F488191

General Info

Members Datasets Scaffolds Average Seq Length
1013 381 2026 234

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100077363|Ga0070665_1000773632
Length 239
Sequence MVATQTPGPVNADPAELAKFSALAHRWWDPTSEFRPLHEINPLRLAHIENLAGGLAGKRVLDVGCGGGILAEAMAASGAQVTGIDLAEKPLQVATLHKIETGSSVEYRLVAAEALAEEMPGAFDVVTCMEMLEHVPEPASIVRAVAKLAKPGGHAFFSTINRNPKSFLFAIVGAEYVLNLLPRGTHEYAKFITPSELAAFCRASGLEPNDLTGMTYNPLTKVYALGRDVDVNYLMACRV

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
7 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
101 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
102 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
175 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
178 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
193 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
210 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
213 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
222 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
225 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
226 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
261 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
286 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
287 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
294 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
317 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
318 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
320 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
328 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
329 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
330 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
333 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
334 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
339 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
340 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
341 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
342 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
343 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
344 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
345 2643221556 Massilia sp. Root1485 Isolate Unclassified
346 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
347 2643221638 Duganella sp. Root336D2 Isolate Unclassified
348 2643221645 Massilia sp. Root351 Isolate Unclassified
349 2643221664 Massilia sp. Root418 Isolate Unclassified
350 2643221684 Massilia sp. Root133 Isolate Unclassified
351 2738541280 Massilia sp. GV090 Isolate Unclassified
352 2738541297 Duganella sp. GV083 Isolate Unclassified
353 2738541300 Massilia sp. GV016 Isolate Unclassified
354 2738541357 Duganella sp. GV053 Isolate Unclassified
355 2738543003 Duganella sp. GV066 Isolate Unclassified
356 2738543018 Massilia sp. GV045 Isolate Unclassified
357 2738543026 Duganella sp. GV089 Isolate Unclassified
358 2738543029 Duganella sp. GV039 Isolate Unclassified
359 2738543030 Massilia sp. GV097 Isolate Unclassified
360 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
361 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
362 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
363 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
364 2821131069 Duganella sp. 1224 Isolate Unclassified
365 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
366 2842711865 Duganella sp. R-73148 Isolate Unclassified
367 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
368 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
369 2857553236 Duganella sp. R-74557 Isolate Unclassified
370 2857558681 Duganella sp. R-74565 Isolate Unclassified
371 2857564685 Duganella sp. R-74599 Isolate Unclassified
372 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
373 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
374 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
375 2904424332 Duganella sp. 1411 Isolate Rhizosphere
376 2919476304 Duganella sp. 3397 Isolate Unclassified
377 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
378 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
379 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
380 639633007 Azoarcus olearius BH72 Isolate Unclassified
381 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.46
Metatranscriptomes 0.3
Isolates 4.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.96
Nodule 0.2
Rhizoplane 2.57
Rhizosphere 78.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100077363 3300005548 Bacteria 3333
2 JGI25155J39150_1000685 3300002704 Bacteria 6321
3 JGI25156J39149_1013612 3300002705 Bacteria 1717
4 JGI25154J39366_1001901 3300002738 Bacteria 6321
5 JGI25157J39369_1001234 3300002741 Bacteria 10597
6 JGI25152J39213_1001691 3300002773 Bacteria 9086
7 JGI25150J39212_1004735 3300002774 Bacteria 2986
8 JGI25150J39212_1004776 3300002774 Bacteria 2970
9 JGI25159J45721_1005656 3300002987 Bacteria 3886
10 JGI25159J45721_1006490 3300002987 Bacteria 3493
11 JGI25153J46596_10018512 3300003215 Bacteria 2702
12 JGI25153J46596_10019612 3300003215 Bacteria 2584
13 rootL2_10030810 3300003322 Bacteria 18010
14 JGI25161J50226_1002935 3300003374 Bacteria 4133
15 Ga0055532_1000077 3300003758 Bacteria 122193
16 Ga0055525_1000074 3300003759 Bacteria 178058
17 Ga0055529_1000119 3300003763 Bacteria 115765
18 Ga0055526_1000096 3300003771 Bacteria 80897
19 Ga0055526_1000176 3300003771 Bacteria 56708
20 Ga0055526_1005549 3300003771 Bacteria 7207
21 Ga0055526_1012194 3300003771 Bacteria 3776
22 Ga0055537_1002012 3300003773 Bacteria 7223
23 Ga0055537_1007195 3300003773 Bacteria 2716
24 Ga0055524_1000049 3300003775 Bacteria 149383
25 Ga0055524_1006247 3300003775 Bacteria 5194
26 Ga0055524_1009250 3300003775 Bacteria 4029
27 Ga0055524_1010025 3300003775 Bacteria 3804
28 Ga0055524_1010467 3300003775 Bacteria 3691
29 Ga0055534_1002464 3300003784 Bacteria 6391
30 Ga0055534_1007631 3300003784 Bacteria 2550
31 Ga0055528_1000378 3300003790 Bacteria 36269
32 Ga0055528_1010121 3300003790 Bacteria 3872
33 Ga0055530_10007632 3300003791 Bacteria 4512
34 Ga0055531_10014242 3300003794 Bacteria 3598
35 Ga0055543_1000154 3300004625 Bacteria 57352
36 Ga0055543_1007921 3300004625 Bacteria 2406
37 Ga0065165_1000571 3300005262 Bacteria 54679
38 Ga0065165_1001586 3300005262 Bacteria 23398
39 Ga0065165_1005416 3300005262 Bacteria 7192
40 Ga0070658_10397592 3300005327 Bacteria 1183
41 Ga0070676_10079006 3300005328 Bacteria 1991
42 Ga0070683_100023896 3300005329 Bacteria 5472
43 Ga0070690_100006127 3300005330 Bacteria 6806
44 Ga0070690_100054139 3300005330 Bacteria 2568
45 Ga0070677_10024701 3300005333 Bacteria 2237
46 Ga0068869_100005370 3300005334 Bacteria 8053
47 Ga0068869_100246471 3300005334 Bacteria 1425
48 Ga0070666_10182683 3300005335 Bacteria 1471
49 Ga0070680_100099705 3300005336 Bacteria 2411
50 Ga0070682_100336628 3300005337 Bacteria 1120
51 Ga0070660_100005785 3300005339 Bacteria 8565
52 Ga0070660_100053782 3300005339 Bacteria 3106
53 Ga0070689_100100855 3300005340 Bacteria 2284
54 Ga0070687_100017933 3300005343 Bacteria 3265
55 Ga0070687_100255533 3300005343 Bacteria 1091
56 Ga0070661_100018767 3300005344 Bacteria 4922
57 Ga0070661_100405395 3300005344 Bacteria 1079
58 Ga0070692_10119362 3300005345 Bacteria 1469
59 Ga0070668_100046395 3300005347 Bacteria 3336
60 Ga0070674_100002988 3300005356 Bacteria 9393
61 Ga0070688_100004034 3300005365 Bacteria 7618
62 Ga0070659_100000840 3300005366 Bacteria 22393
63 Ga0070659_100143807 3300005366 Bacteria 1942
64 Ga0070659_100338332 3300005366 Bacteria 1260
65 Ga0070659_100368219 3300005366 Bacteria 1208
66 Ga0070667_100257863 3300005367 Bacteria 1560
67 Ga0070714_100191894 3300005435 Bacteria 1865
68 Ga0070701_10007677 3300005438 Bacteria 4626
69 Ga0070700_100075096 3300005441 Bacteria 2167
70 Ga0070663_100435731 3300005455 Bacteria 1078
71 Ga0070685_10061804 3300005466 Bacteria 2194
72 Ga0070684_100064719 3300005535 Bacteria 3208
73 Ga0070672_100158970 3300005543 Bacteria 1873
74 Ga0070665_100092707 3300005548 Bacteria 3025
75 Ga0068855_100096508 3300005563 Bacteria 3405
76 Ga0068855_100266261 3300005563 Bacteria 1907
77 Ga0070664_100007438 3300005564 Bacteria 8840
78 Ga0070664_100071288 3300005564 Bacteria 2977
79 Ga0068857_100134900 3300005577 Bacteria 2229
80 Ga0068857_100323239 3300005577 Bacteria 1425
81 Ga0068856_100085329 3300005614 Bacteria 3136
82 Ga0070702_100054252 3300005615 Bacteria 2305
83 Ga0068861_100068057 3300005719 Bacteria 2750
84 Ga0068858_100029744 3300005842 Bacteria 5074
85 Ga0068858_100255506 3300005842 Bacteria 1665
86 Ga0068860_100114608 3300005843 Bacteria 2577
87 Ga0068862_100156567 3300005844 Bacteria 2031
88 Ga0081539_10017768 3300005985 Bacteria 4972
89 Ga0075368_10045034 3300006042 Bacteria 1742
90 Ga0075363_100012995 3300006048 Bacteria 4022
91 Ga0070712_100021576 3300006175 Bacteria 4232
92 Ga0075362_10095140 3300006177 Bacteria 1387
93 Ga0075369_10022138 3300006186 Bacteria 2619
94 Ga0075369_10037445 3300006186 Bacteria 2066
95 Ga0075366_10002692 3300006195 Bacteria 9166
96 Ga0075366_10125788 3300006195 Bacteria 1546
97 Ga0075366_10264188 3300006195 Bacteria 1051
98 Ga0097621_100015682 3300006237 Bacteria 5710
99 Ga0075370_10038106 3300006353 Bacteria 2705
100 Ga0068871_100000638 3300006358 Bacteria 24082
101 Ga0068865_100702973 3300006881 Bacteria 864
102 Ga0099826_10000005 3300006948 Bacteria 465206
103 Ga0105251_10035840 3300009011 Bacteria 2445
104 Ga0105244_10008754 3300009036 Bacteria 6293
105 Ga0105244_10008940 3300009036 Bacteria 6201
106 Ga0105240_10035812 3300009093 Bacteria 6392
107 Ga0105240_10193821 3300009093 Bacteria 2388
108 Ga0105240_10534436 3300009093 Bacteria 1299
109 Ga0111539_10309447 3300009094 Bacteria 1838
110 Ga0105245_10039862 3300009098 Bacteria 4182
111 Ga0105245_10099696 3300009098 Bacteria 2686
112 Ga0105243_10023507 3300009148 Bacteria 4694
113 Ga0105241_10004455 3300009174 Bacteria 10358
114 Ga0105242_10145097 3300009176 Bacteria 2064
115 Ga0105238_10082619 3300009551 Bacteria 3202
116 Ga0105246_10106875 3300011119 Bacteria 2048
117 Ga0157371_10000014 3300013102 Bacteria 347490
118 Ga0157371_10252115 3300013102 Bacteria 1271
119 Ga0157370_10042640 3300013104 Bacteria 4371
120 Ga0157370_10620228 3300013104 Bacteria 990
121 Ga0157378_10002428 3300013297 Bacteria 16569
122 Ga0157378_10091197 3300013297 Bacteria 2770
123 Ga0163162_10019684 3300013306 Bacteria 6625
124 Ga0163162_10033542 3300013306 Bacteria 5102
125 Ga0163162_10518733 3300013306 Bacteria 1321
126 Ga0157380_10272704 3300014326 Bacteria 1543
127 Ga0182008_10000231 3300014497 Bacteria 43471
128 Ga0157379_10025665 3300014968 Bacteria 5236
129 Ga0157379_10054399 3300014968 Bacteria 3576
130 Ga0157379_10547118 3300014968 Bacteria 1077
131 Ga0157376_10024502 3300014969 Bacteria 4739
132 Ga0182006_1000004 3300015261 Bacteria 622190
133 Ga0182006_1000176 3300015261 Bacteria 67387
134 Ga0182006_1029981 3300015261 Bacteria 2201
135 Ga0182006_1144869 3300015261 Bacteria 809
136 Ga0182007_10001618 3300015262 Bacteria 11961
137 Ga0182005_1000005 3300015265 Bacteria 537378
138 Ga0182005_1000030 3300015265 Bacteria 213092
139 Ga0163161_10028570 3300017792 Bacteria 3961
140 Ga0163161_10029767 3300017792 Bacteria 3881
141 Ga0163161_10071615 3300017792 Bacteria 2537
142 Ga0213872_10000504 3300021361 Bacteria 30966
143 Ga0213872_10001863 3300021361 Bacteria 13043
144 Ga0213872_10010875 3300021361 Bacteria 4319
145 Ga0209435_100048 3300025206 Bacteria 92746
146 Ga0209435_100225 3300025206 Bacteria 15779
147 Ga0209436_100090 3300025208 Bacteria 45531
148 Ga0209436_101258 3300025208 Bacteria 9115
149 Ga0209147_100122 3300025229 Bacteria 138553
150 Ga0209563_100003 3300025230 Bacteria 1932942
151 Ga0209437_100081 3300025233 Bacteria 271072
152 Ga0209437_104536 3300025233 Bacteria 2438
153 Ga0209258_100230 3300025242 Bacteria 104468
154 Ga0207425_1000017 3300025245 Bacteria 423851
155 Ga0207425_1000341 3300025245 Bacteria 32384
156 Ga0207425_1000397 3300025245 Bacteria 29297
157 Ga0207425_1033144 3300025245 Bacteria 1019
158 Ga0209646_1000036 3300025246 Bacteria 358864
159 Ga0209646_1000130 3300025246 Bacteria 128556
160 Ga0209646_1000152 3300025246 Bacteria 97484
161 Ga0209026_1000126 3300025250 Bacteria 122422
162 Ga0209026_1003081 3300025250 Bacteria 5695
163 Ga0209677_115509 3300025253 Bacteria 1002
164 Ga0209148_1001208 3300025254 Bacteria 14673
165 Ga0209759_1000193 3300025256 Bacteria 97484
166 Ga0209759_1001123 3300025256 Bacteria 17232
167 Ga0209129_1000039 3300025258 Bacteria 322444
168 Ga0209129_1000088 3300025258 Bacteria 179071
169 Ga0209129_1010411 3300025258 Bacteria 2321
170 Ga0209565_1000018 3300025263 Bacteria 460940
171 Ga0209565_1001328 3300025263 Bacteria 11325
172 Ga0209565_1004071 3300025263 Bacteria 4555
173 Ga0209565_1004755 3300025263 Bacteria 4076
174 Ga0209565_1013248 3300025263 Bacteria 1934
175 Ga0209565_1020726 3300025263 Bacteria 1384
176 Ga0209565_1023630 3300025263 Bacteria 1261
177 Ga0209455_1000047 3300025272 Bacteria 379709
178 Ga0209455_1006928 3300025272 Bacteria 3279
179 Ga0209673_1000090 3300025273 Bacteria 202223
180 Ga0209130_1001116 3300025284 Bacteria 19716
181 Ga0209130_1001315 3300025284 Bacteria 16986
182 Ga0209130_1003207 3300025284 Bacteria 7206
183 Ga0209675_1000005 3300025291 Bacteria 849192
184 Ga0209675_1001071 3300025291 Bacteria 16951
185 Ga0209675_1008948 3300025291 Bacteria 3600
186 Ga0209025_1011979 3300025294 Bacteria 5626
187 Ga0209564_1000060 3300025295 Bacteria 325890
188 Ga0209564_1000078 3300025295 Bacteria 275766
189 Ga0209564_1000348 3300025295 Bacteria 86984
190 Ga0209564_1000626 3300025295 Bacteria 53912
191 Ga0209564_1008728 3300025295 Bacteria 4945
192 Ga0209564_1030211 3300025295 Bacteria 1683
193 Ga0209758_1000137 3300025297 Bacteria 176734
194 Ga0209758_1000895 3300025297 Bacteria 40555
195 Ga0209050_1000598 3300025298 Bacteria 57505
196 Ga0209050_1003979 3300025298 Bacteria 10424
197 Ga0209050_1004001 3300025298 Bacteria 10390
198 Ga0209256_1000040 3300025299 Bacteria 366839
199 Ga0209256_1000189 3300025299 Bacteria 117922
200 Ga0209256_1000601 3300025299 Bacteria 49925
201 Ga0209256_1003275 3300025299 Bacteria 11590
202 Ga0209256_1008841 3300025299 Bacteria 4557
203 Ga0207426_1002086 3300025302 Bacteria 13819
204 Ga0209051_1016883 3300025303 Bacteria 3280
205 Ga0209257_1010731 3300025304 Bacteria 4561
206 Ga0207697_10010078 3300025315 Bacteria 4058
207 Ga0207655_1001915 3300025728 Bacteria 17866
208 Ga0207655_1033252 3300025728 Bacteria 2340
209 Ga0207682_10000396 3300025893 Bacteria 20033
210 Ga0207642_10007487 3300025899 Bacteria 3692
211 Ga0207688_10013245 3300025901 Bacteria 4482
212 Ga0207680_10142283 3300025903 Bacteria 1591
213 Ga0207645_10004613 3300025907 Bacteria 10153
214 Ga0207643_10117333 3300025908 Bacteria 1573
215 Ga0207705_10011718 3300025909 Bacteria 6335
216 Ga0207695_10007570 3300025913 Bacteria 13769
217 Ga0207695_10014717 3300025913 Bacteria 9252
218 Ga0207693_10416849 3300025915 Bacteria 1050
219 Ga0207660_10094647 3300025917 Bacteria 2221
220 Ga0207662_10002632 3300025918 Bacteria 9056
221 Ga0207662_10196206 3300025918 Bacteria 1305
222 Ga0207657_10003671 3300025919 Bacteria 16325
223 Ga0207657_10050467 3300025919 Bacteria 3621
224 Ga0207657_10167012 3300025919 Bacteria 1784
225 Ga0207649_10139865 3300025920 Bacteria 1655
226 Ga0207649_10269949 3300025920 Bacteria 1232
227 Ga0207694_10055883 3300025924 Bacteria 3065
228 Ga0207650_10210439 3300025925 Bacteria 1561
229 Ga0207687_10055772 3300025927 Bacteria 2770
230 Ga0207687_10083746 3300025927 Bacteria 2310
231 Ga0207664_10081013 3300025929 Bacteria 2640
232 Ga0207706_10010122 3300025933 Bacteria 8635
233 Ga0207686_10342305 3300025934 Bacteria 1123
234 Ga0207709_10017824 3300025935 Bacteria 3969
235 Ga0207709_10043577 3300025935 Bacteria 2706
236 Ga0207669_10070171 3300025937 Bacteria 2195
237 Ga0207669_10143380 3300025937 Bacteria 1662
238 Ga0207711_10213364 3300025941 Bacteria 1764
239 Ga0207689_10040563 3300025942 Bacteria 3853
240 Ga0207661_10025986 3300025944 Bacteria 4457
241 Ga0207679_10002872 3300025945 Bacteria 10685
242 Ga0207679_10341225 3300025945 Bacteria 1303
243 Ga0207667_10044688 3300025949 Bacteria 4693
244 Ga0207667_10200117 3300025949 Bacteria 2049
245 Ga0207658_10105280 3300025986 Bacteria 2218
246 Ga0207677_10075788 3300026023 Bacteria 2392
247 Ga0207703_10011138 3300026035 Bacteria 7002
248 Ga0207678_10249299 3300026067 Bacteria 1521
249 Ga0207708_10001740 3300026075 Bacteria 16079
250 Ga0207702_10098293 3300026078 Bacteria 2578
251 Ga0207702_10482459 3300026078 Bacteria 1206
252 Ga0207641_10045680 3300026088 Bacteria 3689
253 Ga0207648_10002465 3300026089 Bacteria 19880
254 Ga0207674_10071261 3300026116 Bacteria 3492
255 Ga0207675_100057588 3300026118 Bacteria 3626
256 Ga0207698_10043065 3300026142 Bacteria 3379
257 Ga0209969_1001118 3300027360 Bacteria 3677
258 Ga0209996_1006507 3300027395 Bacteria 1510
259 Ga0209995_1002583 3300027471 Bacteria 2865
260 Ga0209983_1015344 3300027665 Bacteria 1580
261 Ga0209282_1000003 3300027666 Bacteria 856377
262 Ga0209971_1004552 3300027682 Bacteria 3290
263 Ga0209974_10023418 3300027876 Bacteria 2044
264 Ga0268266_10162250 3300028379 Bacteria 2023
265 Ga0268265_10534379 3300028380 Bacteria 1110
266 Ga0268264_10239639 3300028381 Bacteria 1679
267 Ga0307515_10294504 3300028794 Bacteria 1315
268 Ga0265324_10055303 3300029957 Bacteria 1361
269 Ga0265331_10000237 3300031250 Bacteria 66600
270 Ga0265327_10000517 3300031251 Bacteria 66613
271 Ga0265327_10100303 3300031251 Bacteria 1398
272 Ga0307408_100000511 3300031548 Bacteria 33537
273 Ga0307408_100000604 3300031548 Bacteria 30833
274 Ga0307408_100034763 3300031548 Bacteria 3532
275 Ga0307408_100053643 3300031548 Bacteria 2912
276 Ga0316579_10029788 3300031691 Bacteria 2491
277 Ga0307518_10023324 3300031838 Bacteria 4458
278 Ga0307416_100504644 3300032002 Bacteria 1275
279 Ga0316583_10010274 3300032133 Bacteria 3373
280 Ga0373932_0039320 3300035112 Bacteria 1356
281 Ga0373960_0144401 3300035121 Bacteria 808
282 Ga0316574_0069730 3300035398 Bacteria 2219
283 Ga0373937_0537079 3300036401 Bacteria 1111
284 Ga0373925_0768015 3300037068 Bacteria 795
285 Ga0395899_0000161 3300037312 Bacteria 102608
286 Ga0395899_0001217 3300037312 Bacteria 22538
287 Ga0395899_0002963 3300037312 Bacteria 13588
288 Ga0395899_0039203 3300037312 Bacteria 3547
289 Ga0395899_0097538 3300037312 Bacteria 2124
290 Ga0395899_0104936 3300037312 Bacteria 2036
291 Ga0395899_0133806 3300037312 Bacteria 1768
292 Ga0395899_0390940 3300037312 Bacteria 922
293 Ga0395900_0003402 3300037418 Bacteria 17187
294 Ga0395900_0004563 3300037418 Bacteria 14631
295 Ga0395900_0007120 3300037418 Bacteria 11589
296 Ga0395900_0035585 3300037418 Bacteria 5129
297 Ga0395900_0186012 3300037418 Bacteria 2108
298 Ga0395900_0341275 3300037418 Bacteria 1473
299 Ga0395900_0363190 3300037418 Bacteria 1419
300 Ga0395898_0003439 3300037466 Bacteria 17699
301 Ga0395898_0160098 3300037466 Bacteria 2153
302 Ga0395898_0171946 3300037466 Bacteria 2071
303 Ga0395898_0324532 3300037466 Bacteria 1468
304 Ga0395898_0411362 3300037466 Bacteria 1289
305 Ga0395905_0000137 3300037471 Bacteria 120800
306 Ga0395905_0010634 3300037471 Bacteria 8928
307 Ga0395905_0023218 3300037471 Bacteria 5862
308 Ga0395905_0053658 3300037471 Bacteria 3772
309 Ga0395905_0174378 3300037471 Bacteria 2019
310 Ga0395905_0327650 3300037471 Bacteria 1422
311 Ga0395905_0371050 3300037471 Bacteria 1324
312 Ga0395905_0401898 3300037471 Bacteria 1265
313 Ga0395905_0555299 3300037471 Bacteria 1049
314 Ga0395901_0001241 3300038443 Bacteria 27240
315 Ga0395901_0001265 3300038443 Bacteria 26801
316 Ga0395901_0035568 3300038443 Bacteria 5147
317 Ga0395901_0061313 3300038443 Bacteria 3913
318 Ga0395901_0061841 3300038443 Bacteria 3896
319 Ga0395901_0124271 3300038443 Bacteria 2711
320 Ga0395901_0134427 3300038443 Bacteria 2599
321 Ga0395901_0152351 3300038443 Bacteria 2429
322 Ga0436361_0067343 3300039447 Bacteria 3918
323 Ga0436361_0557931 3300039447 Bacteria 973
324 Ga0436361_0674923 3300039447 Bacteria 2496
325 Ga0436361_1070108 3300039447 Bacteria 31324
326 Ga0436361_1096226 3300039447 Bacteria 9055
327 Ga0439465_0027121 3300041413 Bacteria 1813
328 Ga0439441_001947 3300042001 Bacteria 2833
329 Ga0439448_0010362 3300042005 Bacteria 2763
330 Ga0439455_0001382 3300042012 Bacteria 4032
331 Ga0439455_0003557 3300042012 Bacteria 2992
332 Ga0450904_001005 3300042139 Bacteria 4374
333 Ga0439458_0014183 3300042157 Bacteria 1797
334 Ga0439458_0033461 3300042157 Bacteria 1231
335 Ga0439460_0088653 3300042461 Bacteria 980
336 Ga0466969_0058096 3300044656 Bacteria 1884
337 Ga0466972_0000327 3300044658 Bacteria 26794
338 Ga0466972_0012337 3300044658 Bacteria 4295
339 Ga0466972_0059397 3300044658 Bacteria 1835
340 Ga0466972_0120736 3300044658 Bacteria 1236
341 Ga0466965_0006991 3300044683 Bacteria 5163
342 Ga0466965_0026378 3300044683 Bacteria 2817
343 Ga0466965_0028687 3300044683 Bacteria 2704
344 Ga0466965_0040088 3300044683 Bacteria 2304
345 Ga0466965_0071293 3300044683 Bacteria 1747
346 Ga0466965_0117394 3300044683 Bacteria 1372
347 Ga0466966_0015642 3300044684 Bacteria 5016
348 Ga0466966_0044458 3300044684 Bacteria 2843
349 Ga0466966_0076831 3300044684 Bacteria 2084
350 Ga0466966_0097402 3300044684 Bacteria 1821
351 Ga0466961_0233942 3300044693 Bacteria 1130
352 Ga0466964_0007552 3300044706 Bacteria 4067
353 Ga0466964_0020832 3300044706 Bacteria 2528
354 Ga0466964_0108333 3300044706 Bacteria 1235
355 Ga0466971_0079333 3300044719 Bacteria 1496
356 Ga0466968_0019441 3300044735 Bacteria 2734
357 Ga0466968_0325371 3300044735 Bacteria 743
358 Ga0466970_0021724 3300044765 Bacteria 3345
359 Ga0466970_0073148 3300044765 Bacteria 1845
360 Ga0466970_0211378 3300044765 Bacteria 1081
361 Ga0466957_0054933 3300044842 Bacteria 2432
362 Ga0466957_0069558 3300044842 Bacteria 2174
363 Ga0466957_0152524 3300044842 Bacteria 1495
364 Ga0466957_0205808 3300044842 Bacteria 1294
365 Ga0466959_0045767 3300045049 Bacteria 3222
366 Ga0466959_0051132 3300045049 Bacteria 3032
367 Ga0466959_0192115 3300045049 Bacteria 1424
368 Ga0466958_0091202 3300045836 Bacteria 1886
369 Ga0466967_0028106 3300045976 Bacteria 4690
370 Ga0466967_0033721 3300045976 Bacteria 4337
371 Ga0466967_0101302 3300045976 Bacteria 2632
372 Ga0495617_000005 3300046452 Bacteria 404687
373 Ga0495617_000015 3300046452 Bacteria 260968
374 Ga0495617_000578 3300046452 Bacteria 18757
375 Ga0495617_005569 3300046452 Bacteria 4456
376 Ga0495617_005661 3300046452 Bacteria 4416
377 Ga0495627_000038 3300046453 Bacteria 198316
378 Ga0495627_000186 3300046453 Bacteria 69314
379 Ga0495603_0015382 3300046455 Bacteria 4628
380 Ga0495603_0045046 3300046455 Bacteria 2632
381 Ga0495603_0123400 3300046455 Bacteria 1509
382 Ga0495590_0000011 3300046457 Bacteria 307470
383 Ga0495590_0000644 3300046457 Bacteria 16180
384 Ga0495590_0004747 3300046457 Bacteria 5449
385 Ga0495590_0014627 3300046457 Bacteria 2861
386 Ga0495590_0016718 3300046457 Bacteria 2648
387 Ga0495591_000814 3300046458 Bacteria 22076
388 Ga0495591_007812 3300046458 Bacteria 4472
389 Ga0495629_0011951 3300046459 Bacteria 6296
390 Ga0495629_0103119 3300046459 Bacteria 1990
391 Ga0495638_0000058 3300046460 Bacteria 192656
392 Ga0495638_0011400 3300046460 Bacteria 6125
393 Ga0495638_0065080 3300046460 Bacteria 2245
394 Ga0495638_0066715 3300046460 Bacteria 2211
395 Ga0495638_0093868 3300046460 Bacteria 1804
396 Ga0495638_0246243 3300046460 Bacteria 987
397 Ga0495653_0000031 3300046463 Bacteria 137159
398 Ga0495653_0018992 3300046463 Bacteria 5577
399 Ga0495650_0000152 3300046471 Bacteria 156983
400 Ga0495650_0000480 3300046471 Bacteria 61049
401 Ga0495650_0000700 3300046471 Bacteria 42992
402 Ga0495650_0000962 3300046471 Bacteria 33039
403 Ga0495650_0001811 3300046471 Bacteria 19221
404 Ga0495650_0002693 3300046471 Bacteria 13792
405 Ga0495650_0021108 3300046471 Bacteria 3156
406 Ga0495580_0477232 3300046472 Bacteria 834
407 Ga0495582_0024678 3300046473 Bacteria 3290
408 Ga0495582_0030001 3300046473 Bacteria 2984
409 Ga0495605_0000021 3300046474 Bacteria 248512
410 Ga0495605_0000082 3300046474 Bacteria 125136
411 Ga0495605_0000408 3300046474 Bacteria 39353
412 Ga0495605_0006381 3300046474 Bacteria 6790
413 Ga0495605_0014561 3300046474 Bacteria 4302
414 Ga0495605_0018022 3300046474 Bacteria 3792
415 Ga0495605_0034387 3300046474 Bacteria 2566
416 Ga0495605_0038539 3300046474 Bacteria 2397
417 Ga0495605_0038836 3300046474 Bacteria 2386
418 Ga0495605_0086716 3300046474 Bacteria 1456
419 Ga0495584_0000009 3300046491 Bacteria 236318
420 Ga0495584_0001552 3300046491 Bacteria 13647
421 Ga0495584_0007345 3300046491 Bacteria 5745
422 Ga0495584_0010378 3300046491 Bacteria 4788
423 Ga0495584_0014421 3300046491 Bacteria 4026
424 Ga0495584_0014452 3300046491 Bacteria 4021
425 Ga0495584_0017925 3300046491 Bacteria 3600
426 Ga0495584_0021788 3300046491 Bacteria 3254
427 Ga0495584_0022133 3300046491 Bacteria 3226
428 Ga0495584_0026386 3300046491 Bacteria 2943
429 Ga0495584_0028256 3300046491 Bacteria 2841
430 Ga0495584_0038362 3300046491 Bacteria 2421
431 Ga0495584_0069818 3300046491 Bacteria 1765
432 Ga0495584_0084207 3300046491 Bacteria 1601
433 Ga0495584_0117517 3300046491 Bacteria 1346
434 Ga0495585_0000107 3300046492 Bacteria 89033
435 Ga0495585_0000318 3300046492 Bacteria 47858
436 Ga0495585_0001768 3300046492 Bacteria 16401
437 Ga0495585_0004190 3300046492 Bacteria 9414
438 Ga0495585_0017410 3300046492 Bacteria 4151
439 Ga0495585_0020133 3300046492 Bacteria 3839
440 Ga0495585_0021739 3300046492 Bacteria 3683
441 Ga0495585_0023006 3300046492 Bacteria 3576
442 Ga0495585_0026887 3300046492 Bacteria 3285
443 Ga0495585_0034447 3300046492 Bacteria 2862
444 Ga0495585_0035580 3300046492 Bacteria 2812
445 Ga0495585_0043964 3300046492 Bacteria 2496
446 Ga0495585_0049126 3300046492 Bacteria 2343
447 Ga0495585_0060109 3300046492 Bacteria 2092
448 Ga0495585_0097302 3300046492 Bacteria 1578
449 Ga0495585_0125523 3300046492 Bacteria 1354
450 Ga0495585_0132959 3300046492 Bacteria 1308
451 Ga0495585_0199214 3300046492 Bacteria 1020
452 Ga0495594_0008863 3300046499 Bacteria 5188
453 Ga0495594_0020766 3300046499 Bacteria 3500
454 Ga0495594_0022414 3300046499 Bacteria 3378
455 Ga0495594_0032513 3300046499 Bacteria 2832
456 Ga0495594_0037613 3300046499 Bacteria 2640
457 Ga0495596_0000402 3300046500 Bacteria 27667
458 Ga0495596_0002710 3300046500 Bacteria 9315
459 Ga0495596_0002746 3300046500 Bacteria 9238
460 Ga0495596_0003161 3300046500 Bacteria 8485
461 Ga0495596_0003393 3300046500 Bacteria 8086
462 Ga0495596_0015384 3300046500 Bacteria 3205
463 Ga0495596_0016137 3300046500 Bacteria 3108
464 Ga0495596_0020649 3300046500 Bacteria 2694
465 Ga0495596_0042814 3300046500 Bacteria 1784
466 Ga0495607_0003324 3300046501 Bacteria 12347
467 Ga0495607_0012878 3300046501 Bacteria 5500
468 Ga0495607_0013241 3300046501 Bacteria 5413
469 Ga0495607_0017972 3300046501 Bacteria 4520
470 Ga0495607_0020283 3300046501 Bacteria 4205
471 Ga0495607_0022189 3300046501 Bacteria 3991
472 Ga0495607_0025050 3300046501 Bacteria 3715
473 Ga0495607_0039620 3300046501 Bacteria 2813
474 Ga0495607_0057702 3300046501 Bacteria 2223
475 Ga0495607_0152104 3300046501 Bacteria 1183
476 Ga0495607_0158218 3300046501 Bacteria 1153
477 Ga0495607_0197575 3300046501 Bacteria 997
478 Ga0495583_0000016 3300046506 Bacteria 312691
479 Ga0495583_0000191 3300046506 Bacteria 102390
480 Ga0495583_0000319 3300046506 Bacteria 76152
481 Ga0495583_0000751 3300046506 Bacteria 41181
482 Ga0495583_0010592 3300046506 Bacteria 5363
483 Ga0495583_0014077 3300046506 Bacteria 4425
484 Ga0495583_0016061 3300046506 Bacteria 4042
485 Ga0495583_0019048 3300046506 Bacteria 3592
486 Ga0495583_0040867 3300046506 Bacteria 2175
487 Ga0495606_0000276 3300046507 Bacteria 90441
488 Ga0495606_0001057 3300046507 Bacteria 39799
489 Ga0495606_0001130 3300046507 Bacteria 38068
490 Ga0495606_0001852 3300046507 Bacteria 26592
491 Ga0495606_0002481 3300046507 Bacteria 21350
492 Ga0495606_0002801 3300046507 Bacteria 19416
493 Ga0495606_0003539 3300046507 Bacteria 16500
494 Ga0495606_0006497 3300046507 Bacteria 10754
495 Ga0495606_0041193 3300046507 Bacteria 3098
496 Ga0495606_0046869 3300046507 Bacteria 2854
497 Ga0495606_0057318 3300046507 Bacteria 2509
498 Ga0495606_0148442 3300046507 Bacteria 1378
499 Ga0495606_0218512 3300046507 Bacteria 1075
500 Ga0495606_0286082 3300046507 Bacteria 899
501 Ga0495610_0000007 3300046512 Bacteria 820919
502 Ga0495610_0002183 3300046512 Bacteria 16605
503 Ga0495610_0004019 3300046512 Bacteria 11094
504 Ga0495610_0010453 3300046512 Bacteria 5765
505 Ga0495610_0014159 3300046512 Bacteria 4701
506 Ga0495610_0014189 3300046512 Bacteria 4693
507 Ga0495610_0041754 3300046512 Bacteria 2300
508 Ga0495616_0000749 3300046513 Bacteria 23720
509 Ga0495616_0001218 3300046513 Bacteria 18122
510 Ga0495616_0011693 3300046513 Bacteria 5018
511 Ga0495616_0011712 3300046513 Bacteria 5013
512 Ga0495616_0013262 3300046513 Bacteria 4657
513 Ga0495616_0014409 3300046513 Bacteria 4425
514 Ga0495616_0019026 3300046513 Bacteria 3754
515 Ga0495616_0031360 3300046513 Bacteria 2783
516 Ga0495616_0051402 3300046513 Bacteria 2055
517 Ga0495616_0059648 3300046513 Bacteria 1876
518 Ga0495616_0090352 3300046513 Bacteria 1451
519 Ga0495620_0013747 3300046515 Bacteria 4137
520 Ga0495630_0034913 3300046517 Bacteria 3757
521 Ga0495630_0149760 3300046517 Bacteria 1775
522 Ga0495631_0005248 3300046518 Bacteria 6812
523 Ga0495631_0012648 3300046518 Bacteria 4116
524 Ga0495631_0014553 3300046518 Bacteria 3792
525 Ga0495631_0036584 3300046518 Bacteria 2191
526 Ga0495631_0082344 3300046518 Bacteria 1387
527 Ga0495631_0085051 3300046518 Bacteria 1363
528 Ga0495631_0093092 3300046518 Bacteria 1297
529 Ga0495631_0119294 3300046518 Bacteria 1134
530 Ga0495632_0000090 3300046519 Bacteria 93838
531 Ga0495632_0000184 3300046519 Bacteria 63861
532 Ga0495632_0008137 3300046519 Bacteria 6483
533 Ga0495632_0013914 3300046519 Bacteria 4571
534 Ga0495632_0017476 3300046519 Bacteria 3956
535 Ga0495632_0018215 3300046519 Bacteria 3858
536 Ga0495632_0023559 3300046519 Bacteria 3286
537 Ga0495637_0001177 3300046520 Bacteria 15969
538 Ga0495637_0004283 3300046520 Bacteria 7408
539 Ga0495637_0014283 3300046520 Bacteria 3748
540 Ga0495637_0022999 3300046520 Bacteria 2837
541 Ga0495637_0037567 3300046520 Bacteria 2101
542 Ga0495637_0065832 3300046520 Bacteria 1474
543 Ga0495643_0000230 3300046522 Bacteria 84299
544 Ga0495643_0000420 3300046522 Bacteria 55396
545 Ga0495643_0010866 3300046522 Bacteria 5578
546 Ga0495643_0025951 3300046522 Bacteria 3311
547 Ga0495643_0031189 3300046522 Bacteria 2968
548 Ga0495643_0042233 3300046522 Bacteria 2484
549 Ga0495643_0092186 3300046522 Bacteria 1562
550 Ga0495644_0003060 3300046523 Bacteria 6614
551 Ga0495644_0009727 3300046523 Bacteria 3701
552 Ga0495644_0020872 3300046523 Bacteria 2498
553 Ga0495644_0028843 3300046523 Bacteria 2099
554 Ga0495644_0063374 3300046523 Bacteria 1389
555 Ga0495644_0108519 3300046523 Bacteria 1052
556 Ga0495648_0000082 3300046524 Bacteria 123682
557 Ga0495648_0001254 3300046524 Bacteria 25334
558 Ga0495648_0006814 3300046524 Bacteria 9230
559 Ga0495648_0011977 3300046524 Bacteria 6500
560 Ga0495648_0013312 3300046524 Bacteria 6089
561 Ga0495648_0032223 3300046524 Bacteria 3442
562 Ga0495648_0056080 3300046524 Bacteria 2372
563 Ga0495648_0138100 3300046524 Bacteria 1286
564 Ga0495648_0190643 3300046524 Bacteria 1034
565 Ga0495663_0002300 3300046525 Bacteria 5781
566 Ga0495663_0037962 3300046525 Bacteria 1454
567 Ga0495666_0000188 3300046526 Bacteria 26481
568 Ga0495666_0011597 3300046526 Bacteria 4393
569 Ga0495666_0025051 3300046526 Bacteria 2948
570 Ga0495666_0025891 3300046526 Bacteria 2895
571 Ga0495666_0035999 3300046526 Bacteria 2411
572 Ga0495666_0046367 3300046526 Bacteria 2095
573 Ga0495666_0078076 3300046526 Bacteria 1568
574 Ga0495642_0000046 3300046528 Bacteria 74298
575 Ga0495642_0006763 3300046528 Bacteria 4396
576 Ga0495642_0011614 3300046528 Bacteria 3388
577 Ga0495642_0040136 3300046528 Bacteria 1900
578 Ga0495642_0102468 3300046528 Bacteria 1219
579 Ga0495652_0032605 3300046529 Bacteria 4555
580 Ga0495654_0002109 3300046530 Bacteria 13010
581 Ga0495654_0011154 3300046530 Bacteria 4879
582 Ga0495654_0012362 3300046530 Bacteria 4587
583 Ga0495654_0019236 3300046530 Bacteria 3573
584 Ga0495654_0049087 3300046530 Bacteria 2068
585 Ga0495654_0085522 3300046530 Bacteria 1471
586 Ga0495665_0007076 3300046531 Bacteria 6053
587 Ga0495665_0013943 3300046531 Bacteria 4342
588 Ga0495640_0079879 3300046533 Bacteria 2177
589 Ga0495586_0004480 3300046535 Bacteria 7460
590 Ga0495586_0019287 3300046535 Bacteria 3627
591 Ga0495586_0042542 3300046535 Bacteria 2446
592 Ga0495586_0109140 3300046535 Bacteria 1539
593 Ga0495586_0132591 3300046535 Bacteria 1395
594 Ga0495587_0010860 3300046536 Bacteria 5780
595 Ga0495587_0123876 3300046536 Bacteria 1479
596 Ga0495587_0142148 3300046536 Bacteria 1369
597 Ga0495609_0000026 3300046538 Bacteria 251973
598 Ga0495609_0000599 3300046538 Bacteria 28268
599 Ga0495609_0002410 3300046538 Bacteria 11501
600 Ga0495609_0006815 3300046538 Bacteria 5776
601 Ga0495609_0007669 3300046538 Bacteria 5362
602 Ga0495609_0007835 3300046538 Bacteria 5283
603 Ga0495609_0015210 3300046538 Bacteria 3604
604 Ga0495609_0016045 3300046538 Bacteria 3495
605 Ga0495609_0019538 3300046538 Bacteria 3133
606 Ga0495609_0020468 3300046538 Bacteria 3058
607 Ga0495609_0026297 3300046538 Bacteria 2665
608 Ga0495609_0036696 3300046538 Bacteria 2212
609 Ga0495609_0058713 3300046538 Bacteria 1701
610 Ga0495621_0017388 3300046539 Bacteria 2324
611 Ga0495597_0000341 3300046542 Bacteria 41785
612 Ga0495597_0001426 3300046542 Bacteria 17187
613 Ga0495597_0002139 3300046542 Bacteria 13083
614 Ga0495597_0002447 3300046542 Bacteria 11774
615 Ga0495597_0002492 3300046542 Bacteria 11609
616 Ga0495597_0009137 3300046542 Bacteria 4918
617 Ga0495597_0024575 3300046542 Bacteria 2780
618 Ga0495597_0026578 3300046542 Bacteria 2658
619 Ga0495597_0027038 3300046542 Bacteria 2632
620 Ga0495597_0034059 3300046542 Bacteria 2302
621 Ga0495597_0089444 3300046542 Bacteria 1308
622 Ga0495597_0146205 3300046542 Bacteria 972
623 Ga0495645_0153435 3300046543 Bacteria 1598
624 Ga0495622_0000036 3300046557 Bacteria 122551
625 Ga0495622_0001962 3300046557 Bacteria 10085
626 Ga0495622_0006774 3300046557 Bacteria 5315
627 Ga0495622_0047494 3300046557 Bacteria 1994
628 Ga0495622_0051735 3300046557 Bacteria 1905
629 Ga0495622_0066490 3300046557 Bacteria 1666
630 Ga0495622_0078099 3300046557 Bacteria 1524
631 Ga0495633_0000342 3300046558 Bacteria 51832
632 Ga0495633_0008545 3300046558 Bacteria 5755
633 Ga0495633_0008826 3300046558 Bacteria 5630
634 Ga0495633_0009734 3300046558 Bacteria 5282
635 Ga0495633_0010297 3300046558 Bacteria 5113
636 Ga0495633_0012562 3300046558 Bacteria 4495
637 Ga0495633_0013497 3300046558 Bacteria 4303
638 Ga0495633_0016073 3300046558 Bacteria 3870
639 Ga0495633_0024291 3300046558 Bacteria 2996
640 Ga0495633_0026015 3300046558 Bacteria 2875
641 Ga0495633_0051005 3300046558 Bacteria 1950
642 Ga0495633_0164072 3300046558 Bacteria 1024
643 Ga0495667_0080515 3300046559 Bacteria 2117
644 Ga0495656_0014820 3300046615 Bacteria 2930
645 Ga0495656_0023716 3300046615 Bacteria 2417
646 Ga0495656_0212645 3300046615 Bacteria 964
647 Ga0495668_0000266 3300046616 Bacteria 73736
648 Ga0495668_0001680 3300046616 Bacteria 20491
649 Ga0495668_0010998 3300046616 Bacteria 5444
650 Ga0495668_0012490 3300046616 Bacteria 5035
651 Ga0495668_0018722 3300046616 Bacteria 4002
652 Ga0495668_0021319 3300046616 Bacteria 3717
653 Ga0495668_0021355 3300046616 Bacteria 3713
654 Ga0495668_0027267 3300046616 Bacteria 3237
655 Ga0495668_0038720 3300046616 Bacteria 2663
656 Ga0495668_0038806 3300046616 Bacteria 2660
657 Ga0495668_0052572 3300046616 Bacteria 2253
658 Ga0495668_0059832 3300046616 Bacteria 2101
659 Ga0495668_0218059 3300046616 Bacteria 1044
660 Ga0495634_0017842 3300046642 Bacteria 5060
661 Ga0495634_0084544 3300046642 Bacteria 2069
662 Ga0495611_0004249 3300046648 Bacteria 6235
663 Ga0495611_0007102 3300046648 Bacteria 4755
664 Ga0495611_0015211 3300046648 Bacteria 3290
665 Ga0495611_0040218 3300046648 Bacteria 2084
666 Ga0495611_0084196 3300046648 Bacteria 1465
667 Ga0495611_0112018 3300046648 Bacteria 1270
668 Ga0495625_0000843 3300046660 Bacteria 41880
669 Ga0495625_0009699 3300046660 Bacteria 8016
670 Ga0495625_0010984 3300046660 Bacteria 7432
671 Ga0495625_0013060 3300046660 Bacteria 6694
672 Ga0495625_0043892 3300046660 Bacteria 3239
673 Ga0495625_0092825 3300046660 Bacteria 2085
674 Ga0495625_0100886 3300046660 Bacteria 1983
675 Ga0495625_0186258 3300046660 Bacteria 1377
676 Ga0495625_0277094 3300046660 Bacteria 1080
677 Ga0495635_0008247 3300046663 Bacteria 7270
678 Ga0495659_0003676 3300046664 Bacteria 4877
679 Ga0495659_0004819 3300046664 Bacteria 4247
680 Ga0495659_0037228 3300046664 Bacteria 1722
681 Ga0495659_0041029 3300046664 Bacteria 1651
682 Ga0495661_0000913 3300046665 Bacteria 27093
683 Ga0495661_0012826 3300046665 Bacteria 5650
684 Ga0495661_0013120 3300046665 Bacteria 5576
685 Ga0495661_0017933 3300046665 Bacteria 4665
686 Ga0495661_0020826 3300046665 Bacteria 4275
687 Ga0495661_0040247 3300046665 Bacteria 2900
688 Ga0495661_0053279 3300046665 Bacteria 2433
689 Ga0495661_0058002 3300046665 Bacteria 2309
690 Ga0495661_0061483 3300046665 Bacteria 2229
691 Ga0495661_0114742 3300046665 Bacteria 1496
692 Ga0495661_0140601 3300046665 Bacteria 1313
693 Ga0495661_0204318 3300046665 Bacteria 1032
694 Ga0495588_0000140 3300046674 Bacteria 107766
695 Ga0495588_0007566 3300046674 Bacteria 4950
696 Ga0495588_0012774 3300046674 Bacteria 3980
697 Ga0495588_0024495 3300046674 Bacteria 2998
698 Ga0495588_0026522 3300046674 Bacteria 2894
699 Ga0495588_0030365 3300046674 Bacteria 2716
700 Ga0495588_0041800 3300046674 Bacteria 2342
701 Ga0495588_0051974 3300046674 Bacteria 2111
702 Ga0495588_0081778 3300046674 Bacteria 1686
703 Ga0495623_0080155 3300046679 Bacteria 2021
704 Ga0495623_0150246 3300046679 Bacteria 1377
705 Ga0495623_0260196 3300046679 Bacteria 972
706 Ga0495646_0271153 3300046680 Bacteria 904
707 Ga0495658_0042199 3300046683 Bacteria 2546
708 Ga0495669_0000896 3300046684 Bacteria 12540
709 Ga0495669_0006748 3300046684 Bacteria 4803
710 Ga0495669_0011483 3300046684 Bacteria 3760
711 Ga0495669_0012333 3300046684 Bacteria 3637
712 Ga0495669_0018469 3300046684 Bacteria 2998
713 Ga0495669_0037720 3300046684 Bacteria 2139
714 Ga0495669_0105437 3300046684 Bacteria 1312
715 Ga0495669_0137703 3300046684 Bacteria 1151
716 Ga0495669_0198535 3300046684 Bacteria 958
717 Ga0495613_0138894 3300046689 Bacteria 1737
718 Ga0495624_0008666 3300046690 Bacteria 7080
719 Ga0495624_0355506 3300046690 Bacteria 881
720 Ga0495670_0007065 3300046691 Bacteria 5528
721 Ga0495670_0016062 3300046691 Bacteria 3680
722 Ga0495670_0087127 3300046691 Bacteria 1595
723 Ga0495670_0092139 3300046691 Bacteria 1552
724 Ga0495670_0120282 3300046691 Bacteria 1363
725 Ga0495671_0000086 3300046692 Bacteria 87499
726 Ga0495671_0000245 3300046692 Bacteria 46833
727 Ga0495671_0002185 3300046692 Bacteria 12462
728 Ga0495671_0105213 3300046692 Bacteria 1378
729 Ga0495671_0111752 3300046692 Bacteria 1334
730 Ga0495671_0139528 3300046692 Bacteria 1181
731 Ga0495649_0000093 3300046694 Bacteria 77036
732 Ga0495649_0008892 3300046694 Bacteria 6012
733 Ga0495649_0028635 3300046694 Bacteria 3087
734 Ga0495649_0041528 3300046694 Bacteria 2515
735 Ga0495649_0048098 3300046694 Bacteria 2318
736 Ga0495649_0217354 3300046694 Bacteria 989
737 Ga0495649_0221499 3300046694 Bacteria 978
738 Ga0495589_0000337 3300046794 Bacteria 36745
739 Ga0495589_0000462 3300046794 Bacteria 29692
740 Ga0495589_0003191 3300046794 Bacteria 8953
741 Ga0495589_0008624 3300046794 Bacteria 5316
742 Ga0495589_0017018 3300046794 Bacteria 3733
743 Ga0495589_0018245 3300046794 Bacteria 3600
744 Ga0495589_0026593 3300046794 Bacteria 2930
745 Ga0495589_0049361 3300046794 Bacteria 2082
746 Ga0495589_0218586 3300046794 Bacteria 896
747 Ga0495600_0020026 3300046809 Bacteria 4277
748 Ga0495600_0050887 3300046809 Bacteria 2703
749 Ga0495660_0000085 3300046810 Bacteria 100369
750 Ga0495660_0002264 3300046810 Bacteria 12381
751 Ga0495660_0002327 3300046810 Bacteria 12181
752 Ga0495660_0002406 3300046810 Bacteria 11935
753 Ga0495660_0010617 3300046810 Bacteria 5356
754 Ga0495660_0019058 3300046810 Bacteria 3940
755 Ga0495660_0022697 3300046810 Bacteria 3581
756 Ga0495660_0024987 3300046810 Bacteria 3396
757 Ga0495660_0030454 3300046810 Bacteria 3039
758 Ga0495660_0031663 3300046810 Bacteria 2973
759 Ga0495660_0045063 3300046810 Bacteria 2423
760 Ga0495660_0078158 3300046810 Bacteria 1740
761 Ga0495660_0122137 3300046810 Bacteria 1316
762 Ga0495581_0013040 3300047315 Bacteria 4817
763 Ga0495581_0040948 3300047315 Bacteria 2680
764 Ga0495581_0118476 3300047315 Bacteria 1540
765 Ga0495604_0040354 3300047317 Bacteria 3665
766 Ga0495604_0120453 3300047317 Bacteria 1900
767 Ga0495604_0249471 3300047317 Bacteria 1210
768 Ga0495636_0004955 3300047318 Bacteria 5221
769 Ga0495636_0012647 3300047318 Bacteria 3343
770 Ga0495636_0017270 3300047318 Bacteria 2887
771 Ga0495636_0024594 3300047318 Bacteria 2443
772 Ga0495636_0082372 3300047318 Bacteria 1387
773 Ga0495674_0003089 3300047319 Bacteria 16178
774 Ga0495672_0000005 3300047320 Bacteria 593294
775 Ga0495672_0000217 3300047320 Bacteria 82349
776 Ga0495672_0000458 3300047320 Bacteria 48213
777 Ga0495672_0000483 3300047320 Bacteria 47007
778 Ga0495672_0015337 3300047320 Bacteria 5206
779 Ga0495672_0019626 3300047320 Bacteria 4455
780 Ga0495672_0023745 3300047320 Bacteria 3962
781 Ga0495672_0056491 3300047320 Bacteria 2283
782 Ga0495672_0080223 3300047320 Bacteria 1820
783 Ga0495672_0095297 3300047320 Bacteria 1625
784 Ga0495672_0191737 3300047320 Bacteria 1027
785 Ga0495676_0003794 3300047321 Bacteria 13739
786 Ga0495676_0095264 3300047321 Bacteria 2215
787 Ga0495676_0114590 3300047321 Bacteria 1972
788 Ga0495676_0171153 3300047321 Bacteria 1528
789 Ga0495676_0273881 3300047321 Bacteria 1144
790 Ga0495680_0025365 3300047322 Bacteria 4907
791 Ga0495683_0000054 3300047323 Bacteria 121429
792 Ga0495683_0000662 3300047323 Bacteria 25479
793 Ga0495683_0012831 3300047323 Bacteria 4395
794 Ga0495683_0031376 3300047323 Bacteria 2708
795 Ga0495683_0035853 3300047323 Bacteria 2520
796 Ga0495683_0060688 3300047323 Bacteria 1873
797 Ga0495683_0078493 3300047323 Bacteria 1613
798 Ga0495687_000037 3300047443 Bacteria 252363
799 Ga0495687_000155 3300047443 Bacteria 104610
800 Ga0495687_000468 3300047443 Bacteria 48911
801 Ga0495687_001686 3300047443 Bacteria 19708
802 Ga0495687_001978 3300047443 Bacteria 17476
803 Ga0495687_005761 3300047443 Bacteria 7782
804 Ga0495687_009381 3300047443 Bacteria 5472
805 Ga0495687_011026 3300047443 Bacteria 4895
806 Ga0495687_068105 3300047443 Bacteria 1438
807 Ga0495675_0002475 3300047444 Bacteria 11039
808 Ga0495675_0023210 3300047444 Bacteria 3953
809 Ga0495675_0096577 3300047444 Bacteria 1852
810 Ga0495675_0120192 3300047444 Bacteria 1636
811 Ga0495677_0000130 3300047445 Bacteria 36684
812 Ga0495677_0006146 3300047445 Bacteria 4542
813 Ga0495677_0007525 3300047445 Bacteria 4066
814 Ga0495677_0008597 3300047445 Bacteria 3789
815 Ga0495677_0010442 3300047445 Bacteria 3410
816 Ga0495677_0010483 3300047445 Bacteria 3402
817 Ga0495677_0011196 3300047445 Bacteria 3283
818 Ga0495677_0018890 3300047445 Bacteria 2499
819 Ga0495677_0020135 3300047445 Bacteria 2418
820 Ga0495677_0033862 3300047445 Bacteria 1862
821 Ga0495677_0113530 3300047445 Bacteria 1030
822 Ga0495679_007218 3300047446 Bacteria 4664
823 Ga0495679_007632 3300047446 Bacteria 4492
824 Ga0495679_013012 3300047446 Bacteria 3142
825 Ga0495679_031141 3300047446 Bacteria 1723
826 Ga0495679_032605 3300047446 Bacteria 1669
827 Ga0495685_000032 3300047447 Bacteria 58381
828 Ga0495685_002375 3300047447 Bacteria 5894
829 Ga0495685_069250 3300047447 Bacteria 1183
830 Ga0495673_0000057 3300047469 Bacteria 239715
831 Ga0495673_0000060 3300047469 Bacteria 231642
832 Ga0495673_0001499 3300047469 Bacteria 18453
833 Ga0495673_0019812 3300047469 Bacteria 3364
834 Ga0495673_0046075 3300047469 Bacteria 1934
835 Ga0495681_0000431 3300047470 Bacteria 32175
836 Ga0495681_0000955 3300047470 Bacteria 22212
837 Ga0495681_0002687 3300047470 Bacteria 12599
838 Ga0495681_0009295 3300047470 Bacteria 6070
839 Ga0495681_0015314 3300047470 Bacteria 4343
840 Ga0495681_0016965 3300047470 Bacteria 4060
841 Ga0495681_0032166 3300047470 Bacteria 2644
842 Ga0495686_0000047 3300047472 Bacteria 280086
843 Ga0495686_0000142 3300047472 Bacteria 143655
844 Ga0495686_0002586 3300047472 Bacteria 16837
845 Ga0495686_0013068 3300047472 Bacteria 5781
846 Ga0495686_0015664 3300047472 Bacteria 5169
847 Ga0495686_0035276 3300047472 Bacteria 3216
848 Ga0495686_0050660 3300047472 Bacteria 2608
849 Ga0495686_0107452 3300047472 Bacteria 1677
850 Ga0495593_0012258 3300047673 Bacteria 4899
851 Ga0495593_0020991 3300047673 Bacteria 3651
852 Ga0495593_0027434 3300047673 Bacteria 3135
853 Ga0495602_0132554 3300048088 Bacteria 1985
854 Ga0495602_0157443 3300048088 Bacteria 1777
855 Ga0495614_0015534 3300048089 Bacteria 3319
856 Ga0495614_0018631 3300048089 Bacteria 3006
857 Ga0495626_0000009 3300048091 Bacteria 270596
858 Ga0495626_0000078 3300048091 Bacteria 130020
859 Ga0495626_0002601 3300048091 Bacteria 12329
860 Ga0495626_0006180 3300048091 Bacteria 6846
861 Ga0495626_0011834 3300048091 Bacteria 4595
862 Ga0495626_0012268 3300048091 Bacteria 4499
863 Ga0495626_0016679 3300048091 Bacteria 3725
864 Ga0495626_0023846 3300048091 Bacteria 3006
865 Ga0495626_0028717 3300048091 Bacteria 2694
866 Ga0495626_0145656 3300048091 Bacteria 1002
867 Ga0495626_0173846 3300048091 Bacteria 896
868 Ga0496100_0148412 3300048903 Bacteria 1669
869 Ga0496100_0552697 3300048903 Bacteria 891
870 Ga0496102_0000360 3300048905 Bacteria 54961
871 Ga0496102_0033039 3300048905 Bacteria 4648
872 Ga0496102_0038714 3300048905 Bacteria 4305
873 Ga0496102_0269798 3300048905 Bacteria 1604
874 Ga0496103_0001443 3300048906 Bacteria 15943
875 Ga0496103_0012438 3300048906 Bacteria 5047
876 Ga0496103_0041402 3300048906 Bacteria 2832
877 Ga0496105_0165537 3300048908 Bacteria 1814
878 Ga0496105_0231960 3300048908 Bacteria 1500
879 Ga0496106_0023634 3300048909 Bacteria 4566
880 Ga0496106_0030666 3300048909 Bacteria 4008
881 Ga0496107_0134791 3300048910 Bacteria 1824
882 Ga0496107_0201807 3300048910 Bacteria 1478
883 Ga0496107_0623101 3300048910 Bacteria 796
884 Ga0496108_0616503 3300048911 Bacteria 945
885 Ga0496110_0077107 3300048913 Bacteria 2964
886 Ga0496110_0411770 3300048913 Bacteria 1232
887 Ga0496111_0149814 3300048914 Bacteria 1730
888 Ga0496111_0314153 3300048914 Bacteria 1161
889 Ga0496113_0043136 3300048916 Bacteria 3336
890 Ga0496113_0278888 3300048916 Bacteria 1336
891 Ga0496115_0049354 3300048918 Bacteria 3368
892 Ga0496115_0606002 3300048918 Bacteria 870
893 Ga0496116_0041137 3300048919 Bacteria 3174
894 Ga0496117_0000011 3300048920 Bacteria 610930
895 Ga0496118_0000010 3300048921 Bacteria 610930
896 Ga0496118_0186155 3300048921 Bacteria 1248
897 Ga0496121_0014681 3300048924 Bacteria 8282
898 Ga0496121_0052677 3300048924 Bacteria 3414
899 Ga0496122_0000549 3300048925 Bacteria 77692
900 Ga0496122_0002477 3300048925 Bacteria 26088
901 Ga0496122_0003057 3300048925 Bacteria 22632
902 Ga0496122_0015963 3300048925 Bacteria 7142
903 Ga0496122_0083157 3300048925 Bacteria 2221
904 Ga0496122_0125872 3300048925 Bacteria 1640
905 Ga0496123_0000326 3300048926 Bacteria 90896
906 Ga0496123_0014307 3300048926 Bacteria 6587
907 Ga0496123_0017258 3300048926 Bacteria 5818
908 Ga0496123_0033067 3300048926 Bacteria 3729
909 Ga0496124_0001925 3300048927 Bacteria 28421
910 Ga0496124_0042693 3300048927 Bacteria 3902
911 Ga0496124_0057575 3300048927 Bacteria 3274
912 Ga0496124_0064120 3300048927 Bacteria 3068
913 Ga0496124_0083828 3300048927 Bacteria 2615
914 Ga0496124_0153107 3300048927 Bacteria 1806
915 Ga0496124_0242504 3300048927 Bacteria 1339
916 Ga0496124_0309214 3300048927 Bacteria 1137
917 Ga0496125_0009304 3300048928 Bacteria 10134
918 Ga0496125_0025826 3300048928 Bacteria 5369
919 Ga0496125_0035590 3300048928 Bacteria 4363
920 Ga0496125_0069129 3300048928 Bacteria 2773
921 Ga0496125_0106794 3300048928 Bacteria 2042
922 Ga0496125_0357216 3300048928 Bacteria 870
923 Ga0496126_0006527 3300048929 Bacteria 12985
924 Ga0501304_006870 3300049160 Bacteria 926
925 Ga0495678_000001 3300049459 Bacteria 1060340
926 Ga0495678_000163 3300049459 Bacteria 78292
927 Ga0495678_000347 3300049459 Bacteria 48195
928 Ga0495678_002748 3300049459 Bacteria 11539
929 Ga0495678_002777 3300049459 Bacteria 11439
930 Ga0495678_003899 3300049459 Bacteria 8949
931 Ga0495678_010182 3300049459 Bacteria 4583
932 Ga0495678_070628 3300049459 Bacteria 1281
933 Ga0495678_079460 3300049459 Bacteria 1181
934 Ga0495678_080101 3300049459 Bacteria 1174
935 Ga0495682_0000292 3300049460 Bacteria 38485
936 Ga0495682_0005778 3300049460 Bacteria 5096
937 Ga0495682_0006944 3300049460 Bacteria 4542
938 Ga0495682_0006952 3300049460 Bacteria 4538
939 Ga0495682_0010628 3300049460 Bacteria 3557
940 Ga0495682_0016641 3300049460 Bacteria 2782
941 Ga0495682_0028792 3300049460 Bacteria 2057
942 Ga0501036_0155045 3300049572 Bacteria 1932
943 Ga0501249_004735 3300049679 Bacteria 2771
944 Ga0501269_000077 3300049766 Bacteria 30388
945 Ga0501269_012765 3300049766 Bacteria 1027
946 Ga0501035_0002946 3300049822 Bacteria 16379
947 Ga0501044_0262201 3300049823 Bacteria 1666
948 nmdc:mga03683_17027_c1 3300050489 Bacteria 2743
949 nmdc:mga0yw44_50801_c1 3300050492 Bacteria 2509
950 nmdc:mga06z11_100034_c1 3300050494 Bacteria 1589
951 nmdc:mga06z11_119347_c1 3300050494 Bacteria 1470
952 nmdc:mga08y16_121431_c1 3300050511 Bacteria 2719
953 nmdc:mga0sz30_56177_c1 3300050516 Bacteria 1676
954 Ga0500641_0007972 3300053096 Bacteria 3775
955 Ga0500641_0072881 3300053096 Bacteria 1448
956 Ga0500594_0035340 3300053118 Bacteria 1339
957 Ga0500618_000384 3300053125 Bacteria 30501
958 Ga0500618_000433 3300053125 Bacteria 27738
959 Ga0500618_002204 3300053125 Bacteria 7632
960 Ga0500559_0108682 3300053136 Bacteria 1284
961 Ga0500586_000135 3300053145 Bacteria 13519
962 Ga0500636_0000106 3300053177 Bacteria 43073
963 Ga0500637_0039690 3300053178 Bacteria 2656
964 Ga0500637_0129698 3300053178 Bacteria 1462
965 Ga0500637_0184097 3300053178 Bacteria 1196
966 Ga0501084_0305968 3300054114 Bacteria 1343
967 Ga0587090_024863 3300059510 Bacteria 964
968 Ga0587111_0041035 3300060346 Bacteria 986
969 Ga0466962_0035793 3300061719 Bacteria 2375
970 Ga0466962_0092611 3300061719 Bacteria 1449
971 2511248015 2511231003 Bacteria 5606035
972 2511385024 2511231026 Bacteria 5225445
973 2526210880 2526164512 Bacteria 4025691
974 2574430522 2574179768 Bacteria 4907129
975 2601669530 2600255292 Bacteria 6300551
976 2643788147 2643221554 Bacteria 6603920
977 2643801106 2643221556 Bacteria 7251154
978 2644026832 2643221603 Bacteria 6147767
979 2644216251 2643221638 Bacteria 6579467
980 2644255366 2643221645 Bacteria 7207331
981 2644359888 2643221664 Bacteria 7272945
982 2644472808 2643221684 Bacteria 7145183
983 2738742495 2738541280 Bacteria 6630198
984 2738827237 2738541297 Bacteria 6549566
985 2738846551 2738541300 Bacteria 6675882
986 2739151034 2738541357 Bacteria 6549408
987 2739192953 2738543003 Bacteria 6549560
988 2739277195 2738543018 Bacteria 6718814
989 2739319430 2738543026 Bacteria 6549408
990 2739337671 2738543029 Bacteria 6549249
991 2739346245 2738543030 Bacteria 6719714
992 2809128589 2808606415 Bacteria 4576710
993 2809142275 2808606418 Bacteria 6724496
994 2809148210 2808606419 Bacteria 4576925
995 2819594999 2818991445 Bacteria 4955017
996 2821134595 2821131069 Bacteria 6108407
997 2834641526 2834641062 Bacteria 5559922
998 2842715101 2842711865 Bacteria 7155354
999 2852620371 2852618963 Bacteria 4577824
1000 2857549651 2857547612 Bacteria 6179999
1001 2857557088 2857553236 Bacteria 6166726
1002 2857560496 2857558681 Bacteria 6617694
1003 2857570010 2857564685 Bacteria 6290584
1004 2884852910 2884852848 Bacteria 5221161
1005 2885081443 2885080285 Bacteria 6355622
1006 2891634060 2891633521 Bacteria 4602265
1007 2904430262 2904424332 Bacteria 7633521
1008 2919480838 2919476304 Bacteria 5888696
1009 2928134073 2928130867 Bacteria 5467269
1010 2932415733 2932410948 Bacteria 6312192
1011 2932421723 2932416698 Bacteria 6315112
1012 639787744 639633007 Bacteria 4376040
1013 8047675152 8047673197 Bacteria 7395230
1014 Ga0070665_100077363
1015 JGI25155J39150_1000685
1016 JGI25156J39149_1013612
1017 JGI25154J39366_1001901
1018 JGI25157J39369_1001234
1019 JGI25152J39213_1001691
1020 JGI25150J39212_1004735
1021 JGI25150J39212_1004776
1022 JGI25159J45721_1005656
1023 JGI25159J45721_1006490
1024 JGI25153J46596_10018512
1025 JGI25153J46596_10019612
1026 rootL2_10030810
1027 JGI25161J50226_1002935
1028 Ga0055532_1000077
1029 Ga0055525_1000074
1030 Ga0055529_1000119
1031 Ga0055526_1000096
1032 Ga0055526_1000176
1033 Ga0055526_1005549
1034 Ga0055526_1012194
1035 Ga0055537_1002012
1036 Ga0055537_1007195
1037 Ga0055524_1000049
1038 Ga0055524_1006247
1039 Ga0055524_1009250
1040 Ga0055524_1010025
1041 Ga0055524_1010467
1042 Ga0055534_1002464
1043 Ga0055534_1007631
1044 Ga0055528_1000378
1045 Ga0055528_1010121
1046 Ga0055530_10007632
1047 Ga0055531_10014242
1048 Ga0055543_1000154
1049 Ga0055543_1007921
1050 Ga0065165_1000571
1051 Ga0065165_1001586
1052 Ga0065165_1005416
1053 Ga0070658_10397592
1054 Ga0070676_10079006
1055 Ga0070683_100023896
1056 Ga0070690_100006127
1057 Ga0070690_100054139
1058 Ga0070677_10024701
1059 Ga0068869_100005370
1060 Ga0068869_100246471
1061 Ga0070666_10182683
1062 Ga0070680_100099705
1063 Ga0070682_100336628
1064 Ga0070660_100005785
1065 Ga0070660_100053782
1066 Ga0070689_100100855
1067 Ga0070687_100017933
1068 Ga0070687_100255533
1069 Ga0070661_100018767
1070 Ga0070661_100405395
1071 Ga0070692_10119362
1072 Ga0070668_100046395
1073 Ga0070674_100002988
1074 Ga0070688_100004034
1075 Ga0070659_100000840
1076 Ga0070659_100143807
1077 Ga0070659_100338332
1078 Ga0070659_100368219
1079 Ga0070667_100257863
1080 Ga0070714_100191894
1081 Ga0070701_10007677
1082 Ga0070700_100075096
1083 Ga0070663_100435731
1084 Ga0070685_10061804
1085 Ga0070684_100064719
1086 Ga0070672_100158970
1087 Ga0070665_100092707
1088 Ga0068855_100096508
1089 Ga0068855_100266261
1090 Ga0070664_100007438
1091 Ga0070664_100071288
1092 Ga0068857_100134900
1093 Ga0068857_100323239
1094 Ga0068856_100085329
1095 Ga0070702_100054252
1096 Ga0068861_100068057
1097 Ga0068858_100029744
1098 Ga0068858_100255506
1099 Ga0068860_100114608
1100 Ga0068862_100156567
1101 Ga0081539_10017768
1102 Ga0075368_10045034
1103 Ga0075363_100012995
1104 Ga0070712_100021576
1105 Ga0075362_10095140
1106 Ga0075369_10022138
1107 Ga0075369_10037445
1108 Ga0075366_10002692
1109 Ga0075366_10125788
1110 Ga0075366_10264188
1111 Ga0097621_100015682
1112 Ga0075370_10038106
1113 Ga0068871_100000638
1114 Ga0068865_100702973
1115 Ga0099826_10000005
1116 Ga0105251_10035840
1117 Ga0105244_10008754
1118 Ga0105244_10008940
1119 Ga0105240_10035812
1120 Ga0105240_10193821
1121 Ga0105240_10534436
1122 Ga0111539_10309447
1123 Ga0105245_10039862
1124 Ga0105245_10099696
1125 Ga0105243_10023507
1126 Ga0105241_10004455
1127 Ga0105242_10145097
1128 Ga0105238_10082619
1129 Ga0105246_10106875
1130 Ga0157371_10000014
1131 Ga0157371_10252115
1132 Ga0157370_10042640
1133 Ga0157370_10620228
1134 Ga0157378_10002428
1135 Ga0157378_10091197
1136 Ga0163162_10019684
1137 Ga0163162_10033542
1138 Ga0163162_10518733
1139 Ga0157380_10272704
1140 Ga0182008_10000231
1141 Ga0157379_10025665
1142 Ga0157379_10054399
1143 Ga0157379_10547118
1144 Ga0157376_10024502
1145 Ga0182006_1000004
1146 Ga0182006_1000176
1147 Ga0182006_1029981
1148 Ga0182006_1144869
1149 Ga0182007_10001618
1150 Ga0182005_1000005
1151 Ga0182005_1000030
1152 Ga0163161_10028570
1153 Ga0163161_10029767
1154 Ga0163161_10071615
1155 Ga0213872_10000504
1156 Ga0213872_10001863
1157 Ga0213872_10010875
1158 Ga0209435_100048
1159 Ga0209435_100225
1160 Ga0209436_100090
1161 Ga0209436_101258
1162 Ga0209147_100122
1163 Ga0209563_100003
1164 Ga0209437_100081
1165 Ga0209437_104536
1166 Ga0209258_100230
1167 Ga0207425_1000017
1168 Ga0207425_1000341
1169 Ga0207425_1000397
1170 Ga0207425_1033144
1171 Ga0209646_1000036
1172 Ga0209646_1000130
1173 Ga0209646_1000152
1174 Ga0209026_1000126
1175 Ga0209026_1003081
1176 Ga0209677_115509
1177 Ga0209148_1001208
1178 Ga0209759_1000193
1179 Ga0209759_1001123
1180 Ga0209129_1000039
1181 Ga0209129_1000088
1182 Ga0209129_1010411
1183 Ga0209565_1000018
1184 Ga0209565_1001328
1185 Ga0209565_1004071
1186 Ga0209565_1004755
1187 Ga0209565_1013248
1188 Ga0209565_1020726
1189 Ga0209565_1023630
1190 Ga0209455_1000047
1191 Ga0209455_1006928
1192 Ga0209673_1000090
1193 Ga0209130_1001116
1194 Ga0209130_1001315
1195 Ga0209130_1003207
1196 Ga0209675_1000005
1197 Ga0209675_1001071
1198 Ga0209675_1008948
1199 Ga0209025_1011979
1200 Ga0209564_1000060
1201 Ga0209564_1000078
1202 Ga0209564_1000348
1203 Ga0209564_1000626
1204 Ga0209564_1008728
1205 Ga0209564_1030211
1206 Ga0209758_1000137
1207 Ga0209758_1000895
1208 Ga0209050_1000598
1209 Ga0209050_1003979
1210 Ga0209050_1004001
1211 Ga0209256_1000040
1212 Ga0209256_1000189
1213 Ga0209256_1000601
1214 Ga0209256_1003275
1215 Ga0209256_1008841
1216 Ga0207426_1002086
1217 Ga0209051_1016883
1218 Ga0209257_1010731
1219 Ga0207697_10010078
1220 Ga0207655_1001915
1221 Ga0207655_1033252
1222 Ga0207682_10000396
1223 Ga0207642_10007487
1224 Ga0207688_10013245
1225 Ga0207680_10142283
1226 Ga0207645_10004613
1227 Ga0207643_10117333
1228 Ga0207705_10011718
1229 Ga0207695_10007570
1230 Ga0207695_10014717
1231 Ga0207693_10416849
1232 Ga0207660_10094647
1233 Ga0207662_10002632
1234 Ga0207662_10196206
1235 Ga0207657_10003671
1236 Ga0207657_10050467
1237 Ga0207657_10167012
1238 Ga0207649_10139865
1239 Ga0207649_10269949
1240 Ga0207694_10055883
1241 Ga0207650_10210439
1242 Ga0207687_10055772
1243 Ga0207687_10083746
1244 Ga0207664_10081013
1245 Ga0207706_10010122
1246 Ga0207686_10342305
1247 Ga0207709_10017824
1248 Ga0207709_10043577
1249 Ga0207669_10070171
1250 Ga0207669_10143380
1251 Ga0207711_10213364
1252 Ga0207689_10040563
1253 Ga0207661_10025986
1254 Ga0207679_10002872
1255 Ga0207679_10341225
1256 Ga0207667_10044688
1257 Ga0207667_10200117
1258 Ga0207658_10105280
1259 Ga0207677_10075788
1260 Ga0207703_10011138
1261 Ga0207678_10249299
1262 Ga0207708_10001740
1263 Ga0207702_10098293
1264 Ga0207702_10482459
1265 Ga0207641_10045680
1266 Ga0207648_10002465
1267 Ga0207674_10071261
1268 Ga0207675_100057588
1269 Ga0207698_10043065
1270 Ga0209969_1001118
1271 Ga0209996_1006507
1272 Ga0209995_1002583
1273 Ga0209983_1015344
1274 Ga0209282_1000003
1275 Ga0209971_1004552
1276 Ga0209974_10023418
1277 Ga0268266_10162250
1278 Ga0268265_10534379
1279 Ga0268264_10239639
1280 Ga0307515_10294504
1281 Ga0265324_10055303
1282 Ga0265331_10000237
1283 Ga0265327_10000517
1284 Ga0265327_10100303
1285 Ga0307408_100000511
1286 Ga0307408_100000604
1287 Ga0307408_100034763
1288 Ga0307408_100053643
1289 Ga0316579_10029788
1290 Ga0307518_10023324
1291 Ga0307416_100504644
1292 Ga0316583_10010274
1293 Ga0373932_0039320
1294 Ga0373960_0144401
1295 Ga0316574_0069730
1296 Ga0373937_0537079
1297 Ga0373925_0768015
1298 Ga0395899_0000161
1299 Ga0395899_0001217
1300 Ga0395899_0002963
1301 Ga0395899_0039203
1302 Ga0395899_0097538
1303 Ga0395899_0104936
1304 Ga0395899_0133806
1305 Ga0395899_0390940
1306 Ga0395900_0003402
1307 Ga0395900_0004563
1308 Ga0395900_0007120
1309 Ga0395900_0035585
1310 Ga0395900_0186012
1311 Ga0395900_0341275
1312 Ga0395900_0363190
1313 Ga0395898_0003439
1314 Ga0395898_0160098
1315 Ga0395898_0171946
1316 Ga0395898_0324532
1317 Ga0395898_0411362
1318 Ga0395905_0000137
1319 Ga0395905_0010634
1320 Ga0395905_0023218
1321 Ga0395905_0053658
1322 Ga0395905_0174378
1323 Ga0395905_0327650
1324 Ga0395905_0371050
1325 Ga0395905_0401898
1326 Ga0395905_0555299
1327 Ga0395901_0001241
1328 Ga0395901_0001265
1329 Ga0395901_0035568
1330 Ga0395901_0061313
1331 Ga0395901_0061841
1332 Ga0395901_0124271
1333 Ga0395901_0134427
1334 Ga0395901_0152351
1335 Ga0436361_0067343
1336 Ga0436361_0557931
1337 Ga0436361_0674923
1338 Ga0436361_1070108
1339 Ga0436361_1096226
1340 Ga0439465_0027121
1341 Ga0439441_001947
1342 Ga0439448_0010362
1343 Ga0439455_0001382
1344 Ga0439455_0003557
1345 Ga0450904_001005
1346 Ga0439458_0014183
1347 Ga0439458_0033461
1348 Ga0439460_0088653
1349 Ga0466969_0058096
1350 Ga0466972_0000327
1351 Ga0466972_0012337
1352 Ga0466972_0059397
1353 Ga0466972_0120736
1354 Ga0466965_0006991
1355 Ga0466965_0026378
1356 Ga0466965_0028687
1357 Ga0466965_0040088
1358 Ga0466965_0071293
1359 Ga0466965_0117394
1360 Ga0466966_0015642
1361 Ga0466966_0044458
1362 Ga0466966_0076831
1363 Ga0466966_0097402
1364 Ga0466961_0233942
1365 Ga0466964_0007552
1366 Ga0466964_0020832
1367 Ga0466964_0108333
1368 Ga0466971_0079333
1369 Ga0466968_0019441
1370 Ga0466968_0325371
1371 Ga0466970_0021724
1372 Ga0466970_0073148
1373 Ga0466970_0211378
1374 Ga0466957_0054933
1375 Ga0466957_0069558
1376 Ga0466957_0152524
1377 Ga0466957_0205808
1378 Ga0466959_0045767
1379 Ga0466959_0051132
1380 Ga0466959_0192115
1381 Ga0466958_0091202
1382 Ga0466967_0028106
1383 Ga0466967_0033721
1384 Ga0466967_0101302
1385 Ga0495617_000005
1386 Ga0495617_000015
1387 Ga0495617_000578
1388 Ga0495617_005569
1389 Ga0495617_005661
1390 Ga0495627_000038
1391 Ga0495627_000186
1392 Ga0495603_0015382
1393 Ga0495603_0045046
1394 Ga0495603_0123400
1395 Ga0495590_0000011
1396 Ga0495590_0000644
1397 Ga0495590_0004747
1398 Ga0495590_0014627
1399 Ga0495590_0016718
1400 Ga0495591_000814
1401 Ga0495591_007812
1402 Ga0495629_0011951
1403 Ga0495629_0103119
1404 Ga0495638_0000058
1405 Ga0495638_0011400
1406 Ga0495638_0065080
1407 Ga0495638_0066715
1408 Ga0495638_0093868
1409 Ga0495638_0246243
1410 Ga0495653_0000031
1411 Ga0495653_0018992
1412 Ga0495650_0000152
1413 Ga0495650_0000480
1414 Ga0495650_0000700
1415 Ga0495650_0000962
1416 Ga0495650_0001811
1417 Ga0495650_0002693
1418 Ga0495650_0021108
1419 Ga0495580_0477232
1420 Ga0495582_0024678
1421 Ga0495582_0030001
1422 Ga0495605_0000021
1423 Ga0495605_0000082
1424 Ga0495605_0000408
1425 Ga0495605_0006381
1426 Ga0495605_0014561
1427 Ga0495605_0018022
1428 Ga0495605_0034387
1429 Ga0495605_0038539
1430 Ga0495605_0038836
1431 Ga0495605_0086716
1432 Ga0495584_0000009
1433 Ga0495584_0001552
1434 Ga0495584_0007345
1435 Ga0495584_0010378
1436 Ga0495584_0014421
1437 Ga0495584_0014452
1438 Ga0495584_0017925
1439 Ga0495584_0021788
1440 Ga0495584_0022133
1441 Ga0495584_0026386
1442 Ga0495584_0028256
1443 Ga0495584_0038362
1444 Ga0495584_0069818
1445 Ga0495584_0084207
1446 Ga0495584_0117517
1447 Ga0495585_0000107
1448 Ga0495585_0000318
1449 Ga0495585_0001768
1450 Ga0495585_0004190
1451 Ga0495585_0017410
1452 Ga0495585_0020133
1453 Ga0495585_0021739
1454 Ga0495585_0023006
1455 Ga0495585_0026887
1456 Ga0495585_0034447
1457 Ga0495585_0035580
1458 Ga0495585_0043964
1459 Ga0495585_0049126
1460 Ga0495585_0060109
1461 Ga0495585_0097302
1462 Ga0495585_0125523
1463 Ga0495585_0132959
1464 Ga0495585_0199214
1465 Ga0495594_0008863
1466 Ga0495594_0020766
1467 Ga0495594_0022414
1468 Ga0495594_0032513
1469 Ga0495594_0037613
1470 Ga0495596_0000402
1471 Ga0495596_0002710
1472 Ga0495596_0002746
1473 Ga0495596_0003161
1474 Ga0495596_0003393
1475 Ga0495596_0015384
1476 Ga0495596_0016137
1477 Ga0495596_0020649
1478 Ga0495596_0042814
1479 Ga0495607_0003324
1480 Ga0495607_0012878
1481 Ga0495607_0013241
1482 Ga0495607_0017972
1483 Ga0495607_0020283
1484 Ga0495607_0022189
1485 Ga0495607_0025050
1486 Ga0495607_0039620
1487 Ga0495607_0057702
1488 Ga0495607_0152104
1489 Ga0495607_0158218
1490 Ga0495607_0197575
1491 Ga0495583_0000016
1492 Ga0495583_0000191
1493 Ga0495583_0000319
1494 Ga0495583_0000751
1495 Ga0495583_0010592
1496 Ga0495583_0014077
1497 Ga0495583_0016061
1498 Ga0495583_0019048
1499 Ga0495583_0040867
1500 Ga0495606_0000276
1501 Ga0495606_0001057
1502 Ga0495606_0001130
1503 Ga0495606_0001852
1504 Ga0495606_0002481
1505 Ga0495606_0002801
1506 Ga0495606_0003539
1507 Ga0495606_0006497
1508 Ga0495606_0041193
1509 Ga0495606_0046869
1510 Ga0495606_0057318
1511 Ga0495606_0148442
1512 Ga0495606_0218512
1513 Ga0495606_0286082
1514 Ga0495610_0000007
1515 Ga0495610_0002183
1516 Ga0495610_0004019
1517 Ga0495610_0010453
1518 Ga0495610_0014159
1519 Ga0495610_0014189
1520 Ga0495610_0041754
1521 Ga0495616_0000749
1522 Ga0495616_0001218
1523 Ga0495616_0011693
1524 Ga0495616_0011712
1525 Ga0495616_0013262
1526 Ga0495616_0014409
1527 Ga0495616_0019026
1528 Ga0495616_0031360
1529 Ga0495616_0051402
1530 Ga0495616_0059648
1531 Ga0495616_0090352
1532 Ga0495620_0013747
1533 Ga0495630_0034913
1534 Ga0495630_0149760
1535 Ga0495631_0005248
1536 Ga0495631_0012648
1537 Ga0495631_0014553
1538 Ga0495631_0036584
1539 Ga0495631_0082344
1540 Ga0495631_0085051
1541 Ga0495631_0093092
1542 Ga0495631_0119294
1543 Ga0495632_0000090
1544 Ga0495632_0000184
1545 Ga0495632_0008137
1546 Ga0495632_0013914
1547 Ga0495632_0017476
1548 Ga0495632_0018215
1549 Ga0495632_0023559
1550 Ga0495637_0001177
1551 Ga0495637_0004283
1552 Ga0495637_0014283
1553 Ga0495637_0022999
1554 Ga0495637_0037567
1555 Ga0495637_0065832
1556 Ga0495643_0000230
1557 Ga0495643_0000420
1558 Ga0495643_0010866
1559 Ga0495643_0025951
1560 Ga0495643_0031189
1561 Ga0495643_0042233
1562 Ga0495643_0092186
1563 Ga0495644_0003060
1564 Ga0495644_0009727
1565 Ga0495644_0020872
1566 Ga0495644_0028843
1567 Ga0495644_0063374
1568 Ga0495644_0108519
1569 Ga0495648_0000082
1570 Ga0495648_0001254
1571 Ga0495648_0006814
1572 Ga0495648_0011977
1573 Ga0495648_0013312
1574 Ga0495648_0032223
1575 Ga0495648_0056080
1576 Ga0495648_0138100
1577 Ga0495648_0190643
1578 Ga0495663_0002300
1579 Ga0495663_0037962
1580 Ga0495666_0000188
1581 Ga0495666_0011597
1582 Ga0495666_0025051
1583 Ga0495666_0025891
1584 Ga0495666_0035999
1585 Ga0495666_0046367
1586 Ga0495666_0078076
1587 Ga0495642_0000046
1588 Ga0495642_0006763
1589 Ga0495642_0011614
1590 Ga0495642_0040136
1591 Ga0495642_0102468
1592 Ga0495652_0032605
1593 Ga0495654_0002109
1594 Ga0495654_0011154
1595 Ga0495654_0012362
1596 Ga0495654_0019236
1597 Ga0495654_0049087
1598 Ga0495654_0085522
1599 Ga0495665_0007076
1600 Ga0495665_0013943
1601 Ga0495640_0079879
1602 Ga0495586_0004480
1603 Ga0495586_0019287
1604 Ga0495586_0042542
1605 Ga0495586_0109140
1606 Ga0495586_0132591
1607 Ga0495587_0010860
1608 Ga0495587_0123876
1609 Ga0495587_0142148
1610 Ga0495609_0000026
1611 Ga0495609_0000599
1612 Ga0495609_0002410
1613 Ga0495609_0006815
1614 Ga0495609_0007669
1615 Ga0495609_0007835
1616 Ga0495609_0015210
1617 Ga0495609_0016045
1618 Ga0495609_0019538
1619 Ga0495609_0020468
1620 Ga0495609_0026297
1621 Ga0495609_0036696
1622 Ga0495609_0058713
1623 Ga0495621_0017388
1624 Ga0495597_0000341
1625 Ga0495597_0001426
1626 Ga0495597_0002139
1627 Ga0495597_0002447
1628 Ga0495597_0002492
1629 Ga0495597_0009137
1630 Ga0495597_0024575
1631 Ga0495597_0026578
1632 Ga0495597_0027038
1633 Ga0495597_0034059
1634 Ga0495597_0089444
1635 Ga0495597_0146205
1636 Ga0495645_0153435
1637 Ga0495622_0000036
1638 Ga0495622_0001962
1639 Ga0495622_0006774
1640 Ga0495622_0047494
1641 Ga0495622_0051735
1642 Ga0495622_0066490
1643 Ga0495622_0078099
1644 Ga0495633_0000342
1645 Ga0495633_0008545
1646 Ga0495633_0008826
1647 Ga0495633_0009734
1648 Ga0495633_0010297
1649 Ga0495633_0012562
1650 Ga0495633_0013497
1651 Ga0495633_0016073
1652 Ga0495633_0024291
1653 Ga0495633_0026015
1654 Ga0495633_0051005
1655 Ga0495633_0164072
1656 Ga0495667_0080515
1657 Ga0495656_0014820
1658 Ga0495656_0023716
1659 Ga0495656_0212645
1660 Ga0495668_0000266
1661 Ga0495668_0001680
1662 Ga0495668_0010998
1663 Ga0495668_0012490
1664 Ga0495668_0018722
1665 Ga0495668_0021319
1666 Ga0495668_0021355
1667 Ga0495668_0027267
1668 Ga0495668_0038720
1669 Ga0495668_0038806
1670 Ga0495668_0052572
1671 Ga0495668_0059832
1672 Ga0495668_0218059
1673 Ga0495634_0017842
1674 Ga0495634_0084544
1675 Ga0495611_0004249
1676 Ga0495611_0007102
1677 Ga0495611_0015211
1678 Ga0495611_0040218
1679 Ga0495611_0084196
1680 Ga0495611_0112018
1681 Ga0495625_0000843
1682 Ga0495625_0009699
1683 Ga0495625_0010984
1684 Ga0495625_0013060
1685 Ga0495625_0043892
1686 Ga0495625_0092825
1687 Ga0495625_0100886
1688 Ga0495625_0186258
1689 Ga0495625_0277094
1690 Ga0495635_0008247
1691 Ga0495659_0003676
1692 Ga0495659_0004819
1693 Ga0495659_0037228
1694 Ga0495659_0041029
1695 Ga0495661_0000913
1696 Ga0495661_0012826
1697 Ga0495661_0013120
1698 Ga0495661_0017933
1699 Ga0495661_0020826
1700 Ga0495661_0040247
1701 Ga0495661_0053279
1702 Ga0495661_0058002
1703 Ga0495661_0061483
1704 Ga0495661_0114742
1705 Ga0495661_0140601
1706 Ga0495661_0204318
1707 Ga0495588_0000140
1708 Ga0495588_0007566
1709 Ga0495588_0012774
1710 Ga0495588_0024495
1711 Ga0495588_0026522
1712 Ga0495588_0030365
1713 Ga0495588_0041800
1714 Ga0495588_0051974
1715 Ga0495588_0081778
1716 Ga0495623_0080155
1717 Ga0495623_0150246
1718 Ga0495623_0260196
1719 Ga0495646_0271153
1720 Ga0495658_0042199
1721 Ga0495669_0000896
1722 Ga0495669_0006748
1723 Ga0495669_0011483
1724 Ga0495669_0012333
1725 Ga0495669_0018469
1726 Ga0495669_0037720
1727 Ga0495669_0105437
1728 Ga0495669_0137703
1729 Ga0495669_0198535
1730 Ga0495613_0138894
1731 Ga0495624_0008666
1732 Ga0495624_0355506
1733 Ga0495670_0007065
1734 Ga0495670_0016062
1735 Ga0495670_0087127
1736 Ga0495670_0092139
1737 Ga0495670_0120282
1738 Ga0495671_0000086
1739 Ga0495671_0000245
1740 Ga0495671_0002185
1741 Ga0495671_0105213
1742 Ga0495671_0111752
1743 Ga0495671_0139528
1744 Ga0495649_0000093
1745 Ga0495649_0008892
1746 Ga0495649_0028635
1747 Ga0495649_0041528
1748 Ga0495649_0048098
1749 Ga0495649_0217354
1750 Ga0495649_0221499
1751 Ga0495589_0000337
1752 Ga0495589_0000462
1753 Ga0495589_0003191
1754 Ga0495589_0008624
1755 Ga0495589_0017018
1756 Ga0495589_0018245
1757 Ga0495589_0026593
1758 Ga0495589_0049361
1759 Ga0495589_0218586
1760 Ga0495600_0020026
1761 Ga0495600_0050887
1762 Ga0495660_0000085
1763 Ga0495660_0002264
1764 Ga0495660_0002327
1765 Ga0495660_0002406
1766 Ga0495660_0010617
1767 Ga0495660_0019058
1768 Ga0495660_0022697
1769 Ga0495660_0024987
1770 Ga0495660_0030454
1771 Ga0495660_0031663
1772 Ga0495660_0045063
1773 Ga0495660_0078158
1774 Ga0495660_0122137
1775 Ga0495581_0013040
1776 Ga0495581_0040948
1777 Ga0495581_0118476
1778 Ga0495604_0040354
1779 Ga0495604_0120453
1780 Ga0495604_0249471
1781 Ga0495636_0004955
1782 Ga0495636_0012647
1783 Ga0495636_0017270
1784 Ga0495636_0024594
1785 Ga0495636_0082372
1786 Ga0495674_0003089
1787 Ga0495672_0000005
1788 Ga0495672_0000217
1789 Ga0495672_0000458
1790 Ga0495672_0000483
1791 Ga0495672_0015337
1792 Ga0495672_0019626
1793 Ga0495672_0023745
1794 Ga0495672_0056491
1795 Ga0495672_0080223
1796 Ga0495672_0095297
1797 Ga0495672_0191737
1798 Ga0495676_0003794
1799 Ga0495676_0095264
1800 Ga0495676_0114590
1801 Ga0495676_0171153
1802 Ga0495676_0273881
1803 Ga0495680_0025365
1804 Ga0495683_0000054
1805 Ga0495683_0000662
1806 Ga0495683_0012831
1807 Ga0495683_0031376
1808 Ga0495683_0035853
1809 Ga0495683_0060688
1810 Ga0495683_0078493
1811 Ga0495687_000037
1812 Ga0495687_000155
1813 Ga0495687_000468
1814 Ga0495687_001686
1815 Ga0495687_001978
1816 Ga0495687_005761
1817 Ga0495687_009381
1818 Ga0495687_011026
1819 Ga0495687_068105
1820 Ga0495675_0002475
1821 Ga0495675_0023210
1822 Ga0495675_0096577
1823 Ga0495675_0120192
1824 Ga0495677_0000130
1825 Ga0495677_0006146
1826 Ga0495677_0007525
1827 Ga0495677_0008597
1828 Ga0495677_0010442
1829 Ga0495677_0010483
1830 Ga0495677_0011196
1831 Ga0495677_0018890
1832 Ga0495677_0020135
1833 Ga0495677_0033862
1834 Ga0495677_0113530
1835 Ga0495679_007218
1836 Ga0495679_007632
1837 Ga0495679_013012
1838 Ga0495679_031141
1839 Ga0495679_032605
1840 Ga0495685_000032
1841 Ga0495685_002375
1842 Ga0495685_069250
1843 Ga0495673_0000057
1844 Ga0495673_0000060
1845 Ga0495673_0001499
1846 Ga0495673_0019812
1847 Ga0495673_0046075
1848 Ga0495681_0000431
1849 Ga0495681_0000955
1850 Ga0495681_0002687
1851 Ga0495681_0009295
1852 Ga0495681_0015314
1853 Ga0495681_0016965
1854 Ga0495681_0032166
1855 Ga0495686_0000047
1856 Ga0495686_0000142
1857 Ga0495686_0002586
1858 Ga0495686_0013068
1859 Ga0495686_0015664
1860 Ga0495686_0035276
1861 Ga0495686_0050660
1862 Ga0495686_0107452
1863 Ga0495593_0012258
1864 Ga0495593_0020991
1865 Ga0495593_0027434
1866 Ga0495602_0132554
1867 Ga0495602_0157443
1868 Ga0495614_0015534
1869 Ga0495614_0018631
1870 Ga0495626_0000009
1871 Ga0495626_0000078
1872 Ga0495626_0002601
1873 Ga0495626_0006180
1874 Ga0495626_0011834
1875 Ga0495626_0012268
1876 Ga0495626_0016679
1877 Ga0495626_0023846
1878 Ga0495626_0028717
1879 Ga0495626_0145656
1880 Ga0495626_0173846
1881 Ga0496100_0148412
1882 Ga0496100_0552697
1883 Ga0496102_0000360
1884 Ga0496102_0033039
1885 Ga0496102_0038714
1886 Ga0496102_0269798
1887 Ga0496103_0001443
1888 Ga0496103_0012438
1889 Ga0496103_0041402
1890 Ga0496105_0165537
1891 Ga0496105_0231960
1892 Ga0496106_0023634
1893 Ga0496106_0030666
1894 Ga0496107_0134791
1895 Ga0496107_0201807
1896 Ga0496107_0623101
1897 Ga0496108_0616503
1898 Ga0496110_0077107
1899 Ga0496110_0411770
1900 Ga0496111_0149814
1901 Ga0496111_0314153
1902 Ga0496113_0043136
1903 Ga0496113_0278888
1904 Ga0496115_0049354
1905 Ga0496115_0606002
1906 Ga0496116_0041137
1907 Ga0496117_0000011
1908 Ga0496118_0000010
1909 Ga0496118_0186155
1910 Ga0496121_0014681
1911 Ga0496121_0052677
1912 Ga0496122_0000549
1913 Ga0496122_0002477
1914 Ga0496122_0003057
1915 Ga0496122_0015963
1916 Ga0496122_0083157
1917 Ga0496122_0125872
1918 Ga0496123_0000326
1919 Ga0496123_0014307
1920 Ga0496123_0017258
1921 Ga0496123_0033067
1922 Ga0496124_0001925
1923 Ga0496124_0042693
1924 Ga0496124_0057575
1925 Ga0496124_0064120
1926 Ga0496124_0083828
1927 Ga0496124_0153107
1928 Ga0496124_0242504
1929 Ga0496124_0309214
1930 Ga0496125_0009304
1931 Ga0496125_0025826
1932 Ga0496125_0035590
1933 Ga0496125_0069129
1934 Ga0496125_0106794
1935 Ga0496125_0357216
1936 Ga0496126_0006527
1937 Ga0501304_006870
1938 Ga0495678_000001
1939 Ga0495678_000163
1940 Ga0495678_000347
1941 Ga0495678_002748
1942 Ga0495678_002777
1943 Ga0495678_003899
1944 Ga0495678_010182
1945 Ga0495678_070628
1946 Ga0495678_079460
1947 Ga0495678_080101
1948 Ga0495682_0000292
1949 Ga0495682_0005778
1950 Ga0495682_0006944
1951 Ga0495682_0006952
1952 Ga0495682_0010628
1953 Ga0495682_0016641
1954 Ga0495682_0028792
1955 Ga0501036_0155045
1956 Ga0501249_004735
1957 Ga0501269_000077
1958 Ga0501269_012765
1959 Ga0501035_0002946
1960 Ga0501044_0262201
1961 nmdc:mga03683_17027_c1
1962 nmdc:mga0yw44_50801_c1
1963 nmdc:mga06z11_100034_c1
1964 nmdc:mga06z11_119347_c1
1965 nmdc:mga08y16_121431_c1
1966 nmdc:mga0sz30_56177_c1
1967 Ga0500641_0007972
1968 Ga0500641_0072881
1969 Ga0500594_0035340
1970 Ga0500618_000384
1971 Ga0500618_000433
1972 Ga0500618_002204
1973 Ga0500559_0108682
1974 Ga0500586_000135
1975 Ga0500636_0000106
1976 Ga0500637_0039690
1977 Ga0500637_0129698
1978 Ga0500637_0184097
1979 Ga0501084_0305968
1980 Ga0587090_024863
1981 Ga0587111_0041035
1982 Ga0466962_0035793
1983 Ga0466962_0092611
1984 2511248015
1985 2511385024
1986 2526210880
1987 2574430522
1988 2601669530
1989 2643788147
1990 2643801106
1991 2644026832
1992 2644216251
1993 2644255366
1994 2644359888
1995 2644472808
1996 2738742495
1997 2738827237
1998 2738846551
1999 2739151034
2000 2739192953
2001 2739277195
2002 2739319430
2003 2739337671
2004 2739346245
2005 2809128589
2006 2809142275
2007 2809148210
2008 2819594999
2009 2821134595
2010 2834641526
2011 2842715101
2012 2852620371
2013 2857549651
2014 2857557088
2015 2857560496
2016 2857570010
2017 2884852910
2018 2885081443
2019 2891634060
2020 2904430262
2021 2919480838
2022 2928134073
2023 2932415733
2024 2932421723
2025 639787744
2026 8047675152

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

61

157

0.95

PF13649

Methyltransf_25

Methyltransferase domain

60

153

0.93

PF13847

Methyltransf_31

Methyltransferase domain

55

191

0.86

PF08003

Methyltransf_9

Protein of unknown function (DUF1698)

42

168

0.86

PF08242

Methyltransf_12

Methyltransferase domain

61

155

0.83

PF07021

MetW

Methionine biosynthesis protein MetW

45

203

0.82

PF02353

CMAS

Mycolic acid cyclopropane synthetase

35

192

0.82

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

38

192

0.81

PF13489

Methyltransf_23

Methyltransferase domain

37

210

0.76

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

37

171

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kdr-assembly1.cif.gz_A crystal structure of ubig/sah complex 0.9482 21 248
5dpm-assembly1.cif.gz_A crystal structure of ubig mutant in complex with sah 0.9457 21 248
4kdr-assembly1.cif.gz_A crystal structure of ubig/sah complex 0.9349 21 248
5dpm-assembly1.cif.gz_A crystal structure of ubig mutant in complex with sah 0.9322 21 248
4kdc-assembly1.cif.gz_A crystal structure of ubig 0.8717 27 248
ID Description Score Start End Superfamily
af_A0A1D6FP65_72_359_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.962 22 248 3.40.50.150
af_Q0DEH4_83_317_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9613 27 246 3.40.50.150
4kdrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9482 21 248 3.40.50.150
af_Q54XD0_74_321_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9477 27 248 3.40.50.150
af_O74421_37_271_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9436 27 249 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4R1FNI0-F1-model_v4 Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) 0.9852 20 248 GO:0010420
GO:0032259
GO:0061542
GO:0102208
AF-A0A193KBS2-F1-model_v4 deleted 0.9803 16 250
AF-A0A7V8QSE0-F1-model_v4 Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) 0.967 21 248 GO:0010420
GO:0032259
GO:0061542
AF-A0A193KBS2-F1-model_v4 deleted 0.9641 16 250
AF-A0A4R1FNI0-F1-model_v4 Ubiquinone biosynthesis O-methyltransferase (2-polyprenyl-6-hydroxyphenol methylase) (EC 2.1.1.222) (3-demethylubiquinone 3-O-methyltransferase) (EC 2.1.1.64) 0.9603 20 248 GO:0010420
GO:0032259
GO:0061542
GO:0102208

Map