362 | 3300042005 | Bacteria | 2763 |
| 330 | Ga0439455_0001382 | 3300042012 | Bacteria | 4032 |
| 331 | Ga0439455_0003557 | 3300042012 | Bacteria | 2992 |
| 332 | Ga0450904_001005 | 3300042139 | Bacteria | 4374 |
| 333 | Ga0439458_0014183 | 3300042157 | Bacteria | 1797 |
| 334 | Ga0439458_0033461 | 3300042157 | Bacteria | 1231 |
| 335 | Ga0439460_0088653 | 3300042461 | Bacteria | 980 |
| 336 | Ga0466969_0058096 | 3300044656 | Bacteria | 1884 |
| 337 | Ga0466972_0000327 | 3300044658 | Bacteria | 26794 |
| 338 | Ga0466972_0012337 | 3300044658 | Bacteria | 4295 |
| 339 | Ga0466972_0059397 | 3300044658 | Bacteria | 1835 |
| 340 | Ga0466972_0120736 | 3300044658 | Bacteria | 1236 |
| 341 | Ga0466965_0006991 | 3300044683 | Bacteria | 5163 |
| 342 | Ga0466965_0026378 | 3300044683 | Bacteria | 2817 |
| 343 | Ga0466965_0028687 | 3300044683 | Bacteria | 2704 |
| 344 | Ga0466965_0040088 | 3300044683 | Bacteria | 2304 |
| 345 | Ga0466965_0071293 | 3300044683 | Bacteria | 1747 |
| 346 | Ga0466965_0117394 | 3300044683 | Bacteria | 1372 |
| 347 | Ga0466966_0015642 | 3300044684 | Bacteria | 5016 |
| 348 | Ga0466966_0044458 | 3300044684 | Bacteria | 2843 |
| 349 | Ga0466966_0076831 | 3300044684 | Bacteria | 2084 |
| 350 | Ga0466966_0097402 | 3300044684 | Bacteria | 1821 |
| 351 | Ga0466961_0233942 | 3300044693 | Bacteria | 1130 |
| 352 | Ga0466964_0007552 | 3300044706 | Bacteria | 4067 |
| 353 | Ga0466964_0020832 | 3300044706 | Bacteria | 2528 |
| 354 | Ga0466964_0108333 | 3300044706 | Bacteria | 1235 |
| 355 | Ga0466971_0079333 | 3300044719 | Bacteria | 1496 |
| 356 | Ga0466968_0019441 | 3300044735 | Bacteria | 2734 |
| 357 | Ga0466968_0325371 | 3300044735 | Bacteria | 743 |
| 358 | Ga0466970_0021724 | 3300044765 | Bacteria | 3345 |
| 359 | Ga0466970_0073148 | 3300044765 | Bacteria | 1845 |
| 360 | Ga0466970_0211378 | 3300044765 | Bacteria | 1081 |
| 361 | Ga0466957_0054933 | 3300044842 | Bacteria | 2432 |
| 362 | Ga0466957_0069558 | 3300044842 | Bacteria | 2174 |
| 363 | Ga0466957_0152524 | 3300044842 | Bacteria | 1495 |
| 364 | Ga0466957_0205808 | 3300044842 | Bacteria | 1294 |
| 365 | Ga0466959_0045767 | 3300045049 | Bacteria | 3222 |
| 366 | Ga0466959_0051132 | 3300045049 | Bacteria | 3032 |
| 367 | Ga0466959_0192115 | 3300045049 | Bacteria | 1424 |
| 368 | Ga0466958_0091202 | 3300045836 | Bacteria | 1886 |
| 369 | Ga0466967_0028106 | 3300045976 | Bacteria | 4690 |
| 370 | Ga0466967_0033721 | 3300045976 | Bacteria | 4337 |
| 371 | Ga0466967_0101302 | 3300045976 | Bacteria | 2632 |
| 372 | Ga0495617_000005 | 3300046452 | Bacteria | 404687 |
| 373 | Ga0495617_000015 | 3300046452 | Bacteria | 260968 |
| 374 | Ga0495617_000578 | 3300046452 | Bacteria | 18757 |
| 375 | Ga0495617_005569 | 3300046452 | Bacteria | 4456 |
| 376 | Ga0495617_005661 | 3300046452 | Bacteria | 4416 |
| 377 | Ga0495627_000038 | 3300046453 | Bacteria | 198316 |
| 378 | Ga0495627_000186 | 3300046453 | Bacteria | 69314 |
| 379 | Ga0495603_0015382 | 3300046455 | Bacteria | 4628 |
| 380 | Ga0495603_0045046 | 3300046455 | Bacteria | 2632 |
| 381 | Ga0495603_0123400 | 3300046455 | Bacteria | 1509 |
| 382 | Ga0495590_0000011 | 3300046457 | Bacteria | 307470 |
| 383 | Ga0495590_0000644 | 3300046457 | Bacteria | 16180 |
| 384 | Ga0495590_0004747 | 3300046457 | Bacteria | 5449 |
| 385 | Ga0495590_0014627 | 3300046457 | Bacteria | 2861 |
| 386 | Ga0495590_0016718 | 3300046457 | Bacteria | 2648 |
| 387 | Ga0495591_000814 | 3300046458 | Bacteria | 22076 |
| 388 | Ga0495591_007812 | 3300046458 | Bacteria | 4472 |
| 389 | Ga0495629_0011951 | 3300046459 | Bacteria | 6296 |
| 390 | Ga0495629_0103119 | 3300046459 | Bacteria | 1990 |
| 391 | Ga0495638_0000058 | 3300046460 | Bacteria | 192656 |
| 392 | Ga0495638_0011400 | 3300046460 | Bacteria | 6125 |
| 393 | Ga0495638_0065080 | 3300046460 | Bacteria | 2245 |
| 394 | Ga0495638_0066715 | 3300046460 | Bacteria | 2211 |
| 395 | Ga0495638_0093868 | 3300046460 | Bacteria | 1804 |
| 396 | Ga0495638_0246243 | 3300046460 | Bacteria | 987 |
| 397 | Ga0495653_0000031 | 3300046463 | Bacteria | 137159 |
| 398 | Ga0495653_0018992 | 3300046463 | Bacteria | 5577 |
| 399 | Ga0495650_0000152 | 3300046471 | Bacteria | 156983 |
| 400 | Ga0495650_0000480 | 3300046471 | Bacteria | 61049 |
| 401 | Ga0495650_0000700 | 3300046471 | Bacteria | 42992 |
| 402 | Ga0495650_0000962 | 3300046471 | Bacteria | 33039 |
| 403 | Ga0495650_0001811 | 3300046471 | Bacteria | 19221 |
| 404 | Ga0495650_0002693 | 3300046471 | Bacteria | 13792 |
| 405 | Ga0495650_0021108 | 3300046471 | Bacteria | 3156 |
| 406 | Ga0495580_0477232 | 3300046472 | Bacteria | 834 |
| 407 | Ga0495582_0024678 | 3300046473 | Bacteria | 3290 |
| 408 | Ga0495582_0030001 | 3300046473 | Bacteria | 2984 |
| 409 | Ga0495605_0000021 | 3300046474 | Bacteria | 248512 |
| 410 | Ga0495605_0000082 | 3300046474 | Bacteria | 125136 |
| 411 | Ga0495605_0000408 | 3300046474 | Bacteria | 39353 |
| 412 | Ga0495605_0006381 | 3300046474 | Bacteria | 6790 |
| 413 | Ga0495605_0014561 | 3300046474 | Bacteria | 4302 |
| 414 | Ga0495605_0018022 | 3300046474 | Bacteria | 3792 |
| 415 | Ga0495605_0034387 | 3300046474 | Bacteria | 2566 |
| 416 | Ga0495605_0038539 | 3300046474 | Bacteria | 2397 |
| 417 | Ga0495605_0038836 | 3300046474 | Bacteria | 2386 |
| 418 | Ga0495605_0086716 | 3300046474 | Bacteria | 1456 |
| 419 | Ga0495584_0000009 | 3300046491 | Bacteria | 236318 |
| 420 | Ga0495584_0001552 | 3300046491 | Bacteria | 13647 |
| 421 | Ga0495584_0007345 | 3300046491 | Bacteria | 5745 |
| 422 | Ga0495584_0010378 | 3300046491 | Bacteria | 4788 |
| 423 | Ga0495584_0014421 | 3300046491 | Bacteria | 4026 |
| 424 | Ga0495584_0014452 | 3300046491 | Bacteria | 4021 |
| 425 | Ga0495584_0017925 | 3300046491 | Bacteria | 3600 |
| 426 | Ga0495584_0021788 | 3300046491 | Bacteria | 3254 |
| 427 | Ga0495584_0022133 | 3300046491 | Bacteria | 3226 |
| 428 | Ga0495584_0026386 | 3300046491 | Bacteria | 2943 |
| 429 | Ga0495584_0028256 | 3300046491 | Bacteria | 2841 |
| 430 | Ga0495584_0038362 | 3300046491 | Bacteria | 2421 |
| 431 | Ga0495584_0069818 | 3300046491 | Bacteria | 1765 |
| 432 | Ga0495584_0084207 | 3300046491 | Bacteria | 1601 |
| 433 | Ga0495584_0117517 | 3300046491 | Bacteria | 1346 |
| 434 | Ga0495585_0000107 | 3300046492 | Bacteria | 89033 |
| 435 | Ga0495585_0000318 | 3300046492 | Bacteria | 47858 |
| 436 | Ga0495585_0001768 | 3300046492 | Bacteria | 16401 |
| 437 | Ga0495585_0004190 | 3300046492 | Bacteria | 9414 |
| 438 | Ga0495585_0017410 | 3300046492 | Bacteria | 4151 |
| 439 | Ga0495585_0020133 | 3300046492 | Bacteria | 3839 |
| 440 | Ga0495585_0021739 | 3300046492 | Bacteria | 3683 |
| 441 | Ga0495585_0023006 | 3300046492 | Bacteria | 3576 |
| 442 | Ga0495585_0026887 | 3300046492 | Bacteria | 3285 |
| 443 | Ga0495585_0034447 | 3300046492 | Bacteria | 2862 |
| 444 | Ga0495585_0035580 | 3300046492 | Bacteria | 2812 |
| 445 | Ga0495585_0043964 | 3300046492 | Bacteria | 2496 |
| 446 | Ga0495585_0049126 | 3300046492 | Bacteria | 2343 |
| 447 | Ga0495585_0060109 | 3300046492 | Bacteria | 2092 |
| 448 | Ga0495585_0097302 | 3300046492 | Bacteria | 1578 |
| 449 | Ga0495585_0125523 | 3300046492 | Bacteria | 1354 |
| 450 | Ga0495585_0132959 | 3300046492 | Bacteria | 1308 |
| 451 | Ga0495585_0199214 | 3300046492 | Bacteria | 1020 |
| 452 | Ga0495594_0008863 | 3300046499 | Bacteria | 5188 |
| 453 | Ga0495594_0020766 | 3300046499 | Bacteria | 3500 |
| 454 | Ga0495594_0022414 | 3300046499 | Bacteria | 3378 |
| 455 | Ga0495594_0032513 | 3300046499 | Bacteria | 2832 |
| 456 | Ga0495594_0037613 | 3300046499 | Bacteria | 2640 |
| 457 | Ga0495596_0000402 | 3300046500 | Bacteria | 27667 |
| 458 | Ga0495596_0002710 | 3300046500 | Bacteria | 9315 |
| 459 | Ga0495596_0002746 | 3300046500 | Bacteria | 9238 |
| 460 | Ga0495596_0003161 | 3300046500 | Bacteria | 8485 |
| 461 | Ga0495596_0003393 | 3300046500 | Bacteria | 8086 |
| 462 | Ga0495596_0015384 | 3300046500 | Bacteria | 3205 |
| 463 | Ga0495596_0016137 | 3300046500 | Bacteria | 3108 |
| 464 | Ga0495596_0020649 | 3300046500 | Bacteria | 2694 |
| 465 | Ga0495596_0042814 | 3300046500 | Bacteria | 1784 |
| 466 | Ga0495607_0003324 | 3300046501 | Bacteria | 12347 |
| 467 | Ga0495607_0012878 | 3300046501 | Bacteria | 5500 |
| 468 | Ga0495607_0013241 | 3300046501 | Bacteria | 5413 |
| 469 | Ga0495607_0017972 | 3300046501 | Bacteria | 4520 |
| 470 | Ga0495607_0020283 | 3300046501 | Bacteria | 4205 |
| 471 | Ga0495607_0022189 | 3300046501 | Bacteria | 3991 |
| 472 | Ga0495607_0025050 | 3300046501 | Bacteria | 3715 |
| 473 | Ga0495607_0039620 | 3300046501 | Bacteria | 2813 |
| 474 | Ga0495607_0057702 | 3300046501 | Bacteria | 2223 |
| 475 | Ga0495607_0152104 | 3300046501 | Bacteria | 1183 |
| 476 | Ga0495607_0158218 | 3300046501 | Bacteria | 1153 |
| 477 | Ga0495607_0197575 | 3300046501 | Bacteria | 997 |
| 478 | Ga0495583_0000016 | 3300046506 | Bacteria | 312691 |
| 479 | Ga0495583_0000191 | 3300046506 | Bacteria | 102390 |
| 480 | Ga0495583_0000319 | 3300046506 | Bacteria | 76152 |
| 481 | Ga0495583_0000751 | 3300046506 | Bacteria | 41181 |
| 482 | Ga0495583_0010592 | 3300046506 | Bacteria | 5363 |
| 483 | Ga0495583_0014077 | 3300046506 | Bacteria | 4425 |
| 484 | Ga0495583_0016061 | 3300046506 | Bacteria | 4042 |
| 485 | Ga0495583_0019048 | 3300046506 | Bacteria | 3592 |
| 486 | Ga0495583_0040867 | 3300046506 | Bacteria | 2175 |
| 487 | Ga0495606_0000276 | 3300046507 | Bacteria | 90441 |
| 488 | Ga0495606_0001057 | 3300046507 | Bacteria | 39799 |
| 489 | Ga0495606_0001130 | 3300046507 | Bacteria | 38068 |
| 490 | Ga0495606_0001852 | 3300046507 | Bacteria | 26592 |
| 491 | Ga0495606_0002481 | 3300046507 | Bacteria | 21350 |
| 492 | Ga0495606_0002801 | 3300046507 | Bacteria | 19416 |
| 493 | Ga0495606_0003539 | 3300046507 | Bacteria | 16500 |
| 494 | Ga0495606_0006497 | 3300046507 | Bacteria | 10754 |
| 495 | Ga0495606_0041193 | 3300046507 | Bacteria | 3098 |
| 496 | Ga0495606_0046869 | 3300046507 | Bacteria | 2854 |
| 497 | Ga0495606_0057318 | 3300046507 | Bacteria | 2509 |
| 498 | Ga0495606_0148442 | 3300046507 | Bacteria | 1378 |
| 499 | Ga0495606_0218512 | 3300046507 | Bacteria | 1075 |
| 500 | Ga0495606_0286082 | 3300046507 | Bacteria | 899 |
| 501 | Ga0495610_0000007 | 3300046512 | Bacteria | 820919 |
| 502 | Ga0495610_0002183 | 3300046512 | Bacteria | 16605 |
| 503 | Ga0495610_0004019 | 3300046512 | Bacteria | 11094 |
| 504 | Ga0495610_0010453 | 3300046512 | Bacteria | 5765 |
| 505 | Ga0495610_0014159 | 3300046512 | Bacteria | 4701 |
| 506 | Ga0495610_0014189 | 3300046512 | Bacteria | 4693 |
| 507 | Ga0495610_0041754 | 3300046512 | Bacteria | 2300 |
| 508 | Ga0495616_0000749 | 3300046513 | Bacteria | 23720 |
| 509 | Ga0495616_0001218 | 3300046513 | Bacteria | 18122 |
| 510 | Ga0495616_0011693 | 3300046513 | Bacteria | 5018 |
| 511 | Ga0495616_0011712 | 3300046513 | Bacteria | 5013 |
| 512 | Ga0495616_0013262 | 3300046513 | Bacteria | 4657 |
| 513 | Ga0495616_0014409 | 3300046513 | Bacteria | 4425 |
| 514 | Ga0495616_0019026 | 3300046513 | Bacteria | 3754 |
| 515 | Ga0495616_0031360 | 3300046513 | Bacteria | 2783 |
| 516 | Ga0495616_0051402 | 3300046513 | Bacteria | 2055 |
| 517 | Ga0495616_0059648 | 3300046513 | Bacteria | 1876 |
| 518 | Ga0495616_0090352 | 3300046513 | Bacteria | 1451 |
| 519 | Ga0495620_0013747 | 3300046515 | Bacteria | 4137 |
| 520 | Ga0495630_0034913 | 3300046517 | Bacteria | 3757 |
| 521 | Ga0495630_0149760 | 3300046517 | Bacteria | 1775 |
| 522 | Ga0495631_0005248 | 3300046518 | Bacteria | 6812 |
| 523 | Ga0495631_0012648 | 3300046518 | Bacteria | 4116 |
| 524 | Ga0495631_0014553 | 3300046518 | Bacteria | 3792 |
| 525 | Ga0495631_0036584 | 3300046518 | Bacteria | 2191 |
| 526 | Ga0495631_0082344 | 3300046518 | Bacteria | 1387 |
| 527 | Ga0495631_0085051 | 3300046518 | Bacteria | 1363 |
| 528 | Ga0495631_0093092 | 3300046518 | Bacteria | 1297 |
| 529 | Ga0495631_0119294 | 3300046518 | Bacteria | 1134 |
| 530 | Ga0495632_0000090 | 3300046519 | Bacteria | 93838 |
| 531 | Ga0495632_0000184 | 3300046519 | Bacteria | 63861 |
| 532 | Ga0495632_0008137 | 3300046519 | Bacteria | 6483 |
| 533 | Ga0495632_0013914 | 3300046519 | Bacteria | 4571 |
| 534 | Ga0495632_0017476 | 3300046519 | Bacteria | 3956 |
| 535 | Ga0495632_0018215 | 3300046519 | Bacteria | 3858 |
| 536 | Ga0495632_0023559 | 3300046519 | Bacteria | 3286 |
| 537 | Ga0495637_0001177 | 3300046520 | Bacteria | 15969 |
| 538 | Ga0495637_0004283 | 3300046520 | Bacteria | 7408 |
| 539 | Ga0495637_0014283 | 3300046520 | Bacteria | 3748 |
| 540 | Ga0495637_0022999 | 3300046520 | Bacteria | 2837 |
| 541 | Ga0495637_0037567 | 3300046520 | Bacteria | 2101 |
| 542 | Ga0495637_0065832 | 3300046520 | Bacteria | 1474 |
| 543 | Ga0495643_0000230 | 3300046522 | Bacteria | 84299 |
| 544 | Ga0495643_0000420 | 3300046522 | Bacteria | 55396 |
| 545 | Ga0495643_0010866 | 3300046522 | Bacteria | 5578 |
| 546 | Ga0495643_0025951 | 3300046522 | Bacteria | 3311 |
| 547 | Ga0495643_0031189 | 3300046522 | Bacteria | 2968 |
| 548 | Ga0495643_0042233 | 3300046522 | Bacteria | 2484 |
| 549 | Ga0495643_0092186 | 3300046522 | Bacteria | 1562 |
| 550 | Ga0495644_0003060 | 3300046523 | Bacteria | 6614 |
| 551 | Ga0495644_0009727 | 3300046523 | Bacteria | 3701 |
| 552 | Ga0495644_0020872 | 3300046523 | Bacteria | 2498 |
| 553 | Ga0495644_0028843 | 3300046523 | Bacteria | 2099 |
| 554 | Ga0495644_0063374 | 3300046523 | Bacteria | 1389 |
| 555 | Ga0495644_0108519 | 3300046523 | Bacteria | 1052 |
| 556 | Ga0495648_0000082 | 3300046524 | Bacteria | 123682 |
| 557 | Ga0495648_0001254 | 3300046524 | Bacteria | 25334 |
| 558 | Ga0495648_0006814 | 3300046524 | Bacteria | 9230 |
| 559 | Ga0495648_0011977 | 3300046524 | Bacteria | 6500 |
| 560 | Ga0495648_0013312 | 3300046524 | Bacteria | 6089 |
| 561 | Ga0495648_0032223 | 3300046524 | Bacteria | 3442 |
| 562 | Ga0495648_0056080 | 3300046524 | Bacteria | 2372 |
| 563 | Ga0495648_0138100 | 3300046524 | Bacteria | 1286 |
| 564 | Ga0495648_0190643 | 3300046524 | Bacteria | 1034 |
| 565 | Ga0495663_0002300 | 3300046525 | Bacteria | 5781 |
| 566 | Ga0495663_0037962 | 3300046525 | Bacteria | 1454 |
| 567 | Ga0495666_0000188 | 3300046526 | Bacteria | 26481 |
| 568 | Ga0495666_0011597 | 3300046526 | Bacteria | 4393 |
| 569 | Ga0495666_0025051 | 3300046526 | Bacteria | 2948 |
| 570 | Ga0495666_0025891 | 3300046526 | Bacteria | 2895 |
| 571 | Ga0495666_0035999 | 3300046526 | Bacteria | 2411 |
| 572 | Ga0495666_0046367 | 3300046526 | Bacteria | 2095 |
| 573 | Ga0495666_0078076 | 3300046526 | Bacteria | 1568 |
| 574 | Ga0495642_0000046 | 3300046528 | Bacteria | 74298 |
| 575 | Ga0495642_0006763 | 3300046528 | Bacteria | 4396 |
| 576 | Ga0495642_0011614 | 3300046528 | Bacteria | 3388 |
| 577 | Ga0495642_0040136 | 3300046528 | Bacteria | 1900 |
| 578 | Ga0495642_0102468 | 3300046528 | Bacteria | 1219 |
| 579 | Ga0495652_0032605 | 3300046529 | Bacteria | 4555 |
| 580 | Ga0495654_0002109 | 3300046530 | Bacteria | 13010 |
| 581 | Ga0495654_0011154 | 3300046530 | Bacteria | 4879 |
| 582 | Ga0495654_0012362 | 3300046530 | Bacteria | 4587 |
| 583 | Ga0495654_0019236 | 3300046530 | Bacteria | 3573 |
| 584 | Ga0495654_0049087 | 3300046530 | Bacteria | 2068 |
| 585 | Ga0495654_0085522 | 3300046530 | Bacteria | 1471 |
| 586 | Ga0495665_0007076 | 3300046531 | Bacteria | 6053 |
| 587 | Ga0495665_0013943 | 3300046531 | Bacteria | 4342 |
| 588 | Ga0495640_0079879 | 3300046533 | Bacteria | 2177 |
| 589 | Ga0495586_0004480 | 3300046535 | Bacteria | 7460 |
| 590 | Ga0495586_0019287 | 3300046535 | Bacteria | 3627 |
| 591 | Ga0495586_0042542 | 3300046535 | Bacteria | 2446 |
| 592 | Ga0495586_0109140 | 3300046535 | Bacteria | 1539 |
| 593 | Ga0495586_0132591 | 3300046535 | Bacteria | 1395 |
| 594 | Ga0495587_0010860 | 3300046536 | Bacteria | 5780 |
| 595 | Ga0495587_0123876 | 3300046536 | Bacteria | 1479 |
| 596 | Ga0495587_0142148 | 3300046536 | Bacteria | 1369 |
| 597 | Ga0495609_0000026 | 3300046538 | Bacteria | 251973 |
| 598 | Ga0495609_0000599 | 3300046538 | Bacteria | 28268 |
| 599 | Ga0495609_0002410 | 3300046538 | Bacteria | 11501 |
| 600 | Ga0495609_0006815 | 3300046538 | Bacteria | 5776 |
| 601 | Ga0495609_0007669 | 3300046538 | Bacteria | 5362 |
| 602 | Ga0495609_0007835 | 3300046538 | Bacteria | 5283 |
| 603 | Ga0495609_0015210 | 3300046538 | Bacteria | 3604 |
| 604 | Ga0495609_0016045 | 3300046538 | Bacteria | 3495 |
| 605 | Ga0495609_0019538 | 3300046538 | Bacteria | 3133 |
| 606 | Ga0495609_0020468 | 3300046538 | Bacteria | 3058 |
| 607 | Ga0495609_0026297 | 3300046538 | Bacteria | 2665 |
| 608 | Ga0495609_0036696 | 3300046538 | Bacteria | 2212 |
| 609 | Ga0495609_0058713 | 3300046538 | Bacteria | 1701 |
| 610 | Ga0495621_0017388 | 3300046539 | Bacteria | 2324 |
| 611 | Ga0495597_0000341 | 3300046542 | Bacteria | 41785 |
| 612 | Ga0495597_0001426 | 3300046542 | Bacteria | 17187 |
| 613 | Ga0495597_0002139 | 3300046542 | Bacteria | 13083 |
| 614 | Ga0495597_0002447 | 3300046542 | Bacteria | 11774 |
| 615 | Ga0495597_0002492 | 3300046542 | Bacteria | 11609 |
| 616 | Ga0495597_0009137 | 3300046542 | Bacteria | 4918 |
| 617 | Ga0495597_0024575 | 3300046542 | Bacteria | 2780 |
| 618 | Ga0495597_0026578 | 3300046542 | Bacteria | 2658 |
| 619 | Ga0495597_0027038 | 3300046542 | Bacteria | 2632 |
| 620 | Ga0495597_0034059 | 3300046542 | Bacteria | 2302 |
| 621 | Ga0495597_0089444 | 3300046542 | Bacteria | 1308 |
| 622 | Ga0495597_0146205 | 3300046542 | Bacteria | 972 |
| 623 | Ga0495645_0153435 | 3300046543 | Bacteria | 1598 |
| 624 | Ga0495622_0000036 | 3300046557 | Bacteria | 122551 |
| 625 | Ga0495622_0001962 | 3300046557 | Bacteria | 10085 |
| 626 | Ga0495622_0006774 | 3300046557 | Bacteria | 5315 |
| 627 | Ga0495622_0047494 | 3300046557 | Bacteria | 1994 |
| 628 | Ga0495622_0051735 | 3300046557 | Bacteria | 1905 |
| 629 | Ga0495622_0066490 | 3300046557 | Bacteria | 1666 |
| 630 | Ga0495622_0078099 | 3300046557 | Bacteria | 1524 |
| 631 | Ga0495633_0000342 | 3300046558 | Bacteria | 51832 |
| 632 | Ga0495633_0008545 | 3300046558 | Bacteria | 5755 |
| 633 | Ga0495633_0008826 | 3300046558 | Bacteria | 5630 |
| 634 | Ga0495633_0009734 | 3300046558 | Bacteria | 5282 |
| 635 | Ga0495633_0010297 | 3300046558 | Bacteria | 5113 |
| 636 | Ga0495633_0012562 | 3300046558 | Bacteria | 4495 |
| 637 | Ga0495633_0013497 | 3300046558 | Bacteria | 4303 |
| 638 | Ga0495633_0016073 | 3300046558 | Bacteria | 3870 |
| 639 | Ga0495633_0024291 | 3300046558 | Bacteria | 2996 |
| 640 | Ga0495633_0026015 | 3300046558 | Bacteria | 2875 |
| 641 | Ga0495633_0051005 | 3300046558 | Bacteria | 1950 |
| 642 | Ga0495633_0164072 | 3300046558 | Bacteria | 1024 |
| 643 | Ga0495667_0080515 | 3300046559 | Bacteria | 2117 |
| 644 | Ga0495656_0014820 | 3300046615 | Bacteria | 2930 |
| 645 | Ga0495656_0023716 | 3300046615 | Bacteria | 2417 |
| 646 | Ga0495656_0212645 | 3300046615 | Bacteria | 964 |
| 647 | Ga0495668_0000266 | 3300046616 | Bacteria | 73736 |
| 648 | Ga0495668_0001680 | 3300046616 | Bacteria | 20491 |
| 649 | Ga0495668_0010998 | 3300046616 | Bacteria | 5444 |
| 650 | Ga0495668_0012490 | 3300046616 | Bacteria | 5035 |
| 651 | Ga0495668_0018722 | 3300046616 | Bacteria | 4002 |
| 652 | Ga0495668_0021319 | 3300046616 | Bacteria | 3717 |
| 653 | Ga0495668_0021355 | 3300046616 | Bacteria | 3713 |
| 654 | Ga0495668_0027267 | 3300046616 | Bacteria | 3237 |
| 655 | Ga0495668_0038720 | 3300046616 | Bacteria | 2663 |
| 656 | Ga0495668_0038806 | 3300046616 | Bacteria | 2660 |
| 657 | Ga0495668_0052572 | 3300046616 | Bacteria | 2253 |
| 658 | Ga0495668_0059832 | 3300046616 | Bacteria | 2101 |
| 659 | Ga0495668_0218059 | 3300046616 | Bacteria | 1044 |
| 660 | Ga0495634_0017842 | 3300046642 | Bacteria | 5060 |
| 661 | Ga0495634_0084544 | 3300046642 | Bacteria | 2069 |
| 662 | Ga0495611_0004249 | 3300046648 | Bacteria | 6235 |
| 663 | Ga0495611_0007102 | 3300046648 | Bacteria | 4755 |
| 664 | Ga0495611_0015211 | 3300046648 | Bacteria | 3290 |
| 665 | Ga0495611_0040218 | 3300046648 | Bacteria | 2084 |
| 666 | Ga0495611_0084196 | 3300046648 | Bacteria | 1465 |
| 667 | Ga0495611_0112018 | 3300046648 | Bacteria | 1270 |
| 668 | Ga0495625_0000843 | 3300046660 | Bacteria | 41880 |
| 669 | Ga0495625_0009699 | 3300046660 | Bacteria | 8016 |
| 670 | Ga0495625_0010984 | 3300046660 | Bacteria | 7432 |
| 671 | Ga0495625_0013060 | 3300046660 | Bacteria | 6694 |
| 672 | Ga0495625_0043892 | 3300046660 | Bacteria | 3239 |
| 673 | Ga0495625_0092825 | 3300046660 | Bacteria | 2085 |
| 674 | Ga0495625_0100886 | 3300046660 | Bacteria | 1983 |
| 675 | Ga0495625_0186258 | 3300046660 | Bacteria | 1377 |
| 676 | Ga0495625_0277094 | 3300046660 | Bacteria | 1080 |
| 677 | Ga0495635_0008247 | 3300046663 | Bacteria | 7270 |
| 678 | Ga0495659_0003676 | 3300046664 | Bacteria | 4877 |
| 679 | Ga0495659_0004819 | 3300046664 | Bacteria | 4247 |
| 680 | Ga0495659_0037228 | 3300046664 | Bacteria | 1722 |
| 681 | Ga0495659_0041029 | 3300046664 | Bacteria | 1651 |
| 682 | Ga0495661_0000913 | 3300046665 | Bacteria | 27093 |
| 683 | Ga0495661_0012826 | 3300046665 | Bacteria | 5650 |
| 684 | Ga0495661_0013120 | 3300046665 | Bacteria | 5576 |
| 685 | Ga0495661_0017933 | 3300046665 | Bacteria | 4665 |
| 686 | Ga0495661_0020826 | 3300046665 | Bacteria | 4275 |
| 687 | Ga0495661_0040247 | 3300046665 | Bacteria | 2900 |
| 688 | Ga0495661_0053279 | 3300046665 | Bacteria | 2433 |
| 689 | Ga0495661_0058002 | 3300046665 | Bacteria | 2309 |
| 690 | Ga0495661_0061483 | 3300046665 | Bacteria | 2229 |
| 691 | Ga0495661_0114742 | 3300046665 | Bacteria | 1496 |
| 692 | Ga0495661_0140601 | 3300046665 | Bacteria | 1313 |
| 693 | Ga0495661_0204318 | 3300046665 | Bacteria | 1032 |
| 694 | Ga0495588_0000140 | 3300046674 | Bacteria | 107766 |
| 695 | Ga0495588_0007566 | 3300046674 | Bacteria | 4950 |
| 696 | Ga0495588_0012774 | 3300046674 | Bacteria | 3980 |
| 697 | Ga0495588_0024495 | 3300046674 | Bacteria | 2998 |
| 698 | Ga0495588_0026522 | 3300046674 | Bacteria | 2894 |
| 699 | Ga0495588_0030365 | 3300046674 | Bacteria | 2716 |
| 700 | Ga0495588_0041800 | 3300046674 | Bacteria | 2342 |
| 701 | Ga0495588_0051974 | 3300046674 | Bacteria | 2111 |
| 702 | Ga0495588_0081778 | 3300046674 | Bacteria | 1686 |
| 703 | Ga0495623_0080155 | 3300046679 | Bacteria | 2021 |
| 704 | Ga0495623_0150246 | 3300046679 | Bacteria | 1377 |
| 705 | Ga0495623_0260196 | 3300046679 | Bacteria | 972 |
| 706 | Ga0495646_0271153 | 3300046680 | Bacteria | 904 |
| 707 | Ga0495658_0042199 | 3300046683 | Bacteria | 2546 |
| 708 | Ga0495669_0000896 | 3300046684 | Bacteria | 12540 |
| 709 | Ga0495669_0006748 | 3300046684 | Bacteria | 4803 |
| 710 | Ga0495669_0011483 | 3300046684 | Bacteria | 3760 |
| 711 | Ga0495669_0012333 | 3300046684 | Bacteria | 3637 |
| 712 | Ga0495669_0018469 | 3300046684 | Bacteria | 2998 |
| 713 | Ga0495669_0037720 | 3300046684 | Bacteria | 2139 |
| 714 | Ga0495669_0105437 | 3300046684 | Bacteria | 1312 |
| 715 | Ga0495669_0137703 | 3300046684 | Bacteria | 1151 |
| 716 | Ga0495669_0198535 | 3300046684 | Bacteria | 958 |
| 717 | Ga0495613_0138894 | 3300046689 | Bacteria | 1737 |
| 718 | Ga0495624_0008666 | 3300046690 | Bacteria | 7080 |
| 719 | Ga0495624_0355506 | 3300046690 | Bacteria | 881 |
| 720 | Ga0495670_0007065 | 3300046691 | Bacteria | 5528 |
| 721 | Ga0495670_0016062 | 3300046691 | Bacteria | 3680 |
| 722 | Ga0495670_0087127 | 3300046691 | Bacteria | 1595 |
| 723 | Ga0495670_0092139 | 3300046691 | Bacteria | 1552 |
| 724 | Ga0495670_0120282 | 3300046691 | Bacteria | 1363 |
| 725 | Ga0495671_0000086 | 3300046692 | Bacteria | 87499 |
| 726 | Ga0495671_0000245 | 3300046692 | Bacteria | 46833 |
| 727 | Ga0495671_0002185 | 3300046692 | Bacteria | 12462 |
| 728 | Ga0495671_0105213 | 3300046692 | Bacteria | 1378 |
| 729 | Ga0495671_0111752 | 3300046692 | Bacteria | 1334 |
| 730 | Ga0495671_0139528 | 3300046692 | Bacteria | 1181 |
| 731 | Ga0495649_0000093 | 3300046694 | Bacteria | 77036 |
| 732 | Ga0495649_0008892 | 3300046694 | Bacteria | 6012 |
| 733 | Ga0495649_0028635 | 3300046694 | Bacteria | 3087 |
| 734 | Ga0495649_0041528 | 3300046694 | Bacteria | 2515 |
| 735 | Ga0495649_0048098 | 3300046694 | Bacteria | 2318 |
| 736 | Ga0495649_0217354 | 3300046694 | Bacteria | 989 |
| 737 | Ga0495649_0221499 | 3300046694 | Bacteria | 978 |
| 738 | Ga0495589_0000337 | 3300046794 | Bacteria | 36745 |
| 739 | Ga0495589_0000462 | 3300046794 | Bacteria | 29692 |
| 740 | Ga0495589_0003191 | 3300046794 | Bacteria | 8953 |
| 741 | Ga0495589_0008624 | 3300046794 | Bacteria | 5316 |
| 742 | Ga0495589_0017018 | 3300046794 | Bacteria | 3733 |
| 743 | Ga0495589_0018245 | 3300046794 | Bacteria | 3600 |
| 744 | Ga0495589_0026593 | 3300046794 | Bacteria | 2930 |
| 745 | Ga0495589_0049361 | 3300046794 | Bacteria | 2082 |
| 746 | Ga0495589_0218586 | 3300046794 | Bacteria | 896 |
| 747 | Ga0495600_0020026 | 3300046809 | Bacteria | 4277 |
| 748 | Ga0495600_0050887 | 3300046809 | Bacteria | 2703 |
| 749 | Ga0495660_0000085 | 3300046810 | Bacteria | 100369 |
| 750 | Ga0495660_0002264 | 3300046810 | Bacteria | 12381 |
| 751 | Ga0495660_0002327 | 3300046810 | Bacteria | 12181 |
| 752 | Ga0495660_0002406 | 3300046810 | Bacteria | 11935 |
| 753 | Ga0495660_0010617 | 3300046810 | Bacteria | 5356 |
| 754 | Ga0495660_0019058 | 3300046810 | Bacteria | 3940 |
| 755 | Ga0495660_0022697 | 3300046810 | Bacteria | 3581 |
| 756 | Ga0495660_0024987 | 3300046810 | Bacteria | 3396 |
| 757 | Ga0495660_0030454 | 3300046810 | Bacteria | 3039 |
| 758 | Ga0495660_0031663 | 3300046810 | Bacteria | 2973 |
| 759 | Ga0495660_0045063 | 3300046810 | Bacteria | 2423 |
| 760 | Ga0495660_0078158 | 3300046810 | Bacteria | 1740 |
| 761 | Ga0495660_0122137 | 3300046810 | Bacteria | 1316 |
| 762 | Ga0495581_0013040 | 3300047315 | Bacteria | 4817 |
| 763 | Ga0495581_0040948 | 3300047315 | Bacteria | 2680 |
| 764 | Ga0495581_0118476 | 3300047315 | Bacteria | 1540 |
| 765 | Ga0495604_0040354 | 3300047317 | Bacteria | 3665 |
| 766 | Ga0495604_0120453 | 3300047317 | Bacteria | 1900 |
| 767 | Ga0495604_0249471 | 3300047317 | Bacteria | 1210 |
| 768 | Ga0495636_0004955 | 3300047318 | Bacteria | 5221 |
| 769 | Ga0495636_0012647 | 3300047318 | Bacteria | 3343 |
| 770 | Ga0495636_0017270 | 3300047318 | Bacteria | 2887 |
| 771 | Ga0495636_0024594 | 3300047318 | Bacteria | 2443 |
| 772 | Ga0495636_0082372 | 3300047318 | Bacteria | 1387 |
| 773 | Ga0495674_0003089 | 3300047319 | Bacteria | 16178 |
| 774 | Ga0495672_0000005 | 3300047320 | Bacteria | 593294 |
| 775 | Ga0495672_0000217 | 3300047320 | Bacteria | 82349 |
| 776 | Ga0495672_0000458 | 3300047320 | Bacteria | 48213 |
| 777 | Ga0495672_0000483 | 3300047320 | Bacteria | 47007 |
| 778 | Ga0495672_0015337 | 3300047320 | Bacteria | 5206 |
| 779 | Ga0495672_0019626 | 3300047320 | Bacteria | 4455 |
| 780 | Ga0495672_0023745 | 3300047320 | Bacteria | 3962 |
| 781 | Ga0495672_0056491 | 3300047320 | Bacteria | 2283 |
| 782 | Ga0495672_0080223 | 3300047320 | Bacteria | 1820 |
| 783 | Ga0495672_0095297 | 3300047320 | Bacteria | 1625 |
| 784 | Ga0495672_0191737 | 3300047320 | Bacteria | 1027 |
| 785 | Ga0495676_0003794 | 3300047321 | Bacteria | 13739 |
| 786 | Ga0495676_0095264 | 3300047321 | Bacteria | 2215 |
| 787 | Ga0495676_0114590 | 3300047321 | Bacteria | 1972 |
| 788 | Ga0495676_0171153 | 3300047321 | Bacteria | 1528 |
| 789 | Ga0495676_0273881 | 3300047321 | Bacteria | 1144 |
| 790 | Ga0495680_0025365 | 3300047322 | Bacteria | 4907 |
| 791 | Ga0495683_0000054 | 3300047323 | Bacteria | 121429 |
| 792 | Ga0495683_0000662 | 3300047323 | Bacteria | 25479 |
| 793 | Ga0495683_0012831 | 3300047323 | Bacteria | 4395 |
| 794 | Ga0495683_0031376 | 3300047323 | Bacteria | 2708 |
| 795 | Ga0495683_0035853 | 3300047323 | Bacteria | 2520 |
| 796 | Ga0495683_0060688 | 3300047323 | Bacteria | 1873 |
| 797 | Ga0495683_0078493 | 3300047323 | Bacteria | 1613 |
| 798 | Ga0495687_000037 | 3300047443 | Bacteria | 252363 |
| 799 | Ga0495687_000155 | 3300047443 | Bacteria | 104610 |
| 800 | Ga0495687_000468 | 3300047443 | Bacteria | 48911 |
| 801 | Ga0495687_001686 | 3300047443 | Bacteria | 19708 |
| 802 | Ga0495687_001978 | 3300047443 | Bacteria | 17476 |
| 803 | Ga0495687_005761 | 3300047443 | Bacteria | 7782 |
| 804 | Ga0495687_009381 | 3300047443 | Bacteria | 5472 |
| 805 | Ga0495687_011026 | 3300047443 | Bacteria | 4895 |
| 806 | Ga0495687_068105 | 3300047443 | Bacteria | 1438 |
| 807 | Ga0495675_0002475 | 3300047444 | Bacteria | 11039 |
| 808 | Ga0495675_0023210 | 3300047444 | Bacteria | 3953 |
| 809 | Ga0495675_0096577 | 3300047444 | Bacteria | 1852 |
| 810 | Ga0495675_0120192 | 3300047444 | Bacteria | 1636 |
| 811 | Ga0495677_0000130 | 3300047445 | Bacteria | 36684 |
| 812 | Ga0495677_0006146 | 3300047445 | Bacteria | 4542 |
| 813 | Ga0495677_0007525 | 3300047445 | Bacteria | 4066 |
| 814 | Ga0495677_0008597 | 3300047445 | Bacteria | 3789 |
| 815 | Ga0495677_0010442 | 3300047445 | Bacteria | 3410 |
| 816 | Ga0495677_0010483 | 3300047445 | Bacteria | 3402 |
| 817 | Ga0495677_0011196 | 3300047445 | Bacteria | 3283 |
| 818 | Ga0495677_0018890 | 3300047445 | Bacteria | 2499 |
| 819 | Ga0495677_0020135 | 3300047445 | Bacteria | 2418 |
| 820 | Ga0495677_0033862 | 3300047445 | Bacteria | 1862 |
| 821 | Ga0495677_0113530 | 3300047445 | Bacteria | 1030 |
| 822 | Ga0495679_007218 | 3300047446 | Bacteria | 4664 |
| 823 | Ga0495679_007632 | 3300047446 | Bacteria | 4492 |
| 824 | Ga0495679_013012 | 3300047446 | Bacteria | 3142 |
| 825 | Ga0495679_031141 | 3300047446 | Bacteria | 1723 |
| 826 | Ga0495679_032605 | 3300047446 | Bacteria | 1669 |
| 827 | Ga0495685_000032 | 3300047447 | Bacteria | 58381 |
| 828 | Ga0495685_002375 | 3300047447 | Bacteria | 5894 |
| 829 | Ga0495685_069250 | 3300047447 | Bacteria | 1183 |
| 830 | Ga0495673_0000057 | 3300047469 | Bacteria | 239715 |
| 831 | Ga0495673_0000060 | 3300047469 | Bacteria | 231642 |
| 832 | Ga0495673_0001499 | 3300047469 | Bacteria | 18453 |
| 833 | Ga0495673_0019812 | 3300047469 | Bacteria | 3364 |
| 834 | Ga0495673_0046075 | 3300047469 | Bacteria | 1934 |
| 835 | Ga0495681_0000431 | 3300047470 | Bacteria | 32175 |
| 836 | Ga0495681_0000955 | 3300047470 | Bacteria | 22212 |
| 837 | Ga0495681_0002687 | 3300047470 | Bacteria | 12599 |
| 838 | Ga0495681_0009295 | 3300047470 | Bacteria | 6070 |
| 839 | Ga0495681_0015314 | 3300047470 | Bacteria | 4343 |
| 840 | Ga0495681_0016965 | 3300047470 | Bacteria | 4060 |
| 841 | Ga0495681_0032166 | 3300047470 | Bacteria | 2644 |
| 842 | Ga0495686_0000047 | 3300047472 | Bacteria | 280086 |
| 843 | Ga0495686_0000142 | 3300047472 | Bacteria | 143655 |
| 844 | Ga0495686_0002586 | 3300047472 | Bacteria | 16837 |
| 845 | Ga0495686_0013068 | 3300047472 | Bacteria | 5781 |
| 846 | Ga0495686_0015664 | 3300047472 | Bacteria | 5169 |
| 847 | Ga0495686_0035276 | 3300047472 | Bacteria | 3216 |
| 848 | Ga0495686_0050660 | 3300047472 | Bacteria | 2608 |
| 849 | Ga0495686_0107452 | 3300047472 | Bacteria | 1677 |
| 850 | Ga0495593_0012258 | 3300047673 | Bacteria | 4899 |
| 851 | Ga0495593_0020991 | 3300047673 | Bacteria | 3651 |
| 852 | Ga0495593_0027434 | 3300047673 | Bacteria | 3135 |
| 853 | Ga0495602_0132554 | 3300048088 | Bacteria | 1985 |
| 854 | Ga0495602_0157443 | 3300048088 | Bacteria | 1777 |
| 855 | Ga0495614_0015534 | 3300048089 | Bacteria | 3319 |
| 856 | Ga0495614_0018631 | 3300048089 | Bacteria | 3006 |
| 857 | Ga0495626_0000009 | 3300048091 | Bacteria | 270596 |
| 858 | Ga0495626_0000078 | 3300048091 | Bacteria | 130020 |
| 859 | Ga0495626_0002601 | 3300048091 | Bacteria | 12329 |
| 860 | Ga0495626_0006180 | 3300048091 | Bacteria | 6846 |
| 861 | Ga0495626_0011834 | 3300048091 | Bacteria | 4595 |
| 862 | Ga0495626_0012268 | 3300048091 | Bacteria | 4499 |
| 863 | Ga0495626_0016679 | 3300048091 | Bacteria | 3725 |
| 864 | Ga0495626_0023846 | 3300048091 | Bacteria | 3006 |
| 865 | Ga0495626_0028717 | 3300048091 | Bacteria | 2694 |
| 866 | Ga0495626_0145656 | 3300048091 | Bacteria | 1002 |
| 867 | Ga0495626_0173846 | 3300048091 | Bacteria | 896 |
| 868 | Ga0496100_0148412 | 3300048903 | Bacteria | 1669 |
| 869 | Ga0496100_0552697 | 3300048903 | Bacteria | 891 |
| 870 | Ga0496102_0000360 | 3300048905 | Bacteria | 54961 |
| 871 | Ga0496102_0033039 | 3300048905 | Bacteria | 4648 |
| 872 | Ga0496102_0038714 | 3300048905 | Bacteria | 4305 |
| 873 | Ga0496102_0269798 | 3300048905 | Bacteria | 1604 |
| 874 | Ga0496103_0001443 | 3300048906 | Bacteria | 15943 |
| 875 | Ga0496103_0012438 | 3300048906 | Bacteria | 5047 |
| 876 | Ga0496103_0041402 | 3300048906 | Bacteria | 2832 |
| 877 | Ga0496105_0165537 | 3300048908 | Bacteria | 1814 |
| 878 | Ga0496105_0231960 | 3300048908 | Bacteria | 1500 |
| 879 | Ga0496106_0023634 | 3300048909 | Bacteria | 4566 |
| 880 | Ga0496106_0030666 | 3300048909 | Bacteria | 4008 |
| 881 | Ga0496107_0134791 | 3300048910 | Bacteria | 1824 |
| 882 | Ga0496107_0201807 | 3300048910 | Bacteria | 1478 |
| 883 | Ga0496107_0623101 | 3300048910 | Bacteria | 796 |
| 884 | Ga0496108_0616503 | 3300048911 | Bacteria | 945 |
| 885 | Ga0496110_0077107 | 3300048913 | Bacteria | 2964 |
| 886 | Ga0496110_0411770 | 3300048913 | Bacteria | 1232 |
| 887 | Ga0496111_0149814 | 3300048914 | Bacteria | 1730 |
| 888 | Ga0496111_0314153 | 3300048914 | Bacteria | 1161 |
| 889 | Ga0496113_0043136 | 3300048916 | Bacteria | 3336 |
| 890 | Ga0496113_0278888 | 3300048916 | Bacteria | 1336 |
| 891 | Ga0496115_0049354 | 3300048918 | Bacteria | 3368 |
| 892 | Ga0496115_0606002 | 3300048918 | Bacteria | 870 |
| 893 | Ga0496116_0041137 | 3300048919 | Bacteria | 3174 |
| 894 | Ga0496117_0000011 | 3300048920 | Bacteria | 610930 |
| 895 | Ga0496118_0000010 | 3300048921 | Bacteria | 610930 |
| 896 | Ga0496118_0186155 | 3300048921 | Bacteria | 1248 |
| 897 | Ga0496121_0014681 | 3300048924 | Bacteria | 8282 |
| 898 | Ga0496121_0052677 | 3300048924 | Bacteria | 3414 |
| 899 | Ga0496122_0000549 | 3300048925 | Bacteria | 77692 |
| 900 | Ga0496122_0002477 | 3300048925 | Bacteria | 26088 |
| 901 | Ga0496122_0003057 | 3300048925 | Bacteria | 22632 |
| 902 | Ga0496122_0015963 | 3300048925 | Bacteria | 7142 |
| 903 | Ga0496122_0083157 | 3300048925 | Bacteria | 2221 |
| 904 | Ga0496122_0125872 | 3300048925 | Bacteria | 1640 |
| 905 | Ga0496123_0000326 | 3300048926 | Bacteria | 90896 |
| 906 | Ga0496123_0014307 | 3300048926 | Bacteria | 6587 |
| 907 | Ga0496123_0017258 | 3300048926 | Bacteria | 5818 |
| 908 | Ga0496123_0033067 | 3300048926 | Bacteria | 3729 |
| 909 | Ga0496124_0001925 | 3300048927 | Bacteria | 28421 |
| 910 | Ga0496124_0042693 | 3300048927 | Bacteria | 3902 |
| 911 | Ga0496124_0057575 | 3300048927 | Bacteria | 3274 |
| 912 | Ga0496124_0064120 | 3300048927 | Bacteria | 3068 |
| 913 | Ga0496124_0083828 | 3300048927 | Bacteria | 2615 |
| 914 | Ga0496124_0153107 | 3300048927 | Bacteria | 1806 |
| 915 | Ga0496124_0242504 | 3300048927 | Bacteria | 1339 |
| 916 | Ga0496124_0309214 | 3300048927 | Bacteria | 1137 |
| 917 | Ga0496125_0009304 | 3300048928 | Bacteria | 10134 |
| 918 | Ga0496125_0025826 | 3300048928 | Bacteria | 5369 |
| 919 | Ga0496125_0035590 | 3300048928 | Bacteria | 4363 |
| 920 | Ga0496125_0069129 | 3300048928 | Bacteria | 2773 |
| 921 | Ga0496125_0106794 | 3300048928 | Bacteria | 2042 |
| 922 | Ga0496125_0357216 | 3300048928 | Bacteria | 870 |
| 923 | Ga0496126_0006527 | 3300048929 | Bacteria | 12985 |
| 924 | Ga0501304_006870 | 3300049160 | Bacteria | 926 |
| 925 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 926 | Ga0495678_000163 | 3300049459 | Bacteria | 78292 |
| 927 | Ga0495678_000347 | 3300049459 | Bacteria | 48195 |
| 928 | Ga0495678_002748 | 3300049459 | Bacteria | 11539 |
| 929 | Ga0495678_002777 | 3300049459 | Bacteria | 11439 |
| 930 | Ga0495678_003899 | 3300049459 | Bacteria | 8949 |
| 931 | Ga0495678_010182 | 3300049459 | Bacteria | 4583 |
| 932 | Ga0495678_070628 | 3300049459 | Bacteria | 1281 |
| 933 | Ga0495678_079460 | 3300049459 | Bacteria | 1181 |
| 934 | Ga0495678_080101 | 3300049459 | Bacteria | 1174 |
| 935 | Ga0495682_0000292 | 3300049460 | Bacteria | 38485 |
| 936 | Ga0495682_0005778 | 3300049460 | Bacteria | 5096 |
| 937 | Ga0495682_0006944 | 3300049460 | Bacteria | 4542 |
| 938 | Ga0495682_0006952 | 3300049460 | Bacteria | 4538 |
| 939 | Ga0495682_0010628 | 3300049460 | Bacteria | 3557 |
| 940 | Ga0495682_0016641 | 3300049460 | Bacteria | 2782 |
| 941 | Ga0495682_0028792 | 3300049460 | Bacteria | 2057 |
| 942 | Ga0501036_0155045 | 3300049572 | Bacteria | 1932 |
| 943 | Ga0501249_004735 | 3300049679 | Bacteria | 2771 |
| 944 | Ga0501269_000077 | 3300049766 | Bacteria | 30388 |
| 945 | Ga0501269_012765 | 3300049766 | Bacteria | 1027 |
| 946 | Ga0501035_0002946 | 3300049822 | Bacteria | 16379 |
| 947 | Ga0501044_0262201 | 3300049823 | Bacteria | 1666 |
| 948 | nmdc:mga03683_17027_c1 | 3300050489 | Bacteria | 2743 |
| 949 | nmdc:mga0yw44_50801_c1 | 3300050492 | Bacteria | 2509 |
| 950 | nmdc:mga06z11_100034_c1 | 3300050494 | Bacteria | 1589 |
| 951 | nmdc:mga06z11_119347_c1 | 3300050494 | Bacteria | 1470 |
| 952 | nmdc:mga08y16_121431_c1 | 3300050511 | Bacteria | 2719 |
| 953 | nmdc:mga0sz30_56177_c1 | 3300050516 | Bacteria | 1676 |
| 954 | Ga0500641_0007972 | 3300053096 | Bacteria | 3775 |
| 955 | Ga0500641_0072881 | 3300053096 | Bacteria | 1448 |
| 956 | Ga0500594_0035340 | 3300053118 | Bacteria | 1339 |
| 957 | Ga0500618_000384 | 3300053125 | Bacteria | 30501 |
| 958 | Ga0500618_000433 | 3300053125 | Bacteria | 27738 |
| 959 | Ga0500618_002204 | 3300053125 | Bacteria | 7632 |
| 960 | Ga0500559_0108682 | 3300053136 | Bacteria | 1284 |
| 961 | Ga0500586_000135 | 3300053145 | Bacteria | 13519 |
| 962 | Ga0500636_0000106 | 3300053177 | Bacteria | 43073 |
| 963 | Ga0500637_0039690 | 3300053178 | Bacteria | 2656 |
| 964 | Ga0500637_0129698 | 3300053178 | Bacteria | 1462 |
| 965 | Ga0500637_0184097 | 3300053178 | Bacteria | 1196 |
| 966 | Ga0501084_0305968 | 3300054114 | Bacteria | 1343 |
| 967 | Ga0587090_024863 | 3300059510 | Bacteria | 964 |
| 968 | Ga0587111_0041035 | 3300060346 | Bacteria | 986 |
| 969 | Ga0466962_0035793 | 3300061719 | Bacteria | 2375 |
| 970 | Ga0466962_0092611 | 3300061719 | Bacteria | 1449 |
| 971 | 2511248015 | 2511231003 | Bacteria | 5606035 |
| 972 | 2511385024 | 2511231026 | Bacteria | 5225445 |
| 973 | 2526210880 | 2526164512 | Bacteria | 4025691 |
| 974 | 2574430522 | 2574179768 | Bacteria | 4907129 |
| 975 | 2601669530 | 2600255292 | Bacteria | 6300551 |
| 976 | 2643788147 | 2643221554 | Bacteria | 6603920 |
| 977 | 2643801106 | 2643221556 | Bacteria | 7251154 |
| 978 | 2644026832 | 2643221603 | Bacteria | 6147767 |
| 979 | 2644216251 | 2643221638 | Bacteria | 6579467 |
| 980 | 2644255366 | 2643221645 | Bacteria | 7207331 |
| 981 | 2644359888 | 2643221664 | Bacteria | 7272945 |
| 982 | 2644472808 | 2643221684 | Bacteria | 7145183 |
| 983 | 2738742495 | 2738541280 | Bacteria | 6630198 |
| 984 | 2738827237 | 2738541297 | Bacteria | 6549566 |
| 985 | 2738846551 | 2738541300 | Bacteria | 6675882 |
| 986 | 2739151034 | 2738541357 | Bacteria | 6549408 |
| 987 | 2739192953 | 2738543003 | Bacteria | 6549560 |
| 988 | 2739277195 | 2738543018 | Bacteria | 6718814 |
| 989 | 2739319430 | 2738543026 | Bacteria | 6549408 |
| 990 | 2739337671 | 2738543029 | Bacteria | 6549249 |
| 991 | 2739346245 | 2738543030 | Bacteria | 6719714 |
| 992 | 2809128589 | 2808606415 | Bacteria | 4576710 |
| 993 | 2809142275 | 2808606418 | Bacteria | 6724496 |
| 994 | 2809148210 | 2808606419 | Bacteria | 4576925 |
| 995 | 2819594999 | 2818991445 | Bacteria | 4955017 |
| 996 | 2821134595 | 2821131069 | Bacteria | 6108407 |
| 997 | 2834641526 | 2834641062 | Bacteria | 5559922 |
| 998 | 2842715101 | 2842711865 | Bacteria | 7155354 |
| 999 | 2852620371 | 2852618963 | Bacteria | 4577824 |
| 1000 | 2857549651 | 2857547612 | Bacteria | 6179999 |
| 1001 | 2857557088 | 2857553236 | Bacteria | 6166726 |
| 1002 | 2857560496 | 2857558681 | Bacteria | 6617694 |
| 1003 | 2857570010 | 2857564685 | Bacteria | 6290584 |
| 1004 | 2884852910 | 2884852848 | Bacteria | 5221161 |
| 1005 | 2885081443 | 2885080285 | Bacteria | 6355622 |
| 1006 | 2891634060 | 2891633521 | Bacteria | 4602265 |
| 1007 | 2904430262 | 2904424332 | Bacteria | 7633521 |
| 1008 | 2919480838 | 2919476304 | Bacteria | 5888696 |
| 1009 | 2928134073 | 2928130867 | Bacteria | 5467269 |
| 1010 | 2932415733 | 2932410948 | Bacteria | 6312192 |
| 1011 | 2932421723 | 2932416698 | Bacteria | 6315112 |
| 1012 | 639787744 | 639633007 | Bacteria | 4376040 |
| 1013 | 8047675152 | 8047673197 | Bacteria | 7395230 |
| 1014 | Ga0070665_100077363 | |||
| 1015 | JGI25155J39150_1000685 | |||
| 1016 | JGI25156J39149_1013612 | |||
| 1017 | JGI25154J39366_1001901 | |||
| 1018 | JGI25157J39369_1001234 | |||
| 1019 | JGI25152J39213_1001691 | |||
| 1020 | JGI25150J39212_1004735 | |||
| 1021 | JGI25150J39212_1004776 | |||
| 1022 | JGI25159J45721_1005656 | |||
| 1023 | JGI25159J45721_1006490 | |||
| 1024 | JGI25153J46596_10018512 | |||
| 1025 | JGI25153J46596_10019612 | |||
| 1026 | rootL2_10030810 | |||
| 1027 | JGI25161J50226_1002935 | |||
| 1028 | Ga0055532_1000077 | |||
| 1029 | Ga0055525_1000074 | |||
| 1030 | Ga0055529_1000119 | |||
| 1031 | Ga0055526_1000096 | |||
| 1032 | Ga0055526_1000176 | |||
| 1033 | Ga0055526_1005549 | |||
| 1034 | Ga0055526_1012194 | |||
| 1035 | Ga0055537_1002012 | |||
| 1036 | Ga0055537_1007195 | |||
| 1037 | Ga0055524_1000049 | |||
| 1038 | Ga0055524_1006247 | |||
| 1039 | Ga0055524_1009250 | |||
| 1040 | Ga0055524_1010025 | |||
| 1041 | Ga0055524_1010467 | |||
| 1042 | Ga0055534_1002464 | |||
| 1043 | Ga0055534_1007631 | |||
| 1044 | Ga0055528_1000378 | |||
| 1045 | Ga0055528_1010121 | |||
| 1046 | Ga0055530_10007632 | |||
| 1047 | Ga0055531_10014242 | |||
| 1048 | Ga0055543_1000154 | |||
| 1049 | Ga0055543_1007921 | |||
| 1050 | Ga0065165_1000571 | |||
| 1051 | Ga0065165_1001586 | |||
| 1052 | Ga0065165_1005416 | |||
| 1053 | Ga0070658_10397592 | |||
| 1054 | Ga0070676_10079006 | |||
| 1055 | Ga0070683_100023896 | |||
| 1056 | Ga0070690_100006127 | |||
| 1057 | Ga0070690_100054139 | |||
| 1058 | Ga0070677_10024701 | |||
| 1059 | Ga0068869_100005370 | |||
| 1060 | Ga0068869_100246471 | |||
| 1061 | Ga0070666_10182683 | |||
| 1062 | Ga0070680_100099705 | |||
| 1063 | Ga0070682_100336628 | |||
| 1064 | Ga0070660_100005785 | |||
| 1065 | Ga0070660_100053782 | |||
| 1066 | Ga0070689_100100855 | |||
| 1067 | Ga0070687_100017933 | |||
| 1068 | Ga0070687_100255533 | |||
| 1069 | Ga0070661_100018767 | |||
| 1070 | Ga0070661_100405395 | |||
| 1071 | Ga0070692_10119362 | |||
| 1072 | Ga0070668_100046395 | |||
| 1073 | Ga0070674_100002988 | |||
| 1074 | Ga0070688_100004034 | |||
| 1075 | Ga0070659_100000840 | |||
| 1076 | Ga0070659_100143807 | |||
| 1077 | Ga0070659_100338332 | |||
| 1078 | Ga0070659_100368219 | |||
| 1079 | Ga0070667_100257863 | |||
| 1080 | Ga0070714_100191894 | |||
| 1081 | Ga0070701_10007677 | |||
| 1082 | Ga0070700_100075096 | |||
| 1083 | Ga0070663_100435731 | |||
| 1084 | Ga0070685_10061804 | |||
| 1085 | Ga0070684_100064719 | |||
| 1086 | Ga0070672_100158970 | |||
| 1087 | Ga0070665_100092707 | |||
| 1088 | Ga0068855_100096508 | |||
| 1089 | Ga0068855_100266261 | |||
| 1090 | Ga0070664_100007438 | |||
| 1091 | Ga0070664_100071288 | |||
| 1092 | Ga0068857_100134900 | |||
| 1093 | Ga0068857_100323239 | |||
| 1094 | Ga0068856_100085329 | |||
| 1095 | Ga0070702_100054252 | |||
| 1096 | Ga0068861_100068057 | |||
| 1097 | Ga0068858_100029744 | |||
| 1098 | Ga0068858_100255506 | |||
| 1099 | Ga0068860_100114608 | |||
| 1100 | Ga0068862_100156567 | |||
| 1101 | Ga0081539_10017768 | |||
| 1102 | Ga0075368_10045034 | |||
| 1103 | Ga0075363_100012995 | |||
| 1104 | Ga0070712_100021576 | |||
| 1105 | Ga0075362_10095140 | |||
| 1106 | Ga0075369_10022138 | |||
| 1107 | Ga0075369_10037445 | |||
| 1108 | Ga0075366_10002692 | |||
| 1109 | Ga0075366_10125788 | |||
| 1110 | Ga0075366_10264188 | |||
| 1111 | Ga0097621_100015682 | |||
| 1112 | Ga0075370_10038106 | |||
| 1113 | Ga0068871_100000638 | |||
| 1114 | Ga0068865_100702973 | |||
| 1115 | Ga0099826_10000005 | |||
| 1116 | Ga0105251_10035840 | |||
| 1117 | Ga0105244_10008754 | |||
| 1118 | Ga0105244_10008940 | |||
| 1119 | Ga0105240_10035812 | |||
| 1120 | Ga0105240_10193821 | |||
| 1121 | Ga0105240_10534436 | |||
| 1122 | Ga0111539_10309447 | |||
| 1123 | Ga0105245_10039862 | |||
| 1124 | Ga0105245_10099696 | |||
| 1125 | Ga0105243_10023507 | |||
| 1126 | Ga0105241_10004455 | |||
| 1127 | Ga0105242_10145097 | |||
| 1128 | Ga0105238_10082619 | |||
| 1129 | Ga0105246_10106875 | |||
| 1130 | Ga0157371_10000014 | |||
| 1131 | Ga0157371_10252115 | |||
| 1132 | Ga0157370_10042640 | |||
| 1133 | Ga0157370_10620228 | |||
| 1134 | Ga0157378_10002428 | |||
| 1135 | Ga0157378_10091197 | |||
| 1136 | Ga0163162_10019684 | |||
| 1137 | Ga0163162_10033542 | |||
| 1138 | Ga0163162_10518733 | |||
| 1139 | Ga0157380_10272704 | |||
| 1140 | Ga0182008_10000231 | |||
| 1141 | Ga0157379_10025665 | |||
| 1142 | Ga0157379_10054399 | |||
| 1143 | Ga0157379_10547118 | |||
| 1144 | Ga0157376_10024502 | |||
| 1145 | Ga0182006_1000004 | |||
| 1146 | Ga0182006_1000176 | |||
| 1147 | Ga0182006_1029981 | |||
| 1148 | Ga0182006_1144869 | |||
| 1149 | Ga0182007_10001618 | |||
| 1150 | Ga0182005_1000005 | |||
| 1151 | Ga0182005_1000030 | |||
| 1152 | Ga0163161_10028570 | |||
| 1153 | Ga0163161_10029767 | |||
| 1154 | Ga0163161_10071615 | |||
| 1155 | Ga0213872_10000504 | |||
| 1156 | Ga0213872_10001863 | |||
| 1157 | Ga0213872_10010875 | |||
| 1158 | Ga0209435_100048 | |||
| 1159 | Ga0209435_100225 | |||
| 1160 | Ga0209436_100090 | |||
| 1161 | Ga0209436_101258 | |||
| 1162 | Ga0209147_100122 | |||
| 1163 | Ga0209563_100003 | |||
| 1164 | Ga0209437_100081 | |||
| 1165 | Ga0209437_104536 | |||
| 1166 | Ga0209258_100230 | |||
| 1167 | Ga0207425_1000017 | |||
| 1168 | Ga0207425_1000341 | |||
| 1169 | Ga0207425_1000397 | |||
| 1170 | Ga0207425_1033144 | |||
| 1171 | Ga0209646_1000036 | |||
| 1172 | Ga0209646_1000130 | |||
| 1173 | Ga0209646_1000152 | |||
| 1174 | Ga0209026_1000126 | |||
| 1175 | Ga0209026_1003081 | |||
| 1176 | Ga0209677_115509 | |||
| 1177 | Ga0209148_1001208 | |||
| 1178 | Ga0209759_1000193 | |||
| 1179 | Ga0209759_1001123 | |||
| 1180 | Ga0209129_1000039 | |||
| 1181 | Ga0209129_1000088 | |||
| 1182 | Ga0209129_1010411 | |||
| 1183 | Ga0209565_1000018 | |||
| 1184 | Ga0209565_1001328 | |||
| 1185 | Ga0209565_1004071 | |||
| 1186 | Ga0209565_1004755 | |||
| 1187 | Ga0209565_1013248 | |||
| 1188 | Ga0209565_1020726 | |||
| 1189 | Ga0209565_1023630 | |||
| 1190 | Ga0209455_1000047 | |||
| 1191 | Ga0209455_1006928 | |||
| 1192 | Ga0209673_1000090 | |||
| 1193 | Ga0209130_1001116 | |||
| 1194 | Ga0209130_1001315 | |||
| 1195 | Ga0209130_1003207 | |||
| 1196 | Ga0209675_1000005 | |||
| 1197 | Ga0209675_1001071 | |||
| 1198 | Ga0209675_1008948 | |||
| 1199 | Ga0209025_1011979 | |||
| 1200 | Ga0209564_1000060 | |||
| 1201 | Ga0209564_1000078 | |||
| 1202 | Ga0209564_1000348 | |||
| 1203 | Ga0209564_1000626 | |||
| 1204 | Ga0209564_1008728 | |||
| 1205 | Ga0209564_1030211 | |||
| 1206 | Ga0209758_1000137 | |||
| 1207 | Ga0209758_1000895 | |||
| 1208 | Ga0209050_1000598 | |||
| 1209 | Ga0209050_1003979 | |||
| 1210 | Ga0209050_1004001 | |||
| 1211 | Ga0209256_1000040 | |||
| 1212 | Ga0209256_1000189 | |||
| 1213 | Ga0209256_1000601 | |||
| 1214 | Ga0209256_1003275 | |||
| 1215 | Ga0209256_1008841 | |||
| 1216 | Ga0207426_1002086 | |||
| 1217 | Ga0209051_1016883 | |||
| 1218 | Ga0209257_1010731 | |||
| 1219 | Ga0207697_10010078 | |||
| 1220 | Ga0207655_1001915 | |||
| 1221 | Ga0207655_1033252 | |||
| 1222 | Ga0207682_10000396 | |||
| 1223 | Ga0207642_10007487 | |||
| 1224 | Ga0207688_10013245 | |||
| 1225 | Ga0207680_10142283 | |||
| 1226 | Ga0207645_10004613 | |||
| 1227 | Ga0207643_10117333 | |||
| 1228 | Ga0207705_10011718 | |||
| 1229 | Ga0207695_10007570 | |||
| 1230 | Ga0207695_10014717 | |||
| 1231 | Ga0207693_10416849 | |||
| 1232 | Ga0207660_10094647 | |||
| 1233 | Ga0207662_10002632 | |||
| 1234 | Ga0207662_10196206 | |||
| 1235 | Ga0207657_10003671 | |||
| 1236 | Ga0207657_10050467 | |||
| 1237 | Ga0207657_10167012 | |||
| 1238 | Ga0207649_10139865 | |||
| 1239 | Ga0207649_10269949 | |||
| 1240 | Ga0207694_10055883 | |||
| 1241 | Ga0207650_10210439 | |||
| 1242 | Ga0207687_10055772 | |||
| 1243 | Ga0207687_10083746 | |||
| 1244 | Ga0207664_10081013 | |||
| 1245 | Ga0207706_10010122 | |||
| 1246 | Ga0207686_10342305 | |||
| 1247 | Ga0207709_10017824 | |||
| 1248 | Ga0207709_10043577 | |||
| 1249 | Ga0207669_10070171 | |||
| 1250 | Ga0207669_10143380 | |||
| 1251 | Ga0207711_10213364 | |||
| 1252 | Ga0207689_10040563 | |||
| 1253 | Ga0207661_10025986 | |||
| 1254 | Ga0207679_10002872 | |||
| 1255 | Ga0207679_10341225 | |||
| 1256 | Ga0207667_10044688 | |||
| 1257 | Ga0207667_10200117 | |||
| 1258 | Ga0207658_10105280 | |||
| 1259 | Ga0207677_10075788 | |||
| 1260 | Ga0207703_10011138 | |||
| 1261 | Ga0207678_10249299 | |||
| 1262 | Ga0207708_10001740 | |||
| 1263 | Ga0207702_10098293 | |||
| 1264 | Ga0207702_10482459 | |||
| 1265 | Ga0207641_10045680 | |||
| 1266 | Ga0207648_10002465 | |||
| 1267 | Ga0207674_10071261 | |||
| 1268 | Ga0207675_100057588 | |||
| 1269 | Ga0207698_10043065 | |||
| 1270 | Ga0209969_1001118 | |||
| 1271 | Ga0209996_1006507 | |||
| 1272 | Ga0209995_1002583 | |||
| 1273 | Ga0209983_1015344 | |||
| 1274 | Ga0209282_1000003 | |||
| 1275 | Ga0209971_1004552 | |||
| 1276 | Ga0209974_10023418 | |||
| 1277 | Ga0268266_10162250 | |||
| 1278 | Ga0268265_10534379 | |||
| 1279 | Ga0268264_10239639 | |||
| 1280 | Ga0307515_10294504 | |||
| 1281 | Ga0265324_10055303 | |||
| 1282 | Ga0265331_10000237 | |||
| 1283 | Ga0265327_10000517 | |||
| 1284 | Ga0265327_10100303 | |||
| 1285 | Ga0307408_100000511 | |||
| 1286 | Ga0307408_100000604 | |||
| 1287 | Ga0307408_100034763 | |||
| 1288 | Ga0307408_100053643 | |||
| 1289 | Ga0316579_10029788 | |||
| 1290 | Ga0307518_10023324 | |||
| 1291 | Ga0307416_100504644 | |||
| 1292 | Ga0316583_10010274 | |||
| 1293 | Ga0373932_0039320 | |||
| 1294 | Ga0373960_0144401 | |||
| 1295 | Ga0316574_0069730 | |||
| 1296 | Ga0373937_0537079 | |||
| 1297 | Ga0373925_0768015 | |||
| 1298 | Ga0395899_0000161 | |||
| 1299 | Ga0395899_0001217 | |||
| 1300 | Ga0395899_0002963 | |||
| 1301 | Ga0395899_0039203 | |||
| 1302 | Ga0395899_0097538 | |||
| 1303 | Ga0395899_0104936 | |||
| 1304 | Ga0395899_0133806 | |||
| 1305 | Ga0395899_0390940 | |||
| 1306 | Ga0395900_0003402 | |||
| 1307 | Ga0395900_0004563 | |||
| 1308 | Ga0395900_0007120 | |||
| 1309 | Ga0395900_0035585 | |||
| 1310 | Ga0395900_0186012 | |||
| 1311 | Ga0395900_0341275 | |||
| 1312 | Ga0395900_0363190 | |||
| 1313 | Ga0395898_0003439 | |||
| 1314 | Ga0395898_0160098 | |||
| 1315 | Ga0395898_0171946 | |||
| 1316 | Ga0395898_0324532 | |||
| 1317 | Ga0395898_0411362 | |||
| 1318 | Ga0395905_0000137 | |||
| 1319 | Ga0395905_0010634 | |||
| 1320 | Ga0395905_0023218 | |||
| 1321 | Ga0395905_0053658 | |||
| 1322 | Ga0395905_0174378 | |||
| 1323 | Ga0395905_0327650 | |||
| 1324 | Ga0395905_0371050 | |||
| 1325 | Ga0395905_0401898 | |||
| 1326 | Ga0395905_0555299 | |||
| 1327 | Ga0395901_0001241 | |||
| 1328 | Ga0395901_0001265 | |||
| 1329 | Ga0395901_0035568 | |||
| 1330 | Ga0395901_0061313 | |||
| 1331 | Ga0395901_0061841 | |||
| 1332 | Ga0395901_0124271 | |||
| 1333 | Ga0395901_0134427 | |||
| 1334 | Ga0395901_0152351 | |||
| 1335 | Ga0436361_0067343 | |||
| 1336 | Ga0436361_0557931 | |||
| 1337 | Ga0436361_0674923 | |||
| 1338 | Ga0436361_1070108 | |||
| 1339 | Ga0436361_1096226 | |||
| 1340 | Ga0439465_0027121 | |||
| 1341 | Ga0439441_001947 | |||
| 1342 | Ga0439448_0010362 | |||
| 1343 | Ga0439455_0001382 | |||
| 1344 | Ga0439455_0003557 | |||
| 1345 | Ga0450904_001005 | |||
| 1346 | Ga0439458_0014183 | |||
| 1347 | Ga0439458_0033461 | |||
| 1348 | Ga0439460_0088653 | |||
| 1349 | Ga0466969_0058096 | |||
| 1350 | Ga0466972_0000327 | |||
| 1351 | Ga0466972_0012337 | |||
| 1352 | Ga0466972_0059397 | |||
| 1353 | Ga0466972_0120736 | |||
| 1354 | Ga0466965_0006991 | |||
| 1355 | Ga0466965_0026378 | |||
| 1356 | Ga0466965_0028687 | |||
| 1357 | Ga0466965_0040088 | |||
| 1358 | Ga0466965_0071293 | |||
| 1359 | Ga0466965_0117394 | |||
| 1360 | Ga0466966_0015642 | |||
| 1361 | Ga0466966_0044458 | |||
| 1362 | Ga0466966_0076831 | |||
| 1363 | Ga0466966_0097402 | |||
| 1364 | Ga0466961_0233942 | |||
| 1365 | Ga0466964_0007552 | |||
| 1366 | Ga0466964_0020832 | |||
| 1367 | Ga0466964_0108333 | |||
| 1368 | Ga0466971_0079333 | |||
| 1369 | Ga0466968_0019441 | |||
| 1370 | Ga0466968_0325371 | |||
| 1371 | Ga0466970_0021724 | |||
| 1372 | Ga0466970_0073148 | |||
| 1373 | Ga0466970_0211378 | |||
| 1374 | Ga0466957_0054933 | |||
| 1375 | Ga0466957_0069558 | |||
| 1376 | Ga0466957_0152524 | |||
| 1377 | Ga0466957_0205808 | |||
| 1378 | Ga0466959_0045767 | |||
| 1379 | Ga0466959_0051132 | |||
| 1380 | Ga0466959_0192115 | |||
| 1381 | Ga0466958_0091202 | |||
| 1382 | Ga0466967_0028106 | |||
| 1383 | Ga0466967_0033721 | |||
| 1384 | Ga0466967_0101302 | |||
| 1385 | Ga0495617_000005 | |||
| 1386 | Ga0495617_000015 | |||
| 1387 | Ga0495617_000578 | |||
| 1388 | Ga0495617_005569 | |||
| 1389 | Ga0495617_005661 | |||
| 1390 | Ga0495627_000038 | |||
| 1391 | Ga0495627_000186 | |||
| 1392 | Ga0495603_0015382 | |||
| 1393 | Ga0495603_0045046 | |||
| 1394 | Ga0495603_0123400 | |||
| 1395 | Ga0495590_0000011 | |||
| 1396 | Ga0495590_0000644 | |||
| 1397 | Ga0495590_0004747 | |||
| 1398 | Ga0495590_0014627 | |||
| 1399 | Ga0495590_0016718 | |||
| 1400 | Ga0495591_000814 | |||
| 1401 | Ga0495591_007812 | |||
| 1402 | Ga0495629_0011951 | |||
| 1403 | Ga0495629_0103119 | |||
| 1404 | Ga0495638_0000058 | |||
| 1405 | Ga0495638_0011400 | |||
| 1406 | Ga0495638_0065080 | |||
| 1407 | Ga0495638_0066715 | |||
| 1408 | Ga0495638_0093868 | |||
| 1409 | Ga0495638_0246243 | |||
| 1410 | Ga0495653_0000031 | |||
| 1411 | Ga0495653_0018992 | |||
| 1412 | Ga0495650_0000152 | |||
| 1413 | Ga0495650_0000480 | |||
| 1414 | Ga0495650_0000700 | |||
| 1415 | Ga0495650_0000962 | |||
| 1416 | Ga0495650_0001811 | |||
| 1417 | Ga0495650_0002693 | |||
| 1418 | Ga0495650_0021108 | |||
| 1419 | Ga0495580_0477232 | |||
| 1420 | Ga0495582_0024678 | |||
| 1421 | Ga0495582_0030001 | |||
| 1422 | Ga0495605_0000021 | |||
| 1423 | Ga0495605_0000082 | |||
| 1424 | Ga0495605_0000408 | |||
| 1425 | Ga0495605_0006381 | |||
| 1426 | Ga0495605_0014561 | |||
| 1427 | Ga0495605_0018022 | |||
| 1428 | Ga0495605_0034387 | |||
| 1429 | Ga0495605_0038539 | |||
| 1430 | Ga0495605_0038836 | |||
| 1431 | Ga0495605_0086716 | |||
| 1432 | Ga0495584_0000009 | |||
| 1433 | Ga0495584_0001552 | |||
| 1434 | Ga0495584_0007345 | |||
| 1435 | Ga0495584_0010378 | |||
| 1436 | Ga0495584_0014421 | |||
| 1437 | Ga0495584_0014452 | |||
| 1438 | Ga0495584_0017925 | |||
| 1439 | Ga0495584_0021788 | |||
| 1440 | Ga0495584_0022133 | |||
| 1441 | Ga0495584_0026386 | |||
| 1442 | Ga0495584_0028256 | |||
| 1443 | Ga0495584_0038362 | |||
| 1444 | Ga0495584_0069818 | |||
| 1445 | Ga0495584_0084207 | |||
| 1446 | Ga0495584_0117517 | |||
| 1447 | Ga0495585_0000107 | |||
| 1448 | Ga0495585_0000318 | |||
| 1449 | Ga0495585_0001768 | |||
| 1450 | Ga0495585_0004190 | |||
| 1451 | Ga0495585_0017410 | |||
| 1452 | Ga0495585_0020133 | |||
| 1453 | Ga0495585_0021739 | |||
| 1454 | Ga0495585_0023006 | |||
| 1455 | Ga0495585_0026887 | |||
| 1456 | Ga0495585_0034447 | |||
| 1457 | Ga0495585_0035580 | |||
| 1458 | Ga0495585_0043964 | |||
| 1459 | Ga0495585_0049126 | |||
| 1460 | Ga0495585_0060109 | |||
| 1461 | Ga0495585_0097302 | |||
| 1462 | Ga0495585_0125523 | |||
| 1463 | Ga0495585_0132959 | |||
| 1464 | Ga0495585_0199214 | |||
| 1465 | Ga0495594_0008863 | |||
| 1466 | Ga0495594_0020766 | |||
| 1467 | Ga0495594_0022414 | |||
| 1468 | Ga0495594_0032513 | |||
| 1469 | Ga0495594_0037613 | |||
| 1470 | Ga0495596_0000402 | |||
| 1471 | Ga0495596_0002710 | |||
| 1472 | Ga0495596_0002746 | |||
| 1473 | Ga0495596_0003161 | |||
| 1474 | Ga0495596_0003393 | |||
| 1475 | Ga0495596_0015384 | |||
| 1476 | Ga0495596_0016137 | |||
| 1477 | Ga0495596_0020649 | |||
| 1478 | Ga0495596_0042814 | |||
| 1479 | Ga0495607_0003324 | |||
| 1480 | Ga0495607_0012878 | |||
| 1481 | Ga0495607_0013241 | |||
| 1482 | Ga0495607_0017972 | |||
| 1483 | Ga0495607_0020283 | |||
| 1484 | Ga0495607_0022189 | |||
| 1485 | Ga0495607_0025050 | |||
| 1486 | Ga0495607_0039620 | |||
| 1487 | Ga0495607_0057702 | |||
| 1488 | Ga0495607_0152104 | |||
| 1489 | Ga0495607_0158218 | |||
| 1490 | Ga0495607_0197575 | |||
| 1491 | Ga0495583_0000016 | |||
| 1492 | Ga0495583_0000191 | |||
| 1493 | Ga0495583_0000319 | |||
| 1494 | Ga0495583_0000751 | |||
| 1495 | Ga0495583_0010592 | |||
| 1496 | Ga0495583_0014077 | |||
| 1497 | Ga0495583_0016061 | |||
| 1498 | Ga0495583_0019048 | |||
| 1499 | Ga0495583_0040867 | |||
| 1500 | Ga0495606_0000276 | |||
| 1501 | Ga0495606_0001057 | |||
| 1502 | Ga0495606_0001130 | |||
| 1503 | Ga0495606_0001852 | |||
| 1504 | Ga0495606_0002481 | |||
| 1505 | Ga0495606_0002801 | |||
| 1506 | Ga0495606_0003539 | |||
| 1507 | Ga0495606_0006497 | |||
| 1508 | Ga0495606_0041193 | |||
| 1509 | Ga0495606_0046869 | |||
| 1510 | Ga0495606_0057318 | |||
| 1511 | Ga0495606_0148442 | |||
| 1512 | Ga0495606_0218512 | |||
| 1513 | Ga0495606_0286082 | |||
| 1514 | Ga0495610_0000007 | |||
| 1515 | Ga0495610_0002183 | |||
| 1516 | Ga0495610_0004019 | |||
| 1517 | Ga0495610_0010453 | |||
| 1518 | Ga0495610_0014159 | |||
| 1519 | Ga0495610_0014189 | |||
| 1520 | Ga0495610_0041754 | |||
| 1521 | Ga0495616_0000749 | |||
| 1522 | Ga0495616_0001218 | |||
| 1523 | Ga0495616_0011693 | |||
| 1524 | Ga0495616_0011712 | |||
| 1525 | Ga0495616_0013262 | |||
| 1526 | Ga0495616_0014409 | |||
| 1527 | Ga0495616_0019026 | |||
| 1528 | Ga0495616_0031360 | |||
| 1529 | Ga0495616_0051402 | |||
| 1530 | Ga0495616_0059648 | |||
| 1531 | Ga0495616_0090352 | |||
| 1532 | Ga0495620_0013747 | |||
| 1533 | Ga0495630_0034913 | |||
| 1534 | Ga0495630_0149760 | |||
| 1535 | Ga0495631_0005248 | |||
| 1536 | Ga0495631_0012648 | |||
| 1537 | Ga0495631_0014553 | |||
| 1538 | Ga0495631_0036584 | |||
| 1539 | Ga0495631_0082344 | |||
| 1540 | Ga0495631_0085051 | |||
| 1541 | Ga0495631_0093092 | |||
| 1542 | Ga0495631_0119294 | |||
| 1543 | Ga0495632_0000090 | |||
| 1544 | Ga0495632_0000184 | |||
| 1545 | Ga0495632_0008137 | |||
| 1546 | Ga0495632_0013914 | |||
| 1547 | Ga0495632_0017476 | |||
| 1548 | Ga0495632_0018215 | |||
| 1549 | Ga0495632_0023559 | |||
| 1550 | Ga0495637_0001177 | |||
| 1551 | Ga0495637_0004283 | |||
| 1552 | Ga0495637_0014283 | |||
| 1553 | Ga0495637_0022999 | |||
| 1554 | Ga0495637_0037567 | |||
| 1555 | Ga0495637_0065832 | |||
| 1556 | Ga0495643_0000230 | |||
| 1557 | Ga0495643_0000420 | |||
| 1558 | Ga0495643_0010866 | |||
| 1559 | Ga0495643_0025951 | |||
| 1560 | Ga0495643_0031189 | |||
| 1561 | Ga0495643_0042233 | |||
| 1562 | Ga0495643_0092186 | |||
| 1563 | Ga0495644_0003060 | |||
| 1564 | Ga0495644_0009727 | |||
| 1565 | Ga0495644_0020872 | |||
| 1566 | Ga0495644_0028843 | |||
| 1567 | Ga0495644_0063374 | |||
| 1568 | Ga0495644_0108519 | |||
| 1569 | Ga0495648_0000082 | |||
| 1570 | Ga0495648_0001254 | |||
| 1571 | Ga0495648_0006814 | |||
| 1572 | Ga0495648_0011977 | |||
| 1573 | Ga0495648_0013312 | |||
| 1574 | Ga0495648_0032223 | |||
| 1575 | Ga0495648_0056080 | |||
| 1576 | Ga0495648_0138100 | |||
| 1577 | Ga0495648_0190643 | |||
| 1578 | Ga0495663_0002300 | |||
| 1579 | Ga0495663_0037962 | |||
| 1580 | Ga0495666_0000188 | |||
| 1581 | Ga0495666_0011597 | |||
| 1582 | Ga0495666_0025051 | |||
| 1583 | Ga0495666_0025891 | |||
| 1584 | Ga0495666_0035999 | |||
| 1585 | Ga0495666_0046367 | |||
| 1586 | Ga0495666_0078076 | |||
| 1587 | Ga0495642_0000046 | |||
| 1588 | Ga0495642_0006763 | |||
| 1589 | Ga0495642_0011614 | |||
| 1590 | Ga0495642_0040136 | |||
| 1591 | Ga0495642_0102468 | |||
| 1592 | Ga0495652_0032605 | |||
| 1593 | Ga0495654_0002109 | |||
| 1594 | Ga0495654_0011154 | |||
| 1595 | Ga0495654_0012362 | |||
| 1596 | Ga0495654_0019236 | |||
| 1597 | Ga0495654_0049087 | |||
| 1598 | Ga0495654_0085522 | |||
| 1599 | Ga0495665_0007076 | |||
| 1600 | Ga0495665_0013943 | |||
| 1601 | Ga0495640_0079879 | |||
| 1602 | Ga0495586_0004480 | |||
| 1603 | Ga0495586_0019287 | |||
| 1604 | Ga0495586_0042542 | |||
| 1605 | Ga0495586_0109140 | |||
| 1606 | Ga0495586_0132591 | |||
| 1607 | Ga0495587_0010860 | |||
| 1608 | Ga0495587_0123876 | |||
| 1609 | Ga0495587_0142148 | |||
| 1610 | Ga0495609_0000026 | |||
| 1611 | Ga0495609_0000599 | |||
| 1612 | Ga0495609_0002410 | |||
| 1613 | Ga0495609_0006815 | |||
| 1614 | Ga0495609_0007669 | |||
| 1615 | Ga0495609_0007835 | |||
| 1616 | Ga0495609_0015210 | |||
| 1617 | Ga0495609_0016045 | |||
| 1618 | Ga0495609_0019538 | |||
| 1619 | Ga0495609_0020468 | |||
| 1620 | Ga0495609_0026297 | |||
| 1621 | Ga0495609_0036696 | |||
| 1622 | Ga0495609_0058713 | |||
| 1623 | Ga0495621_0017388 | |||
| 1624 | Ga0495597_0000341 | |||
| 1625 | Ga0495597_0001426 | |||
| 1626 | Ga0495597_0002139 | |||
| 1627 | Ga0495597_0002447 | |||
| 1628 | Ga0495597_0002492 | |||
| 1629 | Ga0495597_0009137 | |||
| 1630 | Ga0495597_0024575 | |||
| 1631 | Ga0495597_0026578 | |||
| 1632 | Ga0495597_0027038 | |||
| 1633 | Ga0495597_0034059 | |||
| 1634 | Ga0495597_0089444 | |||
| 1635 | Ga0495597_0146205 | |||
| 1636 | Ga0495645_0153435 | |||
| 1637 | Ga0495622_0000036 | |||
| 1638 | Ga0495622_0001962 | |||
| 1639 | Ga0495622_0006774 | |||
| 1640 | Ga0495622_0047494 | |||
| 1641 | Ga0495622_0051735 | |||
| 1642 | Ga0495622_0066490 | |||
| 1643 | Ga0495622_0078099 | |||
| 1644 | Ga0495633_0000342 | |||
| 1645 | Ga0495633_0008545 | |||
| 1646 | Ga0495633_0008826 | |||
| 1647 | Ga0495633_0009734 | |||
| 1648 | Ga0495633_0010297 | |||
| 1649 | Ga0495633_0012562 | |||
| 1650 | Ga0495633_0013497 | |||
| 1651 | Ga0495633_0016073 | |||
| 1652 | Ga0495633_0024291 | |||
| 1653 | Ga0495633_0026015 | |||
| 1654 | Ga0495633_0051005 | |||
| 1655 | Ga0495633_0164072 | |||
| 1656 | Ga0495667_0080515 | |||
| 1657 | Ga0495656_0014820 | |||
| 1658 | Ga0495656_0023716 | |||
| 1659 | Ga0495656_0212645 | |||
| 1660 | Ga0495668_0000266 | |||
| 1661 | Ga0495668_0001680 | |||
| 1662 | Ga0495668_0010998 | |||
| 1663 | Ga0495668_0012490 | |||
| 1664 | Ga0495668_0018722 | |||
| 1665 | Ga0495668_0021319 | |||
| 1666 | Ga0495668_0021355 | |||
| 1667 | Ga0495668_0027267 | |||
| 1668 | Ga0495668_0038720 | |||
| 1669 | Ga0495668_0038806 | |||
| 1670 | Ga0495668_0052572 | |||
| 1671 | Ga0495668_0059832 | |||
| 1672 | Ga0495668_0218059 | |||
| 1673 | Ga0495634_0017842 | |||
| 1674 | Ga0495634_0084544 | |||
| 1675 | Ga0495611_0004249 | |||
| 1676 | Ga0495611_0007102 | |||
| 1677 | Ga0495611_0015211 | |||
| 1678 | Ga0495611_0040218 | |||
| 1679 | Ga0495611_0084196 | |||
| 1680 | Ga0495611_0112018 | |||
| 1681 | Ga0495625_0000843 | |||
| 1682 | Ga0495625_0009699 | |||
| 1683 | Ga0495625_0010984 | |||
| 1684 | Ga0495625_0013060 | |||
| 1685 | Ga0495625_0043892 | |||
| 1686 | Ga0495625_0092825 | |||
| 1687 | Ga0495625_0100886 | |||
| 1688 | Ga0495625_0186258 | |||
| 1689 | Ga0495625_0277094 | |||
| 1690 | Ga0495635_0008247 | |||
| 1691 | Ga0495659_0003676 | |||
| 1692 | Ga0495659_0004819 | |||
| 1693 | Ga0495659_0037228 | |||
| 1694 | Ga0495659_0041029 | |||
| 1695 | Ga0495661_0000913 | |||
| 1696 | Ga0495661_0012826 | |||
| 1697 | Ga0495661_0013120 | |||
| 1698 | Ga0495661_0017933 | |||
| 1699 | Ga0495661_0020826 | |||
| 1700 | Ga0495661_0040247 | |||
| 1701 | Ga0495661_0053279 | |||
| 1702 | Ga0495661_0058002 | |||
| 1703 | Ga0495661_0061483 | |||
| 1704 | Ga0495661_0114742 | |||
| 1705 | Ga0495661_0140601 | |||
| 1706 | Ga0495661_0204318 | |||
| 1707 | Ga0495588_0000140 | |||
| 1708 | Ga0495588_0007566 | |||
| 1709 | Ga0495588_0012774 | |||
| 1710 | Ga0495588_0024495 | |||
| 1711 | Ga0495588_0026522 | |||
| 1712 | Ga0495588_0030365 | |||
| 1713 | Ga0495588_0041800 | |||
| 1714 | Ga0495588_0051974 | |||
| 1715 | Ga0495588_0081778 | |||
| 1716 | Ga0495623_0080155 | |||
| 1717 | Ga0495623_0150246 | |||
| 1718 | Ga0495623_0260196 | |||
| 1719 | Ga0495646_0271153 | |||
| 1720 | Ga0495658_0042199 | |||
| 1721 | Ga0495669_0000896 | |||
| 1722 | Ga0495669_0006748 | |||
| 1723 | Ga0495669_0011483 | |||
| 1724 | Ga0495669_0012333 | |||
| 1725 | Ga0495669_0018469 | |||
| 1726 | Ga0495669_0037720 | |||
| 1727 | Ga0495669_0105437 | |||
| 1728 | Ga0495669_0137703 | |||
| 1729 | Ga0495669_0198535 | |||
| 1730 | Ga0495613_0138894 | |||
| 1731 | Ga0495624_0008666 | |||
| 1732 | Ga0495624_0355506 | |||
| 1733 | Ga0495670_0007065 | |||
| 1734 | Ga0495670_0016062 | |||
| 1735 | Ga0495670_0087127 | |||
| 1736 | Ga0495670_0092139 | |||
| 1737 | Ga0495670_0120282 | |||
| 1738 | Ga0495671_0000086 | |||
| 1739 | Ga0495671_0000245 | |||
| 1740 | Ga0495671_0002185 | |||
| 1741 | Ga0495671_0105213 | |||
| 1742 | Ga0495671_0111752 | |||
| 1743 | Ga0495671_0139528 | |||
| 1744 | Ga0495649_0000093 | |||
| 1745 | Ga0495649_0008892 | |||
| 1746 | Ga0495649_0028635 | |||
| 1747 | Ga0495649_0041528 | |||
| 1748 | Ga0495649_0048098 | |||
| 1749 | Ga0495649_0217354 | |||
| 1750 | Ga0495649_0221499 | |||
| 1751 | Ga0495589_0000337 | |||
| 1752 | Ga0495589_0000462 | |||
| 1753 | Ga0495589_0003191 | |||
| 1754 | Ga0495589_0008624 | |||
| 1755 | Ga0495589_0017018 | |||
| 1756 | Ga0495589_0018245 | |||
| 1757 | Ga0495589_0026593 | |||
| 1758 | Ga0495589_0049361 | |||
| 1759 | Ga0495589_0218586 | |||
| 1760 | Ga0495600_0020026 | |||
| 1761 | Ga0495600_0050887 | |||
| 1762 | Ga0495660_0000085 | |||
| 1763 | Ga0495660_0002264 | |||
| 1764 | Ga0495660_0002327 | |||
| 1765 | Ga0495660_0002406 | |||
| 1766 | Ga0495660_0010617 | |||
| 1767 | Ga0495660_0019058 | |||
| 1768 | Ga0495660_0022697 | |||
| 1769 | Ga0495660_0024987 | |||
| 1770 | Ga0495660_0030454 | |||
| 1771 | Ga0495660_0031663 | |||
| 1772 | Ga0495660_0045063 | |||
| 1773 | Ga0495660_0078158 | |||
| 1774 | Ga0495660_0122137 | |||
| 1775 | Ga0495581_0013040 | |||
| 1776 | Ga0495581_0040948 | |||
| 1777 | Ga0495581_0118476 | |||
| 1778 | Ga0495604_0040354 | |||
| 1779 | Ga0495604_0120453 | |||
| 1780 | Ga0495604_0249471 | |||
| 1781 | Ga0495636_0004955 | |||
| 1782 | Ga0495636_0012647 | |||
| 1783 | Ga0495636_0017270 | |||
| 1784 | Ga0495636_0024594 | |||
| 1785 | Ga0495636_0082372 | |||
| 1786 | Ga0495674_0003089 | |||
| 1787 | Ga0495672_0000005 | |||
| 1788 | Ga0495672_0000217 | |||
| 1789 | Ga0495672_0000458 | |||
| 1790 | Ga0495672_0000483 | |||
| 1791 | Ga0495672_0015337 | |||
| 1792 | Ga0495672_0019626 | |||
| 1793 | Ga0495672_0023745 | |||
| 1794 | Ga0495672_0056491 | |||
| 1795 | Ga0495672_0080223 | |||
| 1796 | Ga0495672_0095297 | |||
| 1797 | Ga0495672_0191737 | |||
| 1798 | Ga0495676_0003794 | |||
| 1799 | Ga0495676_0095264 | |||
| 1800 | Ga0495676_0114590 | |||
| 1801 | Ga0495676_0171153 | |||
| 1802 | Ga0495676_0273881 | |||
| 1803 | Ga0495680_0025365 | |||
| 1804 | Ga0495683_0000054 | |||
| 1805 | Ga0495683_0000662 | |||
| 1806 | Ga0495683_0012831 | |||
| 1807 | Ga0495683_0031376 | |||
| 1808 | Ga0495683_0035853 | |||
| 1809 | Ga0495683_0060688 | |||
| 1810 | Ga0495683_0078493 | |||
| 1811 | Ga0495687_000037 | |||
| 1812 | Ga0495687_000155 | |||
| 1813 | Ga0495687_000468 | |||
| 1814 | Ga0495687_001686 | |||
| 1815 | Ga0495687_001978 | |||
| 1816 | Ga0495687_005761 | |||
| 1817 | Ga0495687_009381 | |||
| 1818 | Ga0495687_011026 | |||
| 1819 | Ga0495687_068105 | |||
| 1820 | Ga0495675_0002475 | |||
| 1821 | Ga0495675_0023210 | |||
| 1822 | Ga0495675_0096577 | |||
| 1823 | Ga0495675_0120192 | |||
| 1824 | Ga0495677_0000130 | |||
| 1825 | Ga0495677_0006146 | |||
| 1826 | Ga0495677_0007525 | |||
| 1827 | Ga0495677_0008597 | |||
| 1828 | Ga0495677_0010442 | |||
| 1829 | Ga0495677_0010483 | |||
| 1830 | Ga0495677_0011196 | |||
| 1831 | Ga0495677_0018890 | |||
| 1832 | Ga0495677_0020135 | |||
| 1833 | Ga0495677_0033862 | |||
| 1834 | Ga0495677_0113530 | |||
| 1835 | Ga0495679_007218 | |||
| 1836 | Ga0495679_007632 | |||
| 1837 | Ga0495679_013012 | |||
| 1838 | Ga0495679_031141 | |||
| 1839 | Ga0495679_032605 | |||
| 1840 | Ga0495685_000032 | |||
| 1841 | Ga0495685_002375 | |||
| 1842 | Ga0495685_069250 | |||
| 1843 | Ga0495673_0000057 | |||
| 1844 | Ga0495673_0000060 | |||
| 1845 | Ga0495673_0001499 | |||
| 1846 | Ga0495673_0019812 | |||
| 1847 | Ga0495673_0046075 | |||
| 1848 | Ga0495681_0000431 | |||
| 1849 | Ga0495681_0000955 | |||
| 1850 | Ga0495681_0002687 | |||
| 1851 | Ga0495681_0009295 | |||
| 1852 | Ga0495681_0015314 | |||
| 1853 | Ga0495681_0016965 | |||
| 1854 | Ga0495681_0032166 | |||
| 1855 | Ga0495686_0000047 | |||
| 1856 | Ga0495686_0000142 | |||
| 1857 | Ga0495686_0002586 | |||
| 1858 | Ga0495686_0013068 | |||
| 1859 | Ga0495686_0015664 | |||
| 1860 | Ga0495686_0035276 | |||
| 1861 | Ga0495686_0050660 | |||
| 1862 | Ga0495686_0107452 | |||
| 1863 | Ga0495593_0012258 | |||
| 1864 | Ga0495593_0020991 | |||
| 1865 | Ga0495593_0027434 | |||
| 1866 | Ga0495602_0132554 | |||
| 1867 | Ga0495602_0157443 | |||
| 1868 | Ga0495614_0015534 | |||
| 1869 | Ga0495614_0018631 | |||
| 1870 | Ga0495626_0000009 | |||
| 1871 | Ga0495626_0000078 | |||
| 1872 | Ga0495626_0002601 | |||
| 1873 | Ga0495626_0006180 | |||
| 1874 | Ga0495626_0011834 | |||
| 1875 | Ga0495626_0012268 | |||
| 1876 | Ga0495626_0016679 | |||
| 1877 | Ga0495626_0023846 | |||
| 1878 | Ga0495626_0028717 | |||
| 1879 | Ga0495626_0145656 | |||
| 1880 | Ga0495626_0173846 | |||
| 1881 | Ga0496100_0148412 | |||
| 1882 | Ga0496100_0552697 | |||
| 1883 | Ga0496102_0000360 | |||
| 1884 | Ga0496102_0033039 | |||
| 1885 | Ga0496102_0038714 | |||
| 1886 | Ga0496102_0269798 | |||
| 1887 | Ga0496103_0001443 | |||
| 1888 | Ga0496103_0012438 | |||
| 1889 | Ga0496103_0041402 | |||
| 1890 | Ga0496105_0165537 | |||
| 1891 | Ga0496105_0231960 | |||
| 1892 | Ga0496106_0023634 | |||
| 1893 | Ga0496106_0030666 | |||
| 1894 | Ga0496107_0134791 | |||
| 1895 | Ga0496107_0201807 | |||
| 1896 | Ga0496107_0623101 | |||
| 1897 | Ga0496108_0616503 | |||
| 1898 | Ga0496110_0077107 | |||
| 1899 | Ga0496110_0411770 | |||
| 1900 | Ga0496111_0149814 | |||
| 1901 | Ga0496111_0314153 | |||
| 1902 | Ga0496113_0043136 | |||
| 1903 | Ga0496113_0278888 | |||
| 1904 | Ga0496115_0049354 | |||
| 1905 | Ga0496115_0606002 | |||
| 1906 | Ga0496116_0041137 | |||
| 1907 | Ga0496117_0000011 | |||
| 1908 | Ga0496118_0000010 | |||
| 1909 | Ga0496118_0186155 | |||
| 1910 | Ga0496121_0014681 | |||
| 1911 | Ga0496121_0052677 | |||
| 1912 | Ga0496122_0000549 | |||
| 1913 | Ga0496122_0002477 | |||
| 1914 | Ga0496122_0003057 | |||
| 1915 | Ga0496122_0015963 | |||
| 1916 | Ga0496122_0083157 | |||
| 1917 | Ga0496122_0125872 | |||
| 1918 | Ga0496123_0000326 | |||
| 1919 | Ga0496123_0014307 | |||
| 1920 | Ga0496123_0017258 | |||
| 1921 | Ga0496123_0033067 | |||
| 1922 | Ga0496124_0001925 | |||
| 1923 | Ga0496124_0042693 | |||
| 1924 | Ga0496124_0057575 | |||
| 1925 | Ga0496124_0064120 | |||
| 1926 | Ga0496124_0083828 | |||
| 1927 | Ga0496124_0153107 | |||
| 1928 | Ga0496124_0242504 | |||
| 1929 | Ga0496124_0309214 | |||
| 1930 | Ga0496125_0009304 | |||
| 1931 | Ga0496125_0025826 | |||
| 1932 | Ga0496125_0035590 | |||
| 1933 | Ga0496125_0069129 | |||
| 1934 | Ga0496125_0106794 | |||
| 1935 | Ga0496125_0357216 | |||
| 1936 | Ga0496126_0006527 | |||
| 1937 | Ga0501304_006870 | |||
| 1938 | Ga0495678_000001 | |||
| 1939 | Ga0495678_000163 | |||
| 1940 | Ga0495678_000347 | |||
| 1941 | Ga0495678_002748 | |||
| 1942 | Ga0495678_002777 | |||
| 1943 | Ga0495678_003899 | |||
| 1944 | Ga0495678_010182 | |||
| 1945 | Ga0495678_070628 | |||
| 1946 | Ga0495678_079460 | |||
| 1947 | Ga0495678_080101 | |||
| 1948 | Ga0495682_0000292 | |||
| 1949 | Ga0495682_0005778 | |||
| 1950 | Ga0495682_0006944 | |||
| 1951 | Ga0495682_0006952 | |||
| 1952 | Ga0495682_0010628 | |||
| 1953 | Ga0495682_0016641 | |||
| 1954 | Ga0495682_0028792 | |||
| 1955 | Ga0501036_0155045 | |||
| 1956 | Ga0501249_004735 | |||
| 1957 | Ga0501269_000077 | |||
| 1958 | Ga0501269_012765 | |||
| 1959 | Ga0501035_0002946 | |||
| 1960 | Ga0501044_0262201 | |||
| 1961 | nmdc:mga03683_17027_c1 | |||
| 1962 | nmdc:mga0yw44_50801_c1 | |||
| 1963 | nmdc:mga06z11_100034_c1 | |||
| 1964 | nmdc:mga06z11_119347_c1 | |||
| 1965 | nmdc:mga08y16_121431_c1 | |||
| 1966 | nmdc:mga0sz30_56177_c1 | |||
| 1967 | Ga0500641_0007972 | |||
| 1968 | Ga0500641_0072881 | |||
| 1969 | Ga0500594_0035340 | |||
| 1970 | Ga0500618_000384 | |||
| 1971 | Ga0500618_000433 | |||
| 1972 | Ga0500618_002204 | |||
| 1973 | Ga0500559_0108682 | |||
| 1974 | Ga0500586_000135 | |||
| 1975 | Ga0500636_0000106 | |||
| 1976 | Ga0500637_0039690 | |||
| 1977 | Ga0500637_0129698 | |||
| 1978 | Ga0500637_0184097 | |||
| 1979 | Ga0501084_0305968 | |||
| 1980 | Ga0587090_024863 | |||
| 1981 | Ga0587111_0041035 | |||
| 1982 | Ga0466962_0035793 | |||
| 1983 | Ga0466962_0092611 | |||
| 1984 | 2511248015 | |||
| 1985 | 2511385024 | |||
| 1986 | 2526210880 | |||
| 1987 | 2574430522 | |||
| 1988 | 2601669530 | |||
| 1989 | 2643788147 | |||
| 1990 | 2643801106 | |||
| 1991 | 2644026832 | |||
| 1992 | 2644216251 | |||
| 1993 | 2644255366 | |||
| 1994 | 2644359888 | |||
| 1995 | 2644472808 | |||
| 1996 | 2738742495 | |||
| 1997 | 2738827237 | |||
| 1998 | 2738846551 | |||
| 1999 | 2739151034 | |||
| 2000 | 2739192953 | |||
| 2001 | 2739277195 | |||
| 2002 | 2739319430 | |||
| 2003 | 2739337671 | |||
| 2004 | 2739346245 | |||
| 2005 | 2809128589 | |||
| 2006 | 2809142275 | |||
| 2007 | 2809148210 | |||
| 2008 | 2819594999 | |||
| 2009 | 2821134595 | |||
| 2010 | 2834641526 | |||
| 2011 | 2842715101 | |||
| 2012 | 2852620371 | |||
| 2013 | 2857549651 | |||
| 2014 | 2857557088 | |||
| 2015 | 2857560496 | |||
| 2016 | 2857570010 | |||
| 2017 | 2884852910 | |||
| 2018 | 2885081443 | |||
| 2019 | 2891634060 | |||
| 2020 | 2904430262 | |||
| 2021 | 2919480838 | |||
| 2022 | 2928134073 | |||
| 2023 | 2932415733 | |||
| 2024 | 2932421723 | |||
| 2025 | 639787744 | |||
| 2026 | 8047675152 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kdr-assembly1.cif.gz_A | crystal structure of ubig/sah complex | 0.9482 | 21 | 248 |
| 5dpm-assembly1.cif.gz_A | crystal structure of ubig mutant in complex with sah | 0.9457 | 21 | 248 |
| 4kdr-assembly1.cif.gz_A | crystal structure of ubig/sah complex | 0.9349 | 21 | 248 |
| 5dpm-assembly1.cif.gz_A | crystal structure of ubig mutant in complex with sah | 0.9322 | 21 | 248 |
| 4kdc-assembly1.cif.gz_A | crystal structure of ubig | 0.8717 | 27 | 248 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6FP65_72_359_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.962 | 22 | 248 | 3.40.50.150 |
| af_Q0DEH4_83_317_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9613 | 27 | 246 | 3.40.50.150 |
| 4kdrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9482 | 21 | 248 | 3.40.50.150 |
| af_Q54XD0_74_321_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9477 | 27 | 248 | 3.40.50.150 |
| af_O74421_37_271_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9436 | 27 | 249 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R1FNI0-F1-model_v4 | Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) | 0.9852 | 20 | 248 |
GO:0010420
GO:0032259 GO:0061542 GO:0102208 |
| AF-A0A193KBS2-F1-model_v4 | deleted | 0.9803 | 16 | 250 |
|
| AF-A0A7V8QSE0-F1-model_v4 | Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) | 0.967 | 21 | 248 |
GO:0010420
GO:0032259 GO:0061542 |
| AF-A0A193KBS2-F1-model_v4 | deleted | 0.9641 | 16 | 250 |
|
| AF-A0A4R1FNI0-F1-model_v4 | Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) | 0.9603 | 20 | 248 |
GO:0010420
GO:0032259 GO:0061542 GO:0102208 |