F488238

General Info

Members Datasets Scaffolds Average Seq Length
1015 496 2030 237

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10503601|Ga0105239_105036011
Length 255
Sequence MLLGVRRQAISSFSLREKGRGWGRFSLLPSFRFNGATMTKRQDVPAAGKRFHANDNIAEFVDGEAELQALEAEVSEKLQAVLESLVIDTVSDHNTRGTAHRVARMFVHETFKGRYYHAPKVTEFPNSERLNELMIVGPITVRSACSHHFVPILGRLWVGILPSEKSNLIGLSKYSRIAEWIMSRPQIQEEAIIQLADELERRMRPDGLALVLEADHFCMQWRGVRDESHMTNSVMRGAFLVNPELRKEFLQLVKP

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
72 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
101 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
104 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
105 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
128 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
145 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
148 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
149 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
150 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
153 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
155 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
156 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
157 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
159 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
160 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
171 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
228 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
230 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
236 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
237 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
238 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
239 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
240 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
241 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
242 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
243 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
244 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
245 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
246 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
247 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
248 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
249 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
250 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
251 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
252 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
253 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
254 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
255 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
256 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
257 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
258 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
259 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
277 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
278 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
279 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
280 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
281 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
282 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
283 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
284 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
285 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
286 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
287 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
288 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
289 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
290 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
291 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
292 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
293 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
294 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
295 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
296 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
297 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
298 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
299 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
300 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
301 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
302 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
303 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
304 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
305 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
306 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
307 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
308 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
309 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
310 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
311 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
312 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
313 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
317 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
318 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
319 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
320 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
321 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
322 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
323 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
324 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
325 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
326 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
327 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
328 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
329 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
330 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
331 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
332 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
333 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
334 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
335 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
336 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
337 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
338 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
339 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
340 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
341 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
342 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
346 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
347 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
348 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
349 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
350 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
356 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
359 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
360 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
361 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
362 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
363 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
364 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
365 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
366 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
367 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
368 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
369 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
381 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
382 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
383 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
384 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
385 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
386 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
387 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
388 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
389 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
390 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
391 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
392 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
393 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
394 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
395 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
396 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
399 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
400 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
403 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
404 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
405 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
406 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
407 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
408 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
409 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
410 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
411 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
412 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
413 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
414 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
415 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
416 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
417 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
418 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
419 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
420 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
421 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
422 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
423 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
424 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
425 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
426 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
427 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
428 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
429 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
430 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
431 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
432 2547132374 Acidovorax radicis N35 Isolate Unclassified
433 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
434 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
435 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
436 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
437 2643221570 Acidovorax sp. Root568 Isolate Unclassified
438 2643221596 Acidovorax sp. Root70 Isolate Unclassified
439 2643221609 Acidovorax sp. Root217 Isolate Unclassified
440 2643221611 Acidovorax sp. Root219 Isolate Unclassified
441 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
442 2643221652 Acidovorax sp. Root402 Isolate Unclassified
443 2643221658 Variovorax sp. Root411 Isolate Unclassified
444 2643221672 Variovorax sp. Root434 Isolate Unclassified
445 2643221683 Variovorax sp. Root473 Isolate Unclassified
446 2643221717 Acidovorax sp. Root267 Isolate Unclassified
447 2721755523 Delftia sp. HK171 Isolate Unclassified
448 2738541277 Variovorax sp. GV051 Isolate Unclassified
449 2738541307 Variovorax sp. GV008 Isolate Unclassified
450 2738543012 Acidovorax sp. CF301 Isolate Unclassified
451 2738543013 Variovorax sp. BT01 Isolate Unclassified
452 2738543019 Variovorax sp. GV040 Isolate Unclassified
453 2816332133 Acidovorax radicis 2721A Isolate Unclassified
454 2818991446 Variovorax sp. 1180 Isolate Unclassified
455 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
456 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
457 2842677519 Variovorax sp. R-72495 Isolate Unclassified
458 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
459 2842733646 Variovorax sp. R-72446 Isolate Unclassified
460 2842747753 Variovorax sp. R-72060 Isolate Unclassified
461 2857553236 Duganella sp. R-74557 Isolate Unclassified
462 2857558681 Duganella sp. R-74565 Isolate Unclassified
463 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
464 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
465 2885198086 Variovorax sp. 679 Isolate Unclassified
466 2885211737 Variovorax sp. 553 Isolate Unclassified
467 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
468 2899924645 Variovorax sp. 369 Isolate Unclassified
469 2904424332 Duganella sp. 1411 Isolate Rhizosphere
470 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
471 2904456579 Variovorax sp. 2002 Isolate Unclassified
472 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
473 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
474 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
475 2919476304 Duganella sp. 3397 Isolate Unclassified
476 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
477 2928037797 Variovorax sp. 1126 Isolate Unclassified
478 2928044640 Variovorax sp. 1128 Isolate Unclassified
479 2928051484 Variovorax sp. 1133 Isolate Unclassified
480 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
481 2928070936 Variovorax gossypii 1167 Isolate Unclassified
482 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
483 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
484 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
485 2929520902 Variovorax beijingensis 502 Isolate Unclassified
486 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
487 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
488 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
489 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
490 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
491 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
492 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
493 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
494 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
495 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
496 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.4
Metatranscriptomes 0
Isolates 6.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.28
Nodule 0.89
Rhizoplane 2.66
Rhizosphere 66.9
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10503601 3300010375 Bacteria 1377
2 SwRhRL2b_contig_1402350 2162886007 Bacteria 924
3 SwRhRL2b_contig_2016154 2162886007 Bacteria 1794
4 JGI25155J39150_1000022 3300002704 Bacteria 142950
5 JGI25156J39149_1000005 3300002705 Bacteria 263980
6 JGI25154J39366_1000017 3300002738 Bacteria 252448
7 JGI25154J39366_1000144 3300002738 Bacteria 55903
8 JGI25158J39367_1000189 3300002739 Bacteria 14634
9 JGI25158J39367_1009433 3300002739 Bacteria 1337
10 JGI25157J39369_1000003 3300002741 Bacteria 274935
11 JGI25152J39213_1001945 3300002773 Bacteria 8224
12 JGI25152J39213_1002156 3300002773 Bacteria 7717
13 JGI25150J39212_1007317 3300002774 Bacteria 2223
14 JGI25150J39212_1010993 3300002774 Bacteria 1659
15 JGI25159J45721_1000650 3300002987 Bacteria 15392
16 JGI25159J45721_1001946 3300002987 Bacteria 8224
17 JGI25159J45721_1015778 3300002987 Bacteria 1640
18 JGI25159J45721_1015855 3300002987 Bacteria 1632
19 JGI25159J45721_1018585 3300002987 Bacteria 1396
20 JGI25151J46595_10012722 3300003187 Bacteria 3817
21 JGI25151J46595_10020736 3300003187 Bacteria 2765
22 JGI25151J46595_10028883 3300003187 Bacteria 2204
23 JGI25153J46596_10024047 3300003215 Bacteria 2204
24 JGI25153J46596_10025225 3300003215 Bacteria 2128
25 rootH1_10011772 3300003323 Bacteria 16537
26 JGI25160J50197_1000930 3300003354 Bacteria 15392
27 JGI25160J50197_1001567 3300003354 Bacteria 11279
28 JGI25160J50197_1002666 3300003354 Bacteria 8224
29 JGI25160J50197_1006098 3300003354 Bacteria 4919
30 JGI25161J50226_1000149 3300003374 Bacteria 48658
31 JGI25161J50226_1000313 3300003374 Bacteria 26654
32 JGI25161J50226_1000585 3300003374 Bacteria 15392
33 JGI25161J50226_1005639 3300003374 Bacteria 2387
34 JGI25161J50226_1008040 3300003374 Bacteria 1672
35 Ga0055532_1013860 3300003758 Bacteria 914
36 Ga0055535_1000380 3300003761 Bacteria 42008
37 Ga0055542_1000062 3300003762 Bacteria 161494
38 Ga0055526_1001764 3300003771 Bacteria 15027
39 Ga0055526_1021860 3300003771 Bacteria 2204
40 Ga0055526_1021878 3300003771 Bacteria 2202
41 Ga0055537_1000115 3300003773 Bacteria 60828
42 Ga0055537_1000550 3300003773 Bacteria 21428
43 Ga0055537_1009201 3300003773 Bacteria 2204
44 Ga0055537_1017640 3300003773 Bacteria 1166
45 Ga0055524_1000073 3300003775 Bacteria 123033
46 Ga0055524_1012450 3300003775 Bacteria 3263
47 Ga0055524_1020728 3300003775 Bacteria 2204
48 Ga0055524_1020750 3300003775 Bacteria 2202
49 Ga0055534_1000106 3300003784 Bacteria 63996
50 Ga0055534_1000548 3300003784 Bacteria 20007
51 Ga0055534_1003985 3300003784 Bacteria 4439
52 Ga0055528_1001098 3300003790 Bacteria 17777
53 Ga0055528_1001361 3300003790 Bacteria 15067
54 Ga0055528_1006025 3300003790 Bacteria 5548
55 Ga0055528_1009609 3300003790 Bacteria 4027
56 Ga0055528_1019860 3300003790 Bacteria 2204
57 Ga0055530_10000208 3300003791 Bacteria 53265
58 Ga0055530_10002623 3300003791 Bacteria 11288
59 Ga0055530_10004408 3300003791 Bacteria 7255
60 Ga0055540_1000037 3300003792 Bacteria 162957
61 Ga0055540_1005690 3300003792 Bacteria 5153
62 Ga0055540_1037074 3300003792 Bacteria 1077
63 Ga0055531_10000112 3300003794 Bacteria 89016
64 Ga0055531_10001068 3300003794 Bacteria 21517
65 Ga0055543_1000989 3300004625 Bacteria 12816
66 Ga0055543_1001481 3300004625 Bacteria 9254
67 Ga0055543_1002029 3300004625 Bacteria 7127
68 Ga0065165_1002493 3300005262 Bacteria 15430
69 Ga0065165_1004528 3300005262 Bacteria 8520
70 Ga0065714_10017201 3300005288 Bacteria 2482
71 Ga0065704_10203129 3300005289 Bacteria 1138
72 Ga0065707_10186626 3300005295 Bacteria 1385
73 Ga0070658_10138120 3300005327 Bacteria 2035
74 Ga0070676_10399620 3300005328 Bacteria 956
75 Ga0070690_100007433 3300005330 Bacteria 6278
76 Ga0070670_100216731 3300005331 Bacteria 1665
77 Ga0070677_10015440 3300005333 Bacteria 2705
78 Ga0068869_100016076 3300005334 Bacteria 5038
79 Ga0068869_100212014 3300005334 Bacteria 1531
80 Ga0068869_100552227 3300005334 Bacteria 968
81 Ga0070666_10136438 3300005335 Bacteria 1707
82 Ga0070680_100016548 3300005336 Bacteria 5803
83 Ga0070682_100011151 3300005337 Bacteria 5128
84 Ga0070682_100084353 3300005337 Bacteria 2064
85 Ga0070682_100207963 3300005337 Bacteria 1385
86 Ga0070682_100237827 3300005337 Bacteria 1306
87 Ga0068868_100021692 3300005338 Bacteria 4838
88 Ga0068868_100430108 3300005338 Bacteria 1145
89 Ga0070660_100051782 3300005339 Bacteria 3163
90 Ga0070689_100005263 3300005340 Bacteria 8810
91 Ga0070687_100093927 3300005343 Bacteria 1665
92 Ga0070687_100121794 3300005343 Bacteria 1493
93 Ga0070661_100013863 3300005344 Bacteria 5664
94 Ga0070668_100237889 3300005347 Bacteria 1507
95 Ga0070669_100022797 3300005353 Bacteria 4478
96 Ga0070669_100409321 3300005353 Bacteria 1111
97 Ga0070669_100741306 3300005353 Bacteria 832
98 Ga0070675_100050998 3300005354 Bacteria 3399
99 Ga0070675_100052126 3300005354 Bacteria 3363
100 Ga0070675_100362763 3300005354 Bacteria 1287
101 Ga0070671_100007502 3300005355 Bacteria 8718
102 Ga0070671_100589781 3300005355 Bacteria 960
103 Ga0070671_100629012 3300005355 Bacteria 929
104 Ga0070674_100006311 3300005356 Bacteria 6906
105 Ga0070674_100028647 3300005356 Bacteria 3659
106 Ga0070674_100198255 3300005356 Bacteria 1548
107 Ga0070674_100425286 3300005356 Bacteria 1091
108 Ga0070673_100056176 3300005364 Bacteria 3105
109 Ga0070673_100064348 3300005364 Bacteria 2922
110 Ga0070673_100114607 3300005364 Bacteria 2240
111 Ga0070688_100055598 3300005365 Bacteria 2483
112 Ga0070659_100214534 3300005366 Bacteria 1587
113 Ga0070667_100077315 3300005367 Bacteria 2842
114 Ga0070667_100241803 3300005367 Bacteria 1612
115 Ga0070714_100060331 3300005435 Bacteria 3255
116 Ga0070713_100141594 3300005436 Bacteria 2131
117 Ga0070710_10075900 3300005437 Bacteria 1949
118 Ga0070701_10006937 3300005438 Bacteria 4802
119 Ga0070705_100003004 3300005440 Bacteria 8345
120 Ga0070708_100619376 3300005445 Bacteria 1020
121 Ga0070663_100088579 3300005455 Bacteria 2289
122 Ga0070663_100296265 3300005455 Bacteria 1293
123 Ga0070663_100545097 3300005455 Bacteria 969
124 Ga0070678_100080167 3300005456 Bacteria 2471
125 Ga0070678_100294870 3300005456 Bacteria 1376
126 Ga0070662_100057064 3300005457 Bacteria 2836
127 Ga0070681_10045978 3300005458 Bacteria 4366
128 Ga0068867_100027638 3300005459 Bacteria 4080
129 Ga0068867_100036057 3300005459 Bacteria 3588
130 Ga0070685_10195098 3300005466 Bacteria 1313
131 Ga0070707_100729450 3300005468 Bacteria 954
132 Ga0070679_100013640 3300005530 Bacteria 7785
133 Ga0070679_100090124 3300005530 Bacteria 3054
134 Ga0070679_100137837 3300005530 Bacteria 2421
135 Ga0068853_100002881 3300005539 Bacteria 13053
136 Ga0068853_100083361 3300005539 Bacteria 2801
137 Ga0070672_100002831 3300005543 Bacteria 11117
138 Ga0070672_100005868 3300005543 Bacteria 8189
139 Ga0070686_100501226 3300005544 Bacteria 942
140 Ga0070695_100262449 3300005545 Bacteria 1262
141 Ga0070695_100368482 3300005545 Bacteria 1081
142 Ga0070693_100032239 3300005547 Bacteria 2880
143 Ga0070665_100006246 3300005548 Bacteria 12188
144 Ga0070665_100157260 3300005548 Bacteria 2275
145 Ga0070665_100260552 3300005548 Bacteria 1735
146 Ga0070704_100005740 3300005549 Bacteria 7257
147 Ga0070704_100005983 3300005549 Bacteria 7132
148 Ga0070704_100180796 3300005549 Bacteria 1686
149 Ga0070704_100254427 3300005549 Bacteria 1444
150 Ga0068855_100019841 3300005563 Bacteria 8076
151 Ga0068855_100034189 3300005563 Bacteria 6064
152 Ga0068855_100144671 3300005563 Bacteria 2708
153 Ga0068855_100180509 3300005563 Bacteria 2387
154 Ga0068855_100270975 3300005563 Bacteria 1888
155 Ga0068855_100663650 3300005563 Bacteria 1119
156 Ga0070664_100043542 3300005564 Bacteria 3788
157 Ga0070664_100094714 3300005564 Bacteria 2589
158 Ga0070664_100418508 3300005564 Bacteria 1227
159 Ga0068857_100009157 3300005577 Bacteria 8593
160 Ga0068857_100119025 3300005577 Bacteria 2377
161 Ga0068857_100120477 3300005577 Bacteria 2362
162 Ga0068857_100199963 3300005577 Bacteria 1822
163 Ga0070702_100064882 3300005615 Bacteria 2137
164 Ga0070702_100283931 3300005615 Bacteria 1138
165 Ga0070702_100341742 3300005615 Bacteria 1051
166 Ga0068859_100009359 3300005617 Bacteria 9891
167 Ga0068859_100010146 3300005617 Bacteria 9487
168 Ga0068859_100024887 3300005617 Bacteria 6009
169 Ga0068859_100130039 3300005617 Bacteria 2589
170 Ga0068859_100318625 3300005617 Bacteria 1649
171 Ga0068859_100962127 3300005617 Bacteria 937
172 Ga0068864_100023476 3300005618 Bacteria 5180
173 Ga0068864_100087026 3300005618 Bacteria 2750
174 Ga0068861_100004581 3300005719 Bacteria 9279
175 Ga0068861_100011094 3300005719 Bacteria 6260
176 Ga0068861_100092058 3300005719 Bacteria 2395
177 Ga0068861_100198208 3300005719 Bacteria 1683
178 Ga0068861_100647478 3300005719 Bacteria 976
179 Ga0068851_10021066 3300005834 Bacteria 3163
180 Ga0068870_10408991 3300005840 Bacteria 885
181 Ga0068870_10446120 3300005840 Bacteria 852
182 Ga0068863_100568865 3300005841 Bacteria 1120
183 Ga0068863_100611553 3300005841 Bacteria 1079
184 Ga0068858_100067629 3300005842 Bacteria 3310
185 Ga0068858_100175815 3300005842 Bacteria 2020
186 Ga0068860_100495222 3300005843 Bacteria 1220
187 Ga0068860_100623850 3300005843 Bacteria 1085
188 Ga0068862_100118010 3300005844 Bacteria 2336
189 Ga0068862_100127057 3300005844 Bacteria 2252
190 Ga0068862_100178378 3300005844 Bacteria 1905
191 Ga0068862_100247278 3300005844 Bacteria 1624
192 Ga0081455_10037259 3300005937 Bacteria 4321
193 Ga0075365_10024848 3300006038 Bacteria 3786
194 Ga0075365_10042604 3300006038 Bacteria 2968
195 Ga0075365_10087948 3300006038 Bacteria 2113
196 Ga0075365_10135602 3300006038 Bacteria 1706
197 Ga0075368_10087877 3300006042 Bacteria 1269
198 Ga0075363_100022242 3300006048 Bacteria 3204
199 Ga0075363_100033700 3300006048 Bacteria 2669
200 Ga0075363_100066964 3300006048 Bacteria 1945
201 Ga0075364_10059236 3300006051 Bacteria 2510
202 Ga0075364_10189855 3300006051 Bacteria 1391
203 Ga0075432_10053093 3300006058 Bacteria 1432
204 Ga0070716_100255625 3300006173 Bacteria 1196
205 Ga0070716_100544251 3300006173 Bacteria 864
206 Ga0075362_10013111 3300006177 Bacteria 3309
207 Ga0075362_10020802 3300006177 Bacteria 2745
208 Ga0075362_10082839 3300006177 Bacteria 1481
209 Ga0075362_10174804 3300006177 Bacteria 1039
210 Ga0075367_10071834 3300006178 Bacteria 2082
211 Ga0075367_10120386 3300006178 Bacteria 1617
212 Ga0075366_10003634 3300006195 Bacteria 8175
213 Ga0075366_10010511 3300006195 Bacteria 5197
214 Ga0075366_10024337 3300006195 Bacteria 3531
215 Ga0075366_10029646 3300006195 Bacteria 3215
216 Ga0075366_10033780 3300006195 Bacteria 3014
217 Ga0075366_10056551 3300006195 Bacteria 2330
218 Ga0097621_100003874 3300006237 Bacteria 10367
219 Ga0097621_100022479 3300006237 Bacteria 4896
220 Ga0097621_100075499 3300006237 Bacteria 2794
221 Ga0097621_100141131 3300006237 Bacteria 2058
222 Ga0097621_100481497 3300006237 Bacteria 1122
223 Ga0075370_10000173 3300006353 Bacteria 22441
224 Ga0075370_10001174 3300006353 Bacteria 11030
225 Ga0075370_10005920 3300006353 Bacteria 6117
226 Ga0075370_10041933 3300006353 Bacteria 2584
227 Ga0075370_10104888 3300006353 Bacteria 1638
228 Ga0068871_100014949 3300006358 Bacteria 5802
229 Ga0068871_100095416 3300006358 Bacteria 2484
230 Ga0068871_100098501 3300006358 Bacteria 2446
231 Ga0068871_100176867 3300006358 Bacteria 1832
232 Ga0075428_100470111 3300006844 Bacteria 1346
233 Ga0075430_100709808 3300006846 Bacteria 829
234 Ga0075431_100003033 3300006847 Bacteria 16243
235 Ga0075431_100182381 3300006847 Bacteria 2154
236 Ga0075431_100236394 3300006847 Bacteria 1860
237 Ga0075433_10205070 3300006852 Bacteria 1753
238 Ga0075429_100037613 3300006880 Bacteria 4213
239 Ga0075429_100198395 3300006880 Bacteria 1758
240 Ga0068865_100035518 3300006881 Bacteria 3353
241 Ga0068865_100268078 3300006881 Bacteria 1355
242 Ga0068865_100410657 3300006881 Bacteria 1111
243 Ga0068865_100568847 3300006881 Bacteria 954
244 Ga0097620_100009359 3300006931 Bacteria 9891
245 Ga0097620_100010146 3300006931 Bacteria 9487
246 Ga0097620_100024885 3300006931 Bacteria 6009
247 Ga0097620_100130042 3300006931 Bacteria 2589
248 Ga0097620_100318616 3300006931 Bacteria 1649
249 Ga0097620_100962093 3300006931 Bacteria 937
250 Ga0079104_1016655 3300006946 Bacteria 2140
251 Ga0079104_1032012 3300006946 Bacteria 1300
252 Ga0099826_10001074 3300006948 Bacteria 15513
253 Ga0099826_10075973 3300006948 Bacteria 2113
254 Ga0075435_100050112 3300007076 Bacteria 3360
255 Ga0105244_10010540 3300009036 Bacteria 5598
256 Ga0105244_10027073 3300009036 Bacteria 3095
257 Ga0105244_10034661 3300009036 Bacteria 2656
258 Ga0105250_10009033 3300009092 Bacteria 4212
259 Ga0105240_10019143 3300009093 Bacteria 9153
260 Ga0105240_10050951 3300009093 Bacteria 5213
261 Ga0105240_10279500 3300009093 Bacteria 1918
262 Ga0111539_10211864 3300009094 Bacteria 2257
263 Ga0111539_10363843 3300009094 Bacteria 1684
264 Ga0105245_10021354 3300009098 Bacteria 5678
265 Ga0105245_10095634 3300009098 Bacteria 2741
266 Ga0105247_10037710 3300009101 Bacteria 2949
267 Ga0114129_10003978 3300009147 Bacteria 20874
268 Ga0105243_10007519 3300009148 Bacteria 8376
269 Ga0105243_10045436 3300009148 Bacteria 3451
270 Ga0105243_10477806 3300009148 Bacteria 1175
271 Ga0105241_10087578 3300009174 Bacteria 2451
272 Ga0105241_10110465 3300009174 Bacteria 2200
273 Ga0105241_10146216 3300009174 Bacteria 1929
274 Ga0105242_10002049 3300009176 Bacteria 15887
275 Ga0105242_10149425 3300009176 Bacteria 2036
276 Ga0105242_10152839 3300009176 Bacteria 2014
277 Ga0105242_10286462 3300009176 Bacteria 1498
278 Ga0105242_10539499 3300009176 Bacteria 1116
279 Ga0105248_10019781 3300009177 Bacteria 7456
280 Ga0105248_10126716 3300009177 Bacteria 2880
281 Ga0105248_10578635 3300009177 Bacteria 1267
282 Ga0105248_10693244 3300009177 Bacteria 1149
283 Ga0105248_10914916 3300009177 Bacteria 990
284 Ga0105237_10009912 3300009545 Bacteria 10169
285 Ga0105237_10083558 3300009545 Bacteria 3184
286 Ga0105237_10104620 3300009545 Bacteria 2822
287 Ga0105237_10177031 3300009545 Bacteria 2133
288 Ga0105237_10461792 3300009545 Bacteria 1276
289 Ga0105238_10043012 3300009551 Bacteria 4572
290 Ga0105238_10922267 3300009551 Bacteria 892
291 Ga0105249_10075446 3300009553 Bacteria 3123
292 Ga0105249_10278839 3300009553 Bacteria 1668
293 Ga0105246_10057478 3300011119 Bacteria 2692
294 Ga0157347_1005329 3300012502 Bacteria 1226
295 Ga0157326_1001774 3300012513 Bacteria 2354
296 Ga0157373_10053917 3300013100 Bacteria 2858
297 Ga0157373_10258558 3300013100 Bacteria 1232
298 Ga0157371_10008532 3300013102 Bacteria 8157
299 Ga0157370_10281202 3300013104 Bacteria 1537
300 Ga0157369_10001065 3300013105 Bacteria 34435
301 Ga0157369_10009756 3300013105 Bacteria 10981
302 Ga0157374_10013287 3300013296 Bacteria 7184
303 Ga0157374_10282129 3300013296 Bacteria 1640
304 Ga0157378_10061821 3300013297 Bacteria 3344
305 Ga0157378_10178612 3300013297 Bacteria 1995
306 Ga0163162_10117764 3300013306 Bacteria 2758
307 Ga0163162_10240370 3300013306 Bacteria 1942
308 Ga0163162_10580521 3300013306 Bacteria 1248
309 Ga0163162_10603825 3300013306 Bacteria 1223
310 Ga0157372_10094772 3300013307 Bacteria 3400
311 Ga0157372_10321073 3300013307 Bacteria 1803
312 Ga0157375_10005957 3300013308 Bacteria 10629
313 Ga0157375_10008046 3300013308 Bacteria 9230
314 Ga0157375_10058883 3300013308 Bacteria 3803
315 Ga0157375_10091318 3300013308 Bacteria 3107
316 Ga0157375_10645035 3300013308 Bacteria 1215
317 Ga0163163_10042648 3300014325 Bacteria 4445
318 Ga0163163_10221264 3300014325 Bacteria 1942
319 Ga0163163_10713147 3300014325 Bacteria 1067
320 Ga0163163_11212894 3300014325 Bacteria 817
321 Ga0157380_10047417 3300014326 Bacteria 3380
322 Ga0157380_10336233 3300014326 Bacteria 1406
323 Ga0182008_10000070 3300014497 Bacteria 81986
324 Ga0182008_10001756 3300014497 Bacteria 14210
325 Ga0182008_10009040 3300014497 Bacteria 5395
326 Ga0182008_10316386 3300014497 Bacteria 820
327 Ga0157376_10002739 3300014969 Bacteria 12019
328 Ga0157376_10005883 3300014969 Bacteria 8606
329 Ga0157376_10144651 3300014969 Bacteria 2137
330 Ga0157376_10180141 3300014969 Bacteria 1931
331 Ga0157376_11151779 3300014969 Bacteria 802
332 Ga0182006_1000008 3300015261 Bacteria 449652
333 Ga0182006_1000705 3300015261 Bacteria 23167
334 Ga0182006_1022284 3300015261 Bacteria 2634
335 Ga0182006_1164331 3300015261 Bacteria 746
336 Ga0182007_10000289 3300015262 Bacteria 33181
337 Ga0182007_10000957 3300015262 Bacteria 15855
338 Ga0182007_10019104 3300015262 Bacteria 2470
339 Ga0182005_1000008 3300015265 Bacteria 471394
340 Ga0183362_10003 3300015683 Bacteria 977584
341 Ga0163161_10000397 3300017792 Bacteria 36318
342 Ga0163161_10026189 3300017792 Bacteria 4131
343 Ga0163161_10056442 3300017792 Bacteria 2852
344 Ga0163161_10154304 3300017792 Bacteria 1747
345 Ga0163161_10530656 3300017792 Bacteria 962
346 Ga0163161_10667984 3300017792 Bacteria 862
347 Ga0213872_10000229 3300021361 Bacteria 49150
348 Ga0213872_10001024 3300021361 Bacteria 19508
349 Ga0213872_10011565 3300021361 Bacteria 4174
350 Ga0213872_10256532 3300021361 Bacteria 735
351 Ga0209435_100002 3300025206 Bacteria 794178
352 Ga0209436_100643 3300025208 Bacteria 14864
353 Ga0209436_113364 3300025208 Bacteria 1347
354 Ga0209436_114320 3300025208 Bacteria 1265
355 Ga0209672_101806 3300025228 Bacteria 6543
356 Ga0209147_101183 3300025229 Bacteria 10606
357 Ga0209437_109416 3300025233 Bacteria 1524
358 Ga0209258_100154 3300025242 Bacteria 158235
359 Ga0207425_1000855 3300025245 Bacteria 14979
360 Ga0207425_1001326 3300025245 Bacteria 10615
361 Ga0207425_1001372 3300025245 Bacteria 10313
362 Ga0207425_1003411 3300025245 Bacteria 5096
363 Ga0209646_1000001 3300025246 Bacteria 3092932
364 Ga0209026_1000001 3300025250 Bacteria 1228671
365 Ga0209148_1000145 3300025254 Bacteria 161352
366 Ga0209759_1000001 3300025256 Bacteria 2799452
367 Ga0209129_1000054 3300025258 Bacteria 261997
368 Ga0209129_1004503 3300025258 Bacteria 5405
369 Ga0209129_1005389 3300025258 Bacteria 4553
370 Ga0209565_1000067 3300025263 Bacteria 171247
371 Ga0209565_1000143 3300025263 Bacteria 99302
372 Ga0209565_1000185 3300025263 Bacteria 76451
373 Ga0209565_1000989 3300025263 Bacteria 14609
374 Ga0209565_1001534 3300025263 Bacteria 9949
375 Ga0209565_1009915 3300025263 Bacteria 2386
376 Ga0209673_1000008 3300025273 Bacteria 626013
377 Ga0209673_1000097 3300025273 Bacteria 193482
378 Ga0209673_1000172 3300025273 Bacteria 133472
379 Ga0209673_1001768 3300025273 Bacteria 17945
380 Ga0209673_1003839 3300025273 Bacteria 8491
381 Ga0209673_1003964 3300025273 Bacteria 8266
382 Ga0209673_1014525 3300025273 Bacteria 3043
383 Ga0209130_1000072 3300025284 Bacteria 175726
384 Ga0209130_1000315 3300025284 Bacteria 56958
385 Ga0209130_1001009 3300025284 Bacteria 21838
386 Ga0209130_1001241 3300025284 Bacteria 17909
387 Ga0209130_1001470 3300025284 Bacteria 15444
388 Ga0209130_1009689 3300025284 Bacteria 2720
389 Ga0209675_1000038 3300025291 Bacteria 250481
390 Ga0209675_1000221 3300025291 Bacteria 59141
391 Ga0209675_1001078 3300025291 Bacteria 16851
392 Ga0209675_1001255 3300025291 Bacteria 15212
393 Ga0209675_1001715 3300025291 Bacteria 12081
394 Ga0209675_1004900 3300025291 Bacteria 5779
395 Ga0209675_1007021 3300025291 Bacteria 4396
396 Ga0209675_1053946 3300025291 Bacteria 818
397 Ga0209676_1000023 3300025292 Bacteria 589732
398 Ga0209676_1000103 3300025292 Bacteria 226908
399 Ga0209676_1003243 3300025292 Bacteria 10256
400 Ga0209676_1005918 3300025292 Bacteria 6195
401 Ga0209025_1000185 3300025294 Bacteria 155366
402 Ga0209025_1000310 3300025294 Bacteria 108186
403 Ga0209025_1000474 3300025294 Bacteria 78060
404 Ga0209025_1005757 3300025294 Bacteria 9948
405 Ga0209025_1008072 3300025294 Bacteria 7663
406 Ga0209025_1010766 3300025294 Bacteria 6146
407 Ga0209025_1011168 3300025294 Bacteria 5968
408 Ga0209025_1032874 3300025294 Bacteria 2413
409 Ga0209564_1000241 3300025295 Bacteria 118237
410 Ga0209564_1000435 3300025295 Bacteria 72434
411 Ga0209564_1000998 3300025295 Bacteria 35364
412 Ga0209564_1001015 3300025295 Bacteria 34625
413 Ga0209564_1002789 3300025295 Bacteria 13039
414 Ga0209564_1006273 3300025295 Bacteria 6478
415 Ga0209564_1017907 3300025295 Bacteria 2730
416 Ga0209758_1000034 3300025297 Bacteria 467637
417 Ga0209758_1006876 3300025297 Bacteria 7950
418 Ga0209758_1009936 3300025297 Bacteria 5798
419 Ga0209758_1019858 3300025297 Bacteria 3213
420 Ga0209050_1000012 3300025298 Bacteria 813717
421 Ga0209050_1000022 3300025298 Bacteria 565239
422 Ga0209050_1000294 3300025298 Bacteria 105705
423 Ga0209050_1000331 3300025298 Bacteria 94245
424 Ga0209050_1002640 3300025298 Bacteria 14708
425 Ga0209050_1004039 3300025298 Bacteria 10307
426 Ga0209050_1020673 3300025298 Bacteria 2437
427 Ga0209256_1000001 3300025299 Bacteria 2166974
428 Ga0209256_1000103 3300025299 Bacteria 193900
429 Ga0209256_1000165 3300025299 Bacteria 135104
430 Ga0209256_1012906 3300025299 Bacteria 3145
431 Ga0209256_1059198 3300025299 Bacteria 898
432 Ga0207426_1000058 3300025302 Bacteria 363857
433 Ga0207426_1000067 3300025302 Bacteria 342108
434 Ga0207426_1000319 3300025302 Bacteria 92696
435 Ga0207426_1001869 3300025302 Bacteria 15444
436 Ga0207426_1013619 3300025302 Bacteria 3007
437 Ga0209051_1000013 3300025303 Bacteria 565239
438 Ga0209051_1000019 3300025303 Bacteria 511268
439 Ga0209051_1000235 3300025303 Bacteria 92799
440 Ga0209051_1000384 3300025303 Bacteria 62340
441 Ga0209051_1001048 3300025303 Bacteria 26073
442 Ga0209051_1009408 3300025303 Bacteria 5043
443 Ga0209257_1000024 3300025304 Bacteria 726068
444 Ga0209257_1000042 3300025304 Bacteria 537149
445 Ga0209257_1000057 3300025304 Bacteria 396985
446 Ga0209257_1000096 3300025304 Bacteria 259390
447 Ga0209257_1003704 3300025304 Bacteria 12716
448 Ga0209257_1003751 3300025304 Bacteria 12555
449 Ga0209257_1019286 3300025304 Bacteria 2576
450 Ga0209257_1021246 3300025304 Bacteria 2366
451 Ga0207696_1016922 3300025711 Bacteria 2427
452 Ga0207655_1005464 3300025728 Bacteria 8630
453 Ga0207655_1029791 3300025728 Bacteria 2548
454 Ga0207655_1059468 3300025728 Bacteria 1487
455 Ga0207653_10027468 3300025885 Bacteria 1827
456 Ga0207653_10117189 3300025885 Bacteria 956
457 Ga0207682_10005463 3300025893 Bacteria 5174
458 Ga0207647_10174666 3300025904 Bacteria 1250
459 Ga0207645_10092517 3300025907 Bacteria 1945
460 Ga0207645_10478598 3300025907 Bacteria 842
461 Ga0207643_10122208 3300025908 Bacteria 1543
462 Ga0207643_10171425 3300025908 Bacteria 1310
463 Ga0207705_10064625 3300025909 Bacteria 2644
464 Ga0207705_10108363 3300025909 Bacteria 2050
465 Ga0207654_10068895 3300025911 Bacteria 2094
466 Ga0207654_10181297 3300025911 Bacteria 1374
467 Ga0207654_10188424 3300025911 Bacteria 1350
468 Ga0207707_10100711 3300025912 Bacteria 2525
469 Ga0207707_10327577 3300025912 Bacteria 1322
470 Ga0207695_10075662 3300025913 Bacteria 3425
471 Ga0207695_10085778 3300025913 Bacteria 3177
472 Ga0207695_10209779 3300025913 Bacteria 1859
473 Ga0207671_10077564 3300025914 Bacteria 2487
474 Ga0207671_10210187 3300025914 Bacteria 1522
475 Ga0207663_10154267 3300025916 Bacteria 1614
476 Ga0207660_10020778 3300025917 Bacteria 4412
477 Ga0207662_10192222 3300025918 Bacteria 1317
478 Ga0207657_10015595 3300025919 Bacteria 7353
479 Ga0207649_10061832 3300025920 Bacteria 2358
480 Ga0207649_10135937 3300025920 Bacteria 1676
481 Ga0207649_10254180 3300025920 Bacteria 1267
482 Ga0207652_10028089 3300025921 Bacteria 4692
483 Ga0207652_10036453 3300025921 Bacteria 4158
484 Ga0207652_10609902 3300025921 Bacteria 978
485 Ga0207681_10460571 3300025923 Bacteria 1036
486 Ga0207694_10037143 3300025924 Bacteria 3739
487 Ga0207659_10078659 3300025926 Bacteria 2430
488 Ga0207687_10027054 3300025927 Bacteria 3845
489 Ga0207687_10143351 3300025927 Bacteria 1815
490 Ga0207687_10207686 3300025927 Bacteria 1534
491 Ga0207687_10291630 3300025927 Bacteria 1311
492 Ga0207700_10252369 3300025928 Bacteria 1507
493 Ga0207664_10076234 3300025929 Bacteria 2714
494 Ga0207690_10139811 3300025932 Bacteria 1783
495 Ga0207706_10005566 3300025933 Bacteria 11745
496 Ga0207686_10005963 3300025934 Bacteria 6542
497 Ga0207709_10000111 3300025935 Bacteria 127580
498 Ga0207709_10000215 3300025935 Bacteria 73474
499 Ga0207709_10001162 3300025935 Bacteria 19142
500 Ga0207709_10076394 3300025935 Bacteria 2144
501 Ga0207670_10045023 3300025936 Bacteria 2923
502 Ga0207670_10147502 3300025936 Bacteria 1742
503 Ga0207669_10127588 3300025937 Bacteria 1741
504 Ga0207669_10130545 3300025937 Bacteria 1725
505 Ga0207669_10136849 3300025937 Bacteria 1693
506 Ga0207669_10317421 3300025937 Bacteria 1191
507 Ga0207704_10067668 3300025938 Bacteria 2248
508 Ga0207704_10122354 3300025938 Bacteria 1784
509 Ga0207704_10394062 3300025938 Bacteria 1091
510 Ga0207665_10045670 3300025939 Bacteria 2933
511 Ga0207691_10002844 3300025940 Bacteria 16866
512 Ga0207691_10010164 3300025940 Bacteria 9028
513 Ga0207691_10017171 3300025940 Bacteria 6865
514 Ga0207711_10018692 3300025941 Bacteria 5762
515 Ga0207711_10029734 3300025941 Bacteria 4609
516 Ga0207711_10085608 3300025941 Bacteria 2762
517 Ga0207711_10707752 3300025941 Bacteria 939
518 Ga0207689_10002020 3300025942 Bacteria 19176
519 Ga0207689_10050453 3300025942 Bacteria 3431
520 Ga0207689_10067041 3300025942 Bacteria 2950
521 Ga0207689_10067948 3300025942 Bacteria 2929
522 Ga0207679_10087855 3300025945 Bacteria 2395
523 Ga0207679_10356164 3300025945 Bacteria 1277
524 Ga0207679_10637737 3300025945 Bacteria 963
525 Ga0207679_10677103 3300025945 Bacteria 935
526 Ga0207667_10020724 3300025949 Bacteria 7305
527 Ga0207667_10076109 3300025949 Bacteria 3483
528 Ga0207667_10090026 3300025949 Bacteria 3171
529 Ga0207667_10227482 3300025949 Bacteria 1910
530 Ga0207651_10072029 3300025960 Bacteria 2452
531 Ga0207651_10089856 3300025960 Bacteria 2244
532 Ga0207712_10555786 3300025961 Bacteria 988
533 Ga0207668_10040482 3300025972 Bacteria 3145
534 Ga0207668_10120330 3300025972 Bacteria 1987
535 Ga0207668_10127969 3300025972 Bacteria 1935
536 Ga0207658_10223900 3300025986 Bacteria 1584
537 Ga0207677_10048945 3300026023 Bacteria 2849
538 Ga0207677_10059527 3300026023 Bacteria 2635
539 Ga0207677_10468082 3300026023 Bacteria 1083
540 Ga0207703_10267503 3300026035 Bacteria 1547
541 Ga0207639_10012452 3300026041 Bacteria 5924
542 Ga0207639_10049758 3300026041 Bacteria 3179
543 Ga0207639_10162004 3300026041 Bacteria 1886
544 Ga0207639_10412446 3300026041 Bacteria 1219
545 Ga0207678_10060361 3300026067 Bacteria 3262
546 Ga0207678_10327942 3300026067 Bacteria 1318
547 Ga0207708_10083598 3300026075 Bacteria 2454
548 Ga0207708_10113725 3300026075 Bacteria 2103
549 Ga0207702_10338901 3300026078 Bacteria 1436
550 Ga0207641_10091882 3300026088 Bacteria 2657
551 Ga0207641_10777469 3300026088 Bacteria 946
552 Ga0207648_10005938 3300026089 Bacteria 12213
553 Ga0207648_10020064 3300026089 Bacteria 6029
554 Ga0207648_10096831 3300026089 Bacteria 2582
555 Ga0207648_10264482 3300026089 Bacteria 1535
556 Ga0207676_10033784 3300026095 Bacteria 3868
557 Ga0207676_10064529 3300026095 Bacteria 2913
558 Ga0207676_10199230 3300026095 Bacteria 1768
559 Ga0207676_10760011 3300026095 Bacteria 943
560 Ga0207674_10013170 3300026116 Bacteria 9202
561 Ga0207674_10109708 3300026116 Bacteria 2735
562 Ga0207674_10199962 3300026116 Bacteria 1948
563 Ga0207674_10204531 3300026116 Bacteria 1924
564 Ga0207674_10282029 3300026116 Bacteria 1609
565 Ga0207675_100003032 3300026118 Bacteria 16471
566 Ga0207675_100003943 3300026118 Bacteria 14407
567 Ga0207675_100032715 3300026118 Bacteria 4845
568 Ga0207675_100065798 3300026118 Bacteria 3388
569 Ga0207675_100128997 3300026118 Bacteria 2397
570 Ga0207683_10019416 3300026121 Bacteria 5804
571 Ga0207683_10112354 3300026121 Bacteria 2440
572 Ga0207683_10225217 3300026121 Bacteria 1709
573 Ga0207683_10336323 3300026121 Bacteria 1384
574 Ga0207698_10155442 3300026142 Bacteria 1992
575 Ga0209281_1000007 3300027111 Bacteria 938265
576 Ga0209281_1008243 3300027111 Bacteria 2545
577 Ga0209970_1000655 3300027614 Bacteria 6006
578 Ga0209282_1000613 3300027666 Bacteria 17535
579 Ga0209971_1042457 3300027682 Bacteria 1095
580 Ga0209974_10047863 3300027876 Bacteria 1433
581 Ga0209974_10081460 3300027876 Bacteria 1114
582 Ga0207428_10119015 3300027907 Bacteria 2027
583 Ga0268266_10036778 3300028379 Bacteria 4170
584 Ga0268266_10040237 3300028379 Bacteria 3984
585 Ga0268266_10100245 3300028379 Bacteria 2551
586 Ga0268266_10791121 3300028379 Bacteria 916
587 Ga0268265_10018587 3300028380 Bacteria 4820
588 Ga0268265_10067943 3300028380 Bacteria 2761
589 Ga0268265_10186763 3300028380 Bacteria 1786
590 Ga0268265_10513659 3300028380 Bacteria 1131
591 Ga0268265_10700660 3300028380 Bacteria 978
592 Ga0307515_10000472 3300028794 Bacteria 96172
593 Ga0307515_10037959 3300028794 Bacteria 7724
594 Ga0316177_1047792 3300030731 Bacteria 3238
595 Ga0316177_1195429 3300030731 Bacteria 1851
596 Ga0316178_1157584 3300030735 Bacteria 867
597 Ga0316180_1042735 3300030736 Bacteria 4445
598 Ga0316180_1079304 3300030736 Bacteria 2938
599 Ga0316183_1159521 3300030742 Bacteria 14384
600 Ga0316181_1090374 3300030744 Bacteria 1155
601 Ga0316181_1169111 3300030744 Bacteria 2256
602 Ga0316181_1253489 3300030744 Bacteria 2759
603 Ga0316182_1035127 3300030745 Bacteria 2632
604 Ga0265330_10000046 3300031235 Bacteria 108853
605 Ga0265332_10000028 3300031238 Bacteria 184029
606 Ga0265332_10000125 3300031238 Bacteria 63932
607 Ga0265329_10019348 3300031242 Bacteria 2313
608 Ga0265340_10002618 3300031247 Bacteria 10232
609 Ga0265331_10002589 3300031250 Bacteria 12161
610 Ga0265327_10000020 3300031251 Bacteria 424552
611 Ga0265327_10001288 3300031251 Bacteria 32919
612 Ga0265327_10025788 3300031251 Bacteria 3418
613 Ga0265327_10063073 3300031251 Bacteria 1883
614 Ga0307513_10000064 3300031456 Bacteria 141845
615 Ga0307513_10000117 3300031456 Bacteria 110951
616 Ga0307513_10024485 3300031456 Bacteria 7023
617 Ga0307513_10042007 3300031456 Bacteria 5040
618 Ga0307513_10064597 3300031456 Bacteria 3856
619 Ga0307513_10080341 3300031456 Bacteria 3364
620 Ga0307513_10261893 3300031456 Bacteria 1518
621 Ga0307509_10014687 3300031507 Bacteria 9187
622 Ga0307509_10040865 3300031507 Bacteria 5040
623 Ga0307408_100000101 3300031548 Bacteria 94089
624 Ga0307408_100005024 3300031548 Bacteria 8870
625 Ga0307408_100067034 3300031548 Bacteria 2638
626 Ga0307408_100342619 3300031548 Bacteria 1266
627 Ga0307514_10000593 3300031649 Bacteria 67957
628 Ga0307514_10041176 3300031649 Bacteria 3638
629 Ga0265314_10000054 3300031711 Bacteria 184029
630 Ga0265314_10021525 3300031711 Bacteria 4954
631 Ga0307516_10000092 3300031730 Bacteria 100931
632 Ga0307516_10017630 3300031730 Bacteria 7440
633 Ga0307405_10030635 3300031731 Bacteria 3157
634 Ga0307405_10164213 3300031731 Bacteria 1577
635 Ga0307405_10268788 3300031731 Bacteria 1277
636 Ga0307413_10357297 3300031824 Bacteria 1130
637 Ga0307406_10000362 3300031901 Bacteria 26340
638 Ga0307406_10354778 3300031901 Bacteria 1147
639 Ga0307407_10232226 3300031903 Bacteria 1253
640 Ga0307407_10534843 3300031903 Bacteria 864
641 Ga0307412_10007228 3300031911 Bacteria 6299
642 Ga0307412_10100103 3300031911 Bacteria 2048
643 Ga0307412_10101067 3300031911 Bacteria 2039
644 Ga0307412_10129011 3300031911 Bacteria 1834
645 Ga0307412_10515314 3300031911 Bacteria 998
646 Ga0307409_100014420 3300031995 Bacteria 5142
647 Ga0307409_100082462 3300031995 Bacteria 2603
648 Ga0307409_100333110 3300031995 Bacteria 1425
649 Ga0307416_100077278 3300032002 Bacteria 2795
650 Ga0307416_100098557 3300032002 Bacteria 2536
651 Ga0307416_100114057 3300032002 Bacteria 2390
652 Ga0307416_100210566 3300032002 Bacteria 1854
653 Ga0307416_100981510 3300032002 Bacteria 947
654 Ga0307414_10038036 3300032004 Bacteria 3227
655 Ga0307414_10306355 3300032004 Bacteria 1346
656 Ga0307414_10693265 3300032004 Bacteria 921
657 Ga0307411_10037870 3300032005 Bacteria 3036
658 Ga0307411_10068565 3300032005 Bacteria 2391
659 Ga0307411_10253418 3300032005 Bacteria 1385
660 Ga0307415_100127612 3300032126 Bacteria 1920
661 Ga0307415_100139370 3300032126 Bacteria 1850
662 Ga0307510_10179066 3300033180 Bacteria 1686
663 Ga0373955_0097827 3300035172 Bacteria 1681
664 Ga0373924_0120709 3300035410 Bacteria 1137
665 Ga0373931_0224067 3300035691 Bacteria 1133
666 Ga0373931_0438821 3300035691 Bacteria 833
667 Ga0373935_0637921 3300035692 Bacteria 781
668 Ga0373937_0167611 3300036401 Bacteria 2060
669 Ga0373937_0439778 3300036401 Bacteria 1238
670 Ga0395899_0001454 3300037312 Bacteria 20187
671 Ga0395899_0036017 3300037312 Bacteria 3713
672 Ga0395899_0068646 3300037312 Bacteria 2598
673 Ga0395899_0149599 3300037312 Bacteria 1655
674 Ga0395900_0087200 3300037418 Bacteria 3208
675 Ga0395900_0090683 3300037418 Bacteria 3142
676 Ga0395900_0118454 3300037418 Bacteria 2717
677 Ga0395900_0505353 3300037418 Bacteria 1158
678 Ga0395900_0524272 3300037418 Bacteria 1132
679 Ga0395898_0027889 3300037466 Bacteria 5662
680 Ga0395898_0028865 3300037466 Bacteria 5560
681 Ga0395898_0059772 3300037466 Bacteria 3706
682 Ga0395898_0080703 3300037466 Bacteria 3137
683 Ga0395898_0108760 3300037466 Bacteria 2658
684 Ga0395898_0424407 3300037466 Bacteria 1267
685 Ga0395905_0000043 3300037471 Bacteria 247469
686 Ga0395905_0003965 3300037471 Bacteria 15577
687 Ga0395905_0004042 3300037471 Bacteria 15395
688 Ga0395905_0006888 3300037471 Bacteria 11365
689 Ga0395905_0023252 3300037471 Bacteria 5859
690 Ga0395905_0112559 3300037471 Bacteria 2556
691 Ga0395905_0125298 3300037471 Bacteria 2415
692 Ga0395905_0413399 3300037471 Bacteria 1244
693 Ga0395901_0029560 3300038443 Bacteria 5642
694 Ga0395901_0032445 3300038443 Bacteria 5388
695 Ga0395901_0077396 3300038443 Bacteria 3471
696 Ga0395901_0084660 3300038443 Bacteria 3314
697 Ga0395901_0147974 3300038443 Bacteria 2468
698 Ga0395901_0248712 3300038443 Bacteria 1853
699 Ga0395901_0412435 3300038443 Bacteria 1386
700 Ga0395901_0461686 3300038443 Bacteria 1297
701 Ga0436361_0029532 3300039447 Bacteria 33847
702 Ga0436361_0156800 3300039447 Bacteria 2962
703 Ga0436361_0238975 3300039447 Bacteria 15801
704 Ga0436361_0590566 3300039447 Bacteria 41611
705 Ga0436361_0639219 3300039447 Bacteria 17192
706 Ga0439436_0000671 3300041404 Bacteria 9170
707 Ga0439436_0041755 3300041404 Bacteria 1312
708 Ga0439439_0003700 3300041406 Bacteria 3392
709 Ga0439447_023660 3300041407 Bacteria 1598
710 Ga0439466_0007543 3300041411 Bacteria 4114
711 Ga0439466_0015358 3300041411 Bacteria 2781
712 Ga0439466_0042395 3300041411 Bacteria 1515
713 Ga0439465_0001721 3300041413 Bacteria 7151
714 Ga0451791_1388555 3300041451 Bacteria 1351
715 Ga0451798_1168222 3300041458 Bacteria 3626
716 Ga0451800_0278107 3300041459 Bacteria 2246
717 Ga0451807_0916476 3300041486 Bacteria 3761
718 Ga0451807_1124865 3300041486 Bacteria 2590
719 Ga0451807_2022197 3300041486 Bacteria 3281
720 Ga0451807_2292674 3300041486 Bacteria 1097
721 Ga0451853_2190404 3300041512 Bacteria 933
722 Ga0439431_0000100 3300041997 Bacteria 14455
723 Ga0439433_0001551 3300041999 Bacteria 4759
724 Ga0439445_0002091 3300042004 Bacteria 4423
725 Ga0439432_001822 3300042006 Bacteria 7997
726 Ga0439432_003167 3300042006 Bacteria 6119
727 Ga0439449_0000187 3300042007 Bacteria 21694
728 Ga0439449_0001945 3300042007 Bacteria 8119
729 Ga0439452_001407 3300042010 Bacteria 9899
730 Ga0439457_002640 3300042014 Bacteria 5061
731 Ga0439462_0003997 3300042015 Bacteria 3573
732 Ga0439462_0004629 3300042015 Bacteria 3363
733 Ga0450923_036402 3300042125 Bacteria 1021
734 Ga0450906_004435 3300042145 Bacteria 2943
735 Ga0450907_002830 3300042146 Bacteria 3210
736 Ga0439446_0022410 3300042156 Bacteria 1791
737 Ga0450918_006860 3300042531 Bacteria 2023
738 Ga0451577_0000190 3300042876 Bacteria 130692
739 Ga0451577_0011527 3300042876 Bacteria 8355
740 Ga0451577_0153391 3300042876 Bacteria 2073
741 Ga0451577_0461822 3300042876 Bacteria 1153
742 Ga0466969_0043122 3300044656 Bacteria 2248
743 Ga0466972_0077025 3300044658 Bacteria 1588
744 Ga0453683_0165061 3300044673 Bacteria 1401
745 Ga0466965_0004099 3300044683 Bacteria 6470
746 Ga0466961_0040397 3300044693 Bacteria 2991
747 Ga0466964_0105129 3300044706 Bacteria 1251
748 Ga0453684_0000618 3300044712 Bacteria 129995
749 Ga0453684_0060318 3300044712 Bacteria 4880
750 Ga0466960_0043098 3300044901 Bacteria 2145
751 Ga0466959_0059135 3300045049 Bacteria 2791
752 Ga0451576_0001628 3300045051 Bacteria 37621
753 Ga0451576_0012621 3300045051 Bacteria 9484
754 Ga0451576_0042289 3300045051 Bacteria 4811
755 Ga0451576_0636603 3300045051 Bacteria 1120
756 Ga0466958_0191872 3300045836 Bacteria 1299
757 Ga0495617_000062 3300046452 Bacteria 96803
758 Ga0495627_000001 3300046453 Bacteria 1104709
759 Ga0495627_005576 3300046453 Bacteria 5043
760 Ga0495590_0029686 3300046457 Bacteria 1916
761 Ga0495651_0438848 3300046462 Bacteria 846
762 Ga0495653_0000040 3300046463 Bacteria 119794
763 Ga0495650_0000066 3300046471 Bacteria 272883
764 Ga0495650_0000490 3300046471 Bacteria 60177
765 Ga0495650_0009333 3300046471 Bacteria 5590
766 Ga0495605_0000038 3300046474 Bacteria 197063
767 Ga0495639_0006365 3300046475 Bacteria 5075
768 Ga0495585_0001127 3300046492 Bacteria 21917
769 Ga0495607_0002281 3300046501 Bacteria 15782
770 Ga0495606_0000053 3300046507 Bacteria 200818
771 Ga0495606_0005433 3300046507 Bacteria 12208
772 Ga0495610_0003853 3300046512 Bacteria 11404
773 Ga0495610_0008611 3300046512 Bacteria 6580
774 Ga0495610_0048160 3300046512 Bacteria 2093
775 Ga0495616_0002528 3300046513 Bacteria 12090
776 Ga0495620_0033706 3300046515 Bacteria 2322
777 Ga0495631_0000553 3300046518 Bacteria 25076
778 Ga0495637_0002453 3300046520 Bacteria 10248
779 Ga0495637_0034641 3300046520 Bacteria 2209
780 Ga0495643_0025602 3300046522 Bacteria 3337
781 Ga0495643_0049397 3300046522 Bacteria 2269
782 Ga0495644_0006844 3300046523 Bacteria 4415
783 Ga0495648_0001319 3300046524 Bacteria 24588
784 Ga0495654_0005029 3300046530 Bacteria 7754
785 Ga0495654_0008030 3300046530 Bacteria 5857
786 Ga0495654_0238618 3300046530 Bacteria 762
787 Ga0495621_0008885 3300046539 Bacteria 3029
788 Ga0495597_0000084 3300046542 Bacteria 83344
789 Ga0495633_0001809 3300046558 Bacteria 15760
790 Ga0495633_0003312 3300046558 Bacteria 10827
791 Ga0495633_0017218 3300046558 Bacteria 3703
792 Ga0495633_0027071 3300046558 Bacteria 2806
793 Ga0495633_0038262 3300046558 Bacteria 2292
794 Ga0495656_0000121 3300046615 Bacteria 30144
795 Ga0495656_0009845 3300046615 Bacteria 3452
796 Ga0495668_0000027 3300046616 Bacteria 297194
797 Ga0495668_0000391 3300046616 Bacteria 57845
798 Ga0495668_0012882 3300046616 Bacteria 4951
799 Ga0495625_0001055 3300046660 Bacteria 36138
800 Ga0495625_0022600 3300046660 Bacteria 4819
801 Ga0495625_0028814 3300046660 Bacteria 4159
802 Ga0495625_0035272 3300046660 Bacteria 3688
803 Ga0495625_0140537 3300046660 Bacteria 1629
804 Ga0495661_0053592 3300046665 Bacteria 2425
805 Ga0495588_0023569 3300046674 Bacteria 3049
806 Ga0495588_0026817 3300046674 Bacteria 2877
807 Ga0495658_0326044 3300046683 Bacteria 974
808 Ga0495613_0133522 3300046689 Bacteria 1777
809 Ga0495670_0173846 3300046691 Bacteria 1135
810 Ga0495671_0004658 3300046692 Bacteria 8125
811 Ga0495671_0020440 3300046692 Bacteria 3488
812 Ga0495671_0335394 3300046692 Bacteria 726
813 Ga0495672_0194142 3300047320 Bacteria 1019
814 Ga0495676_0072538 3300047321 Bacteria 2643
815 Ga0495683_0078230 3300047323 Bacteria 1616
816 Ga0495677_0074250 3300047445 Bacteria 1269
817 Ga0495679_006210 3300047446 Bacteria 5180
818 Ga0495673_0000050 3300047469 Bacteria 262267
819 Ga0495681_0007628 3300047470 Bacteria 6882
820 Ga0495686_0000109 3300047472 Bacteria 171482
821 Ga0496101_0052138 3300048904 Bacteria 2949
822 Ga0496102_0016736 3300048905 Bacteria 6413
823 Ga0496102_0172685 3300048905 Bacteria 2035
824 Ga0496102_0335597 3300048905 Bacteria 1424
825 Ga0496104_0008779 3300048907 Bacteria 8985
826 Ga0496104_0347376 3300048907 Bacteria 1396
827 Ga0496105_0001858 3300048908 Bacteria 15129
828 Ga0496106_0105969 3300048909 Bacteria 2185
829 Ga0496108_0060181 3300048911 Bacteria 3195
830 Ga0496110_0094925 3300048913 Bacteria 2670
831 Ga0496110_0640608 3300048913 Bacteria 962
832 Ga0496113_0180135 3300048916 Bacteria 1675
833 Ga0496113_0480732 3300048916 Bacteria 998
834 Ga0496114_0066443 3300048917 Bacteria 3023
835 Ga0496114_0320886 3300048917 Bacteria 1369
836 Ga0496114_0610368 3300048917 Bacteria 961
837 Ga0496114_0735059 3300048917 Bacteria 864
838 Ga0496116_0015944 3300048919 Bacteria 5909
839 Ga0496117_0021939 3300048920 Bacteria 5140
840 Ga0496118_0005839 3300048921 Bacteria 13800
841 Ga0496118_0085577 3300048921 Bacteria 2194
842 Ga0496121_0029926 3300048924 Bacteria 5016
843 Ga0496122_0000204 3300048925 Bacteria 132123
844 Ga0496122_0015228 3300048925 Bacteria 7359
845 Ga0496122_0044655 3300048925 Bacteria 3455
846 Ga0496122_0125188 3300048925 Bacteria 1647
847 Ga0496123_0001226 3300048926 Bacteria 37377
848 Ga0496124_0052926 3300048927 Bacteria 3446
849 Ga0496124_0151506 3300048927 Bacteria 1818
850 Ga0496124_0181310 3300048927 Bacteria 1620
851 Ga0496124_0190789 3300048927 Bacteria 1568
852 Ga0496125_0001189 3300048928 Bacteria 39370
853 Ga0496125_0008337 3300048928 Bacteria 10873
854 Ga0496125_0066122 3300048928 Bacteria 2859
855 Ga0496125_0242219 3300048928 Bacteria 1144
856 Ga0495678_000009 3300049459 Bacteria 373806
857 Ga0501031_0011864 3300049568 Bacteria 5680
858 Ga0501036_0787106 3300049572 Bacteria 784
859 Ga0501038_0132238 3300049574 Bacteria 2047
860 Ga0501039_0020825 3300049575 Bacteria 5027
861 Ga0501039_0403201 3300049575 Bacteria 1074
862 Ga0501040_0011533 3300049576 Bacteria 5785
863 Ga0501041_0004462 3300049577 Bacteria 8102
864 Ga0501042_0237963 3300049578 Bacteria 1314
865 Ga0501042_0481885 3300049578 Bacteria 900
866 Ga0501043_0126494 3300049579 Bacteria 2004
867 Ga0501046_0071336 3300049580 Bacteria 2699
868 Ga0501046_0115619 3300049580 Bacteria 2045
869 Ga0501047_0152492 3300049581 Bacteria 2186
870 Ga0501047_0156133 3300049581 Bacteria 2155
871 Ga0501048_0011356 3300049582 Bacteria 6642
872 Ga0501068_0459628 3300049584 Bacteria 824
873 Ga0501071_0005717 3300049587 Bacteria 8021
874 Ga0501072_0004661 3300049588 Bacteria 10438
875 Ga0501072_0239100 3300049588 Bacteria 1446
876 Ga0501073_0002899 3300049589 Bacteria 12868
877 Ga0501074_0017705 3300049590 Bacteria 5175
878 Ga0501074_0063972 3300049590 Bacteria 2649
879 Ga0501075_0001298 3300049591 Bacteria 16202
880 Ga0501075_0245506 3300049591 Bacteria 1365
881 Ga0501076_0015872 3300049592 Bacteria 5699
882 Ga0501076_0285150 3300049592 Bacteria 1353
883 Ga0501077_0113376 3300049593 Bacteria 1719
884 Ga0501077_0376801 3300049593 Bacteria 906
885 Ga0501240_006489 3300049673 Bacteria 1440
886 Ga0501249_000812 3300049679 Bacteria 6941
887 Ga0501225_0004613 3300049705 Bacteria 4100
888 Ga0501079_0002520 3300049741 Bacteria 13296
889 Ga0501079_0387063 3300049741 Bacteria 1096
890 Ga0501080_0016685 3300049742 Bacteria 6781
891 Ga0501080_0058403 3300049742 Bacteria 3591
892 Ga0501080_0136559 3300049742 Bacteria 2269
893 Ga0501081_0000822 3300049743 Bacteria 18357
894 Ga0501081_0057009 3300049743 Bacteria 2701
895 Ga0501081_0084765 3300049743 Bacteria 2223
896 Ga0501262_000060 3300049759 Bacteria 13272
897 Ga0501269_000140 3300049766 Bacteria 22530
898 Ga0501035_0039403 3300049822 Bacteria 4276
899 Ga0501035_0147918 3300049822 Bacteria 2039
900 Ga0501044_0379629 3300049823 Bacteria 1328
901 Ga0501045_0001293 3300049824 Bacteria 16600
902 nmdc:mga03683_7466_c1 3300050489 Bacteria 3795
903 nmdc:mga03n38_16473_c1 3300050490 Bacteria 2875
904 nmdc:mga03n38_171943_c1 3300050490 Bacteria 1104
905 nmdc:mga00v17_19714_c1 3300050491 Bacteria 3856
906 nmdc:mga0yw44_657_c1 3300050492 Bacteria 12590
907 nmdc:mga0k408_197065_c1 3300050493 Bacteria 887
908 nmdc:mga0k408_20674_c1 3300050493 Bacteria 3691
909 nmdc:mga0k408_2786_c1 3300050493 Bacteria 9288
910 nmdc:mga0k408_45435_c1 3300050493 Bacteria 2534
911 nmdc:mga0k408_74462_c1 3300050493 Bacteria 1984
912 nmdc:mga07m45_14640_c1 3300050496 Bacteria 4183
913 nmdc:mga07m45_204011_c1 3300050496 Bacteria 1150
914 nmdc:mga07m45_280_c1 3300050496 Bacteria 20436
915 nmdc:mga07m45_32762_c1 3300050496 Bacteria 2882
916 nmdc:mga07m45_32795_c1 3300050496 Bacteria 2881
917 nmdc:mga07m45_5201_c1 3300050496 Bacteria 6453
918 nmdc:mga05p37_431_c1 3300050507 Bacteria 45404
919 nmdc:mga09592_123241_c1 3300050508 Bacteria 2227
920 nmdc:mga09592_12862_c1 3300050508 Bacteria 6823
921 nmdc:mga0qj67_642358_c1 3300050509 Bacteria 847
922 nmdc:mga06r32_180990_c1 3300050510 Bacteria 2093
923 nmdc:mga06r32_6296_c1 3300050510 Bacteria 10657
924 nmdc:mga0rr50_786511_c1 3300050513 Bacteria 812
925 nmdc:mga0a205_322542_c1 3300050515 Bacteria 1415
926 Ga0500643_013702 3300053087 Bacteria 2851
927 Ga0500651_0000137 3300053093 Bacteria 45846
928 Ga0500571_000067 3300053110 Bacteria 32699
929 Ga0500593_000653 3300053117 Bacteria 13237
930 Ga0500594_0002600 3300053118 Bacteria 3921
931 Ga0500607_004251 3300053121 Bacteria 9966
932 Ga0500608_071729 3300053122 Bacteria 1646
933 Ga0500658_0016126 3300053134 Bacteria 2781
934 Ga0500559_0001487 3300053136 Bacteria 13220
935 Ga0500559_0001525 3300053136 Bacteria 12983
936 Ga0500559_0062863 3300053136 Bacteria 1658
937 Ga0500568_0014757 3300053139 Bacteria 3516
938 Ga0500574_033640 3300053141 Bacteria 1394
939 Ga0500586_002357 3300053145 Bacteria 4239
940 Ga0500627_0000290 3300053158 Bacteria 14042
941 Ga0500645_000983 3300053730 Bacteria 16109
942 Ga0501084_0179431 3300054114 Bacteria 1787
943 Ga0590071_010584 3300059421 Bacteria 2158
944 Ga0501082_0001941 3300060353 Bacteria 18202
945 Ga0501082_0116684 3300060353 Bacteria 2312
946 Ga0501082_0232877 3300060353 Bacteria 1603
947 Ga0466962_0126800 3300061719 Bacteria 1233
948 Ga0530510_0002234 3300061734 Bacteria 13276
949 2511244592 2511231002 Bacteria 5042903
950 2513231056 2513020051 Bacteria 6053213
951 2548498989 2547132374 Bacteria 5530232
952 2599623369 2599185214 Bacteria 8209958
953 2599675413 2599185226 Bacteria 8233575
954 2599680974 2599185227 Bacteria 8246414
955 2599692989 2599185229 Bacteria 8216126
956 2643867798 2643221570 Bacteria 5103772
957 2643991662 2643221596 Bacteria 5006805
958 2644062160 2643221609 Bacteria 6756331
959 2644071348 2643221611 Bacteria 6820941
960 2644161868 2643221628 Bacteria 5745828
961 2644293407 2643221652 Bacteria 5140275
962 2644325530 2643221658 Bacteria 6064537
963 2644399254 2643221672 Bacteria 6322190
964 2644467064 2643221683 Bacteria 5749203
965 2644648446 2643221717 Bacteria 5676132
966 2722882015 2721755523 Bacteria 6430384
967 2738718221 2738541277 Bacteria 7458140
968 2738880389 2738541307 Bacteria 8606193
969 2739246510 2738543012 Bacteria 7115078
970 2739248303 2738543013 Bacteria 5618633
971 2739281408 2738543019 Bacteria 7459457
972 2816476308 2816332133 Bacteria 7249298
973 2819600545 2818991446 Bacteria 7757362
974 2831267729 2831265667 Bacteria 7184833
975 2838061543 2838054893 Bacteria 7451788
976 2842677555 2842677519 Bacteria 5615038
977 2842718756 2842718218 Bacteria 4560148
978 2842736337 2842733646 Bacteria 5716726
979 2842748845 2842747753 Bacteria 5578255
980 2857556982 2857553236 Bacteria 6166726
981 2857560065 2857558681 Bacteria 6617694
982 2881103019 2881101125 Bacteria 4590519
983 2885196910 2885192300 Bacteria 5882526
984 2885198801 2885198086 Bacteria 7212419
985 2885211819 2885211737 Bacteria 7212420
986 2894024373 2894023352 Bacteria 5167372
987 2899928308 2899924645 Bacteria 7487985
988 2904424461 2904424332 Bacteria 7633521
989 2904451845 2904449895 Bacteria 6927402
990 2904462498 2904456579 Bacteria 6819253
991 2904479743 2904479285 Bacteria 5073931
992 2904545100 2904541872 Bacteria 8915136
993 2919467171 2919462493 Bacteria 5817112
994 2919477831 2919476304 Bacteria 5888696
995 2919707161 2919704043 Bacteria 5560311
996 2928041260 2928037797 Bacteria 7273642
997 2928048102 2928044640 Bacteria 7271509
998 2928055943 2928051484 Bacteria 7773759
999 2928066576 2928064002 Bacteria 7419480
1000 2928077270 2928070936 Bacteria 8062541
1001 2928087571 2928084124 Bacteria 7159212
1002 2928120692 2928115317 Bacteria 6477646
1003 2929165278 2929160207 Bacteria 9075316
1004 2929523611 2929520902 Bacteria 6765052
1005 2932426407 2932422444 Bacteria 4678430
1006 2939634195 2939631187 Bacteria 6118131
1007 2945910118 2945909444 Bacteria 7065066
1008 2945946147 2945945610 Bacteria 5951079
1009 2945975747 2945972063 Bacteria 6086495
1010 2945987866 2945984333 Bacteria 7358892
1011 2954768803 2954767861 Bacteria 5535784
1012 2974320360 2974320154 Bacteria 4571377
1013 2990713892 2990710928 Bacteria 5002431
1014 2998346649 2998344455 Bacteria 4222996
1015 8055226858 8055225921 Bacteria 3341787
1016 Ga0105239_10503601
1017 SwRhRL2b_contig_1402350
1018 SwRhRL2b_contig_2016154
1019 JGI25155J39150_1000022
1020 JGI25156J39149_1000005
1021 JGI25154J39366_1000017
1022 JGI25154J39366_1000144
1023 JGI25158J39367_1000189
1024 JGI25158J39367_1009433
1025 JGI25157J39369_1000003
1026 JGI25152J39213_1001945
1027 JGI25152J39213_1002156
1028 JGI25150J39212_1007317
1029 JGI25150J39212_1010993
1030 JGI25159J45721_1000650
1031 JGI25159J45721_1001946
1032 JGI25159J45721_1015778
1033 JGI25159J45721_1015855
1034 JGI25159J45721_1018585
1035 JGI25151J46595_10012722
1036 JGI25151J46595_10020736
1037 JGI25151J46595_10028883
1038 JGI25153J46596_10024047
1039 JGI25153J46596_10025225
1040 rootH1_10011772
1041 JGI25160J50197_1000930
1042 JGI25160J50197_1001567
1043 JGI25160J50197_1002666
1044 JGI25160J50197_1006098
1045 JGI25161J50226_1000149
1046 JGI25161J50226_1000313
1047 JGI25161J50226_1000585
1048 JGI25161J50226_1005639
1049 JGI25161J50226_1008040
1050 Ga0055532_1013860
1051 Ga0055535_1000380
1052 Ga0055542_1000062
1053 Ga0055526_1001764
1054 Ga0055526_1021860
1055 Ga0055526_1021878
1056 Ga0055537_1000115
1057 Ga0055537_1000550
1058 Ga0055537_1009201
1059 Ga0055537_1017640
1060 Ga0055524_1000073
1061 Ga0055524_1012450
1062 Ga0055524_1020728
1063 Ga0055524_1020750
1064 Ga0055534_1000106
1065 Ga0055534_1000548
1066 Ga0055534_1003985
1067 Ga0055528_1001098
1068 Ga0055528_1001361
1069 Ga0055528_1006025
1070 Ga0055528_1009609
1071 Ga0055528_1019860
1072 Ga0055530_10000208
1073 Ga0055530_10002623
1074 Ga0055530_10004408
1075 Ga0055540_1000037
1076 Ga0055540_1005690
1077 Ga0055540_1037074
1078 Ga0055531_10000112
1079 Ga0055531_10001068
1080 Ga0055543_1000989
1081 Ga0055543_1001481
1082 Ga0055543_1002029
1083 Ga0065165_1002493
1084 Ga0065165_1004528
1085 Ga0065714_10017201
1086 Ga0065704_10203129
1087 Ga0065707_10186626
1088 Ga0070658_10138120
1089 Ga0070676_10399620
1090 Ga0070690_100007433
1091 Ga0070670_100216731
1092 Ga0070677_10015440
1093 Ga0068869_100016076
1094 Ga0068869_100212014
1095 Ga0068869_100552227
1096 Ga0070666_10136438
1097 Ga0070680_100016548
1098 Ga0070682_100011151
1099 Ga0070682_100084353
1100 Ga0070682_100207963
1101 Ga0070682_100237827
1102 Ga0068868_100021692
1103 Ga0068868_100430108
1104 Ga0070660_100051782
1105 Ga0070689_100005263
1106 Ga0070687_100093927
1107 Ga0070687_100121794
1108 Ga0070661_100013863
1109 Ga0070668_100237889
1110 Ga0070669_100022797
1111 Ga0070669_100409321
1112 Ga0070669_100741306
1113 Ga0070675_100050998
1114 Ga0070675_100052126
1115 Ga0070675_100362763
1116 Ga0070671_100007502
1117 Ga0070671_100589781
1118 Ga0070671_100629012
1119 Ga0070674_100006311
1120 Ga0070674_100028647
1121 Ga0070674_100198255
1122 Ga0070674_100425286
1123 Ga0070673_100056176
1124 Ga0070673_100064348
1125 Ga0070673_100114607
1126 Ga0070688_100055598
1127 Ga0070659_100214534
1128 Ga0070667_100077315
1129 Ga0070667_100241803
1130 Ga0070714_100060331
1131 Ga0070713_100141594
1132 Ga0070710_10075900
1133 Ga0070701_10006937
1134 Ga0070705_100003004
1135 Ga0070708_100619376
1136 Ga0070663_100088579
1137 Ga0070663_100296265
1138 Ga0070663_100545097
1139 Ga0070678_100080167
1140 Ga0070678_100294870
1141 Ga0070662_100057064
1142 Ga0070681_10045978
1143 Ga0068867_100027638
1144 Ga0068867_100036057
1145 Ga0070685_10195098
1146 Ga0070707_100729450
1147 Ga0070679_100013640
1148 Ga0070679_100090124
1149 Ga0070679_100137837
1150 Ga0068853_100002881
1151 Ga0068853_100083361
1152 Ga0070672_100002831
1153 Ga0070672_100005868
1154 Ga0070686_100501226
1155 Ga0070695_100262449
1156 Ga0070695_100368482
1157 Ga0070693_100032239
1158 Ga0070665_100006246
1159 Ga0070665_100157260
1160 Ga0070665_100260552
1161 Ga0070704_100005740
1162 Ga0070704_100005983
1163 Ga0070704_100180796
1164 Ga0070704_100254427
1165 Ga0068855_100019841
1166 Ga0068855_100034189
1167 Ga0068855_100144671
1168 Ga0068855_100180509
1169 Ga0068855_100270975
1170 Ga0068855_100663650
1171 Ga0070664_100043542
1172 Ga0070664_100094714
1173 Ga0070664_100418508
1174 Ga0068857_100009157
1175 Ga0068857_100119025
1176 Ga0068857_100120477
1177 Ga0068857_100199963
1178 Ga0070702_100064882
1179 Ga0070702_100283931
1180 Ga0070702_100341742
1181 Ga0068859_100009359
1182 Ga0068859_100010146
1183 Ga0068859_100024887
1184 Ga0068859_100130039
1185 Ga0068859_100318625
1186 Ga0068859_100962127
1187 Ga0068864_100023476
1188 Ga0068864_100087026
1189 Ga0068861_100004581
1190 Ga0068861_100011094
1191 Ga0068861_100092058
1192 Ga0068861_100198208
1193 Ga0068861_100647478
1194 Ga0068851_10021066
1195 Ga0068870_10408991
1196 Ga0068870_10446120
1197 Ga0068863_100568865
1198 Ga0068863_100611553
1199 Ga0068858_100067629
1200 Ga0068858_100175815
1201 Ga0068860_100495222
1202 Ga0068860_100623850
1203 Ga0068862_100118010
1204 Ga0068862_100127057
1205 Ga0068862_100178378
1206 Ga0068862_100247278
1207 Ga0081455_10037259
1208 Ga0075365_10024848
1209 Ga0075365_10042604
1210 Ga0075365_10087948
1211 Ga0075365_10135602
1212 Ga0075368_10087877
1213 Ga0075363_100022242
1214 Ga0075363_100033700
1215 Ga0075363_100066964
1216 Ga0075364_10059236
1217 Ga0075364_10189855
1218 Ga0075432_10053093
1219 Ga0070716_100255625
1220 Ga0070716_100544251
1221 Ga0075362_10013111
1222 Ga0075362_10020802
1223 Ga0075362_10082839
1224 Ga0075362_10174804
1225 Ga0075367_10071834
1226 Ga0075367_10120386
1227 Ga0075366_10003634
1228 Ga0075366_10010511
1229 Ga0075366_10024337
1230 Ga0075366_10029646
1231 Ga0075366_10033780
1232 Ga0075366_10056551
1233 Ga0097621_100003874
1234 Ga0097621_100022479
1235 Ga0097621_100075499
1236 Ga0097621_100141131
1237 Ga0097621_100481497
1238 Ga0075370_10000173
1239 Ga0075370_10001174
1240 Ga0075370_10005920
1241 Ga0075370_10041933
1242 Ga0075370_10104888
1243 Ga0068871_100014949
1244 Ga0068871_100095416
1245 Ga0068871_100098501
1246 Ga0068871_100176867
1247 Ga0075428_100470111
1248 Ga0075430_100709808
1249 Ga0075431_100003033
1250 Ga0075431_100182381
1251 Ga0075431_100236394
1252 Ga0075433_10205070
1253 Ga0075429_100037613
1254 Ga0075429_100198395
1255 Ga0068865_100035518
1256 Ga0068865_100268078
1257 Ga0068865_100410657
1258 Ga0068865_100568847
1259 Ga0097620_100009359
1260 Ga0097620_100010146
1261 Ga0097620_100024885
1262 Ga0097620_100130042
1263 Ga0097620_100318616
1264 Ga0097620_100962093
1265 Ga0079104_1016655
1266 Ga0079104_1032012
1267 Ga0099826_10001074
1268 Ga0099826_10075973
1269 Ga0075435_100050112
1270 Ga0105244_10010540
1271 Ga0105244_10027073
1272 Ga0105244_10034661
1273 Ga0105250_10009033
1274 Ga0105240_10019143
1275 Ga0105240_10050951
1276 Ga0105240_10279500
1277 Ga0111539_10211864
1278 Ga0111539_10363843
1279 Ga0105245_10021354
1280 Ga0105245_10095634
1281 Ga0105247_10037710
1282 Ga0114129_10003978
1283 Ga0105243_10007519
1284 Ga0105243_10045436
1285 Ga0105243_10477806
1286 Ga0105241_10087578
1287 Ga0105241_10110465
1288 Ga0105241_10146216
1289 Ga0105242_10002049
1290 Ga0105242_10149425
1291 Ga0105242_10152839
1292 Ga0105242_10286462
1293 Ga0105242_10539499
1294 Ga0105248_10019781
1295 Ga0105248_10126716
1296 Ga0105248_10578635
1297 Ga0105248_10693244
1298 Ga0105248_10914916
1299 Ga0105237_10009912
1300 Ga0105237_10083558
1301 Ga0105237_10104620
1302 Ga0105237_10177031
1303 Ga0105237_10461792
1304 Ga0105238_10043012
1305 Ga0105238_10922267
1306 Ga0105249_10075446
1307 Ga0105249_10278839
1308 Ga0105246_10057478
1309 Ga0157347_1005329
1310 Ga0157326_1001774
1311 Ga0157373_10053917
1312 Ga0157373_10258558
1313 Ga0157371_10008532
1314 Ga0157370_10281202
1315 Ga0157369_10001065
1316 Ga0157369_10009756
1317 Ga0157374_10013287
1318 Ga0157374_10282129
1319 Ga0157378_10061821
1320 Ga0157378_10178612
1321 Ga0163162_10117764
1322 Ga0163162_10240370
1323 Ga0163162_10580521
1324 Ga0163162_10603825
1325 Ga0157372_10094772
1326 Ga0157372_10321073
1327 Ga0157375_10005957
1328 Ga0157375_10008046
1329 Ga0157375_10058883
1330 Ga0157375_10091318
1331 Ga0157375_10645035
1332 Ga0163163_10042648
1333 Ga0163163_10221264
1334 Ga0163163_10713147
1335 Ga0163163_11212894
1336 Ga0157380_10047417
1337 Ga0157380_10336233
1338 Ga0182008_10000070
1339 Ga0182008_10001756
1340 Ga0182008_10009040
1341 Ga0182008_10316386
1342 Ga0157376_10002739
1343 Ga0157376_10005883
1344 Ga0157376_10144651
1345 Ga0157376_10180141
1346 Ga0157376_11151779
1347 Ga0182006_1000008
1348 Ga0182006_1000705
1349 Ga0182006_1022284
1350 Ga0182006_1164331
1351 Ga0182007_10000289
1352 Ga0182007_10000957
1353 Ga0182007_10019104
1354 Ga0182005_1000008
1355 Ga0183362_10003
1356 Ga0163161_10000397
1357 Ga0163161_10026189
1358 Ga0163161_10056442
1359 Ga0163161_10154304
1360 Ga0163161_10530656
1361 Ga0163161_10667984
1362 Ga0213872_10000229
1363 Ga0213872_10001024
1364 Ga0213872_10011565
1365 Ga0213872_10256532
1366 Ga0209435_100002
1367 Ga0209436_100643
1368 Ga0209436_113364
1369 Ga0209436_114320
1370 Ga0209672_101806
1371 Ga0209147_101183
1372 Ga0209437_109416
1373 Ga0209258_100154
1374 Ga0207425_1000855
1375 Ga0207425_1001326
1376 Ga0207425_1001372
1377 Ga0207425_1003411
1378 Ga0209646_1000001
1379 Ga0209026_1000001
1380 Ga0209148_1000145
1381 Ga0209759_1000001
1382 Ga0209129_1000054
1383 Ga0209129_1004503
1384 Ga0209129_1005389
1385 Ga0209565_1000067
1386 Ga0209565_1000143
1387 Ga0209565_1000185
1388 Ga0209565_1000989
1389 Ga0209565_1001534
1390 Ga0209565_1009915
1391 Ga0209673_1000008
1392 Ga0209673_1000097
1393 Ga0209673_1000172
1394 Ga0209673_1001768
1395 Ga0209673_1003839
1396 Ga0209673_1003964
1397 Ga0209673_1014525
1398 Ga0209130_1000072
1399 Ga0209130_1000315
1400 Ga0209130_1001009
1401 Ga0209130_1001241
1402 Ga0209130_1001470
1403 Ga0209130_1009689
1404 Ga0209675_1000038
1405 Ga0209675_1000221
1406 Ga0209675_1001078
1407 Ga0209675_1001255
1408 Ga0209675_1001715
1409 Ga0209675_1004900
1410 Ga0209675_1007021
1411 Ga0209675_1053946
1412 Ga0209676_1000023
1413 Ga0209676_1000103
1414 Ga0209676_1003243
1415 Ga0209676_1005918
1416 Ga0209025_1000185
1417 Ga0209025_1000310
1418 Ga0209025_1000474
1419 Ga0209025_1005757
1420 Ga0209025_1008072
1421 Ga0209025_1010766
1422 Ga0209025_1011168
1423 Ga0209025_1032874
1424 Ga0209564_1000241
1425 Ga0209564_1000435
1426 Ga0209564_1000998
1427 Ga0209564_1001015
1428 Ga0209564_1002789
1429 Ga0209564_1006273
1430 Ga0209564_1017907
1431 Ga0209758_1000034
1432 Ga0209758_1006876
1433 Ga0209758_1009936
1434 Ga0209758_1019858
1435 Ga0209050_1000012
1436 Ga0209050_1000022
1437 Ga0209050_1000294
1438 Ga0209050_1000331
1439 Ga0209050_1002640
1440 Ga0209050_1004039
1441 Ga0209050_1020673
1442 Ga0209256_1000001
1443 Ga0209256_1000103
1444 Ga0209256_1000165
1445 Ga0209256_1012906
1446 Ga0209256_1059198
1447 Ga0207426_1000058
1448 Ga0207426_1000067
1449 Ga0207426_1000319
1450 Ga0207426_1001869
1451 Ga0207426_1013619
1452 Ga0209051_1000013
1453 Ga0209051_1000019
1454 Ga0209051_1000235
1455 Ga0209051_1000384
1456 Ga0209051_1001048
1457 Ga0209051_1009408
1458 Ga0209257_1000024
1459 Ga0209257_1000042
1460 Ga0209257_1000057
1461 Ga0209257_1000096
1462 Ga0209257_1003704
1463 Ga0209257_1003751
1464 Ga0209257_1019286
1465 Ga0209257_1021246
1466 Ga0207696_1016922
1467 Ga0207655_1005464
1468 Ga0207655_1029791
1469 Ga0207655_1059468
1470 Ga0207653_10027468
1471 Ga0207653_10117189
1472 Ga0207682_10005463
1473 Ga0207647_10174666
1474 Ga0207645_10092517
1475 Ga0207645_10478598
1476 Ga0207643_10122208
1477 Ga0207643_10171425
1478 Ga0207705_10064625
1479 Ga0207705_10108363
1480 Ga0207654_10068895
1481 Ga0207654_10181297
1482 Ga0207654_10188424
1483 Ga0207707_10100711
1484 Ga0207707_10327577
1485 Ga0207695_10075662
1486 Ga0207695_10085778
1487 Ga0207695_10209779
1488 Ga0207671_10077564
1489 Ga0207671_10210187
1490 Ga0207663_10154267
1491 Ga0207660_10020778
1492 Ga0207662_10192222
1493 Ga0207657_10015595
1494 Ga0207649_10061832
1495 Ga0207649_10135937
1496 Ga0207649_10254180
1497 Ga0207652_10028089
1498 Ga0207652_10036453
1499 Ga0207652_10609902
1500 Ga0207681_10460571
1501 Ga0207694_10037143
1502 Ga0207659_10078659
1503 Ga0207687_10027054
1504 Ga0207687_10143351
1505 Ga0207687_10207686
1506 Ga0207687_10291630
1507 Ga0207700_10252369
1508 Ga0207664_10076234
1509 Ga0207690_10139811
1510 Ga0207706_10005566
1511 Ga0207686_10005963
1512 Ga0207709_10000111
1513 Ga0207709_10000215
1514 Ga0207709_10001162
1515 Ga0207709_10076394
1516 Ga0207670_10045023
1517 Ga0207670_10147502
1518 Ga0207669_10127588
1519 Ga0207669_10130545
1520 Ga0207669_10136849
1521 Ga0207669_10317421
1522 Ga0207704_10067668
1523 Ga0207704_10122354
1524 Ga0207704_10394062
1525 Ga0207665_10045670
1526 Ga0207691_10002844
1527 Ga0207691_10010164
1528 Ga0207691_10017171
1529 Ga0207711_10018692
1530 Ga0207711_10029734
1531 Ga0207711_10085608
1532 Ga0207711_10707752
1533 Ga0207689_10002020
1534 Ga0207689_10050453
1535 Ga0207689_10067041
1536 Ga0207689_10067948
1537 Ga0207679_10087855
1538 Ga0207679_10356164
1539 Ga0207679_10637737
1540 Ga0207679_10677103
1541 Ga0207667_10020724
1542 Ga0207667_10076109
1543 Ga0207667_10090026
1544 Ga0207667_10227482
1545 Ga0207651_10072029
1546 Ga0207651_10089856
1547 Ga0207712_10555786
1548 Ga0207668_10040482
1549 Ga0207668_10120330
1550 Ga0207668_10127969
1551 Ga0207658_10223900
1552 Ga0207677_10048945
1553 Ga0207677_10059527
1554 Ga0207677_10468082
1555 Ga0207703_10267503
1556 Ga0207639_10012452
1557 Ga0207639_10049758
1558 Ga0207639_10162004
1559 Ga0207639_10412446
1560 Ga0207678_10060361
1561 Ga0207678_10327942
1562 Ga0207708_10083598
1563 Ga0207708_10113725
1564 Ga0207702_10338901
1565 Ga0207641_10091882
1566 Ga0207641_10777469
1567 Ga0207648_10005938
1568 Ga0207648_10020064
1569 Ga0207648_10096831
1570 Ga0207648_10264482
1571 Ga0207676_10033784
1572 Ga0207676_10064529
1573 Ga0207676_10199230
1574 Ga0207676_10760011
1575 Ga0207674_10013170
1576 Ga0207674_10109708
1577 Ga0207674_10199962
1578 Ga0207674_10204531
1579 Ga0207674_10282029
1580 Ga0207675_100003032
1581 Ga0207675_100003943
1582 Ga0207675_100032715
1583 Ga0207675_100065798
1584 Ga0207675_100128997
1585 Ga0207683_10019416
1586 Ga0207683_10112354
1587 Ga0207683_10225217
1588 Ga0207683_10336323
1589 Ga0207698_10155442
1590 Ga0209281_1000007
1591 Ga0209281_1008243
1592 Ga0209970_1000655
1593 Ga0209282_1000613
1594 Ga0209971_1042457
1595 Ga0209974_10047863
1596 Ga0209974_10081460
1597 Ga0207428_10119015
1598 Ga0268266_10036778
1599 Ga0268266_10040237
1600 Ga0268266_10100245
1601 Ga0268266_10791121
1602 Ga0268265_10018587
1603 Ga0268265_10067943
1604 Ga0268265_10186763
1605 Ga0268265_10513659
1606 Ga0268265_10700660
1607 Ga0307515_10000472
1608 Ga0307515_10037959
1609 Ga0316177_1047792
1610 Ga0316177_1195429
1611 Ga0316178_1157584
1612 Ga0316180_1042735
1613 Ga0316180_1079304
1614 Ga0316183_1159521
1615 Ga0316181_1090374
1616 Ga0316181_1169111
1617 Ga0316181_1253489
1618 Ga0316182_1035127
1619 Ga0265330_10000046
1620 Ga0265332_10000028
1621 Ga0265332_10000125
1622 Ga0265329_10019348
1623 Ga0265340_10002618
1624 Ga0265331_10002589
1625 Ga0265327_10000020
1626 Ga0265327_10001288
1627 Ga0265327_10025788
1628 Ga0265327_10063073
1629 Ga0307513_10000064
1630 Ga0307513_10000117
1631 Ga0307513_10024485
1632 Ga0307513_10042007
1633 Ga0307513_10064597
1634 Ga0307513_10080341
1635 Ga0307513_10261893
1636 Ga0307509_10014687
1637 Ga0307509_10040865
1638 Ga0307408_100000101
1639 Ga0307408_100005024
1640 Ga0307408_100067034
1641 Ga0307408_100342619
1642 Ga0307514_10000593
1643 Ga0307514_10041176
1644 Ga0265314_10000054
1645 Ga0265314_10021525
1646 Ga0307516_10000092
1647 Ga0307516_10017630
1648 Ga0307405_10030635
1649 Ga0307405_10164213
1650 Ga0307405_10268788
1651 Ga0307413_10357297
1652 Ga0307406_10000362
1653 Ga0307406_10354778
1654 Ga0307407_10232226
1655 Ga0307407_10534843
1656 Ga0307412_10007228
1657 Ga0307412_10100103
1658 Ga0307412_10101067
1659 Ga0307412_10129011
1660 Ga0307412_10515314
1661 Ga0307409_100014420
1662 Ga0307409_100082462
1663 Ga0307409_100333110
1664 Ga0307416_100077278
1665 Ga0307416_100098557
1666 Ga0307416_100114057
1667 Ga0307416_100210566
1668 Ga0307416_100981510
1669 Ga0307414_10038036
1670 Ga0307414_10306355
1671 Ga0307414_10693265
1672 Ga0307411_10037870
1673 Ga0307411_10068565
1674 Ga0307411_10253418
1675 Ga0307415_100127612
1676 Ga0307415_100139370
1677 Ga0307510_10179066
1678 Ga0373955_0097827
1679 Ga0373924_0120709
1680 Ga0373931_0224067
1681 Ga0373931_0438821
1682 Ga0373935_0637921
1683 Ga0373937_0167611
1684 Ga0373937_0439778
1685 Ga0395899_0001454
1686 Ga0395899_0036017
1687 Ga0395899_0068646
1688 Ga0395899_0149599
1689 Ga0395900_0087200
1690 Ga0395900_0090683
1691 Ga0395900_0118454
1692 Ga0395900_0505353
1693 Ga0395900_0524272
1694 Ga0395898_0027889
1695 Ga0395898_0028865
1696 Ga0395898_0059772
1697 Ga0395898_0080703
1698 Ga0395898_0108760
1699 Ga0395898_0424407
1700 Ga0395905_0000043
1701 Ga0395905_0003965
1702 Ga0395905_0004042
1703 Ga0395905_0006888
1704 Ga0395905_0023252
1705 Ga0395905_0112559
1706 Ga0395905_0125298
1707 Ga0395905_0413399
1708 Ga0395901_0029560
1709 Ga0395901_0032445
1710 Ga0395901_0077396
1711 Ga0395901_0084660
1712 Ga0395901_0147974
1713 Ga0395901_0248712
1714 Ga0395901_0412435
1715 Ga0395901_0461686
1716 Ga0436361_0029532
1717 Ga0436361_0156800
1718 Ga0436361_0238975
1719 Ga0436361_0590566
1720 Ga0436361_0639219
1721 Ga0439436_0000671
1722 Ga0439436_0041755
1723 Ga0439439_0003700
1724 Ga0439447_023660
1725 Ga0439466_0007543
1726 Ga0439466_0015358
1727 Ga0439466_0042395
1728 Ga0439465_0001721
1729 Ga0451791_1388555
1730 Ga0451798_1168222
1731 Ga0451800_0278107
1732 Ga0451807_0916476
1733 Ga0451807_1124865
1734 Ga0451807_2022197
1735 Ga0451807_2292674
1736 Ga0451853_2190404
1737 Ga0439431_0000100
1738 Ga0439433_0001551
1739 Ga0439445_0002091
1740 Ga0439432_001822
1741 Ga0439432_003167
1742 Ga0439449_0000187
1743 Ga0439449_0001945
1744 Ga0439452_001407
1745 Ga0439457_002640
1746 Ga0439462_0003997
1747 Ga0439462_0004629
1748 Ga0450923_036402
1749 Ga0450906_004435
1750 Ga0450907_002830
1751 Ga0439446_0022410
1752 Ga0450918_006860
1753 Ga0451577_0000190
1754 Ga0451577_0011527
1755 Ga0451577_0153391
1756 Ga0451577_0461822
1757 Ga0466969_0043122
1758 Ga0466972_0077025
1759 Ga0453683_0165061
1760 Ga0466965_0004099
1761 Ga0466961_0040397
1762 Ga0466964_0105129
1763 Ga0453684_0000618
1764 Ga0453684_0060318
1765 Ga0466960_0043098
1766 Ga0466959_0059135
1767 Ga0451576_0001628
1768 Ga0451576_0012621
1769 Ga0451576_0042289
1770 Ga0451576_0636603
1771 Ga0466958_0191872
1772 Ga0495617_000062
1773 Ga0495627_000001
1774 Ga0495627_005576
1775 Ga0495590_0029686
1776 Ga0495651_0438848
1777 Ga0495653_0000040
1778 Ga0495650_0000066
1779 Ga0495650_0000490
1780 Ga0495650_0009333
1781 Ga0495605_0000038
1782 Ga0495639_0006365
1783 Ga0495585_0001127
1784 Ga0495607_0002281
1785 Ga0495606_0000053
1786 Ga0495606_0005433
1787 Ga0495610_0003853
1788 Ga0495610_0008611
1789 Ga0495610_0048160
1790 Ga0495616_0002528
1791 Ga0495620_0033706
1792 Ga0495631_0000553
1793 Ga0495637_0002453
1794 Ga0495637_0034641
1795 Ga0495643_0025602
1796 Ga0495643_0049397
1797 Ga0495644_0006844
1798 Ga0495648_0001319
1799 Ga0495654_0005029
1800 Ga0495654_0008030
1801 Ga0495654_0238618
1802 Ga0495621_0008885
1803 Ga0495597_0000084
1804 Ga0495633_0001809
1805 Ga0495633_0003312
1806 Ga0495633_0017218
1807 Ga0495633_0027071
1808 Ga0495633_0038262
1809 Ga0495656_0000121
1810 Ga0495656_0009845
1811 Ga0495668_0000027
1812 Ga0495668_0000391
1813 Ga0495668_0012882
1814 Ga0495625_0001055
1815 Ga0495625_0022600
1816 Ga0495625_0028814
1817 Ga0495625_0035272
1818 Ga0495625_0140537
1819 Ga0495661_0053592
1820 Ga0495588_0023569
1821 Ga0495588_0026817
1822 Ga0495658_0326044
1823 Ga0495613_0133522
1824 Ga0495670_0173846
1825 Ga0495671_0004658
1826 Ga0495671_0020440
1827 Ga0495671_0335394
1828 Ga0495672_0194142
1829 Ga0495676_0072538
1830 Ga0495683_0078230
1831 Ga0495677_0074250
1832 Ga0495679_006210
1833 Ga0495673_0000050
1834 Ga0495681_0007628
1835 Ga0495686_0000109
1836 Ga0496101_0052138
1837 Ga0496102_0016736
1838 Ga0496102_0172685
1839 Ga0496102_0335597
1840 Ga0496104_0008779
1841 Ga0496104_0347376
1842 Ga0496105_0001858
1843 Ga0496106_0105969
1844 Ga0496108_0060181
1845 Ga0496110_0094925
1846 Ga0496110_0640608
1847 Ga0496113_0180135
1848 Ga0496113_0480732
1849 Ga0496114_0066443
1850 Ga0496114_0320886
1851 Ga0496114_0610368
1852 Ga0496114_0735059
1853 Ga0496116_0015944
1854 Ga0496117_0021939
1855 Ga0496118_0005839
1856 Ga0496118_0085577
1857 Ga0496121_0029926
1858 Ga0496122_0000204
1859 Ga0496122_0015228
1860 Ga0496122_0044655
1861 Ga0496122_0125188
1862 Ga0496123_0001226
1863 Ga0496124_0052926
1864 Ga0496124_0151506
1865 Ga0496124_0181310
1866 Ga0496124_0190789
1867 Ga0496125_0001189
1868 Ga0496125_0008337
1869 Ga0496125_0066122
1870 Ga0496125_0242219
1871 Ga0495678_000009
1872 Ga0501031_0011864
1873 Ga0501036_0787106
1874 Ga0501038_0132238
1875 Ga0501039_0020825
1876 Ga0501039_0403201
1877 Ga0501040_0011533
1878 Ga0501041_0004462
1879 Ga0501042_0237963
1880 Ga0501042_0481885
1881 Ga0501043_0126494
1882 Ga0501046_0071336
1883 Ga0501046_0115619
1884 Ga0501047_0152492
1885 Ga0501047_0156133
1886 Ga0501048_0011356
1887 Ga0501068_0459628
1888 Ga0501071_0005717
1889 Ga0501072_0004661
1890 Ga0501072_0239100
1891 Ga0501073_0002899
1892 Ga0501074_0017705
1893 Ga0501074_0063972
1894 Ga0501075_0001298
1895 Ga0501075_0245506
1896 Ga0501076_0015872
1897 Ga0501076_0285150
1898 Ga0501077_0113376
1899 Ga0501077_0376801
1900 Ga0501240_006489
1901 Ga0501249_000812
1902 Ga0501225_0004613
1903 Ga0501079_0002520
1904 Ga0501079_0387063
1905 Ga0501080_0016685
1906 Ga0501080_0058403
1907 Ga0501080_0136559
1908 Ga0501081_0000822
1909 Ga0501081_0057009
1910 Ga0501081_0084765
1911 Ga0501262_000060
1912 Ga0501269_000140
1913 Ga0501035_0039403
1914 Ga0501035_0147918
1915 Ga0501044_0379629
1916 Ga0501045_0001293
1917 nmdc:mga03683_7466_c1
1918 nmdc:mga03n38_16473_c1
1919 nmdc:mga03n38_171943_c1
1920 nmdc:mga00v17_19714_c1
1921 nmdc:mga0yw44_657_c1
1922 nmdc:mga0k408_197065_c1
1923 nmdc:mga0k408_20674_c1
1924 nmdc:mga0k408_2786_c1
1925 nmdc:mga0k408_45435_c1
1926 nmdc:mga0k408_74462_c1
1927 nmdc:mga07m45_14640_c1
1928 nmdc:mga07m45_204011_c1
1929 nmdc:mga07m45_280_c1
1930 nmdc:mga07m45_32762_c1
1931 nmdc:mga07m45_32795_c1
1932 nmdc:mga07m45_5201_c1
1933 nmdc:mga05p37_431_c1
1934 nmdc:mga09592_123241_c1
1935 nmdc:mga09592_12862_c1
1936 nmdc:mga0qj67_642358_c1
1937 nmdc:mga06r32_180990_c1
1938 nmdc:mga06r32_6296_c1
1939 nmdc:mga0rr50_786511_c1
1940 nmdc:mga0a205_322542_c1
1941 Ga0500643_013702
1942 Ga0500651_0000137
1943 Ga0500571_000067
1944 Ga0500593_000653
1945 Ga0500594_0002600
1946 Ga0500607_004251
1947 Ga0500608_071729
1948 Ga0500658_0016126
1949 Ga0500559_0001487
1950 Ga0500559_0001525
1951 Ga0500559_0062863
1952 Ga0500568_0014757
1953 Ga0500574_033640
1954 Ga0500586_002357
1955 Ga0500627_0000290
1956 Ga0500645_000983
1957 Ga0501084_0179431
1958 Ga0590071_010584
1959 Ga0501082_0001941
1960 Ga0501082_0116684
1961 Ga0501082_0232877
1962 Ga0466962_0126800
1963 Ga0530510_0002234
1964 2511244592
1965 2513231056
1966 2548498989
1967 2599623369
1968 2599675413
1969 2599680974
1970 2599692989
1971 2643867798
1972 2643991662
1973 2644062160
1974 2644071348
1975 2644161868
1976 2644293407
1977 2644325530
1978 2644399254
1979 2644467064
1980 2644648446
1981 2722882015
1982 2738718221
1983 2738880389
1984 2739246510
1985 2739248303
1986 2739281408
1987 2816476308
1988 2819600545
1989 2831267729
1990 2838061543
1991 2842677555
1992 2842718756
1993 2842736337
1994 2842748845
1995 2857556982
1996 2857560065
1997 2881103019
1998 2885196910
1999 2885198801
2000 2885211819
2001 2894024373
2002 2899928308
2003 2904424461
2004 2904451845
2005 2904462498
2006 2904479743
2007 2904545100
2008 2919467171
2009 2919477831
2010 2919707161
2011 2928041260
2012 2928048102
2013 2928055943
2014 2928066576
2015 2928077270
2016 2928087571
2017 2928120692
2018 2929165278
2019 2929523611
2020 2932426407
2021 2939634195
2022 2945910118
2023 2945946147
2024 2945975747
2025 2945987866
2026 2954768803
2027 2974320360
2028 2990713892
2029 2998346649
2030 8055226858

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

74

254

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9306 105 240
6z88-assembly1.cif.gz_E human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9265 56 240
6z89-assembly1.cif.gz_C-2 human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9232 105 240
6z88-assembly1.cif.gz_D human gtp cyclohydrolase i in complex with allosteric inhibitor 0.9194 48 240
6z88-assembly1.cif.gz_G human gtp cyclohydrolase i in complex with allosteric inhibitor 0.918 51 240
ID Description Score Start End Superfamily
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9362 116 241 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9229 107 243 3.30.1130.10
af_Q8I5H7_254_381_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9141 105 223 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9101 107 243 3.30.1130.10
1is8A01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.884 47 92 1.10.286.10
ID Description Score Start End GO Terms
AF-A0A7J8IJ41-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9452 119 239 GO:0003934
GO:0005525
GO:0005634
GO:0005737
GO:0006729
GO:0008270
GO:0046654
AF-A0A1G1NCP7-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9448 114 239 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A539CVM0-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9424 119 238 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A2N0QKM7-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9423 127 237 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
GO:0046656
AF-A0A538BY74-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) 0.9402 130 239 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654

Map