F488243
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1015 | 369 | 2030 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300033180|Ga0307510_10005801|Ga0307510_100058014 |
| Length | 263 |
| Sequence | MSFYVKQPPNLINIFNDLTQSTIQLNQPLNYFYYFSYPMSNNIVIAIDGYSSCGKSTLAKALAQKLHFIYVDSGAMYRAVTLYFLRNNVDLKDHGQIAEALKNIHLNFHSRDYQTHITLNDEEVSEEIRQMPVSDNVSDVAALREVRHEMVKQQQRMGRSKNIVMDGRDIGTTVFPGATLKIFMTADPKVRAERRYKEMHEKNPDITLEEVFENIAHRDYQDTTRTESPLVRAPDAIILDNTNLTPEQQLQFALDKVEPLLHK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 190 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 191 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 192 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 193 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 204 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 217 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 218 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 219 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 222 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 223 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 224 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 273 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 274 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 275 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 276 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 277 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 278 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 298 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 299 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 303 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 307 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 309 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 312 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 313 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 315 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 316 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 317 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 318 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 320 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 322 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 323 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 325 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 326 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 327 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 328 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 329 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 330 | 2738541284 | Pedobacter sp. YR016 | Isolate | Unclassified |
| 331 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 332 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 333 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 334 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 335 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 336 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 337 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 338 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 339 | 2818991460 | Chitinophaga polysaccharea 1209 | Isolate | Unclassified |
| 340 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 341 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 342 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 343 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 344 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 345 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 346 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 347 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 348 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 349 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 350 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 351 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 352 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 353 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 354 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 355 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 356 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 357 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 358 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 359 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 360 | 2928519762 | Leuconostoc citreum 1377 | Isolate | Rhizosphere |
| 361 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 362 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 363 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 364 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 365 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 366 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 367 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 368 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 369 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.57 |
| Metatranscriptomes | 0.1 |
| Isolates | 4.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.31 |
| Nodule | 0 |
| Rhizoplane | 0.99 |
| Rhizosphere | 85.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307510_10005801 | 3300033180 | Bacteria | 14719 |
| 2 | SwRhRL2b_contig_1283784 | 2162886007 | Bacteria | 1715 |
| 3 | SwRhRL2b_contig_1663050 | 2162886007 | Bacteria | 482194 |
| 4 | SwRhRL2b_contig_1916358 | 2162886007 | Bacteria | 3368 |
| 5 | SwRhRL2b_contig_2744323 | 2162886007 | Unclassified | 1678 |
| 6 | SwRhRL2b_contig_3708819 | 2162886007 | Bacteria | 9197 |
| 7 | JGI24741J21665_1018335 | 3300001915 | Bacteria | 1120 |
| 8 | JGI24740J21852_10010217 | 3300001979 | Bacteria | 3627 |
| 9 | JGI24740J21852_10025264 | 3300001979 | Bacteria | 2004 |
| 10 | JGI24740J21852_10047026 | 3300001979 | Bacteria | 1262 |
| 11 | JGI24739J22299_10009023 | 3300001989 | Bacteria | 3721 |
| 12 | JGI24737J22298_10016579 | 3300001990 | Bacteria | 2378 |
| 13 | JGI24735J21928_10000013 | 3300002067 | Bacteria | 208663 |
| 14 | JGI24744J21845_10002459 | 3300002077 | Bacteria | 3775 |
| 15 | JGI24744J21845_10011147 | 3300002077 | Bacteria | 1840 |
| 16 | JGI25162J39368_1000180 | 3300002737 | Bacteria | 67985 |
| 17 | JGI25162J39368_1001035 | 3300002737 | Bacteria | 17180 |
| 18 | JGI25164J39214_1001426 | 3300002772 | Bacteria | 5614 |
| 19 | JGI25152J39213_1000160 | 3300002773 | Bacteria | 45741 |
| 20 | JGI25150J39212_1000002 | 3300002774 | Bacteria | 537631 |
| 21 | JGI25151J46595_10000003 | 3300003187 | Bacteria | 715330 |
| 22 | JGI25406J46586_10000320 | 3300003203 | Bacteria | 21684 |
| 23 | JGI25153J46596_10000003 | 3300003215 | Bacteria | 553253 |
| 24 | rootH1_10018516 | 3300003316 | Bacteria | 3239 |
| 25 | rootH1_10020058 | 3300003316 | Bacteria | 14507 |
| 26 | rootH1_10162869 | 3300003316 | Bacteria | 1400 |
| 27 | rootH1_10188534 | 3300003316 | Bacteria | 1591 |
| 28 | rootH2_10005336 | 3300003320 | Bacteria | 90063 |
| 29 | rootH2_10039401 | 3300003320 | Bacteria | 2677 |
| 30 | rootH2_10041787 | 3300003320 | Unclassified | 2715 |
| 31 | rootH2_10050610 | 3300003320 | Bacteria | 15378 |
| 32 | rootH2_10078540 | 3300003320 | Bacteria | 6578 |
| 33 | rootH2_10096793 | 3300003320 | Bacteria | 1522 |
| 34 | rootH2_10312559 | 3300003320 | Unclassified | 2499 |
| 35 | rootL2_10077558 | 3300003322 | Bacteria | 3565 |
| 36 | rootL2_10138667 | 3300003322 | Bacteria | 4545 |
| 37 | rootL2_10142782 | 3300003322 | Bacteria | 1809 |
| 38 | rootL2_10189067 | 3300003322 | Bacteria | 3156 |
| 39 | rootL2_10233241 | 3300003322 | Bacteria | 4423 |
| 40 | rootH1_10000549 | 3300003323 | Bacteria | 6473 |
| 41 | rootH1_10065836 | 3300003323 | Bacteria | 3811 |
| 42 | rootH1_10105207 | 3300003323 | Bacteria | 3496 |
| 43 | rootH1_10136684 | 3300003323 | Bacteria | 1507 |
| 44 | rootH1_10165942 | 3300003323 | Bacteria | 2084 |
| 45 | rootH1_10217929 | 3300003323 | Bacteria | 5627 |
| 46 | rootH1_10284471 | 3300003323 | Unclassified | 1175 |
| 47 | rootH1_10312356 | 3300003323 | Unclassified | 2858 |
| 48 | rootH1_10314976 | 3300003323 | Bacteria | 2976 |
| 49 | JGI25160J50197_1000809 | 3300003354 | Bacteria | 16812 |
| 50 | JGI25160J50197_1003840 | 3300003354 | Bacteria | 6601 |
| 51 | Ga0055536_1000007 | 3300003781 | Bacteria | 345133 |
| 52 | Ga0055528_1002286 | 3300003790 | Bacteria | 10381 |
| 53 | Ga0055530_10001851 | 3300003791 | Bacteria | 14538 |
| 54 | Ga0055530_10002693 | 3300003791 | Bacteria | 11059 |
| 55 | Ga0055531_10000237 | 3300003794 | Bacteria | 60479 |
| 56 | Ga0065165_1000190 | 3300005262 | Bacteria | 107377 |
| 57 | Ga0065714_10002536 | 3300005288 | Bacteria | 20360 |
| 58 | Ga0065714_10002974 | 3300005288 | Bacteria | 16891 |
| 59 | Ga0065714_10007179 | 3300005288 | Bacteria | 2962 |
| 60 | Ga0065714_10064993 | 3300005288 | Bacteria | 14329 |
| 61 | Ga0065714_10065917 | 3300005288 | Bacteria | 8087 |
| 62 | Ga0065714_10083180 | 3300005288 | Bacteria | 2262 |
| 63 | Ga0065714_10104208 | 3300005288 | Bacteria | 1587 |
| 64 | Ga0065714_10133435 | 3300005288 | Bacteria | 1208 |
| 65 | Ga0065704_10070140 | 3300005289 | Bacteria | 482257 |
| 66 | Ga0065704_10070358 | 3300005289 | Bacteria | 30366 |
| 67 | Ga0065704_10071378 | 3300005289 | Bacteria | 11408 |
| 68 | Ga0065704_10078114 | 3300005289 | Bacteria | 4521 |
| 69 | Ga0065704_10080198 | 3300005289 | Bacteria | 3987 |
| 70 | Ga0065704_10081542 | 3300005289 | Bacteria | 3742 |
| 71 | Ga0065712_10003463 | 3300005290 | Bacteria | 4883 |
| 72 | Ga0065712_10316161 | 3300005290 | Bacteria | 836 |
| 73 | Ga0070658_10000028 | 3300005327 | Bacteria | 157278 |
| 74 | Ga0070658_10084497 | 3300005327 | Bacteria | 2610 |
| 75 | Ga0070658_10091213 | 3300005327 | Bacteria | 2511 |
| 76 | Ga0070658_10274336 | 3300005327 | Bacteria | 1435 |
| 77 | Ga0070658_10296353 | 3300005327 | Bacteria | 1379 |
| 78 | Ga0070658_10334546 | 3300005327 | Bacteria | 1294 |
| 79 | Ga0070658_10507700 | 3300005327 | Unclassified | 1042 |
| 80 | Ga0070676_10000004 | 3300005328 | Bacteria | 82919 |
| 81 | Ga0070676_10000426 | 3300005328 | Bacteria | 19948 |
| 82 | Ga0070676_10328403 | 3300005328 | Unclassified | 1045 |
| 83 | Ga0070683_100013700 | 3300005329 | Bacteria | 7079 |
| 84 | Ga0070683_100027378 | 3300005329 | Bacteria | 5141 |
| 85 | Ga0070683_100032351 | 3300005329 | Bacteria | 4763 |
| 86 | Ga0070683_100065783 | 3300005329 | Bacteria | 3376 |
| 87 | Ga0070690_100015759 | 3300005330 | Bacteria | 4516 |
| 88 | Ga0070670_100030789 | 3300005331 | Bacteria | 4621 |
| 89 | Ga0070670_100045950 | 3300005331 | Bacteria | 3755 |
| 90 | Ga0070670_100060851 | 3300005331 | Bacteria | 3242 |
| 91 | Ga0070670_100375219 | 3300005331 | Bacteria | 1252 |
| 92 | Ga0068869_100019499 | 3300005334 | Bacteria | 4636 |
| 93 | Ga0068869_100044739 | 3300005334 | Bacteria | 3184 |
| 94 | Ga0068869_100201745 | 3300005334 | Unclassified | 1568 |
| 95 | Ga0070666_10024416 | 3300005335 | Bacteria | 3937 |
| 96 | Ga0070666_10030332 | 3300005335 | Bacteria | 3562 |
| 97 | Ga0070680_100011331 | 3300005336 | Bacteria | 6896 |
| 98 | Ga0070680_100035814 | 3300005336 | Bacteria | 4008 |
| 99 | Ga0070680_100046874 | 3300005336 | Bacteria | 3517 |
| 100 | Ga0070680_100060193 | 3300005336 | Bacteria | 3108 |
| 101 | Ga0070680_100265533 | 3300005336 | Bacteria | 1453 |
| 102 | Ga0070682_100018125 | 3300005337 | Bacteria | 4110 |
| 103 | Ga0068868_100001148 | 3300005338 | Bacteria | 18139 |
| 104 | Ga0068868_100008840 | 3300005338 | Bacteria | 7216 |
| 105 | Ga0068868_100061888 | 3300005338 | Bacteria | 2966 |
| 106 | Ga0068868_100442776 | 3300005338 | Bacteria | 1129 |
| 107 | Ga0068868_100592463 | 3300005338 | Bacteria | 981 |
| 108 | Ga0070660_100003457 | 3300005339 | Bacteria | 10872 |
| 109 | Ga0070660_100020931 | 3300005339 | Bacteria | 4815 |
| 110 | Ga0070660_100029171 | 3300005339 | Bacteria | 4132 |
| 111 | Ga0070660_100076358 | 3300005339 | Bacteria | 2624 |
| 112 | Ga0070660_100113149 | 3300005339 | Bacteria | 2161 |
| 113 | Ga0070660_100115650 | 3300005339 | Bacteria | 2138 |
| 114 | Ga0070660_100385728 | 3300005339 | Bacteria | 1157 |
| 115 | Ga0070689_100309053 | 3300005340 | Bacteria | 1318 |
| 116 | Ga0070691_10024526 | 3300005341 | Bacteria | 2803 |
| 117 | Ga0070687_100076750 | 3300005343 | Bacteria | 1811 |
| 118 | Ga0070687_100141208 | 3300005343 | Bacteria | 1403 |
| 119 | Ga0070661_100023853 | 3300005344 | Bacteria | 4388 |
| 120 | Ga0070661_100547611 | 3300005344 | Bacteria | 931 |
| 121 | Ga0070668_100295137 | 3300005347 | Bacteria | 1358 |
| 122 | Ga0070669_100010920 | 3300005353 | Bacteria | 6448 |
| 123 | Ga0070675_100013072 | 3300005354 | Bacteria | 6521 |
| 124 | Ga0070675_100150274 | 3300005354 | Unclassified | 1996 |
| 125 | Ga0070675_100297976 | 3300005354 | Bacteria | 1420 |
| 126 | Ga0070675_100756468 | 3300005354 | Bacteria | 887 |
| 127 | Ga0070671_100028142 | 3300005355 | Bacteria | 4628 |
| 128 | Ga0070671_100095618 | 3300005355 | Bacteria | 2490 |
| 129 | Ga0070674_100020850 | 3300005356 | Bacteria | 4197 |
| 130 | Ga0070674_100113808 | 3300005356 | Bacteria | 1991 |
| 131 | Ga0070673_100093542 | 3300005364 | Bacteria | 2462 |
| 132 | Ga0070673_100128526 | 3300005364 | Bacteria | 2123 |
| 133 | Ga0070673_100184295 | 3300005364 | Bacteria | 1789 |
| 134 | Ga0070673_100507900 | 3300005364 | Bacteria | 1091 |
| 135 | Ga0070688_100075431 | 3300005365 | Bacteria | 2168 |
| 136 | Ga0070688_100386269 | 3300005365 | Bacteria | 1033 |
| 137 | Ga0070659_100000100 | 3300005366 | Bacteria | 63786 |
| 138 | Ga0070659_100004457 | 3300005366 | Bacteria | 10002 |
| 139 | Ga0070659_100015244 | 3300005366 | Bacteria | 5753 |
| 140 | Ga0070659_100035543 | 3300005366 | Bacteria | 3880 |
| 141 | Ga0070659_100042935 | 3300005366 | Bacteria | 3535 |
| 142 | Ga0070659_100142050 | 3300005366 | Bacteria | 1955 |
| 143 | Ga0070667_100006801 | 3300005367 | Bacteria | 9500 |
| 144 | Ga0070667_100060914 | 3300005367 | Bacteria | 3194 |
| 145 | Ga0070667_100062397 | 3300005367 | Bacteria | 3157 |
| 146 | Ga0070667_100239016 | 3300005367 | Bacteria | 1621 |
| 147 | Ga0070663_100004723 | 3300005455 | Bacteria | 8036 |
| 148 | Ga0070663_100154470 | 3300005455 | Bacteria | 1762 |
| 149 | Ga0070678_100001206 | 3300005456 | Bacteria | 13708 |
| 150 | Ga0070678_100029061 | 3300005456 | Bacteria | 3781 |
| 151 | Ga0070678_100039826 | 3300005456 | Bacteria | 3320 |
| 152 | Ga0070678_100306542 | 3300005456 | Bacteria | 1351 |
| 153 | Ga0070678_100681287 | 3300005456 | Bacteria | 925 |
| 154 | Ga0070662_100000014 | 3300005457 | Bacteria | 110124 |
| 155 | Ga0070662_100003803 | 3300005457 | Bacteria | 9442 |
| 156 | Ga0070662_100059800 | 3300005457 | Bacteria | 2777 |
| 157 | Ga0070662_100082408 | 3300005457 | Bacteria | 2399 |
| 158 | Ga0070662_100359515 | 3300005457 | Bacteria | 1194 |
| 159 | Ga0070662_100418845 | 3300005457 | Unclassified | 1108 |
| 160 | Ga0070681_10002077 | 3300005458 | Bacteria | 18184 |
| 161 | Ga0070681_10908519 | 3300005458 | Unclassified | 799 |
| 162 | Ga0068867_100000636 | 3300005459 | Bacteria | 23189 |
| 163 | Ga0068867_100035731 | 3300005459 | Bacteria | 3605 |
| 164 | Ga0068867_100043873 | 3300005459 | Bacteria | 3274 |
| 165 | Ga0068867_100047846 | 3300005459 | Unclassified | 3145 |
| 166 | Ga0068867_100069414 | 3300005459 | Bacteria | 2632 |
| 167 | Ga0068867_100089400 | 3300005459 | Bacteria | 2335 |
| 168 | Ga0068867_100283141 | 3300005459 | Bacteria | 1360 |
| 169 | Ga0068867_100753280 | 3300005459 | Bacteria | 864 |
| 170 | Ga0070685_10076041 | 3300005466 | Bacteria | 2002 |
| 171 | Ga0070679_100000517 | 3300005530 | Bacteria | 32752 |
| 172 | Ga0070679_100031317 | 3300005530 | Bacteria | 5254 |
| 173 | Ga0070679_100064164 | 3300005530 | Bacteria | 3660 |
| 174 | Ga0070679_100099245 | 3300005530 | Bacteria | 2899 |
| 175 | Ga0070679_100107216 | 3300005530 | Bacteria | 2779 |
| 176 | Ga0070679_100188124 | 3300005530 | Bacteria | 2034 |
| 177 | Ga0070684_100020461 | 3300005535 | Bacteria | 5490 |
| 178 | Ga0070684_100047930 | 3300005535 | Bacteria | 3705 |
| 179 | Ga0070684_100060599 | 3300005535 | Bacteria | 3311 |
| 180 | Ga0070684_100801724 | 3300005535 | Bacteria | 880 |
| 181 | Ga0068853_100008704 | 3300005539 | Bacteria | 8163 |
| 182 | Ga0068853_100011075 | 3300005539 | Bacteria | 7313 |
| 183 | Ga0068853_100050481 | 3300005539 | Unclassified | 3579 |
| 184 | Ga0068853_100301312 | 3300005539 | Bacteria | 1481 |
| 185 | Ga0068853_100330101 | 3300005539 | Bacteria | 1415 |
| 186 | Ga0068853_100344676 | 3300005539 | Bacteria | 1385 |
| 187 | Ga0068853_100354133 | 3300005539 | Bacteria | 1366 |
| 188 | Ga0068853_100367136 | 3300005539 | Bacteria | 1342 |
| 189 | Ga0068853_100500516 | 3300005539 | Bacteria | 1147 |
| 190 | Ga0068853_100574457 | 3300005539 | Bacteria | 1069 |
| 191 | Ga0068853_100766468 | 3300005539 | Bacteria | 923 |
| 192 | Ga0070672_100041407 | 3300005543 | Bacteria | 3541 |
| 193 | Ga0070672_100113426 | 3300005543 | Bacteria | 2212 |
| 194 | Ga0070672_100124147 | 3300005543 | Bacteria | 2116 |
| 195 | Ga0070672_100186605 | 3300005543 | Bacteria | 1730 |
| 196 | Ga0070665_100000032 | 3300005548 | Bacteria | 333352 |
| 197 | Ga0070665_100000442 | 3300005548 | Bacteria | 60619 |
| 198 | Ga0070665_100059771 | 3300005548 | Bacteria | 3821 |
| 199 | Ga0070665_100161785 | 3300005548 | Bacteria | 2241 |
| 200 | Ga0070704_100700516 | 3300005549 | Bacteria | 898 |
| 201 | Ga0068855_100000049 | 3300005563 | Bacteria | 145321 |
| 202 | Ga0068855_100000658 | 3300005563 | Bacteria | 42234 |
| 203 | Ga0068855_100004342 | 3300005563 | Bacteria | 17337 |
| 204 | Ga0068855_100012340 | 3300005563 | Bacteria | 10321 |
| 205 | Ga0068855_100030872 | 3300005563 | Bacteria | 6406 |
| 206 | Ga0068855_100101452 | 3300005563 | Bacteria | 3313 |
| 207 | Ga0068855_100143256 | 3300005563 | Bacteria | 2722 |
| 208 | Ga0068855_100152064 | 3300005563 | Bacteria | 2631 |
| 209 | Ga0068855_100176779 | 3300005563 | Bacteria | 2415 |
| 210 | Ga0068855_100233879 | 3300005563 | Bacteria | 2056 |
| 211 | Ga0068855_100445914 | 3300005563 | Bacteria | 1413 |
| 212 | Ga0068855_100540825 | 3300005563 | Bacteria | 1262 |
| 213 | Ga0070664_100018922 | 3300005564 | Bacteria | 5662 |
| 214 | Ga0070664_100070386 | 3300005564 | Bacteria | 2996 |
| 215 | Ga0070664_100217692 | 3300005564 | Unclassified | 1708 |
| 216 | Ga0070664_100236044 | 3300005564 | Bacteria | 1640 |
| 217 | Ga0070664_100363996 | 3300005564 | Bacteria | 1317 |
| 218 | Ga0070664_100374788 | 3300005564 | Bacteria | 1298 |
| 219 | Ga0068857_100016681 | 3300005577 | Bacteria | 6434 |
| 220 | Ga0068857_100334011 | 3300005577 | Bacteria | 1401 |
| 221 | Ga0068854_100213658 | 3300005578 | Bacteria | 1523 |
| 222 | Ga0068854_100460043 | 3300005578 | Bacteria | 1064 |
| 223 | Ga0068856_100000005 | 3300005614 | Bacteria | 225505 |
| 224 | Ga0068856_100000424 | 3300005614 | Bacteria | 46509 |
| 225 | Ga0068856_100045491 | 3300005614 | Bacteria | 4322 |
| 226 | Ga0068856_100060542 | 3300005614 | Bacteria | 3741 |
| 227 | Ga0068856_100161706 | 3300005614 | Bacteria | 2249 |
| 228 | Ga0068856_100246115 | 3300005614 | Unclassified | 1803 |
| 229 | Ga0068856_100264731 | 3300005614 | Bacteria | 1735 |
| 230 | Ga0068856_100575876 | 3300005614 | Bacteria | 1147 |
| 231 | Ga0068856_100910564 | 3300005614 | Bacteria | 898 |
| 232 | Ga0068856_101151736 | 3300005614 | Bacteria | 792 |
| 233 | Ga0070702_100065400 | 3300005615 | Bacteria | 2130 |
| 234 | Ga0068852_100055520 | 3300005616 | Bacteria | 3419 |
| 235 | Ga0068852_100208765 | 3300005616 | Unclassified | 1851 |
| 236 | Ga0068852_100659888 | 3300005616 | Bacteria | 1054 |
| 237 | Ga0068852_100759826 | 3300005616 | Bacteria | 982 |
| 238 | Ga0068859_100249854 | 3300005617 | Bacteria | 1864 |
| 239 | Ga0068859_100250268 | 3300005617 | Bacteria | 1862 |
| 240 | Ga0068859_100795592 | 3300005617 | Bacteria | 1033 |
| 241 | Ga0068859_101006713 | 3300005617 | Bacteria | 915 |
| 242 | Ga0068864_100020770 | 3300005618 | Bacteria | 5495 |
| 243 | Ga0068864_100051272 | 3300005618 | Bacteria | 3554 |
| 244 | Ga0068864_100053174 | 3300005618 | Bacteria | 3493 |
| 245 | Ga0068864_100149758 | 3300005618 | Bacteria | 2113 |
| 246 | Ga0068864_100214985 | 3300005618 | Bacteria | 1772 |
| 247 | Ga0068861_100079101 | 3300005719 | Bacteria | 2570 |
| 248 | Ga0068861_100398783 | 3300005719 | Bacteria | 1220 |
| 249 | Ga0068851_10012608 | 3300005834 | Unclassified | 3988 |
| 250 | Ga0068870_10009985 | 3300005840 | Bacteria | 4340 |
| 251 | Ga0068870_10169029 | 3300005840 | Bacteria | 1303 |
| 252 | Ga0068870_10188031 | 3300005840 | Bacteria | 1244 |
| 253 | Ga0068863_100033510 | 3300005841 | Bacteria | 4893 |
| 254 | Ga0068863_100489852 | 3300005841 | Bacteria | 1210 |
| 255 | Ga0068860_100023461 | 3300005843 | Bacteria | 5962 |
| 256 | Ga0068860_100066819 | 3300005843 | Bacteria | 3416 |
| 257 | Ga0068860_100120755 | 3300005843 | Bacteria | 2509 |
| 258 | Ga0068860_100132142 | 3300005843 | Unclassified | 2396 |
| 259 | Ga0068860_100190085 | 3300005843 | Bacteria | 1987 |
| 260 | Ga0068860_100707649 | 3300005843 | Bacteria | 1017 |
| 261 | Ga0068862_100086787 | 3300005844 | Bacteria | 2721 |
| 262 | Ga0081539_10000147 | 3300005985 | Bacteria | 164274 |
| 263 | Ga0070716_100146709 | 3300006173 | Bacteria | 1512 |
| 264 | Ga0075366_10000173 | 3300006195 | Bacteria | 27823 |
| 265 | Ga0075366_10000703 | 3300006195 | Bacteria | 15855 |
| 266 | Ga0075366_10021146 | 3300006195 | Bacteria | 3782 |
| 267 | Ga0075366_10024166 | 3300006195 | Bacteria | 3545 |
| 268 | Ga0075366_10059185 | 3300006195 | Bacteria | 2275 |
| 269 | Ga0097621_100000224 | 3300006237 | Bacteria | 37801 |
| 270 | Ga0097621_100002869 | 3300006237 | Bacteria | 11830 |
| 271 | Ga0097621_100009933 | 3300006237 | Bacteria | 6935 |
| 272 | Ga0097621_100021511 | 3300006237 | Bacteria | 4991 |
| 273 | Ga0097621_100098964 | 3300006237 | Bacteria | 2451 |
| 274 | Ga0068871_100000021 | 3300006358 | Bacteria | 83155 |
| 275 | Ga0068871_100005685 | 3300006358 | Bacteria | 8751 |
| 276 | Ga0068871_100020267 | 3300006358 | Bacteria | 5092 |
| 277 | Ga0068871_100156684 | 3300006358 | Bacteria | 1945 |
| 278 | Ga0068871_100229905 | 3300006358 | Bacteria | 1609 |
| 279 | Ga0068871_100455356 | 3300006358 | Unclassified | 1147 |
| 280 | Ga0068865_100000045 | 3300006881 | Bacteria | 70227 |
| 281 | Ga0068865_100008014 | 3300006881 | Bacteria | 6523 |
| 282 | Ga0068865_100123051 | 3300006881 | Bacteria | 1932 |
| 283 | Ga0097620_100249847 | 3300006931 | Bacteria | 1864 |
| 284 | Ga0097620_100250272 | 3300006931 | Bacteria | 1862 |
| 285 | Ga0097620_100795580 | 3300006931 | Bacteria | 1033 |
| 286 | Ga0097620_101006767 | 3300006931 | Bacteria | 915 |
| 287 | Ga0105240_10000010 | 3300009093 | Bacteria | 537830 |
| 288 | Ga0105240_10000692 | 3300009093 | Bacteria | 61955 |
| 289 | Ga0105240_10007157 | 3300009093 | Bacteria | 16255 |
| 290 | Ga0105240_10028192 | 3300009093 | Bacteria | 7339 |
| 291 | Ga0105240_10049783 | 3300009093 | Bacteria | 5286 |
| 292 | Ga0105240_10099660 | 3300009093 | Bacteria | 3536 |
| 293 | Ga0105240_10160652 | 3300009093 | Bacteria | 2669 |
| 294 | Ga0105240_10238146 | 3300009093 | Bacteria | 2111 |
| 295 | Ga0105240_10248064 | 3300009093 | Bacteria | 2061 |
| 296 | Ga0105240_10331948 | 3300009093 | Bacteria | 1730 |
| 297 | Ga0105240_10443708 | 3300009093 | Bacteria | 1454 |
| 298 | Ga0111539_10465879 | 3300009094 | Unclassified | 1471 |
| 299 | Ga0111539_10632079 | 3300009094 | Bacteria | 1247 |
| 300 | Ga0105243_10000008 | 3300009148 | Bacteria | 390270 |
| 301 | Ga0105243_10338653 | 3300009148 | Bacteria | 1377 |
| 302 | Ga0105241_10000305 | 3300009174 | Bacteria | 36958 |
| 303 | Ga0105241_10016108 | 3300009174 | Bacteria | 5480 |
| 304 | Ga0105241_10087436 | 3300009174 | Bacteria | 2453 |
| 305 | Ga0105241_10114250 | 3300009174 | Bacteria | 2165 |
| 306 | Ga0105241_10172562 | 3300009174 | Unclassified | 1787 |
| 307 | Ga0105241_10190247 | 3300009174 | Bacteria | 1708 |
| 308 | Ga0105241_11063497 | 3300009174 | Bacteria | 760 |
| 309 | Ga0105242_10030783 | 3300009176 | Unclassified | 4286 |
| 310 | Ga0105242_10040564 | 3300009176 | Bacteria | 3751 |
| 311 | Ga0105242_10142514 | 3300009176 | Bacteria | 2081 |
| 312 | Ga0105242_10196246 | 3300009176 | Unclassified | 1790 |
| 313 | Ga0105242_10197403 | 3300009176 | Bacteria | 1785 |
| 314 | Ga0105242_10734019 | 3300009176 | Unclassified | 970 |
| 315 | Ga0105248_10035252 | 3300009177 | Bacteria | 5597 |
| 316 | Ga0105248_10531310 | 3300009177 | Unclassified | 1326 |
| 317 | Ga0105237_10001165 | 3300009545 | Bacteria | 35143 |
| 318 | Ga0105237_10002429 | 3300009545 | Bacteria | 23143 |
| 319 | Ga0105237_10003157 | 3300009545 | Bacteria | 19816 |
| 320 | Ga0105237_10008501 | 3300009545 | Bacteria | 11105 |
| 321 | Ga0105237_10019154 | 3300009545 | Bacteria | 7072 |
| 322 | Ga0105237_10038945 | 3300009545 | Bacteria | 4800 |
| 323 | Ga0105237_10156842 | 3300009545 | Bacteria | 2273 |
| 324 | Ga0105237_10198468 | 3300009545 | Bacteria | 2006 |
| 325 | Ga0105237_10215980 | 3300009545 | Bacteria | 1918 |
| 326 | Ga0105237_10390870 | 3300009545 | Bacteria | 1396 |
| 327 | Ga0105237_10835725 | 3300009545 | Unclassified | 928 |
| 328 | Ga0105238_10002640 | 3300009551 | Bacteria | 17863 |
| 329 | Ga0105238_10281978 | 3300009551 | Bacteria | 1643 |
| 330 | Ga0105249_10030794 | 3300009553 | Bacteria | 4850 |
| 331 | Ga0105239_10000001 | 3300010375 | Bacteria | 617353 |
| 332 | Ga0105239_10000222 | 3300010375 | Bacteria | 83623 |
| 333 | Ga0105239_10003907 | 3300010375 | Bacteria | 18070 |
| 334 | Ga0105239_10004417 | 3300010375 | Bacteria | 16825 |
| 335 | Ga0105239_10007756 | 3300010375 | Bacteria | 12287 |
| 336 | Ga0105239_10025053 | 3300010375 | Bacteria | 6572 |
| 337 | Ga0105239_10027624 | 3300010375 | Bacteria | 6244 |
| 338 | Ga0105239_10035531 | 3300010375 | Bacteria | 5472 |
| 339 | Ga0105239_10040221 | 3300010375 | Bacteria | 5123 |
| 340 | Ga0105239_10047543 | 3300010375 | Bacteria | 4703 |
| 341 | Ga0105239_10048999 | 3300010375 | Bacteria | 4632 |
| 342 | Ga0105239_10329326 | 3300010375 | Bacteria | 1723 |
| 343 | Ga0105239_10939077 | 3300010375 | Bacteria | 993 |
| 344 | Ga0105246_10016055 | 3300011119 | Unclassified | 4738 |
| 345 | Ga0105246_10157981 | 3300011119 | Unclassified | 1724 |
| 346 | Ga0157373_10000493 | 3300013100 | Bacteria | 31173 |
| 347 | Ga0157373_10001010 | 3300013100 | Bacteria | 21720 |
| 348 | Ga0157373_10008371 | 3300013100 | Bacteria | 7682 |
| 349 | Ga0157373_10023213 | 3300013100 | Bacteria | 4498 |
| 350 | Ga0157373_10027560 | 3300013100 | Unclassified | 4099 |
| 351 | Ga0157373_10038323 | 3300013100 | Bacteria | 3436 |
| 352 | Ga0157373_10060689 | 3300013100 | Bacteria | 2678 |
| 353 | Ga0157373_10112851 | 3300013100 | Bacteria | 1910 |
| 354 | Ga0157373_10151139 | 3300013100 | Bacteria | 1633 |
| 355 | Ga0157373_10165048 | 3300013100 | Unclassified | 1558 |
| 356 | Ga0157371_10000266 | 3300013102 | Bacteria | 71146 |
| 357 | Ga0157371_10001322 | 3300013102 | Bacteria | 26019 |
| 358 | Ga0157371_10001388 | 3300013102 | Bacteria | 25318 |
| 359 | Ga0157371_10001945 | 3300013102 | Bacteria | 20538 |
| 360 | Ga0157371_10002423 | 3300013102 | Bacteria | 17819 |
| 361 | Ga0157371_10002458 | 3300013102 | Bacteria | 17660 |
| 362 | Ga0157371_10002705 | 3300013102 | Bacteria | 16743 |
| 363 | Ga0157371_10003231 | 3300013102 | Bacteria | 14955 |
| 364 | Ga0157371_10006449 | 3300013102 | Bacteria | 9674 |
| 365 | Ga0157371_10027274 | 3300013102 | Bacteria | 4144 |
| 366 | Ga0157371_10048234 | 3300013102 | Bacteria | 3027 |
| 367 | Ga0157371_10048377 | 3300013102 | Bacteria | 3022 |
| 368 | Ga0157371_10052792 | 3300013102 | Bacteria | 2887 |
| 369 | Ga0157371_10064467 | 3300013102 | Bacteria | 2596 |
| 370 | Ga0157371_10070397 | 3300013102 | Bacteria | 2476 |
| 371 | Ga0157371_10176376 | 3300013102 | Unclassified | 1528 |
| 372 | Ga0157371_10208448 | 3300013102 | Bacteria | 1402 |
| 373 | Ga0157371_10240181 | 3300013102 | Bacteria | 1303 |
| 374 | Ga0157370_10004347 | 3300013104 | Bacteria | 16272 |
| 375 | Ga0157370_10009076 | 3300013104 | Bacteria | 10664 |
| 376 | Ga0157370_10010549 | 3300013104 | Bacteria | 9730 |
| 377 | Ga0157370_10016108 | 3300013104 | Bacteria | 7578 |
| 378 | Ga0157370_10023734 | 3300013104 | Bacteria | 6086 |
| 379 | Ga0157370_10026762 | 3300013104 | Bacteria | 5691 |
| 380 | Ga0157370_10041735 | 3300013104 | Bacteria | 4423 |
| 381 | Ga0157370_10051988 | 3300013104 | Bacteria | 3912 |
| 382 | Ga0157370_10085326 | 3300013104 | Bacteria | 2966 |
| 383 | Ga0157370_10088382 | 3300013104 | Bacteria | 2910 |
| 384 | Ga0157370_10106422 | 3300013104 | Bacteria | 2625 |
| 385 | Ga0157370_10159379 | 3300013104 | Bacteria | 2100 |
| 386 | Ga0157370_10235881 | 3300013104 | Bacteria | 1693 |
| 387 | Ga0157369_10000441 | 3300013105 | Bacteria | 55264 |
| 388 | Ga0157369_10023235 | 3300013105 | Bacteria | 6908 |
| 389 | Ga0157369_10092464 | 3300013105 | Bacteria | 3228 |
| 390 | Ga0157369_10104538 | 3300013105 | Bacteria | 3015 |
| 391 | Ga0157369_10140329 | 3300013105 | Bacteria | 2557 |
| 392 | Ga0157369_10279306 | 3300013105 | Bacteria | 1739 |
| 393 | Ga0157369_10337914 | 3300013105 | Unclassified | 1564 |
| 394 | Ga0157369_10348473 | 3300013105 | Bacteria | 1538 |
| 395 | Ga0157369_10516288 | 3300013105 | Bacteria | 1236 |
| 396 | Ga0157374_10001269 | 3300013296 | Bacteria | 21541 |
| 397 | Ga0157374_10008592 | 3300013296 | Bacteria | 8735 |
| 398 | Ga0157374_10013320 | 3300013296 | Bacteria | 7177 |
| 399 | Ga0157374_10017554 | 3300013296 | Bacteria | 6302 |
| 400 | Ga0157374_10032990 | 3300013296 | Bacteria | 4721 |
| 401 | Ga0157374_10034886 | 3300013296 | Bacteria | 4600 |
| 402 | Ga0157374_10188789 | 3300013296 | Bacteria | 2016 |
| 403 | Ga0157374_10399683 | 3300013296 | Bacteria | 1371 |
| 404 | Ga0157374_10551995 | 3300013296 | Bacteria | 1160 |
| 405 | Ga0157378_10001566 | 3300013297 | Bacteria | 20661 |
| 406 | Ga0157378_10003663 | 3300013297 | Bacteria | 13617 |
| 407 | Ga0157378_10012150 | 3300013297 | Bacteria | 7541 |
| 408 | Ga0157378_10026674 | 3300013297 | Bacteria | 5093 |
| 409 | Ga0157378_10028410 | 3300013297 | Bacteria | 4935 |
| 410 | Ga0157378_10034723 | 3300013297 | Bacteria | 4459 |
| 411 | Ga0157378_10144673 | 3300013297 | Bacteria | 2210 |
| 412 | Ga0157378_10150800 | 3300013297 | Bacteria | 2166 |
| 413 | Ga0157378_10257215 | 3300013297 | Unclassified | 1674 |
| 414 | Ga0157378_10270077 | 3300013297 | Bacteria | 1635 |
| 415 | Ga0157378_11064414 | 3300013297 | Bacteria | 845 |
| 416 | Ga0163162_10000010 | 3300013306 | Bacteria | 302032 |
| 417 | Ga0163162_10001751 | 3300013306 | Bacteria | 20347 |
| 418 | Ga0163162_10002720 | 3300013306 | Bacteria | 16777 |
| 419 | Ga0163162_10004021 | 3300013306 | Bacteria | 14113 |
| 420 | Ga0163162_10034404 | 3300013306 | Bacteria | 5043 |
| 421 | Ga0163162_10046160 | 3300013306 | Bacteria | 4366 |
| 422 | Ga0163162_10147273 | 3300013306 | Bacteria | 2471 |
| 423 | Ga0163162_10157820 | 3300013306 | Bacteria | 2389 |
| 424 | Ga0163162_10258188 | 3300013306 | Bacteria | 1874 |
| 425 | Ga0163162_10264563 | 3300013306 | Bacteria | 1851 |
| 426 | Ga0163162_10294345 | 3300013306 | Bacteria | 1755 |
| 427 | Ga0163162_10324809 | 3300013306 | Unclassified | 1671 |
| 428 | Ga0163162_10371489 | 3300013306 | Bacteria | 1563 |
| 429 | Ga0163162_10466857 | 3300013306 | Bacteria | 1394 |
| 430 | Ga0163162_10593162 | 3300013306 | Bacteria | 1234 |
| 431 | Ga0163162_10611109 | 3300013306 | Bacteria | 1216 |
| 432 | Ga0163162_10912003 | 3300013306 | Bacteria | 991 |
| 433 | Ga0157372_10000073 | 3300013307 | Bacteria | 107356 |
| 434 | Ga0157372_10001839 | 3300013307 | Bacteria | 22988 |
| 435 | Ga0157372_10002319 | 3300013307 | Bacteria | 20622 |
| 436 | Ga0157372_10005120 | 3300013307 | Bacteria | 13929 |
| 437 | Ga0157372_10006129 | 3300013307 | Bacteria | 12780 |
| 438 | Ga0157372_10015677 | 3300013307 | Bacteria | 8127 |
| 439 | Ga0157372_10030154 | 3300013307 | Bacteria | 5931 |
| 440 | Ga0157372_10034703 | 3300013307 | Bacteria | 5548 |
| 441 | Ga0157372_10070619 | 3300013307 | Bacteria | 3930 |
| 442 | Ga0157372_10082045 | 3300013307 | Bacteria | 3650 |
| 443 | Ga0157372_10082743 | 3300013307 | Bacteria | 3634 |
| 444 | Ga0157372_10106606 | 3300013307 | Unclassified | 3205 |
| 445 | Ga0157372_10118909 | 3300013307 | Unclassified | 3033 |
| 446 | Ga0157372_10170040 | 3300013307 | Bacteria | 2521 |
| 447 | Ga0157372_10230100 | 3300013307 | Bacteria | 2149 |
| 448 | Ga0157372_10230257 | 3300013307 | Bacteria | 2148 |
| 449 | Ga0157372_10386104 | 3300013307 | Unclassified | 1631 |
| 450 | Ga0157372_10420886 | 3300013307 | Bacteria | 1557 |
| 451 | Ga0157372_10556954 | 3300013307 | Bacteria | 1336 |
| 452 | Ga0157375_10003126 | 3300013308 | Bacteria | 14379 |
| 453 | Ga0157375_10008904 | 3300013308 | Bacteria | 8784 |
| 454 | Ga0157375_10010047 | 3300013308 | Bacteria | 8321 |
| 455 | Ga0157375_10015961 | 3300013308 | Bacteria | 6736 |
| 456 | Ga0157375_10016953 | 3300013308 | Bacteria | 6564 |
| 457 | Ga0157375_10093626 | 3300013308 | Bacteria | 3071 |
| 458 | Ga0157375_10124312 | 3300013308 | Unclassified | 2693 |
| 459 | Ga0157375_10134199 | 3300013308 | Bacteria | 2597 |
| 460 | Ga0157375_10250437 | 3300013308 | Bacteria | 1932 |
| 461 | Ga0157375_10261104 | 3300013308 | Bacteria | 1893 |
| 462 | Ga0157375_10673574 | 3300013308 | Bacteria | 1189 |
| 463 | Ga0157375_11560824 | 3300013308 | Unclassified | 780 |
| 464 | Ga0163163_10004021 | 3300014325 | Bacteria | 12540 |
| 465 | Ga0163163_10221276 | 3300014325 | Bacteria | 1942 |
| 466 | Ga0163163_10337801 | 3300014325 | Bacteria | 1561 |
| 467 | Ga0163163_10662153 | 3300014325 | Unclassified | 1107 |
| 468 | Ga0182008_10000017 | 3300014497 | Bacteria | 235130 |
| 469 | Ga0182008_10000043 | 3300014497 | Bacteria | 117076 |
| 470 | Ga0182008_10000934 | 3300014497 | Bacteria | 20353 |
| 471 | Ga0182008_10047424 | 3300014497 | Bacteria | 2134 |
| 472 | Ga0182008_10134310 | 3300014497 | Unclassified | 1235 |
| 473 | Ga0157377_10002355 | 3300014745 | Bacteria | 8336 |
| 474 | Ga0157377_10042679 | 3300014745 | Bacteria | 2520 |
| 475 | Ga0157379_10038425 | 3300014968 | Bacteria | 4271 |
| 476 | Ga0157379_10046246 | 3300014968 | Bacteria | 3883 |
| 477 | Ga0157379_10047442 | 3300014968 | Bacteria | 3832 |
| 478 | Ga0157379_10053941 | 3300014968 | Bacteria | 3592 |
| 479 | Ga0157379_10122600 | 3300014968 | Bacteria | 2339 |
| 480 | Ga0157379_10326861 | 3300014968 | Bacteria | 1401 |
| 481 | Ga0157379_10461283 | 3300014968 | Unclassified | 1174 |
| 482 | Ga0157376_10003029 | 3300014969 | Bacteria | 11517 |
| 483 | Ga0157376_10011262 | 3300014969 | Bacteria | 6584 |
| 484 | Ga0157376_10189803 | 3300014969 | Unclassified | 1884 |
| 485 | Ga0157376_10655895 | 3300014969 | Bacteria | 1050 |
| 486 | Ga0182006_1000128 | 3300015261 | Bacteria | 81425 |
| 487 | Ga0182006_1001058 | 3300015261 | Bacteria | 17753 |
| 488 | Ga0182006_1003032 | 3300015261 | Bacteria | 8833 |
| 489 | Ga0182006_1026274 | 3300015261 | Bacteria | 2384 |
| 490 | Ga0182006_1052740 | 3300015261 | Bacteria | 1561 |
| 491 | Ga0182007_10000054 | 3300015262 | Bacteria | 91906 |
| 492 | Ga0182007_10018595 | 3300015262 | Bacteria | 2515 |
| 493 | Ga0182007_10047834 | 3300015262 | Bacteria | 1414 |
| 494 | Ga0183373_1015 | 3300015682 | Bacteria | 63862 |
| 495 | Ga0163161_10001077 | 3300017792 | Bacteria | 20663 |
| 496 | Ga0163161_10001415 | 3300017792 | Bacteria | 17712 |
| 497 | Ga0163161_10003355 | 3300017792 | Bacteria | 11229 |
| 498 | Ga0163161_10009075 | 3300017792 | Bacteria | 6878 |
| 499 | Ga0163161_10011686 | 3300017792 | Bacteria | 6092 |
| 500 | Ga0163161_10020964 | 3300017792 | Bacteria | 4592 |
| 501 | Ga0163161_10111331 | 3300017792 | Bacteria | 2047 |
| 502 | Ga0163161_10263964 | 3300017792 | Bacteria | 1346 |
| 503 | Ga0163161_10899461 | 3300017792 | Bacteria | 750 |
| 504 | Ga0206351_10643466 | 3300020077 | Unclassified | 1171 |
| 505 | Ga0213872_10024047 | 3300021361 | Bacteria | 2802 |
| 506 | Ga0213876_10004951 | 3300021384 | Bacteria | 7368 |
| 507 | Ga0207427_100025 | 3300025231 | Bacteria | 433726 |
| 508 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 509 | Ga0209437_100148 | 3300025233 | Bacteria | 158795 |
| 510 | Ga0209258_112460 | 3300025242 | Bacteria | 1041 |
| 511 | Ga0207425_1000004 | 3300025245 | Bacteria | 1092421 |
| 512 | Ga0209026_1000805 | 3300025250 | Bacteria | 17035 |
| 513 | Ga0209026_1000875 | 3300025250 | Bacteria | 15683 |
| 514 | Ga0209129_1000005 | 3300025258 | Bacteria | 777812 |
| 515 | Ga0209129_1010719 | 3300025258 | Bacteria | 2256 |
| 516 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 517 | Ga0209233_1008486 | 3300025261 | Bacteria | 3178 |
| 518 | Ga0209455_1004412 | 3300025272 | Bacteria | 4618 |
| 519 | Ga0209676_1000058 | 3300025292 | Bacteria | 345185 |
| 520 | Ga0209025_1000009 | 3300025294 | Bacteria | 1092561 |
| 521 | Ga0209758_1000010 | 3300025297 | Bacteria | 1092782 |
| 522 | Ga0209050_1000054 | 3300025298 | Bacteria | 345186 |
| 523 | Ga0207426_1000030 | 3300025302 | Bacteria | 461478 |
| 524 | Ga0209257_1000025 | 3300025304 | Bacteria | 724838 |
| 525 | Ga0207697_10051715 | 3300025315 | Bacteria | 1698 |
| 526 | Ga0207656_10009859 | 3300025321 | Bacteria | 3556 |
| 527 | Ga0207642_10010276 | 3300025899 | Bacteria | 3293 |
| 528 | Ga0207642_10147018 | 3300025899 | Bacteria | 1250 |
| 529 | Ga0207642_10206662 | 3300025899 | Bacteria | 1088 |
| 530 | Ga0207642_10252843 | 3300025899 | Bacteria | 1001 |
| 531 | Ga0207680_10410355 | 3300025903 | Bacteria | 958 |
| 532 | Ga0207647_10000022 | 3300025904 | Bacteria | 118094 |
| 533 | Ga0207647_10000499 | 3300025904 | Bacteria | 31400 |
| 534 | Ga0207647_10004321 | 3300025904 | Bacteria | 10533 |
| 535 | Ga0207647_10338523 | 3300025904 | Bacteria | 853 |
| 536 | Ga0207645_10000151 | 3300025907 | Bacteria | 54588 |
| 537 | Ga0207645_10000885 | 3300025907 | Bacteria | 24873 |
| 538 | Ga0207645_10015713 | 3300025907 | Bacteria | 5021 |
| 539 | Ga0207643_10004003 | 3300025908 | Bacteria | 7927 |
| 540 | Ga0207705_10000045 | 3300025909 | Bacteria | 180625 |
| 541 | Ga0207705_10008413 | 3300025909 | Bacteria | 7533 |
| 542 | Ga0207705_10017000 | 3300025909 | Bacteria | 5210 |
| 543 | Ga0207705_10044405 | 3300025909 | Bacteria | 3194 |
| 544 | Ga0207705_10485749 | 3300025909 | Bacteria | 959 |
| 545 | Ga0207654_10002120 | 3300025911 | Bacteria | 10159 |
| 546 | Ga0207654_10157450 | 3300025911 | Bacteria | 1464 |
| 547 | Ga0207654_10164806 | 3300025911 | Bacteria | 1434 |
| 548 | Ga0207654_10411554 | 3300025911 | Bacteria | 942 |
| 549 | Ga0207654_10426098 | 3300025911 | Bacteria | 927 |
| 550 | Ga0207707_10005461 | 3300025912 | Bacteria | 11112 |
| 551 | Ga0207695_10000019 | 3300025913 | Bacteria | 732137 |
| 552 | Ga0207695_10000020 | 3300025913 | Bacteria | 723025 |
| 553 | Ga0207695_10003958 | 3300025913 | Bacteria | 20474 |
| 554 | Ga0207695_10008283 | 3300025913 | Bacteria | 13039 |
| 555 | Ga0207695_10014224 | 3300025913 | Bacteria | 9439 |
| 556 | Ga0207695_10018922 | 3300025913 | Bacteria | 7946 |
| 557 | Ga0207695_10046570 | 3300025913 | Bacteria | 4596 |
| 558 | Ga0207695_10167957 | 3300025913 | Bacteria | 2121 |
| 559 | Ga0207695_10237931 | 3300025913 | Bacteria | 1723 |
| 560 | Ga0207695_10259311 | 3300025913 | Bacteria | 1636 |
| 561 | Ga0207695_10273487 | 3300025913 | Bacteria | 1584 |
| 562 | Ga0207671_10000030 | 3300025914 | Bacteria | 248197 |
| 563 | Ga0207671_10000598 | 3300025914 | Bacteria | 48008 |
| 564 | Ga0207671_10003239 | 3300025914 | Bacteria | 16379 |
| 565 | Ga0207671_10011028 | 3300025914 | Bacteria | 7399 |
| 566 | Ga0207671_10026560 | 3300025914 | Bacteria | 4336 |
| 567 | Ga0207671_10055827 | 3300025914 | Bacteria | 2926 |
| 568 | Ga0207671_10058076 | 3300025914 | Unclassified | 2868 |
| 569 | Ga0207671_10071906 | 3300025914 | Bacteria | 2580 |
| 570 | Ga0207671_10143677 | 3300025914 | Bacteria | 1840 |
| 571 | Ga0207660_10006965 | 3300025917 | Bacteria | 7323 |
| 572 | Ga0207660_10051946 | 3300025917 | Bacteria | 2916 |
| 573 | Ga0207660_10215945 | 3300025917 | Bacteria | 1503 |
| 574 | Ga0207660_10347568 | 3300025917 | Bacteria | 1188 |
| 575 | Ga0207662_10027483 | 3300025918 | Bacteria | 3283 |
| 576 | Ga0207662_10067807 | 3300025918 | Bacteria | 2153 |
| 577 | Ga0207657_10001634 | 3300025919 | Bacteria | 24147 |
| 578 | Ga0207657_10004444 | 3300025919 | Bacteria | 14832 |
| 579 | Ga0207657_10010980 | 3300025919 | Bacteria | 9002 |
| 580 | Ga0207657_10011267 | 3300025919 | Bacteria | 8883 |
| 581 | Ga0207657_10076883 | 3300025919 | Bacteria | 2815 |
| 582 | Ga0207657_10085863 | 3300025919 | Bacteria | 2635 |
| 583 | Ga0207657_10251887 | 3300025919 | Bacteria | 1407 |
| 584 | Ga0207657_10352626 | 3300025919 | Bacteria | 1160 |
| 585 | Ga0207657_10442178 | 3300025919 | Bacteria | 1021 |
| 586 | Ga0207657_10472136 | 3300025919 | Bacteria | 984 |
| 587 | Ga0207649_10003318 | 3300025920 | Bacteria | 8812 |
| 588 | Ga0207649_10397148 | 3300025920 | Bacteria | 1031 |
| 589 | Ga0207652_10000101 | 3300025921 | Bacteria | 93033 |
| 590 | Ga0207652_10000616 | 3300025921 | Bacteria | 35409 |
| 591 | Ga0207652_10066856 | 3300025921 | Bacteria | 3116 |
| 592 | Ga0207652_10125949 | 3300025921 | Bacteria | 2282 |
| 593 | Ga0207652_10154826 | 3300025921 | Unclassified | 2053 |
| 594 | Ga0207652_10395785 | 3300025921 | Bacteria | 1247 |
| 595 | Ga0207681_10064578 | 3300025923 | Bacteria | 2528 |
| 596 | Ga0207681_10187533 | 3300025923 | Bacteria | 1580 |
| 597 | Ga0207681_10342378 | 3300025923 | Unclassified | 1195 |
| 598 | Ga0207694_10018165 | 3300025924 | Bacteria | 5317 |
| 599 | Ga0207694_10161145 | 3300025924 | Bacteria | 1812 |
| 600 | Ga0207650_10008032 | 3300025925 | Bacteria | 7192 |
| 601 | Ga0207650_10126189 | 3300025925 | Bacteria | 1998 |
| 602 | Ga0207650_10145444 | 3300025925 | Bacteria | 1867 |
| 603 | Ga0207659_10036403 | 3300025926 | Bacteria | 3409 |
| 604 | Ga0207644_10010200 | 3300025931 | Bacteria | 6190 |
| 605 | Ga0207644_10071321 | 3300025931 | Bacteria | 2541 |
| 606 | Ga0207644_10080754 | 3300025931 | Bacteria | 2402 |
| 607 | Ga0207644_10178546 | 3300025931 | Bacteria | 1663 |
| 608 | Ga0207644_10439473 | 3300025931 | Bacteria | 1071 |
| 609 | Ga0207690_10029414 | 3300025932 | Bacteria | 3493 |
| 610 | Ga0207690_10187068 | 3300025932 | Bacteria | 1563 |
| 611 | Ga0207690_10255898 | 3300025932 | Bacteria | 1355 |
| 612 | Ga0207706_10000047 | 3300025933 | Bacteria | 119022 |
| 613 | Ga0207706_10002437 | 3300025933 | Bacteria | 18156 |
| 614 | Ga0207706_10004864 | 3300025933 | Bacteria | 12575 |
| 615 | Ga0207706_10068732 | 3300025933 | Bacteria | 3116 |
| 616 | Ga0207706_10142600 | 3300025933 | Bacteria | 2107 |
| 617 | Ga0207686_10155289 | 3300025934 | Unclassified | 1598 |
| 618 | Ga0207709_10000006 | 3300025935 | Bacteria | 800946 |
| 619 | Ga0207670_10126009 | 3300025936 | Bacteria | 1869 |
| 620 | Ga0207669_10142655 | 3300025937 | Bacteria | 1665 |
| 621 | Ga0207704_10000077 | 3300025938 | Bacteria | 60841 |
| 622 | Ga0207704_10006021 | 3300025938 | Bacteria | 5623 |
| 623 | Ga0207704_10105746 | 3300025938 | Bacteria | 1889 |
| 624 | Ga0207691_10038025 | 3300025940 | Bacteria | 4453 |
| 625 | Ga0207691_10054995 | 3300025940 | Bacteria | 3630 |
| 626 | Ga0207691_10225154 | 3300025940 | Bacteria | 1625 |
| 627 | Ga0207711_10020688 | 3300025941 | Bacteria | 5490 |
| 628 | Ga0207689_10013159 | 3300025942 | Bacteria | 7060 |
| 629 | Ga0207689_10018391 | 3300025942 | Bacteria | 5896 |
| 630 | Ga0207689_10019124 | 3300025942 | Bacteria | 5775 |
| 631 | Ga0207689_10199952 | 3300025942 | Bacteria | 1649 |
| 632 | Ga0207661_10011467 | 3300025944 | Bacteria | 6423 |
| 633 | Ga0207661_10041731 | 3300025944 | Bacteria | 3613 |
| 634 | Ga0207661_10048489 | 3300025944 | Bacteria | 3376 |
| 635 | Ga0207679_10004167 | 3300025945 | Bacteria | 8985 |
| 636 | Ga0207679_10460266 | 3300025945 | Bacteria | 1129 |
| 637 | Ga0207667_10000015 | 3300025949 | Bacteria | 417534 |
| 638 | Ga0207667_10001154 | 3300025949 | Bacteria | 33200 |
| 639 | Ga0207667_10001998 | 3300025949 | Bacteria | 25593 |
| 640 | Ga0207667_10100799 | 3300025949 | Bacteria | 2979 |
| 641 | Ga0207667_10130653 | 3300025949 | Bacteria | 2587 |
| 642 | Ga0207667_10184001 | 3300025949 | Bacteria | 2145 |
| 643 | Ga0207667_10413063 | 3300025949 | Bacteria | 1373 |
| 644 | Ga0207667_10497882 | 3300025949 | Bacteria | 1236 |
| 645 | Ga0207667_10877522 | 3300025949 | Unclassified | 890 |
| 646 | Ga0207667_10903059 | 3300025949 | Bacteria | 875 |
| 647 | Ga0207651_10013162 | 3300025960 | Bacteria | 4721 |
| 648 | Ga0207651_10015118 | 3300025960 | Unclassified | 4476 |
| 649 | Ga0207651_10016093 | 3300025960 | Bacteria | 4369 |
| 650 | Ga0207651_10163018 | 3300025960 | Bacteria | 1750 |
| 651 | Ga0207651_10193239 | 3300025960 | Bacteria | 1625 |
| 652 | Ga0207712_10115130 | 3300025961 | Bacteria | 2024 |
| 653 | Ga0207668_10217307 | 3300025972 | Unclassified | 1532 |
| 654 | Ga0207640_10172991 | 3300025981 | Bacteria | 1611 |
| 655 | Ga0207658_10069256 | 3300025986 | Bacteria | 2665 |
| 656 | Ga0207658_10081452 | 3300025986 | Bacteria | 2482 |
| 657 | Ga0207677_10020944 | 3300026023 | Bacteria | 3984 |
| 658 | Ga0207677_10080635 | 3300026023 | Bacteria | 2332 |
| 659 | Ga0207677_10122710 | 3300026023 | Bacteria | 1957 |
| 660 | Ga0207677_10350945 | 3300026023 | Bacteria | 1236 |
| 661 | Ga0207703_10094545 | 3300026035 | Bacteria | 2520 |
| 662 | Ga0207639_10006130 | 3300026041 | Bacteria | 8161 |
| 663 | Ga0207639_10137462 | 3300026041 | Bacteria | 2031 |
| 664 | Ga0207639_10270931 | 3300026041 | Bacteria | 1489 |
| 665 | Ga0207678_10052971 | 3300026067 | Bacteria | 3498 |
| 666 | Ga0207678_10176787 | 3300026067 | Bacteria | 1823 |
| 667 | Ga0207702_10000249 | 3300026078 | Bacteria | 62542 |
| 668 | Ga0207702_10009673 | 3300026078 | Bacteria | 8093 |
| 669 | Ga0207702_10010544 | 3300026078 | Bacteria | 7725 |
| 670 | Ga0207702_10035034 | 3300026078 | Bacteria | 4197 |
| 671 | Ga0207702_10036092 | 3300026078 | Bacteria | 4134 |
| 672 | Ga0207702_10204751 | 3300026078 | Unclassified | 1831 |
| 673 | Ga0207702_10714360 | 3300026078 | Bacteria | 988 |
| 674 | Ga0207702_11078720 | 3300026078 | Bacteria | 797 |
| 675 | Ga0207641_10007365 | 3300026088 | Bacteria | 9163 |
| 676 | Ga0207641_10120909 | 3300026088 | Bacteria | 2337 |
| 677 | Ga0207641_10415418 | 3300026088 | Bacteria | 1294 |
| 678 | Ga0207648_10000510 | 3300026089 | Bacteria | 43437 |
| 679 | Ga0207648_10001095 | 3300026089 | Bacteria | 30359 |
| 680 | Ga0207648_10021772 | 3300026089 | Bacteria | 5759 |
| 681 | Ga0207648_10055384 | 3300026089 | Bacteria | 3462 |
| 682 | Ga0207648_10083555 | 3300026089 | Bacteria | 2785 |
| 683 | Ga0207648_10092067 | 3300026089 | Bacteria | 2651 |
| 684 | Ga0207648_10178422 | 3300026089 | Bacteria | 1879 |
| 685 | Ga0207676_10011977 | 3300026095 | Bacteria | 6207 |
| 686 | Ga0207676_10050878 | 3300026095 | Bacteria | 3233 |
| 687 | Ga0207676_10116109 | 3300026095 | Bacteria | 2249 |
| 688 | Ga0207676_11049257 | 3300026095 | Bacteria | 804 |
| 689 | Ga0207674_10008194 | 3300026116 | Bacteria | 12110 |
| 690 | Ga0207674_10009099 | 3300026116 | Bacteria | 11397 |
| 691 | Ga0207674_10041481 | 3300026116 | Bacteria | 4760 |
| 692 | Ga0207674_10097503 | 3300026116 | Bacteria | 2924 |
| 693 | Ga0207674_10126818 | 3300026116 | Unclassified | 2518 |
| 694 | Ga0207674_10218084 | 3300026116 | Bacteria | 1856 |
| 695 | Ga0207674_10346348 | 3300026116 | Bacteria | 1437 |
| 696 | Ga0207675_100024542 | 3300026118 | Bacteria | 5605 |
| 697 | Ga0207675_100856970 | 3300026118 | Bacteria | 924 |
| 698 | Ga0207683_10005179 | 3300026121 | Bacteria | 11193 |
| 699 | Ga0207683_10061266 | 3300026121 | Bacteria | 3311 |
| 700 | Ga0207683_10122996 | 3300026121 | Bacteria | 2331 |
| 701 | Ga0207683_10556700 | 3300026121 | Bacteria | 1060 |
| 702 | Ga0207698_10022714 | 3300026142 | Bacteria | 4367 |
| 703 | Ga0207698_10191858 | 3300026142 | Unclassified | 1821 |
| 704 | Ga0268266_10000030 | 3300028379 | Bacteria | 417120 |
| 705 | Ga0268266_10000845 | 3300028379 | Bacteria | 39924 |
| 706 | Ga0268266_10052969 | 3300028379 | Bacteria | 3485 |
| 707 | Ga0268264_10100624 | 3300028381 | Bacteria | 2511 |
| 708 | Ga0268264_10214036 | 3300028381 | Bacteria | 1771 |
| 709 | Ga0268264_10224140 | 3300028381 | Unclassified | 1732 |
| 710 | Ga0268264_10514284 | 3300028381 | Bacteria | 1169 |
| 711 | Ga0307517_10039555 | 3300028786 | Bacteria | 5174 |
| 712 | Ga0307515_10000859 | 3300028794 | Bacteria | 69963 |
| 713 | Ga0307515_10001574 | 3300028794 | Bacteria | 50970 |
| 714 | Ga0307515_10099128 | 3300028794 | Unclassified | 3541 |
| 715 | Ga0316177_1082586 | 3300030731 | Bacteria | 11362 |
| 716 | Ga0316176_1049708 | 3300030732 | Bacteria | 17137 |
| 717 | Ga0316183_1098942 | 3300030742 | Bacteria | 10393 |
| 718 | Ga0316181_1041568 | 3300030744 | Bacteria | 14224 |
| 719 | Ga0265327_10000026 | 3300031251 | Bacteria | 379288 |
| 720 | Ga0265327_10000030 | 3300031251 | Bacteria | 333531 |
| 721 | Ga0265327_10000137 | 3300031251 | Bacteria | 160704 |
| 722 | Ga0265327_10053815 | 3300031251 | Bacteria | 2086 |
| 723 | Ga0265327_10102367 | 3300031251 | Bacteria | 1380 |
| 724 | Ga0265327_10189712 | 3300031251 | Bacteria | 936 |
| 725 | Ga0307509_10062346 | 3300031507 | Bacteria | 3932 |
| 726 | Ga0307408_100003148 | 3300031548 | Bacteria | 11370 |
| 727 | Ga0307408_100004875 | 3300031548 | Bacteria | 9039 |
| 728 | Ga0307408_100007443 | 3300031548 | Bacteria | 7243 |
| 729 | Ga0307405_10000481 | 3300031731 | Bacteria | 14975 |
| 730 | Ga0307405_10047381 | 3300031731 | Bacteria | 2646 |
| 731 | Ga0307407_10000041 | 3300031903 | Bacteria | 65180 |
| 732 | Ga0307412_10000142 | 3300031911 | Bacteria | 51770 |
| 733 | Ga0307412_10000823 | 3300031911 | Bacteria | 17889 |
| 734 | Ga0307412_10027106 | 3300031911 | Bacteria | 3569 |
| 735 | Ga0307412_10100605 | 3300031911 | Bacteria | 2044 |
| 736 | Ga0307416_100000029 | 3300032002 | Bacteria | 164815 |
| 737 | Ga0307414_10000269 | 3300032004 | Bacteria | 32505 |
| 738 | Ga0307414_10000504 | 3300032004 | Bacteria | 20317 |
| 739 | Ga0307414_10011832 | 3300032004 | Bacteria | 5137 |
| 740 | Ga0307414_10032775 | 3300032004 | Bacteria | 3426 |
| 741 | Ga0307414_10396129 | 3300032004 | Bacteria | 1198 |
| 742 | Ga0307411_10301092 | 3300032005 | Bacteria | 1286 |
| 743 | Ga0307415_100536055 | 3300032126 | Bacteria | 1030 |
| 744 | Ga0307507_10000510 | 3300033179 | Bacteria | 81853 |
| 745 | Ga0373924_0028945 | 3300035410 | Bacteria | 2211 |
| 746 | Ga0373933_0067349 | 3300035724 | Bacteria | 2172 |
| 747 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 748 | Ga0395899_0000209 | 3300037312 | Bacteria | 85489 |
| 749 | Ga0395899_0000526 | 3300037312 | Bacteria | 42013 |
| 750 | Ga0395899_0000749 | 3300037312 | Bacteria | 32276 |
| 751 | Ga0395899_0003678 | 3300037312 | Bacteria | 12144 |
| 752 | Ga0395899_0045558 | 3300037312 | Bacteria | 3268 |
| 753 | Ga0395899_0058035 | 3300037312 | Bacteria | 2855 |
| 754 | Ga0395899_0296586 | 3300037312 | Bacteria | 1095 |
| 755 | Ga0395900_0000406 | 3300037418 | Bacteria | 62078 |
| 756 | Ga0395900_0021329 | 3300037418 | Bacteria | 6622 |
| 757 | Ga0395900_0029525 | 3300037418 | Bacteria | 5624 |
| 758 | Ga0395900_0032777 | 3300037418 | Bacteria | 5344 |
| 759 | Ga0395900_0046849 | 3300037418 | Bacteria | 4451 |
| 760 | Ga0395900_0056520 | 3300037418 | Bacteria | 4039 |
| 761 | Ga0395900_0115526 | 3300037418 | Bacteria | 2754 |
| 762 | Ga0395900_0127250 | 3300037418 | Bacteria | 2612 |
| 763 | Ga0395900_0128798 | 3300037418 | Bacteria | 2594 |
| 764 | Ga0395900_0146344 | 3300037418 | Bacteria | 2415 |
| 765 | Ga0395900_0305199 | 3300037418 | Bacteria | 1576 |
| 766 | Ga0395898_0003004 | 3300037466 | Bacteria | 19122 |
| 767 | Ga0395898_0004432 | 3300037466 | Bacteria | 15361 |
| 768 | Ga0395898_0016694 | 3300037466 | Bacteria | 7503 |
| 769 | Ga0395898_0016836 | 3300037466 | Bacteria | 7467 |
| 770 | Ga0395898_0058458 | 3300037466 | Bacteria | 3753 |
| 771 | Ga0395898_0103450 | 3300037466 | Bacteria | 2732 |
| 772 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 773 | Ga0395905_0000175 | 3300037471 | Bacteria | 104024 |
| 774 | Ga0395905_0000376 | 3300037471 | Bacteria | 63695 |
| 775 | Ga0395905_0000981 | 3300037471 | Bacteria | 36581 |
| 776 | Ga0395905_0034059 | 3300037471 | Bacteria | 4783 |
| 777 | Ga0395905_0146663 | 3300037471 | Bacteria | 2220 |
| 778 | Ga0395901_0000313 | 3300038443 | Bacteria | 59766 |
| 779 | Ga0395901_0001780 | 3300038443 | Bacteria | 22229 |
| 780 | Ga0395901_0008545 | 3300038443 | Bacteria | 10348 |
| 781 | Ga0395901_0021706 | 3300038443 | Bacteria | 6578 |
| 782 | Ga0395901_0123470 | 3300038443 | Bacteria | 2721 |
| 783 | Ga0395901_0158398 | 3300038443 | Bacteria | 2378 |
| 784 | Ga0395901_0274631 | 3300038443 | Bacteria | 1752 |
| 785 | Ga0395901_0634788 | 3300038443 | Bacteria | 1073 |
| 786 | Ga0436365_0614130 | 3300039437 | Bacteria | 27402 |
| 787 | Ga0436365_1285215 | 3300039437 | Bacteria | 11167 |
| 788 | Ga0436361_0793109 | 3300039447 | Bacteria | 21720 |
| 789 | Ga0451791_1548410 | 3300041451 | Bacteria | 1261 |
| 790 | Ga0451795_0579925 | 3300041456 | Bacteria | 1084 |
| 791 | Ga0451807_1215663 | 3300041486 | Unclassified | 781 |
| 792 | Ga0451855_0129897 | 3300041511 | Unclassified | 1767 |
| 793 | Ga0439445_0002151 | 3300042004 | Bacteria | 4362 |
| 794 | Ga0439455_0079953 | 3300042012 | Bacteria | 887 |
| 795 | Ga0451577_0123928 | 3300042876 | Bacteria | 2316 |
| 796 | Ga0451577_0127077 | 3300042876 | Bacteria | 2285 |
| 797 | Ga0451577_0833259 | 3300042876 | Bacteria | 832 |
| 798 | Ga0466972_0000055 | 3300044658 | Bacteria | 111338 |
| 799 | Ga0453683_0170060 | 3300044673 | Bacteria | 1380 |
| 800 | Ga0466965_0290632 | 3300044683 | Bacteria | 885 |
| 801 | Ga0466966_0166267 | 3300044684 | Bacteria | 1341 |
| 802 | Ga0466961_0029110 | 3300044693 | Bacteria | 3551 |
| 803 | Ga0453684_0010580 | 3300044712 | Bacteria | 15739 |
| 804 | Ga0453684_0042221 | 3300044712 | Bacteria | 6151 |
| 805 | Ga0453684_0212825 | 3300044712 | Bacteria | 2245 |
| 806 | Ga0453684_0376747 | 3300044712 | Bacteria | 1594 |
| 807 | Ga0453684_0823714 | 3300044712 | Bacteria | 999 |
| 808 | Ga0466970_0001040 | 3300044765 | Bacteria | 13412 |
| 809 | Ga0466970_0023647 | 3300044765 | Bacteria | 3211 |
| 810 | Ga0451576_0000012 | 3300045051 | Bacteria | 674684 |
| 811 | Ga0466958_0045640 | 3300045836 | Bacteria | 2644 |
| 812 | Ga0466967_0240144 | 3300045976 | Bacteria | 1728 |
| 813 | Ga0495627_000881 | 3300046453 | Bacteria | 21138 |
| 814 | Ga0495638_0140896 | 3300046460 | Bacteria | 1408 |
| 815 | Ga0495651_0076728 | 3300046462 | Bacteria | 2531 |
| 816 | Ga0495651_0242095 | 3300046462 | Bacteria | 1237 |
| 817 | Ga0495650_0001050 | 3300046471 | Bacteria | 30706 |
| 818 | Ga0495650_0057509 | 3300046471 | Bacteria | 1574 |
| 819 | Ga0495585_0000153 | 3300046492 | Bacteria | 74267 |
| 820 | Ga0495594_0302665 | 3300046499 | Bacteria | 911 |
| 821 | Ga0495583_0076587 | 3300046506 | Bacteria | 1461 |
| 822 | Ga0495606_0000033 | 3300046507 | Bacteria | 247739 |
| 823 | Ga0495606_0009027 | 3300046507 | Bacteria | 8517 |
| 824 | Ga0495606_0234457 | 3300046507 | Unclassified | 1027 |
| 825 | Ga0495610_0000093 | 3300046512 | Bacteria | 105873 |
| 826 | Ga0495610_0002547 | 3300046512 | Bacteria | 15174 |
| 827 | Ga0495610_0002700 | 3300046512 | Bacteria | 14625 |
| 828 | Ga0495616_0051386 | 3300046513 | Bacteria | 2056 |
| 829 | Ga0495618_0057138 | 3300046514 | Bacteria | 2471 |
| 830 | Ga0495630_0018579 | 3300046517 | Bacteria | 5109 |
| 831 | Ga0495631_0178872 | 3300046518 | Bacteria | 909 |
| 832 | Ga0495637_0055151 | 3300046520 | Bacteria | 1649 |
| 833 | Ga0495644_0008891 | 3300046523 | Bacteria | 3863 |
| 834 | Ga0495648_0008346 | 3300046524 | Bacteria | 8165 |
| 835 | Ga0495642_0108783 | 3300046528 | Bacteria | 1184 |
| 836 | Ga0495652_0138696 | 3300046529 | Bacteria | 1915 |
| 837 | Ga0495586_0293154 | 3300046535 | Bacteria | 932 |
| 838 | Ga0495633_0000137 | 3300046558 | Bacteria | 96876 |
| 839 | Ga0495633_0004346 | 3300046558 | Bacteria | 9047 |
| 840 | Ga0495668_0000009 | 3300046616 | Bacteria | 492623 |
| 841 | Ga0495668_0000187 | 3300046616 | Bacteria | 92571 |
| 842 | Ga0495668_0034499 | 3300046616 | Bacteria | 2838 |
| 843 | Ga0495668_0221517 | 3300046616 | Bacteria | 1036 |
| 844 | Ga0495611_0280244 | 3300046648 | Unclassified | 770 |
| 845 | Ga0495625_0000131 | 3300046660 | Bacteria | 117738 |
| 846 | Ga0495625_0000385 | 3300046660 | Bacteria | 67419 |
| 847 | Ga0495625_0001975 | 3300046660 | Bacteria | 23138 |
| 848 | Ga0495625_0038288 | 3300046660 | Bacteria | 3512 |
| 849 | Ga0495625_0471515 | 3300046660 | Bacteria | 772 |
| 850 | Ga0495661_0005299 | 3300046665 | Bacteria | 9169 |
| 851 | Ga0495661_0043674 | 3300046665 | Bacteria | 2753 |
| 852 | Ga0495661_0071661 | 3300046665 | Bacteria | 2024 |
| 853 | Ga0495658_0037745 | 3300046683 | Bacteria | 2672 |
| 854 | Ga0495669_0169611 | 3300046684 | Unclassified | 1038 |
| 855 | Ga0495671_0206250 | 3300046692 | Bacteria | 953 |
| 856 | Ga0495649_0000009 | 3300046694 | Bacteria | 451725 |
| 857 | Ga0495660_0007516 | 3300046810 | Bacteria | 6396 |
| 858 | Ga0495680_0125309 | 3300047322 | Bacteria | 1893 |
| 859 | Ga0495687_000483 | 3300047443 | Bacteria | 48330 |
| 860 | Ga0495687_000882 | 3300047443 | Bacteria | 31691 |
| 861 | Ga0495685_078947 | 3300047447 | Bacteria | 1097 |
| 862 | Ga0495673_0054749 | 3300047469 | Bacteria | 1734 |
| 863 | Ga0495681_0212897 | 3300047470 | Bacteria | 778 |
| 864 | Ga0495684_0172942 | 3300047471 | Bacteria | 1605 |
| 865 | Ga0495686_0000299 | 3300047472 | Bacteria | 85384 |
| 866 | Ga0495686_0001086 | 3300047472 | Bacteria | 32331 |
| 867 | Ga0495686_0006681 | 3300047472 | Bacteria | 8778 |
| 868 | Ga0495686_0153381 | 3300047472 | Bacteria | 1351 |
| 869 | Ga0495686_0159993 | 3300047472 | Bacteria | 1316 |
| 870 | Ga0495686_0199183 | 3300047472 | Unclassified | 1150 |
| 871 | Ga0495686_0227655 | 3300047472 | Bacteria | 1057 |
| 872 | Ga0495614_0014365 | 3300048089 | Bacteria | 3466 |
| 873 | Ga0496101_0112180 | 3300048904 | Bacteria | 2054 |
| 874 | Ga0496105_0201029 | 3300048908 | Unclassified | 1627 |
| 875 | Ga0496106_0235653 | 3300048909 | Bacteria | 1462 |
| 876 | Ga0496106_0588096 | 3300048909 | Bacteria | 892 |
| 877 | Ga0496108_0533744 | 3300048911 | Bacteria | 1024 |
| 878 | Ga0496114_0000420 | 3300048917 | Bacteria | 31391 |
| 879 | Ga0496116_0001546 | 3300048919 | Bacteria | 25478 |
| 880 | Ga0496117_0007089 | 3300048920 | Bacteria | 11078 |
| 881 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 882 | Ga0496122_0000014 | 3300048925 | Bacteria | 491410 |
| 883 | Ga0496122_0000479 | 3300048925 | Bacteria | 83186 |
| 884 | Ga0496122_0005425 | 3300048925 | Bacteria | 15202 |
| 885 | Ga0496123_0004038 | 3300048926 | Bacteria | 15821 |
| 886 | Ga0496123_0007432 | 3300048926 | Bacteria | 10318 |
| 887 | Ga0496123_0246268 | 3300048926 | Bacteria | 884 |
| 888 | Ga0496124_0023126 | 3300048927 | Bacteria | 5683 |
| 889 | Ga0496125_0085272 | 3300048928 | Bacteria | 2394 |
| 890 | Ga0496126_0000019 | 3300048929 | Bacteria | 564723 |
| 891 | Ga0496126_0033933 | 3300048929 | Bacteria | 4799 |
| 892 | Ga0495682_0034191 | 3300049460 | Bacteria | 1875 |
| 893 | Ga0501031_0000222 | 3300049568 | Bacteria | 32499 |
| 894 | Ga0501032_0002894 | 3300049569 | Bacteria | 13347 |
| 895 | Ga0501032_0020282 | 3300049569 | Bacteria | 4632 |
| 896 | Ga0501032_0189343 | 3300049569 | Bacteria | 1345 |
| 897 | Ga0501032_0395420 | 3300049569 | Bacteria | 888 |
| 898 | Ga0501033_0000042 | 3300049570 | Bacteria | 137850 |
| 899 | Ga0501033_0105401 | 3300049570 | Bacteria | 2055 |
| 900 | Ga0501033_0122732 | 3300049570 | Bacteria | 1884 |
| 901 | Ga0501033_0156647 | 3300049570 | Unclassified | 1641 |
| 902 | Ga0501034_0000575 | 3300049571 | Bacteria | 58033 |
| 903 | Ga0501034_0022033 | 3300049571 | Bacteria | 6491 |
| 904 | Ga0501034_0024146 | 3300049571 | Bacteria | 6184 |
| 905 | Ga0501034_0086406 | 3300049571 | Bacteria | 3137 |
| 906 | Ga0501034_0133366 | 3300049571 | Bacteria | 2466 |
| 907 | Ga0501034_0702248 | 3300049571 | Unclassified | 910 |
| 908 | Ga0501036_0003797 | 3300049572 | Bacteria | 12116 |
| 909 | Ga0501036_0057048 | 3300049572 | Bacteria | 3308 |
| 910 | Ga0501037_0005070 | 3300049573 | Bacteria | 9585 |
| 911 | Ga0501037_0146479 | 3300049573 | Bacteria | 1689 |
| 912 | Ga0501037_0351035 | 3300049573 | Bacteria | 1018 |
| 913 | Ga0501038_0001828 | 3300049574 | Bacteria | 19698 |
| 914 | Ga0501038_0039950 | 3300049574 | Bacteria | 4101 |
| 915 | Ga0501039_0013235 | 3300049575 | Bacteria | 6307 |
| 916 | Ga0501039_0352633 | 3300049575 | Unclassified | 1156 |
| 917 | Ga0501043_0000859 | 3300049579 | Bacteria | 26938 |
| 918 | Ga0501043_0011914 | 3300049579 | Bacteria | 6803 |
| 919 | Ga0501046_0048029 | 3300049580 | Bacteria | 3381 |
| 920 | Ga0501047_0005599 | 3300049581 | Bacteria | 11829 |
| 921 | Ga0501048_0116409 | 3300049582 | Bacteria | 1888 |
| 922 | Ga0501067_0096778 | 3300049583 | Bacteria | 1639 |
| 923 | Ga0501070_0044371 | 3300049586 | Unclassified | 3700 |
| 924 | Ga0501070_0075600 | 3300049586 | Bacteria | 2789 |
| 925 | Ga0501073_0001109 | 3300049589 | Bacteria | 19534 |
| 926 | Ga0501077_0164726 | 3300049593 | Bacteria | 1408 |
| 927 | Ga0501198_006634 | 3300049649 | Bacteria | 1652 |
| 928 | Ga0501208_075185 | 3300049655 | Bacteria | 686 |
| 929 | Ga0501223_001002 | 3300049663 | Bacteria | 6680 |
| 930 | Ga0501252_023451 | 3300049682 | Bacteria | 820 |
| 931 | Ga0501083_0020863 | 3300049744 | Bacteria | 4554 |
| 932 | Ga0501241_000831 | 3300049758 | Bacteria | 6554 |
| 933 | Ga0501241_047490 | 3300049758 | Bacteria | 843 |
| 934 | Ga0501035_0001848 | 3300049822 | Bacteria | 21321 |
| 935 | Ga0501035_0019376 | 3300049822 | Bacteria | 6259 |
| 936 | Ga0501035_0081243 | 3300049822 | Unclassified | 2861 |
| 937 | Ga0501035_0456697 | 3300049822 | Bacteria | 1056 |
| 938 | Ga0501044_0000452 | 3300049823 | Bacteria | 49992 |
| 939 | Ga0501044_0036729 | 3300049823 | Bacteria | 5124 |
| 940 | Ga0501044_0096944 | 3300049823 | Bacteria | 2970 |
| 941 | Ga0501044_0400073 | 3300049823 | Bacteria | 1286 |
| 942 | Ga0501045_0000439 | 3300049824 | Bacteria | 25508 |
| 943 | nmdc:mga0k408_22137_c2 | 3300050493 | Bacteria | 3111 |
| 944 | nmdc:mga0k408_282_c1 | 3300050493 | Bacteria | 27609 |
| 945 | nmdc:mga0k408_544_c1 | 3300050493 | Bacteria | 15911 |
| 946 | nmdc:mga0k408_65692_c1 | 3300050493 | Bacteria | 2112 |
| 947 | nmdc:mga07m45_168818_c1 | 3300050496 | Bacteria | 1271 |
| 948 | Ga0500635_0001217 | 3300053080 | Bacteria | 6162 |
| 949 | Ga0495619_0092134 | 3300053085 | Bacteria | 2053 |
| 950 | Ga0500644_0009828 | 3300053088 | Bacteria | 2571 |
| 951 | Ga0500581_059254 | 3300053089 | Bacteria | 1942 |
| 952 | Ga0500651_0000280 | 3300053093 | Bacteria | 29979 |
| 953 | Ga0500566_0004444 | 3300053094 | Bacteria | 8366 |
| 954 | Ga0500556_0017841 | 3300053104 | Bacteria | 2230 |
| 955 | Ga0500562_000083 | 3300053108 | Bacteria | 41350 |
| 956 | Ga0500608_019222 | 3300053122 | Bacteria | 3128 |
| 957 | Ga0500614_014079 | 3300053123 | Bacteria | 1766 |
| 958 | Ga0500618_000012 | 3300053125 | Bacteria | 185382 |
| 959 | Ga0500577_0104140 | 3300053142 | Bacteria | 1164 |
| 960 | Ga0500616_0004942 | 3300053153 | Bacteria | 9255 |
| 961 | Ga0500616_0044650 | 3300053153 | Bacteria | 2364 |
| 962 | Ga0500616_0080489 | 3300053153 | Bacteria | 1638 |
| 963 | Ga0500622_0000051 | 3300053156 | Bacteria | 145514 |
| 964 | Ga0500622_0001321 | 3300053156 | Bacteria | 20162 |
| 965 | Ga0500622_0003294 | 3300053156 | Bacteria | 10940 |
| 966 | Ga0500624_000281 | 3300053157 | Bacteria | 17593 |
| 967 | Ga0500627_0024315 | 3300053158 | Bacteria | 2478 |
| 968 | Ga0500645_019587 | 3300053730 | Bacteria | 2104 |
| 969 | Ga0500645_022425 | 3300053730 | Bacteria | 1942 |
| 970 | Ga0500661_003766 | 3300055283 | Bacteria | 2847 |
| 971 | Ga0500661_028909 | 3300055283 | Bacteria | 977 |
| 972 | 2586210491 | 2585427687 | Bacteria | 5544917 |
| 973 | 2599480366 | 2599185184 | Bacteria | 6430550 |
| 974 | 2722728755 | 2721755487 | Bacteria | 6357185 |
| 975 | 2738758039 | 2738541283 | Bacteria | 7222293 |
| 976 | 2738763759 | 2738541284 | Bacteria | 5199923 |
| 977 | 2738852329 | 2738541302 | Bacteria | 5944758 |
| 978 | 2739304474 | 2738543023 | Bacteria | 6767879 |
| 979 | 2739589781 | 2739367651 | Bacteria | 6359826 |
| 980 | 2739617926 | 2739367656 | Bacteria | 5152243 |
| 981 | 2739644122 | 2739367663 | Bacteria | 5040914 |
| 982 | 2776614896 | 2775506987 | Bacteria | 5373360 |
| 983 | 2819550305 | 2818991437 | Bacteria | 5805520 |
| 984 | 2819586850 | 2818991444 | Bacteria | 6968812 |
| 985 | 2819680619 | 2818991460 | Bacteria | 7595395 |
| 986 | 2842722486 | 2842722452 | Bacteria | 6263924 |
| 987 | 2842906776 | 2842903701 | Bacteria | 6986368 |
| 988 | 2842914593 | 2842909656 | Bacteria | 6185908 |
| 989 | 2849287082 | 2849281842 | Bacteria | 6065644 |
| 990 | 2852624780 | 2852623160 | Bacteria | 4376875 |
| 991 | 2852630013 | 2852627209 | Bacteria | 5896285 |
| 992 | 2857632359 | 2857627736 | Bacteria | 5625397 |
| 993 | 2884936331 | 2884933994 | Bacteria | 4535041 |
| 994 | 2890738609 | 2890737413 | Bacteria | 4269751 |
| 995 | 2896317934 | 2896317667 | Bacteria | 4606601 |
| 996 | 2896344932 | 2896344016 | Bacteria | 3811746 |
| 997 | 2898715251 | 2898713307 | Bacteria | 4110805 |
| 998 | 2902050224 | 2902048731 | Bacteria | 4976191 |
| 999 | 2904449402 | 2904445276 | Bacteria | 5310396 |
| 1000 | 2904784256 | 2904780799 | Bacteria | 5840761 |
| 1001 | 2919179120 | 2919177583 | Bacteria | 5641607 |
| 1002 | 2919188305 | 2919186247 | Bacteria | 6244071 |
| 1003 | 2919438218 | 2919437846 | Bacteria | 6199444 |
| 1004 | 2928083392 | 2928078545 | Bacteria | 6534839 |
| 1005 | 2928151345 | 2928147474 | Bacteria | 6512076 |
| 1006 | 2928520333 | 2928519762 | Bacteria | 1953908 |
| 1007 | 2929157003 | 2929154850 | Bacteria | 6753285 |
| 1008 | 2929245044 | 2929239360 | Bacteria | 7745570 |
| 1009 | 2932087263 | 2932082852 | Bacteria | 6563563 |
| 1010 | 2939664428 | 2939664404 | Bacteria | 6364494 |
| 1011 | 2945999440 | 2945997725 | Bacteria | 6404843 |
| 1012 | 2954016171 | 2954016120 | Bacteria | 6446024 |
| 1013 | 2977236040 | 2977232053 | Bacteria | 5485925 |
| 1014 | 3003233809 | 3003233435 | Bacteria | 4458031 |
| 1015 | 8055589100 | 8055588893 | Bacteria | 3619545 |
| 1016 | Ga0307510_10005801 | |||
| 1017 | SwRhRL2b_contig_1283784 | |||
| 1018 | SwRhRL2b_contig_1663050 | |||
| 1019 | SwRhRL2b_contig_1916358 | |||
| 1020 | SwRhRL2b_contig_2744323 | |||
| 1021 | SwRhRL2b_contig_3708819 | |||
| 1022 | JGI24741J21665_1018335 | |||
| 1023 | JGI24740J21852_10010217 | |||
| 1024 | JGI24740J21852_10025264 | |||
| 1025 | JGI24740J21852_10047026 | |||
| 1026 | JGI24739J22299_10009023 | |||
| 1027 | JGI24737J22298_10016579 | |||
| 1028 | JGI24735J21928_10000013 | |||
| 1029 | JGI24744J21845_10002459 | |||
| 1030 | JGI24744J21845_10011147 | |||
| 1031 | JGI25162J39368_1000180 | |||
| 1032 | JGI25162J39368_1001035 | |||
| 1033 | JGI25164J39214_1001426 | |||
| 1034 | JGI25152J39213_1000160 | |||
| 1035 | JGI25150J39212_1000002 | |||
| 1036 | JGI25151J46595_10000003 | |||
| 1037 | JGI25406J46586_10000320 | |||
| 1038 | JGI25153J46596_10000003 | |||
| 1039 | rootH1_10018516 | |||
| 1040 | rootH1_10020058 | |||
| 1041 | rootH1_10162869 | |||
| 1042 | rootH1_10188534 | |||
| 1043 | rootH2_10005336 | |||
| 1044 | rootH2_10039401 | |||
| 1045 | rootH2_10041787 | |||
| 1046 | rootH2_10050610 | |||
| 1047 | rootH2_10078540 | |||
| 1048 | rootH2_10096793 | |||
| 1049 | rootH2_10312559 | |||
| 1050 | rootL2_10077558 | |||
| 1051 | rootL2_10138667 | |||
| 1052 | rootL2_10142782 | |||
| 1053 | rootL2_10189067 | |||
| 1054 | rootL2_10233241 | |||
| 1055 | rootH1_10000549 | |||
| 1056 | rootH1_10065836 | |||
| 1057 | rootH1_10105207 | |||
| 1058 | rootH1_10136684 | |||
| 1059 | rootH1_10165942 | |||
| 1060 | rootH1_10217929 | |||
| 1061 | rootH1_10284471 | |||
| 1062 | rootH1_10312356 | |||
| 1063 | rootH1_10314976 | |||
| 1064 | JGI25160J50197_1000809 | |||
| 1065 | JGI25160J50197_1003840 | |||
| 1066 | Ga0055536_1000007 | |||
| 1067 | Ga0055528_1002286 | |||
| 1068 | Ga0055530_10001851 | |||
| 1069 | Ga0055530_10002693 | |||
| 1070 | Ga0055531_10000237 | |||
| 1071 | Ga0065165_1000190 | |||
| 1072 | Ga0065714_10002536 | |||
| 1073 | Ga0065714_10002974 | |||
| 1074 | Ga0065714_10007179 | |||
| 1075 | Ga0065714_10064993 | |||
| 1076 | Ga0065714_10065917 | |||
| 1077 | Ga0065714_10083180 | |||
| 1078 | Ga0065714_10104208 | |||
| 1079 | Ga0065714_10133435 | |||
| 1080 | Ga0065704_10070140 | |||
| 1081 | Ga0065704_10070358 | |||
| 1082 | Ga0065704_10071378 | |||
| 1083 | Ga0065704_10078114 | |||
| 1084 | Ga0065704_10080198 | |||
| 1085 | Ga0065704_10081542 | |||
| 1086 | Ga0065712_10003463 | |||
| 1087 | Ga0065712_10316161 | |||
| 1088 | Ga0070658_10000028 | |||
| 1089 | Ga0070658_10084497 | |||
| 1090 | Ga0070658_10091213 | |||
| 1091 | Ga0070658_10274336 | |||
| 1092 | Ga0070658_10296353 | |||
| 1093 | Ga0070658_10334546 | |||
| 1094 | Ga0070658_10507700 | |||
| 1095 | Ga0070676_10000004 | |||
| 1096 | Ga0070676_10000426 | |||
| 1097 | Ga0070676_10328403 | |||
| 1098 | Ga0070683_100013700 | |||
| 1099 | Ga0070683_100027378 | |||
| 1100 | Ga0070683_100032351 | |||
| 1101 | Ga0070683_100065783 | |||
| 1102 | Ga0070690_100015759 | |||
| 1103 | Ga0070670_100030789 | |||
| 1104 | Ga0070670_100045950 | |||
| 1105 | Ga0070670_100060851 | |||
| 1106 | Ga0070670_100375219 | |||
| 1107 | Ga0068869_100019499 | |||
| 1108 | Ga0068869_100044739 | |||
| 1109 | Ga0068869_100201745 | |||
| 1110 | Ga0070666_10024416 | |||
| 1111 | Ga0070666_10030332 | |||
| 1112 | Ga0070680_100011331 | |||
| 1113 | Ga0070680_100035814 | |||
| 1114 | Ga0070680_100046874 | |||
| 1115 | Ga0070680_100060193 | |||
| 1116 | Ga0070680_100265533 | |||
| 1117 | Ga0070682_100018125 | |||
| 1118 | Ga0068868_100001148 | |||
| 1119 | Ga0068868_100008840 | |||
| 1120 | Ga0068868_100061888 | |||
| 1121 | Ga0068868_100442776 | |||
| 1122 | Ga0068868_100592463 | |||
| 1123 | Ga0070660_100003457 | |||
| 1124 | Ga0070660_100020931 | |||
| 1125 | Ga0070660_100029171 | |||
| 1126 | Ga0070660_100076358 | |||
| 1127 | Ga0070660_100113149 | |||
| 1128 | Ga0070660_100115650 | |||
| 1129 | Ga0070660_100385728 | |||
| 1130 | Ga0070689_100309053 | |||
| 1131 | Ga0070691_10024526 | |||
| 1132 | Ga0070687_100076750 | |||
| 1133 | Ga0070687_100141208 | |||
| 1134 | Ga0070661_100023853 | |||
| 1135 | Ga0070661_100547611 | |||
| 1136 | Ga0070668_100295137 | |||
| 1137 | Ga0070669_100010920 | |||
| 1138 | Ga0070675_100013072 | |||
| 1139 | Ga0070675_100150274 | |||
| 1140 | Ga0070675_100297976 | |||
| 1141 | Ga0070675_100756468 | |||
| 1142 | Ga0070671_100028142 | |||
| 1143 | Ga0070671_100095618 | |||
| 1144 | Ga0070674_100020850 | |||
| 1145 | Ga0070674_100113808 | |||
| 1146 | Ga0070673_100093542 | |||
| 1147 | Ga0070673_100128526 | |||
| 1148 | Ga0070673_100184295 | |||
| 1149 | Ga0070673_100507900 | |||
| 1150 | Ga0070688_100075431 | |||
| 1151 | Ga0070688_100386269 | |||
| 1152 | Ga0070659_100000100 | |||
| 1153 | Ga0070659_100004457 | |||
| 1154 | Ga0070659_100015244 | |||
| 1155 | Ga0070659_100035543 | |||
| 1156 | Ga0070659_100042935 | |||
| 1157 | Ga0070659_100142050 | |||
| 1158 | Ga0070667_100006801 | |||
| 1159 | Ga0070667_100060914 | |||
| 1160 | Ga0070667_100062397 | |||
| 1161 | Ga0070667_100239016 | |||
| 1162 | Ga0070663_100004723 | |||
| 1163 | Ga0070663_100154470 | |||
| 1164 | Ga0070678_100001206 | |||
| 1165 | Ga0070678_100029061 | |||
| 1166 | Ga0070678_100039826 | |||
| 1167 | Ga0070678_100306542 | |||
| 1168 | Ga0070678_100681287 | |||
| 1169 | Ga0070662_100000014 | |||
| 1170 | Ga0070662_100003803 | |||
| 1171 | Ga0070662_100059800 | |||
| 1172 | Ga0070662_100082408 | |||
| 1173 | Ga0070662_100359515 | |||
| 1174 | Ga0070662_100418845 | |||
| 1175 | Ga0070681_10002077 | |||
| 1176 | Ga0070681_10908519 | |||
| 1177 | Ga0068867_100000636 | |||
| 1178 | Ga0068867_100035731 | |||
| 1179 | Ga0068867_100043873 | |||
| 1180 | Ga0068867_100047846 | |||
| 1181 | Ga0068867_100069414 | |||
| 1182 | Ga0068867_100089400 | |||
| 1183 | Ga0068867_100283141 | |||
| 1184 | Ga0068867_100753280 | |||
| 1185 | Ga0070685_10076041 | |||
| 1186 | Ga0070679_100000517 | |||
| 1187 | Ga0070679_100031317 | |||
| 1188 | Ga0070679_100064164 | |||
| 1189 | Ga0070679_100099245 | |||
| 1190 | Ga0070679_100107216 | |||
| 1191 | Ga0070679_100188124 | |||
| 1192 | Ga0070684_100020461 | |||
| 1193 | Ga0070684_100047930 | |||
| 1194 | Ga0070684_100060599 | |||
| 1195 | Ga0070684_100801724 | |||
| 1196 | Ga0068853_100008704 | |||
| 1197 | Ga0068853_100011075 | |||
| 1198 | Ga0068853_100050481 | |||
| 1199 | Ga0068853_100301312 | |||
| 1200 | Ga0068853_100330101 | |||
| 1201 | Ga0068853_100344676 | |||
| 1202 | Ga0068853_100354133 | |||
| 1203 | Ga0068853_100367136 | |||
| 1204 | Ga0068853_100500516 | |||
| 1205 | Ga0068853_100574457 | |||
| 1206 | Ga0068853_100766468 | |||
| 1207 | Ga0070672_100041407 | |||
| 1208 | Ga0070672_100113426 | |||
| 1209 | Ga0070672_100124147 | |||
| 1210 | Ga0070672_100186605 | |||
| 1211 | Ga0070665_100000032 | |||
| 1212 | Ga0070665_100000442 | |||
| 1213 | Ga0070665_100059771 | |||
| 1214 | Ga0070665_100161785 | |||
| 1215 | Ga0070704_100700516 | |||
| 1216 | Ga0068855_100000049 | |||
| 1217 | Ga0068855_100000658 | |||
| 1218 | Ga0068855_100004342 | |||
| 1219 | Ga0068855_100012340 | |||
| 1220 | Ga0068855_100030872 | |||
| 1221 | Ga0068855_100101452 | |||
| 1222 | Ga0068855_100143256 | |||
| 1223 | Ga0068855_100152064 | |||
| 1224 | Ga0068855_100176779 | |||
| 1225 | Ga0068855_100233879 | |||
| 1226 | Ga0068855_100445914 | |||
| 1227 | Ga0068855_100540825 | |||
| 1228 | Ga0070664_100018922 | |||
| 1229 | Ga0070664_100070386 | |||
| 1230 | Ga0070664_100217692 | |||
| 1231 | Ga0070664_100236044 | |||
| 1232 | Ga0070664_100363996 | |||
| 1233 | Ga0070664_100374788 | |||
| 1234 | Ga0068857_100016681 | |||
| 1235 | Ga0068857_100334011 | |||
| 1236 | Ga0068854_100213658 | |||
| 1237 | Ga0068854_100460043 | |||
| 1238 | Ga0068856_100000005 | |||
| 1239 | Ga0068856_100000424 | |||
| 1240 | Ga0068856_100045491 | |||
| 1241 | Ga0068856_100060542 | |||
| 1242 | Ga0068856_100161706 | |||
| 1243 | Ga0068856_100246115 | |||
| 1244 | Ga0068856_100264731 | |||
| 1245 | Ga0068856_100575876 | |||
| 1246 | Ga0068856_100910564 | |||
| 1247 | Ga0068856_101151736 | |||
| 1248 | Ga0070702_100065400 | |||
| 1249 | Ga0068852_100055520 | |||
| 1250 | Ga0068852_100208765 | |||
| 1251 | Ga0068852_100659888 | |||
| 1252 | Ga0068852_100759826 | |||
| 1253 | Ga0068859_100249854 | |||
| 1254 | Ga0068859_100250268 | |||
| 1255 | Ga0068859_100795592 | |||
| 1256 | Ga0068859_101006713 | |||
| 1257 | Ga0068864_100020770 | |||
| 1258 | Ga0068864_100051272 | |||
| 1259 | Ga0068864_100053174 | |||
| 1260 | Ga0068864_100149758 | |||
| 1261 | Ga0068864_100214985 | |||
| 1262 | Ga0068861_100079101 | |||
| 1263 | Ga0068861_100398783 | |||
| 1264 | Ga0068851_10012608 | |||
| 1265 | Ga0068870_10009985 | |||
| 1266 | Ga0068870_10169029 | |||
| 1267 | Ga0068870_10188031 | |||
| 1268 | Ga0068863_100033510 | |||
| 1269 | Ga0068863_100489852 | |||
| 1270 | Ga0068860_100023461 | |||
| 1271 | Ga0068860_100066819 | |||
| 1272 | Ga0068860_100120755 | |||
| 1273 | Ga0068860_100132142 | |||
| 1274 | Ga0068860_100190085 | |||
| 1275 | Ga0068860_100707649 | |||
| 1276 | Ga0068862_100086787 | |||
| 1277 | Ga0081539_10000147 | |||
| 1278 | Ga0070716_100146709 | |||
| 1279 | Ga0075366_10000173 | |||
| 1280 | Ga0075366_10000703 | |||
| 1281 | Ga0075366_10021146 | |||
| 1282 | Ga0075366_10024166 | |||
| 1283 | Ga0075366_10059185 | |||
| 1284 | Ga0097621_100000224 | |||
| 1285 | Ga0097621_100002869 | |||
| 1286 | Ga0097621_100009933 | |||
| 1287 | Ga0097621_100021511 | |||
| 1288 | Ga0097621_100098964 | |||
| 1289 | Ga0068871_100000021 | |||
| 1290 | Ga0068871_100005685 | |||
| 1291 | Ga0068871_100020267 | |||
| 1292 | Ga0068871_100156684 | |||
| 1293 | Ga0068871_100229905 | |||
| 1294 | Ga0068871_100455356 | |||
| 1295 | Ga0068865_100000045 | |||
| 1296 | Ga0068865_100008014 | |||
| 1297 | Ga0068865_100123051 | |||
| 1298 | Ga0097620_100249847 | |||
| 1299 | Ga0097620_100250272 | |||
| 1300 | Ga0097620_100795580 | |||
| 1301 | Ga0097620_101006767 | |||
| 1302 | Ga0105240_10000010 | |||
| 1303 | Ga0105240_10000692 | |||
| 1304 | Ga0105240_10007157 | |||
| 1305 | Ga0105240_10028192 | |||
| 1306 | Ga0105240_10049783 | |||
| 1307 | Ga0105240_10099660 | |||
| 1308 | Ga0105240_10160652 | |||
| 1309 | Ga0105240_10238146 | |||
| 1310 | Ga0105240_10248064 | |||
| 1311 | Ga0105240_10331948 | |||
| 1312 | Ga0105240_10443708 | |||
| 1313 | Ga0111539_10465879 | |||
| 1314 | Ga0111539_10632079 | |||
| 1315 | Ga0105243_10000008 | |||
| 1316 | Ga0105243_10338653 | |||
| 1317 | Ga0105241_10000305 | |||
| 1318 | Ga0105241_10016108 | |||
| 1319 | Ga0105241_10087436 | |||
| 1320 | Ga0105241_10114250 | |||
| 1321 | Ga0105241_10172562 | |||
| 1322 | Ga0105241_10190247 | |||
| 1323 | Ga0105241_11063497 | |||
| 1324 | Ga0105242_10030783 | |||
| 1325 | Ga0105242_10040564 | |||
| 1326 | Ga0105242_10142514 | |||
| 1327 | Ga0105242_10196246 | |||
| 1328 | Ga0105242_10197403 | |||
| 1329 | Ga0105242_10734019 | |||
| 1330 | Ga0105248_10035252 | |||
| 1331 | Ga0105248_10531310 | |||
| 1332 | Ga0105237_10001165 | |||
| 1333 | Ga0105237_10002429 | |||
| 1334 | Ga0105237_10003157 | |||
| 1335 | Ga0105237_10008501 | |||
| 1336 | Ga0105237_10019154 | |||
| 1337 | Ga0105237_10038945 | |||
| 1338 | Ga0105237_10156842 | |||
| 1339 | Ga0105237_10198468 | |||
| 1340 | Ga0105237_10215980 | |||
| 1341 | Ga0105237_10390870 | |||
| 1342 | Ga0105237_10835725 | |||
| 1343 | Ga0105238_10002640 | |||
| 1344 | Ga0105238_10281978 | |||
| 1345 | Ga0105249_10030794 | |||
| 1346 | Ga0105239_10000001 | |||
| 1347 | Ga0105239_10000222 | |||
| 1348 | Ga0105239_10003907 | |||
| 1349 | Ga0105239_10004417 | |||
| 1350 | Ga0105239_10007756 | |||
| 1351 | Ga0105239_10025053 | |||
| 1352 | Ga0105239_10027624 | |||
| 1353 | Ga0105239_10035531 | |||
| 1354 | Ga0105239_10040221 | |||
| 1355 | Ga0105239_10047543 | |||
| 1356 | Ga0105239_10048999 | |||
| 1357 | Ga0105239_10329326 | |||
| 1358 | Ga0105239_10939077 | |||
| 1359 | Ga0105246_10016055 | |||
| 1360 | Ga0105246_10157981 | |||
| 1361 | Ga0157373_10000493 | |||
| 1362 | Ga0157373_10001010 | |||
| 1363 | Ga0157373_10008371 | |||
| 1364 | Ga0157373_10023213 | |||
| 1365 | Ga0157373_10027560 | |||
| 1366 | Ga0157373_10038323 | |||
| 1367 | Ga0157373_10060689 | |||
| 1368 | Ga0157373_10112851 | |||
| 1369 | Ga0157373_10151139 | |||
| 1370 | Ga0157373_10165048 | |||
| 1371 | Ga0157371_10000266 | |||
| 1372 | Ga0157371_10001322 | |||
| 1373 | Ga0157371_10001388 | |||
| 1374 | Ga0157371_10001945 | |||
| 1375 | Ga0157371_10002423 | |||
| 1376 | Ga0157371_10002458 | |||
| 1377 | Ga0157371_10002705 | |||
| 1378 | Ga0157371_10003231 | |||
| 1379 | Ga0157371_10006449 | |||
| 1380 | Ga0157371_10027274 | |||
| 1381 | Ga0157371_10048234 | |||
| 1382 | Ga0157371_10048377 | |||
| 1383 | Ga0157371_10052792 | |||
| 1384 | Ga0157371_10064467 | |||
| 1385 | Ga0157371_10070397 | |||
| 1386 | Ga0157371_10176376 | |||
| 1387 | Ga0157371_10208448 | |||
| 1388 | Ga0157371_10240181 | |||
| 1389 | Ga0157370_10004347 | |||
| 1390 | Ga0157370_10009076 | |||
| 1391 | Ga0157370_10010549 | |||
| 1392 | Ga0157370_10016108 | |||
| 1393 | Ga0157370_10023734 | |||
| 1394 | Ga0157370_10026762 | |||
| 1395 | Ga0157370_10041735 | |||
| 1396 | Ga0157370_10051988 | |||
| 1397 | Ga0157370_10085326 | |||
| 1398 | Ga0157370_10088382 | |||
| 1399 | Ga0157370_10106422 | |||
| 1400 | Ga0157370_10159379 | |||
| 1401 | Ga0157370_10235881 | |||
| 1402 | Ga0157369_10000441 | |||
| 1403 | Ga0157369_10023235 | |||
| 1404 | Ga0157369_10092464 | |||
| 1405 | Ga0157369_10104538 | |||
| 1406 | Ga0157369_10140329 | |||
| 1407 | Ga0157369_10279306 | |||
| 1408 | Ga0157369_10337914 | |||
| 1409 | Ga0157369_10348473 | |||
| 1410 | Ga0157369_10516288 | |||
| 1411 | Ga0157374_10001269 | |||
| 1412 | Ga0157374_10008592 | |||
| 1413 | Ga0157374_10013320 | |||
| 1414 | Ga0157374_10017554 | |||
| 1415 | Ga0157374_10032990 | |||
| 1416 | Ga0157374_10034886 | |||
| 1417 | Ga0157374_10188789 | |||
| 1418 | Ga0157374_10399683 | |||
| 1419 | Ga0157374_10551995 | |||
| 1420 | Ga0157378_10001566 | |||
| 1421 | Ga0157378_10003663 | |||
| 1422 | Ga0157378_10012150 | |||
| 1423 | Ga0157378_10026674 | |||
| 1424 | Ga0157378_10028410 | |||
| 1425 | Ga0157378_10034723 | |||
| 1426 | Ga0157378_10144673 | |||
| 1427 | Ga0157378_10150800 | |||
| 1428 | Ga0157378_10257215 | |||
| 1429 | Ga0157378_10270077 | |||
| 1430 | Ga0157378_11064414 | |||
| 1431 | Ga0163162_10000010 | |||
| 1432 | Ga0163162_10001751 | |||
| 1433 | Ga0163162_10002720 | |||
| 1434 | Ga0163162_10004021 | |||
| 1435 | Ga0163162_10034404 | |||
| 1436 | Ga0163162_10046160 | |||
| 1437 | Ga0163162_10147273 | |||
| 1438 | Ga0163162_10157820 | |||
| 1439 | Ga0163162_10258188 | |||
| 1440 | Ga0163162_10264563 | |||
| 1441 | Ga0163162_10294345 | |||
| 1442 | Ga0163162_10324809 | |||
| 1443 | Ga0163162_10371489 | |||
| 1444 | Ga0163162_10466857 | |||
| 1445 | Ga0163162_10593162 | |||
| 1446 | Ga0163162_10611109 | |||
| 1447 | Ga0163162_10912003 | |||
| 1448 | Ga0157372_10000073 | |||
| 1449 | Ga0157372_10001839 | |||
| 1450 | Ga0157372_10002319 | |||
| 1451 | Ga0157372_10005120 | |||
| 1452 | Ga0157372_10006129 | |||
| 1453 | Ga0157372_10015677 | |||
| 1454 | Ga0157372_10030154 | |||
| 1455 | Ga0157372_10034703 | |||
| 1456 | Ga0157372_10070619 | |||
| 1457 | Ga0157372_10082045 | |||
| 1458 | Ga0157372_10082743 | |||
| 1459 | Ga0157372_10106606 | |||
| 1460 | Ga0157372_10118909 | |||
| 1461 | Ga0157372_10170040 | |||
| 1462 | Ga0157372_10230100 | |||
| 1463 | Ga0157372_10230257 | |||
| 1464 | Ga0157372_10386104 | |||
| 1465 | Ga0157372_10420886 | |||
| 1466 | Ga0157372_10556954 | |||
| 1467 | Ga0157375_10003126 | |||
| 1468 | Ga0157375_10008904 | |||
| 1469 | Ga0157375_10010047 | |||
| 1470 | Ga0157375_10015961 | |||
| 1471 | Ga0157375_10016953 | |||
| 1472 | Ga0157375_10093626 | |||
| 1473 | Ga0157375_10124312 | |||
| 1474 | Ga0157375_10134199 | |||
| 1475 | Ga0157375_10250437 | |||
| 1476 | Ga0157375_10261104 | |||
| 1477 | Ga0157375_10673574 | |||
| 1478 | Ga0157375_11560824 | |||
| 1479 | Ga0163163_10004021 | |||
| 1480 | Ga0163163_10221276 | |||
| 1481 | Ga0163163_10337801 | |||
| 1482 | Ga0163163_10662153 | |||
| 1483 | Ga0182008_10000017 | |||
| 1484 | Ga0182008_10000043 | |||
| 1485 | Ga0182008_10000934 | |||
| 1486 | Ga0182008_10047424 | |||
| 1487 | Ga0182008_10134310 | |||
| 1488 | Ga0157377_10002355 | |||
| 1489 | Ga0157377_10042679 | |||
| 1490 | Ga0157379_10038425 | |||
| 1491 | Ga0157379_10046246 | |||
| 1492 | Ga0157379_10047442 | |||
| 1493 | Ga0157379_10053941 | |||
| 1494 | Ga0157379_10122600 | |||
| 1495 | Ga0157379_10326861 | |||
| 1496 | Ga0157379_10461283 | |||
| 1497 | Ga0157376_10003029 | |||
| 1498 | Ga0157376_10011262 | |||
| 1499 | Ga0157376_10189803 | |||
| 1500 | Ga0157376_10655895 | |||
| 1501 | Ga0182006_1000128 | |||
| 1502 | Ga0182006_1001058 | |||
| 1503 | Ga0182006_1003032 | |||
| 1504 | Ga0182006_1026274 | |||
| 1505 | Ga0182006_1052740 | |||
| 1506 | Ga0182007_10000054 | |||
| 1507 | Ga0182007_10018595 | |||
| 1508 | Ga0182007_10047834 | |||
| 1509 | Ga0183373_1015 | |||
| 1510 | Ga0163161_10001077 | |||
| 1511 | Ga0163161_10001415 | |||
| 1512 | Ga0163161_10003355 | |||
| 1513 | Ga0163161_10009075 | |||
| 1514 | Ga0163161_10011686 | |||
| 1515 | Ga0163161_10020964 | |||
| 1516 | Ga0163161_10111331 | |||
| 1517 | Ga0163161_10263964 | |||
| 1518 | Ga0163161_10899461 | |||
| 1519 | Ga0206351_10643466 | |||
| 1520 | Ga0213872_10024047 | |||
| 1521 | Ga0213876_10004951 | |||
| 1522 | Ga0207427_100025 | |||
| 1523 | Ga0209437_100010 | |||
| 1524 | Ga0209437_100148 | |||
| 1525 | Ga0209258_112460 | |||
| 1526 | Ga0207425_1000004 | |||
| 1527 | Ga0209026_1000805 | |||
| 1528 | Ga0209026_1000875 | |||
| 1529 | Ga0209129_1000005 | |||
| 1530 | Ga0209129_1010719 | |||
| 1531 | Ga0209233_1000017 | |||
| 1532 | Ga0209233_1008486 | |||
| 1533 | Ga0209455_1004412 | |||
| 1534 | Ga0209676_1000058 | |||
| 1535 | Ga0209025_1000009 | |||
| 1536 | Ga0209758_1000010 | |||
| 1537 | Ga0209050_1000054 | |||
| 1538 | Ga0207426_1000030 | |||
| 1539 | Ga0209257_1000025 | |||
| 1540 | Ga0207697_10051715 | |||
| 1541 | Ga0207656_10009859 | |||
| 1542 | Ga0207642_10010276 | |||
| 1543 | Ga0207642_10147018 | |||
| 1544 | Ga0207642_10206662 | |||
| 1545 | Ga0207642_10252843 | |||
| 1546 | Ga0207680_10410355 | |||
| 1547 | Ga0207647_10000022 | |||
| 1548 | Ga0207647_10000499 | |||
| 1549 | Ga0207647_10004321 | |||
| 1550 | Ga0207647_10338523 | |||
| 1551 | Ga0207645_10000151 | |||
| 1552 | Ga0207645_10000885 | |||
| 1553 | Ga0207645_10015713 | |||
| 1554 | Ga0207643_10004003 | |||
| 1555 | Ga0207705_10000045 | |||
| 1556 | Ga0207705_10008413 | |||
| 1557 | Ga0207705_10017000 | |||
| 1558 | Ga0207705_10044405 | |||
| 1559 | Ga0207705_10485749 | |||
| 1560 | Ga0207654_10002120 | |||
| 1561 | Ga0207654_10157450 | |||
| 1562 | Ga0207654_10164806 | |||
| 1563 | Ga0207654_10411554 | |||
| 1564 | Ga0207654_10426098 | |||
| 1565 | Ga0207707_10005461 | |||
| 1566 | Ga0207695_10000019 | |||
| 1567 | Ga0207695_10000020 | |||
| 1568 | Ga0207695_10003958 | |||
| 1569 | Ga0207695_10008283 | |||
| 1570 | Ga0207695_10014224 | |||
| 1571 | Ga0207695_10018922 | |||
| 1572 | Ga0207695_10046570 | |||
| 1573 | Ga0207695_10167957 | |||
| 1574 | Ga0207695_10237931 | |||
| 1575 | Ga0207695_10259311 | |||
| 1576 | Ga0207695_10273487 | |||
| 1577 | Ga0207671_10000030 | |||
| 1578 | Ga0207671_10000598 | |||
| 1579 | Ga0207671_10003239 | |||
| 1580 | Ga0207671_10011028 | |||
| 1581 | Ga0207671_10026560 | |||
| 1582 | Ga0207671_10055827 | |||
| 1583 | Ga0207671_10058076 | |||
| 1584 | Ga0207671_10071906 | |||
| 1585 | Ga0207671_10143677 | |||
| 1586 | Ga0207660_10006965 | |||
| 1587 | Ga0207660_10051946 | |||
| 1588 | Ga0207660_10215945 | |||
| 1589 | Ga0207660_10347568 | |||
| 1590 | Ga0207662_10027483 | |||
| 1591 | Ga0207662_10067807 | |||
| 1592 | Ga0207657_10001634 | |||
| 1593 | Ga0207657_10004444 | |||
| 1594 | Ga0207657_10010980 | |||
| 1595 | Ga0207657_10011267 | |||
| 1596 | Ga0207657_10076883 | |||
| 1597 | Ga0207657_10085863 | |||
| 1598 | Ga0207657_10251887 | |||
| 1599 | Ga0207657_10352626 | |||
| 1600 | Ga0207657_10442178 | |||
| 1601 | Ga0207657_10472136 | |||
| 1602 | Ga0207649_10003318 | |||
| 1603 | Ga0207649_10397148 | |||
| 1604 | Ga0207652_10000101 | |||
| 1605 | Ga0207652_10000616 | |||
| 1606 | Ga0207652_10066856 | |||
| 1607 | Ga0207652_10125949 | |||
| 1608 | Ga0207652_10154826 | |||
| 1609 | Ga0207652_10395785 | |||
| 1610 | Ga0207681_10064578 | |||
| 1611 | Ga0207681_10187533 | |||
| 1612 | Ga0207681_10342378 | |||
| 1613 | Ga0207694_10018165 | |||
| 1614 | Ga0207694_10161145 | |||
| 1615 | Ga0207650_10008032 | |||
| 1616 | Ga0207650_10126189 | |||
| 1617 | Ga0207650_10145444 | |||
| 1618 | Ga0207659_10036403 | |||
| 1619 | Ga0207644_10010200 | |||
| 1620 | Ga0207644_10071321 | |||
| 1621 | Ga0207644_10080754 | |||
| 1622 | Ga0207644_10178546 | |||
| 1623 | Ga0207644_10439473 | |||
| 1624 | Ga0207690_10029414 | |||
| 1625 | Ga0207690_10187068 | |||
| 1626 | Ga0207690_10255898 | |||
| 1627 | Ga0207706_10000047 | |||
| 1628 | Ga0207706_10002437 | |||
| 1629 | Ga0207706_10004864 | |||
| 1630 | Ga0207706_10068732 | |||
| 1631 | Ga0207706_10142600 | |||
| 1632 | Ga0207686_10155289 | |||
| 1633 | Ga0207709_10000006 | |||
| 1634 | Ga0207670_10126009 | |||
| 1635 | Ga0207669_10142655 | |||
| 1636 | Ga0207704_10000077 | |||
| 1637 | Ga0207704_10006021 | |||
| 1638 | Ga0207704_10105746 | |||
| 1639 | Ga0207691_10038025 | |||
| 1640 | Ga0207691_10054995 | |||
| 1641 | Ga0207691_10225154 | |||
| 1642 | Ga0207711_10020688 | |||
| 1643 | Ga0207689_10013159 | |||
| 1644 | Ga0207689_10018391 | |||
| 1645 | Ga0207689_10019124 | |||
| 1646 | Ga0207689_10199952 | |||
| 1647 | Ga0207661_10011467 | |||
| 1648 | Ga0207661_10041731 | |||
| 1649 | Ga0207661_10048489 | |||
| 1650 | Ga0207679_10004167 | |||
| 1651 | Ga0207679_10460266 | |||
| 1652 | Ga0207667_10000015 | |||
| 1653 | Ga0207667_10001154 | |||
| 1654 | Ga0207667_10001998 | |||
| 1655 | Ga0207667_10100799 | |||
| 1656 | Ga0207667_10130653 | |||
| 1657 | Ga0207667_10184001 | |||
| 1658 | Ga0207667_10413063 | |||
| 1659 | Ga0207667_10497882 | |||
| 1660 | Ga0207667_10877522 | |||
| 1661 | Ga0207667_10903059 | |||
| 1662 | Ga0207651_10013162 | |||
| 1663 | Ga0207651_10015118 | |||
| 1664 | Ga0207651_10016093 | |||
| 1665 | Ga0207651_10163018 | |||
| 1666 | Ga0207651_10193239 | |||
| 1667 | Ga0207712_10115130 | |||
| 1668 | Ga0207668_10217307 | |||
| 1669 | Ga0207640_10172991 | |||
| 1670 | Ga0207658_10069256 | |||
| 1671 | Ga0207658_10081452 | |||
| 1672 | Ga0207677_10020944 | |||
| 1673 | Ga0207677_10080635 | |||
| 1674 | Ga0207677_10122710 | |||
| 1675 | Ga0207677_10350945 | |||
| 1676 | Ga0207703_10094545 | |||
| 1677 | Ga0207639_10006130 | |||
| 1678 | Ga0207639_10137462 | |||
| 1679 | Ga0207639_10270931 | |||
| 1680 | Ga0207678_10052971 | |||
| 1681 | Ga0207678_10176787 | |||
| 1682 | Ga0207702_10000249 | |||
| 1683 | Ga0207702_10009673 | |||
| 1684 | Ga0207702_10010544 | |||
| 1685 | Ga0207702_10035034 | |||
| 1686 | Ga0207702_10036092 | |||
| 1687 | Ga0207702_10204751 | |||
| 1688 | Ga0207702_10714360 | |||
| 1689 | Ga0207702_11078720 | |||
| 1690 | Ga0207641_10007365 | |||
| 1691 | Ga0207641_10120909 | |||
| 1692 | Ga0207641_10415418 | |||
| 1693 | Ga0207648_10000510 | |||
| 1694 | Ga0207648_10001095 | |||
| 1695 | Ga0207648_10021772 | |||
| 1696 | Ga0207648_10055384 | |||
| 1697 | Ga0207648_10083555 | |||
| 1698 | Ga0207648_10092067 | |||
| 1699 | Ga0207648_10178422 | |||
| 1700 | Ga0207676_10011977 | |||
| 1701 | Ga0207676_10050878 | |||
| 1702 | Ga0207676_10116109 | |||
| 1703 | Ga0207676_11049257 | |||
| 1704 | Ga0207674_10008194 | |||
| 1705 | Ga0207674_10009099 | |||
| 1706 | Ga0207674_10041481 | |||
| 1707 | Ga0207674_10097503 | |||
| 1708 | Ga0207674_10126818 | |||
| 1709 | Ga0207674_10218084 | |||
| 1710 | Ga0207674_10346348 | |||
| 1711 | Ga0207675_100024542 | |||
| 1712 | Ga0207675_100856970 | |||
| 1713 | Ga0207683_10005179 | |||
| 1714 | Ga0207683_10061266 | |||
| 1715 | Ga0207683_10122996 | |||
| 1716 | Ga0207683_10556700 | |||
| 1717 | Ga0207698_10022714 | |||
| 1718 | Ga0207698_10191858 | |||
| 1719 | Ga0268266_10000030 | |||
| 1720 | Ga0268266_10000845 | |||
| 1721 | Ga0268266_10052969 | |||
| 1722 | Ga0268264_10100624 | |||
| 1723 | Ga0268264_10214036 | |||
| 1724 | Ga0268264_10224140 | |||
| 1725 | Ga0268264_10514284 | |||
| 1726 | Ga0307517_10039555 | |||
| 1727 | Ga0307515_10000859 | |||
| 1728 | Ga0307515_10001574 | |||
| 1729 | Ga0307515_10099128 | |||
| 1730 | Ga0316177_1082586 | |||
| 1731 | Ga0316176_1049708 | |||
| 1732 | Ga0316183_1098942 | |||
| 1733 | Ga0316181_1041568 | |||
| 1734 | Ga0265327_10000026 | |||
| 1735 | Ga0265327_10000030 | |||
| 1736 | Ga0265327_10000137 | |||
| 1737 | Ga0265327_10053815 | |||
| 1738 | Ga0265327_10102367 | |||
| 1739 | Ga0265327_10189712 | |||
| 1740 | Ga0307509_10062346 | |||
| 1741 | Ga0307408_100003148 | |||
| 1742 | Ga0307408_100004875 | |||
| 1743 | Ga0307408_100007443 | |||
| 1744 | Ga0307405_10000481 | |||
| 1745 | Ga0307405_10047381 | |||
| 1746 | Ga0307407_10000041 | |||
| 1747 | Ga0307412_10000142 | |||
| 1748 | Ga0307412_10000823 | |||
| 1749 | Ga0307412_10027106 | |||
| 1750 | Ga0307412_10100605 | |||
| 1751 | Ga0307416_100000029 | |||
| 1752 | Ga0307414_10000269 | |||
| 1753 | Ga0307414_10000504 | |||
| 1754 | Ga0307414_10011832 | |||
| 1755 | Ga0307414_10032775 | |||
| 1756 | Ga0307414_10396129 | |||
| 1757 | Ga0307411_10301092 | |||
| 1758 | Ga0307415_100536055 | |||
| 1759 | Ga0307507_10000510 | |||
| 1760 | Ga0373924_0028945 | |||
| 1761 | Ga0373933_0067349 | |||
| 1762 | Ga0395899_0000002 | |||
| 1763 | Ga0395899_0000209 | |||
| 1764 | Ga0395899_0000526 | |||
| 1765 | Ga0395899_0000749 | |||
| 1766 | Ga0395899_0003678 | |||
| 1767 | Ga0395899_0045558 | |||
| 1768 | Ga0395899_0058035 | |||
| 1769 | Ga0395899_0296586 | |||
| 1770 | Ga0395900_0000406 | |||
| 1771 | Ga0395900_0021329 | |||
| 1772 | Ga0395900_0029525 | |||
| 1773 | Ga0395900_0032777 | |||
| 1774 | Ga0395900_0046849 | |||
| 1775 | Ga0395900_0056520 | |||
| 1776 | Ga0395900_0115526 | |||
| 1777 | Ga0395900_0127250 | |||
| 1778 | Ga0395900_0128798 | |||
| 1779 | Ga0395900_0146344 | |||
| 1780 | Ga0395900_0305199 | |||
| 1781 | Ga0395898_0003004 | |||
| 1782 | Ga0395898_0004432 | |||
| 1783 | Ga0395898_0016694 | |||
| 1784 | Ga0395898_0016836 | |||
| 1785 | Ga0395898_0058458 | |||
| 1786 | Ga0395898_0103450 | |||
| 1787 | Ga0395905_0000003 | |||
| 1788 | Ga0395905_0000175 | |||
| 1789 | Ga0395905_0000376 | |||
| 1790 | Ga0395905_0000981 | |||
| 1791 | Ga0395905_0034059 | |||
| 1792 | Ga0395905_0146663 | |||
| 1793 | Ga0395901_0000313 | |||
| 1794 | Ga0395901_0001780 | |||
| 1795 | Ga0395901_0008545 | |||
| 1796 | Ga0395901_0021706 | |||
| 1797 | Ga0395901_0123470 | |||
| 1798 | Ga0395901_0158398 | |||
| 1799 | Ga0395901_0274631 | |||
| 1800 | Ga0395901_0634788 | |||
| 1801 | Ga0436365_0614130 | |||
| 1802 | Ga0436365_1285215 | |||
| 1803 | Ga0436361_0793109 | |||
| 1804 | Ga0451791_1548410 | |||
| 1805 | Ga0451795_0579925 | |||
| 1806 | Ga0451807_1215663 | |||
| 1807 | Ga0451855_0129897 | |||
| 1808 | Ga0439445_0002151 | |||
| 1809 | Ga0439455_0079953 | |||
| 1810 | Ga0451577_0123928 | |||
| 1811 | Ga0451577_0127077 | |||
| 1812 | Ga0451577_0833259 | |||
| 1813 | Ga0466972_0000055 | |||
| 1814 | Ga0453683_0170060 | |||
| 1815 | Ga0466965_0290632 | |||
| 1816 | Ga0466966_0166267 | |||
| 1817 | Ga0466961_0029110 | |||
| 1818 | Ga0453684_0010580 | |||
| 1819 | Ga0453684_0042221 | |||
| 1820 | Ga0453684_0212825 | |||
| 1821 | Ga0453684_0376747 | |||
| 1822 | Ga0453684_0823714 | |||
| 1823 | Ga0466970_0001040 | |||
| 1824 | Ga0466970_0023647 | |||
| 1825 | Ga0451576_0000012 | |||
| 1826 | Ga0466958_0045640 | |||
| 1827 | Ga0466967_0240144 | |||
| 1828 | Ga0495627_000881 | |||
| 1829 | Ga0495638_0140896 | |||
| 1830 | Ga0495651_0076728 | |||
| 1831 | Ga0495651_0242095 | |||
| 1832 | Ga0495650_0001050 | |||
| 1833 | Ga0495650_0057509 | |||
| 1834 | Ga0495585_0000153 | |||
| 1835 | Ga0495594_0302665 | |||
| 1836 | Ga0495583_0076587 | |||
| 1837 | Ga0495606_0000033 | |||
| 1838 | Ga0495606_0009027 | |||
| 1839 | Ga0495606_0234457 | |||
| 1840 | Ga0495610_0000093 | |||
| 1841 | Ga0495610_0002547 | |||
| 1842 | Ga0495610_0002700 | |||
| 1843 | Ga0495616_0051386 | |||
| 1844 | Ga0495618_0057138 | |||
| 1845 | Ga0495630_0018579 | |||
| 1846 | Ga0495631_0178872 | |||
| 1847 | Ga0495637_0055151 | |||
| 1848 | Ga0495644_0008891 | |||
| 1849 | Ga0495648_0008346 | |||
| 1850 | Ga0495642_0108783 | |||
| 1851 | Ga0495652_0138696 | |||
| 1852 | Ga0495586_0293154 | |||
| 1853 | Ga0495633_0000137 | |||
| 1854 | Ga0495633_0004346 | |||
| 1855 | Ga0495668_0000009 | |||
| 1856 | Ga0495668_0000187 | |||
| 1857 | Ga0495668_0034499 | |||
| 1858 | Ga0495668_0221517 | |||
| 1859 | Ga0495611_0280244 | |||
| 1860 | Ga0495625_0000131 | |||
| 1861 | Ga0495625_0000385 | |||
| 1862 | Ga0495625_0001975 | |||
| 1863 | Ga0495625_0038288 | |||
| 1864 | Ga0495625_0471515 | |||
| 1865 | Ga0495661_0005299 | |||
| 1866 | Ga0495661_0043674 | |||
| 1867 | Ga0495661_0071661 | |||
| 1868 | Ga0495658_0037745 | |||
| 1869 | Ga0495669_0169611 | |||
| 1870 | Ga0495671_0206250 | |||
| 1871 | Ga0495649_0000009 | |||
| 1872 | Ga0495660_0007516 | |||
| 1873 | Ga0495680_0125309 | |||
| 1874 | Ga0495687_000483 | |||
| 1875 | Ga0495687_000882 | |||
| 1876 | Ga0495685_078947 | |||
| 1877 | Ga0495673_0054749 | |||
| 1878 | Ga0495681_0212897 | |||
| 1879 | Ga0495684_0172942 | |||
| 1880 | Ga0495686_0000299 | |||
| 1881 | Ga0495686_0001086 | |||
| 1882 | Ga0495686_0006681 | |||
| 1883 | Ga0495686_0153381 | |||
| 1884 | Ga0495686_0159993 | |||
| 1885 | Ga0495686_0199183 | |||
| 1886 | Ga0495686_0227655 | |||
| 1887 | Ga0495614_0014365 | |||
| 1888 | Ga0496101_0112180 | |||
| 1889 | Ga0496105_0201029 | |||
| 1890 | Ga0496106_0235653 | |||
| 1891 | Ga0496106_0588096 | |||
| 1892 | Ga0496108_0533744 | |||
| 1893 | Ga0496114_0000420 | |||
| 1894 | Ga0496116_0001546 | |||
| 1895 | Ga0496117_0007089 | |||
| 1896 | Ga0496121_0000010 | |||
| 1897 | Ga0496122_0000014 | |||
| 1898 | Ga0496122_0000479 | |||
| 1899 | Ga0496122_0005425 | |||
| 1900 | Ga0496123_0004038 | |||
| 1901 | Ga0496123_0007432 | |||
| 1902 | Ga0496123_0246268 | |||
| 1903 | Ga0496124_0023126 | |||
| 1904 | Ga0496125_0085272 | |||
| 1905 | Ga0496126_0000019 | |||
| 1906 | Ga0496126_0033933 | |||
| 1907 | Ga0495682_0034191 | |||
| 1908 | Ga0501031_0000222 | |||
| 1909 | Ga0501032_0002894 | |||
| 1910 | Ga0501032_0020282 | |||
| 1911 | Ga0501032_0189343 | |||
| 1912 | Ga0501032_0395420 | |||
| 1913 | Ga0501033_0000042 | |||
| 1914 | Ga0501033_0105401 | |||
| 1915 | Ga0501033_0122732 | |||
| 1916 | Ga0501033_0156647 | |||
| 1917 | Ga0501034_0000575 | |||
| 1918 | Ga0501034_0022033 | |||
| 1919 | Ga0501034_0024146 | |||
| 1920 | Ga0501034_0086406 | |||
| 1921 | Ga0501034_0133366 | |||
| 1922 | Ga0501034_0702248 | |||
| 1923 | Ga0501036_0003797 | |||
| 1924 | Ga0501036_0057048 | |||
| 1925 | Ga0501037_0005070 | |||
| 1926 | Ga0501037_0146479 | |||
| 1927 | Ga0501037_0351035 | |||
| 1928 | Ga0501038_0001828 | |||
| 1929 | Ga0501038_0039950 | |||
| 1930 | Ga0501039_0013235 | |||
| 1931 | Ga0501039_0352633 | |||
| 1932 | Ga0501043_0000859 | |||
| 1933 | Ga0501043_0011914 | |||
| 1934 | Ga0501046_0048029 | |||
| 1935 | Ga0501047_0005599 | |||
| 1936 | Ga0501048_0116409 | |||
| 1937 | Ga0501067_0096778 | |||
| 1938 | Ga0501070_0044371 | |||
| 1939 | Ga0501070_0075600 | |||
| 1940 | Ga0501073_0001109 | |||
| 1941 | Ga0501077_0164726 | |||
| 1942 | Ga0501198_006634 | |||
| 1943 | Ga0501208_075185 | |||
| 1944 | Ga0501223_001002 | |||
| 1945 | Ga0501252_023451 | |||
| 1946 | Ga0501083_0020863 | |||
| 1947 | Ga0501241_000831 | |||
| 1948 | Ga0501241_047490 | |||
| 1949 | Ga0501035_0001848 | |||
| 1950 | Ga0501035_0019376 | |||
| 1951 | Ga0501035_0081243 | |||
| 1952 | Ga0501035_0456697 | |||
| 1953 | Ga0501044_0000452 | |||
| 1954 | Ga0501044_0036729 | |||
| 1955 | Ga0501044_0096944 | |||
| 1956 | Ga0501044_0400073 | |||
| 1957 | Ga0501045_0000439 | |||
| 1958 | nmdc:mga0k408_22137_c2 | |||
| 1959 | nmdc:mga0k408_282_c1 | |||
| 1960 | nmdc:mga0k408_544_c1 | |||
| 1961 | nmdc:mga0k408_65692_c1 | |||
| 1962 | nmdc:mga07m45_168818_c1 | |||
| 1963 | Ga0500635_0001217 | |||
| 1964 | Ga0495619_0092134 | |||
| 1965 | Ga0500644_0009828 | |||
| 1966 | Ga0500581_059254 | |||
| 1967 | Ga0500651_0000280 | |||
| 1968 | Ga0500566_0004444 | |||
| 1969 | Ga0500556_0017841 | |||
| 1970 | Ga0500562_000083 | |||
| 1971 | Ga0500608_019222 | |||
| 1972 | Ga0500614_014079 | |||
| 1973 | Ga0500618_000012 | |||
| 1974 | Ga0500577_0104140 | |||
| 1975 | Ga0500616_0004942 | |||
| 1976 | Ga0500616_0044650 | |||
| 1977 | Ga0500616_0080489 | |||
| 1978 | Ga0500622_0000051 | |||
| 1979 | Ga0500622_0001321 | |||
| 1980 | Ga0500622_0003294 | |||
| 1981 | Ga0500624_000281 | |||
| 1982 | Ga0500627_0024315 | |||
| 1983 | Ga0500645_019587 | |||
| 1984 | Ga0500645_022425 | |||
| 1985 | Ga0500661_003766 | |||
| 1986 | Ga0500661_028909 | |||
| 1987 | 2586210491 | |||
| 1988 | 2599480366 | |||
| 1989 | 2722728755 | |||
| 1990 | 2738758039 | |||
| 1991 | 2738763759 | |||
| 1992 | 2738852329 | |||
| 1993 | 2739304474 | |||
| 1994 | 2739589781 | |||
| 1995 | 2739617926 | |||
| 1996 | 2739644122 | |||
| 1997 | 2776614896 | |||
| 1998 | 2819550305 | |||
| 1999 | 2819586850 | |||
| 2000 | 2819680619 | |||
| 2001 | 2842722486 | |||
| 2002 | 2842906776 | |||
| 2003 | 2842914593 | |||
| 2004 | 2849287082 | |||
| 2005 | 2852624780 | |||
| 2006 | 2852630013 | |||
| 2007 | 2857632359 | |||
| 2008 | 2884936331 | |||
| 2009 | 2890738609 | |||
| 2010 | 2896317934 | |||
| 2011 | 2896344932 | |||
| 2012 | 2898715251 | |||
| 2013 | 2902050224 | |||
| 2014 | 2904449402 | |||
| 2015 | 2904784256 | |||
| 2016 | 2919179120 | |||
| 2017 | 2919188305 | |||
| 2018 | 2919438218 | |||
| 2019 | 2928083392 | |||
| 2020 | 2928151345 | |||
| 2021 | 2928520333 | |||
| 2022 | 2929157003 | |||
| 2023 | 2929245044 | |||
| 2024 | 2932087263 | |||
| 2025 | 2939664428 | |||
| 2026 | 2945999440 | |||
| 2027 | 2954016171 | |||
| 2028 | 2977236040 | |||
| 2029 | 3003233809 | |||
| 2030 | 8055589100 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kdt-assembly1.cif.gz_A | cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate | 0.9401 | 4 | 225 |
| 4die-assembly6.cif.gz_D | crystal structure of a cytidylate kinase cmk from mycobacterium abscessus bound to cytidine-5'-monophosphate | 0.9351 | 4 | 223 |
| 4die-assembly5.cif.gz_C | crystal structure of a cytidylate kinase cmk from mycobacterium abscessus bound to cytidine-5'-monophosphate | 0.933 | 4 | 223 |
| 3r8c-assembly1.cif.gz_B | crystal structure of cytidylate kinase (cmk) from mycobacterium abscessus | 0.9327 | 4 | 223 |
| 2feo-assembly1.cif.gz_A | mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp | 0.9327 | 4 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4dieB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9316 | 4 | 223 | 3.40.50.300 |
| 4dieB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9272 | 4 | 223 | 3.40.50.300 |
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9215 | 5 | 222 | 3.40.50.300 |
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9093 | 5 | 222 | 3.40.50.300 |
| af_Q2FYF5_1_183_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9064 | 39 | 222 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519SHQ1-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9833 | 1 | 226 |
GO:0005524
GO:0005829 GO:0006220 GO:0015949 GO:0036430 GO:0036431 |
| AF-A0A7C5PM03-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9829 | 6 | 222 |
GO:0004127
GO:0005524 GO:0005829 GO:0006220 GO:0015949 |
| AF-A0A381TJ57-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9798 | 5 | 222 |
GO:0003729
GO:0003735 GO:0004127 GO:0005524 GO:0006412 GO:0022627 |
| AF-A0A382BMV1-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.9797 | 5 | 119 |
GO:0004127
GO:0005524 |
| AF-A0A4Q7MLT9-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9796 | 3 | 224 |
GO:0005524
GO:0005829 GO:0006220 GO:0015949 GO:0036430 GO:0036431 |