F488243

General Info

Members Datasets Scaffolds Average Seq Length
1015 369 2030 229

Family's Representative Sequence

Representative Sequence 3300033180|Ga0307510_10005801|Ga0307510_100058014
Length 263
Sequence MSFYVKQPPNLINIFNDLTQSTIQLNQPLNYFYYFSYPMSNNIVIAIDGYSSCGKSTLAKALAQKLHFIYVDSGAMYRAVTLYFLRNNVDLKDHGQIAEALKNIHLNFHSRDYQTHITLNDEEVSEEIRQMPVSDNVSDVAALREVRHEMVKQQQRMGRSKNIVMDGRDIGTTVFPGATLKIFMTADPKVRAERRYKEMHEKNPDITLEEVFENIAHRDYQDTTRTESPLVRAPDAIILDNTNLTPEQQLQFALDKVEPLLHK

Samples

Sample ID Description Type Environment
1 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
124 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
125 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
126 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
190 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
191 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
192 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
214 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
217 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
218 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
222 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
243 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
244 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
263 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
273 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
281 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
297 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
298 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
299 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
300 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
311 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
312 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
315 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
316 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
317 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
318 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
319 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
322 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
323 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
324 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
325 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
326 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
327 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
328 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
329 2738541283 Pedobacter sp. OK701 Isolate Unclassified
330 2738541284 Pedobacter sp. YR016 Isolate Unclassified
331 2738541302 Pedobacter sp. CF074 Isolate Unclassified
332 2738543023 Pedobacter sp. OK628 Isolate Unclassified
333 2739367651 Pedobacter sp. OK291 Isolate Unclassified
334 2739367656 Pedobacter sp. CF523 Isolate Unclassified
335 2739367663 Pedobacter sp. YR510 Isolate Unclassified
336 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
337 2818991437 Pedobacter terrae 518 Isolate Unclassified
338 2818991444 Filimonas endophytica 3197 Isolate Unclassified
339 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
340 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
341 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
342 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
343 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
344 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
345 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
346 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
347 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
348 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
349 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
350 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
351 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
352 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
353 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
354 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
355 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
356 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
357 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
358 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
359 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
360 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
361 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
362 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
363 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
364 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
365 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
366 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
367 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
368 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
369 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 0.1
Isolates 4.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.31
Nodule 0
Rhizoplane 0.99
Rhizosphere 85.62
Stem 0
Stem Tuber 0
Unclassified 6.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307510_10005801 3300033180 Bacteria 14719
2 SwRhRL2b_contig_1283784 2162886007 Bacteria 1715
3 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
4 SwRhRL2b_contig_1916358 2162886007 Bacteria 3368
5 SwRhRL2b_contig_2744323 2162886007 Unclassified 1678
6 SwRhRL2b_contig_3708819 2162886007 Bacteria 9197
7 JGI24741J21665_1018335 3300001915 Bacteria 1120
8 JGI24740J21852_10010217 3300001979 Bacteria 3627
9 JGI24740J21852_10025264 3300001979 Bacteria 2004
10 JGI24740J21852_10047026 3300001979 Bacteria 1262
11 JGI24739J22299_10009023 3300001989 Bacteria 3721
12 JGI24737J22298_10016579 3300001990 Bacteria 2378
13 JGI24735J21928_10000013 3300002067 Bacteria 208663
14 JGI24744J21845_10002459 3300002077 Bacteria 3775
15 JGI24744J21845_10011147 3300002077 Bacteria 1840
16 JGI25162J39368_1000180 3300002737 Bacteria 67985
17 JGI25162J39368_1001035 3300002737 Bacteria 17180
18 JGI25164J39214_1001426 3300002772 Bacteria 5614
19 JGI25152J39213_1000160 3300002773 Bacteria 45741
20 JGI25150J39212_1000002 3300002774 Bacteria 537631
21 JGI25151J46595_10000003 3300003187 Bacteria 715330
22 JGI25406J46586_10000320 3300003203 Bacteria 21684
23 JGI25153J46596_10000003 3300003215 Bacteria 553253
24 rootH1_10018516 3300003316 Bacteria 3239
25 rootH1_10020058 3300003316 Bacteria 14507
26 rootH1_10162869 3300003316 Bacteria 1400
27 rootH1_10188534 3300003316 Bacteria 1591
28 rootH2_10005336 3300003320 Bacteria 90063
29 rootH2_10039401 3300003320 Bacteria 2677
30 rootH2_10041787 3300003320 Unclassified 2715
31 rootH2_10050610 3300003320 Bacteria 15378
32 rootH2_10078540 3300003320 Bacteria 6578
33 rootH2_10096793 3300003320 Bacteria 1522
34 rootH2_10312559 3300003320 Unclassified 2499
35 rootL2_10077558 3300003322 Bacteria 3565
36 rootL2_10138667 3300003322 Bacteria 4545
37 rootL2_10142782 3300003322 Bacteria 1809
38 rootL2_10189067 3300003322 Bacteria 3156
39 rootL2_10233241 3300003322 Bacteria 4423
40 rootH1_10000549 3300003323 Bacteria 6473
41 rootH1_10065836 3300003323 Bacteria 3811
42 rootH1_10105207 3300003323 Bacteria 3496
43 rootH1_10136684 3300003323 Bacteria 1507
44 rootH1_10165942 3300003323 Bacteria 2084
45 rootH1_10217929 3300003323 Bacteria 5627
46 rootH1_10284471 3300003323 Unclassified 1175
47 rootH1_10312356 3300003323 Unclassified 2858
48 rootH1_10314976 3300003323 Bacteria 2976
49 JGI25160J50197_1000809 3300003354 Bacteria 16812
50 JGI25160J50197_1003840 3300003354 Bacteria 6601
51 Ga0055536_1000007 3300003781 Bacteria 345133
52 Ga0055528_1002286 3300003790 Bacteria 10381
53 Ga0055530_10001851 3300003791 Bacteria 14538
54 Ga0055530_10002693 3300003791 Bacteria 11059
55 Ga0055531_10000237 3300003794 Bacteria 60479
56 Ga0065165_1000190 3300005262 Bacteria 107377
57 Ga0065714_10002536 3300005288 Bacteria 20360
58 Ga0065714_10002974 3300005288 Bacteria 16891
59 Ga0065714_10007179 3300005288 Bacteria 2962
60 Ga0065714_10064993 3300005288 Bacteria 14329
61 Ga0065714_10065917 3300005288 Bacteria 8087
62 Ga0065714_10083180 3300005288 Bacteria 2262
63 Ga0065714_10104208 3300005288 Bacteria 1587
64 Ga0065714_10133435 3300005288 Bacteria 1208
65 Ga0065704_10070140 3300005289 Bacteria 482257
66 Ga0065704_10070358 3300005289 Bacteria 30366
67 Ga0065704_10071378 3300005289 Bacteria 11408
68 Ga0065704_10078114 3300005289 Bacteria 4521
69 Ga0065704_10080198 3300005289 Bacteria 3987
70 Ga0065704_10081542 3300005289 Bacteria 3742
71 Ga0065712_10003463 3300005290 Bacteria 4883
72 Ga0065712_10316161 3300005290 Bacteria 836
73 Ga0070658_10000028 3300005327 Bacteria 157278
74 Ga0070658_10084497 3300005327 Bacteria 2610
75 Ga0070658_10091213 3300005327 Bacteria 2511
76 Ga0070658_10274336 3300005327 Bacteria 1435
77 Ga0070658_10296353 3300005327 Bacteria 1379
78 Ga0070658_10334546 3300005327 Bacteria 1294
79 Ga0070658_10507700 3300005327 Unclassified 1042
80 Ga0070676_10000004 3300005328 Bacteria 82919
81 Ga0070676_10000426 3300005328 Bacteria 19948
82 Ga0070676_10328403 3300005328 Unclassified 1045
83 Ga0070683_100013700 3300005329 Bacteria 7079
84 Ga0070683_100027378 3300005329 Bacteria 5141
85 Ga0070683_100032351 3300005329 Bacteria 4763
86 Ga0070683_100065783 3300005329 Bacteria 3376
87 Ga0070690_100015759 3300005330 Bacteria 4516
88 Ga0070670_100030789 3300005331 Bacteria 4621
89 Ga0070670_100045950 3300005331 Bacteria 3755
90 Ga0070670_100060851 3300005331 Bacteria 3242
91 Ga0070670_100375219 3300005331 Bacteria 1252
92 Ga0068869_100019499 3300005334 Bacteria 4636
93 Ga0068869_100044739 3300005334 Bacteria 3184
94 Ga0068869_100201745 3300005334 Unclassified 1568
95 Ga0070666_10024416 3300005335 Bacteria 3937
96 Ga0070666_10030332 3300005335 Bacteria 3562
97 Ga0070680_100011331 3300005336 Bacteria 6896
98 Ga0070680_100035814 3300005336 Bacteria 4008
99 Ga0070680_100046874 3300005336 Bacteria 3517
100 Ga0070680_100060193 3300005336 Bacteria 3108
101 Ga0070680_100265533 3300005336 Bacteria 1453
102 Ga0070682_100018125 3300005337 Bacteria 4110
103 Ga0068868_100001148 3300005338 Bacteria 18139
104 Ga0068868_100008840 3300005338 Bacteria 7216
105 Ga0068868_100061888 3300005338 Bacteria 2966
106 Ga0068868_100442776 3300005338 Bacteria 1129
107 Ga0068868_100592463 3300005338 Bacteria 981
108 Ga0070660_100003457 3300005339 Bacteria 10872
109 Ga0070660_100020931 3300005339 Bacteria 4815
110 Ga0070660_100029171 3300005339 Bacteria 4132
111 Ga0070660_100076358 3300005339 Bacteria 2624
112 Ga0070660_100113149 3300005339 Bacteria 2161
113 Ga0070660_100115650 3300005339 Bacteria 2138
114 Ga0070660_100385728 3300005339 Bacteria 1157
115 Ga0070689_100309053 3300005340 Bacteria 1318
116 Ga0070691_10024526 3300005341 Bacteria 2803
117 Ga0070687_100076750 3300005343 Bacteria 1811
118 Ga0070687_100141208 3300005343 Bacteria 1403
119 Ga0070661_100023853 3300005344 Bacteria 4388
120 Ga0070661_100547611 3300005344 Bacteria 931
121 Ga0070668_100295137 3300005347 Bacteria 1358
122 Ga0070669_100010920 3300005353 Bacteria 6448
123 Ga0070675_100013072 3300005354 Bacteria 6521
124 Ga0070675_100150274 3300005354 Unclassified 1996
125 Ga0070675_100297976 3300005354 Bacteria 1420
126 Ga0070675_100756468 3300005354 Bacteria 887
127 Ga0070671_100028142 3300005355 Bacteria 4628
128 Ga0070671_100095618 3300005355 Bacteria 2490
129 Ga0070674_100020850 3300005356 Bacteria 4197
130 Ga0070674_100113808 3300005356 Bacteria 1991
131 Ga0070673_100093542 3300005364 Bacteria 2462
132 Ga0070673_100128526 3300005364 Bacteria 2123
133 Ga0070673_100184295 3300005364 Bacteria 1789
134 Ga0070673_100507900 3300005364 Bacteria 1091
135 Ga0070688_100075431 3300005365 Bacteria 2168
136 Ga0070688_100386269 3300005365 Bacteria 1033
137 Ga0070659_100000100 3300005366 Bacteria 63786
138 Ga0070659_100004457 3300005366 Bacteria 10002
139 Ga0070659_100015244 3300005366 Bacteria 5753
140 Ga0070659_100035543 3300005366 Bacteria 3880
141 Ga0070659_100042935 3300005366 Bacteria 3535
142 Ga0070659_100142050 3300005366 Bacteria 1955
143 Ga0070667_100006801 3300005367 Bacteria 9500
144 Ga0070667_100060914 3300005367 Bacteria 3194
145 Ga0070667_100062397 3300005367 Bacteria 3157
146 Ga0070667_100239016 3300005367 Bacteria 1621
147 Ga0070663_100004723 3300005455 Bacteria 8036
148 Ga0070663_100154470 3300005455 Bacteria 1762
149 Ga0070678_100001206 3300005456 Bacteria 13708
150 Ga0070678_100029061 3300005456 Bacteria 3781
151 Ga0070678_100039826 3300005456 Bacteria 3320
152 Ga0070678_100306542 3300005456 Bacteria 1351
153 Ga0070678_100681287 3300005456 Bacteria 925
154 Ga0070662_100000014 3300005457 Bacteria 110124
155 Ga0070662_100003803 3300005457 Bacteria 9442
156 Ga0070662_100059800 3300005457 Bacteria 2777
157 Ga0070662_100082408 3300005457 Bacteria 2399
158 Ga0070662_100359515 3300005457 Bacteria 1194
159 Ga0070662_100418845 3300005457 Unclassified 1108
160 Ga0070681_10002077 3300005458 Bacteria 18184
161 Ga0070681_10908519 3300005458 Unclassified 799
162 Ga0068867_100000636 3300005459 Bacteria 23189
163 Ga0068867_100035731 3300005459 Bacteria 3605
164 Ga0068867_100043873 3300005459 Bacteria 3274
165 Ga0068867_100047846 3300005459 Unclassified 3145
166 Ga0068867_100069414 3300005459 Bacteria 2632
167 Ga0068867_100089400 3300005459 Bacteria 2335
168 Ga0068867_100283141 3300005459 Bacteria 1360
169 Ga0068867_100753280 3300005459 Bacteria 864
170 Ga0070685_10076041 3300005466 Bacteria 2002
171 Ga0070679_100000517 3300005530 Bacteria 32752
172 Ga0070679_100031317 3300005530 Bacteria 5254
173 Ga0070679_100064164 3300005530 Bacteria 3660
174 Ga0070679_100099245 3300005530 Bacteria 2899
175 Ga0070679_100107216 3300005530 Bacteria 2779
176 Ga0070679_100188124 3300005530 Bacteria 2034
177 Ga0070684_100020461 3300005535 Bacteria 5490
178 Ga0070684_100047930 3300005535 Bacteria 3705
179 Ga0070684_100060599 3300005535 Bacteria 3311
180 Ga0070684_100801724 3300005535 Bacteria 880
181 Ga0068853_100008704 3300005539 Bacteria 8163
182 Ga0068853_100011075 3300005539 Bacteria 7313
183 Ga0068853_100050481 3300005539 Unclassified 3579
184 Ga0068853_100301312 3300005539 Bacteria 1481
185 Ga0068853_100330101 3300005539 Bacteria 1415
186 Ga0068853_100344676 3300005539 Bacteria 1385
187 Ga0068853_100354133 3300005539 Bacteria 1366
188 Ga0068853_100367136 3300005539 Bacteria 1342
189 Ga0068853_100500516 3300005539 Bacteria 1147
190 Ga0068853_100574457 3300005539 Bacteria 1069
191 Ga0068853_100766468 3300005539 Bacteria 923
192 Ga0070672_100041407 3300005543 Bacteria 3541
193 Ga0070672_100113426 3300005543 Bacteria 2212
194 Ga0070672_100124147 3300005543 Bacteria 2116
195 Ga0070672_100186605 3300005543 Bacteria 1730
196 Ga0070665_100000032 3300005548 Bacteria 333352
197 Ga0070665_100000442 3300005548 Bacteria 60619
198 Ga0070665_100059771 3300005548 Bacteria 3821
199 Ga0070665_100161785 3300005548 Bacteria 2241
200 Ga0070704_100700516 3300005549 Bacteria 898
201 Ga0068855_100000049 3300005563 Bacteria 145321
202 Ga0068855_100000658 3300005563 Bacteria 42234
203 Ga0068855_100004342 3300005563 Bacteria 17337
204 Ga0068855_100012340 3300005563 Bacteria 10321
205 Ga0068855_100030872 3300005563 Bacteria 6406
206 Ga0068855_100101452 3300005563 Bacteria 3313
207 Ga0068855_100143256 3300005563 Bacteria 2722
208 Ga0068855_100152064 3300005563 Bacteria 2631
209 Ga0068855_100176779 3300005563 Bacteria 2415
210 Ga0068855_100233879 3300005563 Bacteria 2056
211 Ga0068855_100445914 3300005563 Bacteria 1413
212 Ga0068855_100540825 3300005563 Bacteria 1262
213 Ga0070664_100018922 3300005564 Bacteria 5662
214 Ga0070664_100070386 3300005564 Bacteria 2996
215 Ga0070664_100217692 3300005564 Unclassified 1708
216 Ga0070664_100236044 3300005564 Bacteria 1640
217 Ga0070664_100363996 3300005564 Bacteria 1317
218 Ga0070664_100374788 3300005564 Bacteria 1298
219 Ga0068857_100016681 3300005577 Bacteria 6434
220 Ga0068857_100334011 3300005577 Bacteria 1401
221 Ga0068854_100213658 3300005578 Bacteria 1523
222 Ga0068854_100460043 3300005578 Bacteria 1064
223 Ga0068856_100000005 3300005614 Bacteria 225505
224 Ga0068856_100000424 3300005614 Bacteria 46509
225 Ga0068856_100045491 3300005614 Bacteria 4322
226 Ga0068856_100060542 3300005614 Bacteria 3741
227 Ga0068856_100161706 3300005614 Bacteria 2249
228 Ga0068856_100246115 3300005614 Unclassified 1803
229 Ga0068856_100264731 3300005614 Bacteria 1735
230 Ga0068856_100575876 3300005614 Bacteria 1147
231 Ga0068856_100910564 3300005614 Bacteria 898
232 Ga0068856_101151736 3300005614 Bacteria 792
233 Ga0070702_100065400 3300005615 Bacteria 2130
234 Ga0068852_100055520 3300005616 Bacteria 3419
235 Ga0068852_100208765 3300005616 Unclassified 1851
236 Ga0068852_100659888 3300005616 Bacteria 1054
237 Ga0068852_100759826 3300005616 Bacteria 982
238 Ga0068859_100249854 3300005617 Bacteria 1864
239 Ga0068859_100250268 3300005617 Bacteria 1862
240 Ga0068859_100795592 3300005617 Bacteria 1033
241 Ga0068859_101006713 3300005617 Bacteria 915
242 Ga0068864_100020770 3300005618 Bacteria 5495
243 Ga0068864_100051272 3300005618 Bacteria 3554
244 Ga0068864_100053174 3300005618 Bacteria 3493
245 Ga0068864_100149758 3300005618 Bacteria 2113
246 Ga0068864_100214985 3300005618 Bacteria 1772
247 Ga0068861_100079101 3300005719 Bacteria 2570
248 Ga0068861_100398783 3300005719 Bacteria 1220
249 Ga0068851_10012608 3300005834 Unclassified 3988
250 Ga0068870_10009985 3300005840 Bacteria 4340
251 Ga0068870_10169029 3300005840 Bacteria 1303
252 Ga0068870_10188031 3300005840 Bacteria 1244
253 Ga0068863_100033510 3300005841 Bacteria 4893
254 Ga0068863_100489852 3300005841 Bacteria 1210
255 Ga0068860_100023461 3300005843 Bacteria 5962
256 Ga0068860_100066819 3300005843 Bacteria 3416
257 Ga0068860_100120755 3300005843 Bacteria 2509
258 Ga0068860_100132142 3300005843 Unclassified 2396
259 Ga0068860_100190085 3300005843 Bacteria 1987
260 Ga0068860_100707649 3300005843 Bacteria 1017
261 Ga0068862_100086787 3300005844 Bacteria 2721
262 Ga0081539_10000147 3300005985 Bacteria 164274
263 Ga0070716_100146709 3300006173 Bacteria 1512
264 Ga0075366_10000173 3300006195 Bacteria 27823
265 Ga0075366_10000703 3300006195 Bacteria 15855
266 Ga0075366_10021146 3300006195 Bacteria 3782
267 Ga0075366_10024166 3300006195 Bacteria 3545
268 Ga0075366_10059185 3300006195 Bacteria 2275
269 Ga0097621_100000224 3300006237 Bacteria 37801
270 Ga0097621_100002869 3300006237 Bacteria 11830
271 Ga0097621_100009933 3300006237 Bacteria 6935
272 Ga0097621_100021511 3300006237 Bacteria 4991
273 Ga0097621_100098964 3300006237 Bacteria 2451
274 Ga0068871_100000021 3300006358 Bacteria 83155
275 Ga0068871_100005685 3300006358 Bacteria 8751
276 Ga0068871_100020267 3300006358 Bacteria 5092
277 Ga0068871_100156684 3300006358 Bacteria 1945
278 Ga0068871_100229905 3300006358 Bacteria 1609
279 Ga0068871_100455356 3300006358 Unclassified 1147
280 Ga0068865_100000045 3300006881 Bacteria 70227
281 Ga0068865_100008014 3300006881 Bacteria 6523
282 Ga0068865_100123051 3300006881 Bacteria 1932
283 Ga0097620_100249847 3300006931 Bacteria 1864
284 Ga0097620_100250272 3300006931 Bacteria 1862
285 Ga0097620_100795580 3300006931 Bacteria 1033
286 Ga0097620_101006767 3300006931 Bacteria 915
287 Ga0105240_10000010 3300009093 Bacteria 537830
288 Ga0105240_10000692 3300009093 Bacteria 61955
289 Ga0105240_10007157 3300009093 Bacteria 16255
290 Ga0105240_10028192 3300009093 Bacteria 7339
291 Ga0105240_10049783 3300009093 Bacteria 5286
292 Ga0105240_10099660 3300009093 Bacteria 3536
293 Ga0105240_10160652 3300009093 Bacteria 2669
294 Ga0105240_10238146 3300009093 Bacteria 2111
295 Ga0105240_10248064 3300009093 Bacteria 2061
296 Ga0105240_10331948 3300009093 Bacteria 1730
297 Ga0105240_10443708 3300009093 Bacteria 1454
298 Ga0111539_10465879 3300009094 Unclassified 1471
299 Ga0111539_10632079 3300009094 Bacteria 1247
300 Ga0105243_10000008 3300009148 Bacteria 390270
301 Ga0105243_10338653 3300009148 Bacteria 1377
302 Ga0105241_10000305 3300009174 Bacteria 36958
303 Ga0105241_10016108 3300009174 Bacteria 5480
304 Ga0105241_10087436 3300009174 Bacteria 2453
305 Ga0105241_10114250 3300009174 Bacteria 2165
306 Ga0105241_10172562 3300009174 Unclassified 1787
307 Ga0105241_10190247 3300009174 Bacteria 1708
308 Ga0105241_11063497 3300009174 Bacteria 760
309 Ga0105242_10030783 3300009176 Unclassified 4286
310 Ga0105242_10040564 3300009176 Bacteria 3751
311 Ga0105242_10142514 3300009176 Bacteria 2081
312 Ga0105242_10196246 3300009176 Unclassified 1790
313 Ga0105242_10197403 3300009176 Bacteria 1785
314 Ga0105242_10734019 3300009176 Unclassified 970
315 Ga0105248_10035252 3300009177 Bacteria 5597
316 Ga0105248_10531310 3300009177 Unclassified 1326
317 Ga0105237_10001165 3300009545 Bacteria 35143
318 Ga0105237_10002429 3300009545 Bacteria 23143
319 Ga0105237_10003157 3300009545 Bacteria 19816
320 Ga0105237_10008501 3300009545 Bacteria 11105
321 Ga0105237_10019154 3300009545 Bacteria 7072
322 Ga0105237_10038945 3300009545 Bacteria 4800
323 Ga0105237_10156842 3300009545 Bacteria 2273
324 Ga0105237_10198468 3300009545 Bacteria 2006
325 Ga0105237_10215980 3300009545 Bacteria 1918
326 Ga0105237_10390870 3300009545 Bacteria 1396
327 Ga0105237_10835725 3300009545 Unclassified 928
328 Ga0105238_10002640 3300009551 Bacteria 17863
329 Ga0105238_10281978 3300009551 Bacteria 1643
330 Ga0105249_10030794 3300009553 Bacteria 4850
331 Ga0105239_10000001 3300010375 Bacteria 617353
332 Ga0105239_10000222 3300010375 Bacteria 83623
333 Ga0105239_10003907 3300010375 Bacteria 18070
334 Ga0105239_10004417 3300010375 Bacteria 16825
335 Ga0105239_10007756 3300010375 Bacteria 12287
336 Ga0105239_10025053 3300010375 Bacteria 6572
337 Ga0105239_10027624 3300010375 Bacteria 6244
338 Ga0105239_10035531 3300010375 Bacteria 5472
339 Ga0105239_10040221 3300010375 Bacteria 5123
340 Ga0105239_10047543 3300010375 Bacteria 4703
341 Ga0105239_10048999 3300010375 Bacteria 4632
342 Ga0105239_10329326 3300010375 Bacteria 1723
343 Ga0105239_10939077 3300010375 Bacteria 993
344 Ga0105246_10016055 3300011119 Unclassified 4738
345 Ga0105246_10157981 3300011119 Unclassified 1724
346 Ga0157373_10000493 3300013100 Bacteria 31173
347 Ga0157373_10001010 3300013100 Bacteria 21720
348 Ga0157373_10008371 3300013100 Bacteria 7682
349 Ga0157373_10023213 3300013100 Bacteria 4498
350 Ga0157373_10027560 3300013100 Unclassified 4099
351 Ga0157373_10038323 3300013100 Bacteria 3436
352 Ga0157373_10060689 3300013100 Bacteria 2678
353 Ga0157373_10112851 3300013100 Bacteria 1910
354 Ga0157373_10151139 3300013100 Bacteria 1633
355 Ga0157373_10165048 3300013100 Unclassified 1558
356 Ga0157371_10000266 3300013102 Bacteria 71146
357 Ga0157371_10001322 3300013102 Bacteria 26019
358 Ga0157371_10001388 3300013102 Bacteria 25318
359 Ga0157371_10001945 3300013102 Bacteria 20538
360 Ga0157371_10002423 3300013102 Bacteria 17819
361 Ga0157371_10002458 3300013102 Bacteria 17660
362 Ga0157371_10002705 3300013102 Bacteria 16743
363 Ga0157371_10003231 3300013102 Bacteria 14955
364 Ga0157371_10006449 3300013102 Bacteria 9674
365 Ga0157371_10027274 3300013102 Bacteria 4144
366 Ga0157371_10048234 3300013102 Bacteria 3027
367 Ga0157371_10048377 3300013102 Bacteria 3022
368 Ga0157371_10052792 3300013102 Bacteria 2887
369 Ga0157371_10064467 3300013102 Bacteria 2596
370 Ga0157371_10070397 3300013102 Bacteria 2476
371 Ga0157371_10176376 3300013102 Unclassified 1528
372 Ga0157371_10208448 3300013102 Bacteria 1402
373 Ga0157371_10240181 3300013102 Bacteria 1303
374 Ga0157370_10004347 3300013104 Bacteria 16272
375 Ga0157370_10009076 3300013104 Bacteria 10664
376 Ga0157370_10010549 3300013104 Bacteria 9730
377 Ga0157370_10016108 3300013104 Bacteria 7578
378 Ga0157370_10023734 3300013104 Bacteria 6086
379 Ga0157370_10026762 3300013104 Bacteria 5691
380 Ga0157370_10041735 3300013104 Bacteria 4423
381 Ga0157370_10051988 3300013104 Bacteria 3912
382 Ga0157370_10085326 3300013104 Bacteria 2966
383 Ga0157370_10088382 3300013104 Bacteria 2910
384 Ga0157370_10106422 3300013104 Bacteria 2625
385 Ga0157370_10159379 3300013104 Bacteria 2100
386 Ga0157370_10235881 3300013104 Bacteria 1693
387 Ga0157369_10000441 3300013105 Bacteria 55264
388 Ga0157369_10023235 3300013105 Bacteria 6908
389 Ga0157369_10092464 3300013105 Bacteria 3228
390 Ga0157369_10104538 3300013105 Bacteria 3015
391 Ga0157369_10140329 3300013105 Bacteria 2557
392 Ga0157369_10279306 3300013105 Bacteria 1739
393 Ga0157369_10337914 3300013105 Unclassified 1564
394 Ga0157369_10348473 3300013105 Bacteria 1538
395 Ga0157369_10516288 3300013105 Bacteria 1236
396 Ga0157374_10001269 3300013296 Bacteria 21541
397 Ga0157374_10008592 3300013296 Bacteria 8735
398 Ga0157374_10013320 3300013296 Bacteria 7177
399 Ga0157374_10017554 3300013296 Bacteria 6302
400 Ga0157374_10032990 3300013296 Bacteria 4721
401 Ga0157374_10034886 3300013296 Bacteria 4600
402 Ga0157374_10188789 3300013296 Bacteria 2016
403 Ga0157374_10399683 3300013296 Bacteria 1371
404 Ga0157374_10551995 3300013296 Bacteria 1160
405 Ga0157378_10001566 3300013297 Bacteria 20661
406 Ga0157378_10003663 3300013297 Bacteria 13617
407 Ga0157378_10012150 3300013297 Bacteria 7541
408 Ga0157378_10026674 3300013297 Bacteria 5093
409 Ga0157378_10028410 3300013297 Bacteria 4935
410 Ga0157378_10034723 3300013297 Bacteria 4459
411 Ga0157378_10144673 3300013297 Bacteria 2210
412 Ga0157378_10150800 3300013297 Bacteria 2166
413 Ga0157378_10257215 3300013297 Unclassified 1674
414 Ga0157378_10270077 3300013297 Bacteria 1635
415 Ga0157378_11064414 3300013297 Bacteria 845
416 Ga0163162_10000010 3300013306 Bacteria 302032
417 Ga0163162_10001751 3300013306 Bacteria 20347
418 Ga0163162_10002720 3300013306 Bacteria 16777
419 Ga0163162_10004021 3300013306 Bacteria 14113
420 Ga0163162_10034404 3300013306 Bacteria 5043
421 Ga0163162_10046160 3300013306 Bacteria 4366
422 Ga0163162_10147273 3300013306 Bacteria 2471
423 Ga0163162_10157820 3300013306 Bacteria 2389
424 Ga0163162_10258188 3300013306 Bacteria 1874
425 Ga0163162_10264563 3300013306 Bacteria 1851
426 Ga0163162_10294345 3300013306 Bacteria 1755
427 Ga0163162_10324809 3300013306 Unclassified 1671
428 Ga0163162_10371489 3300013306 Bacteria 1563
429 Ga0163162_10466857 3300013306 Bacteria 1394
430 Ga0163162_10593162 3300013306 Bacteria 1234
431 Ga0163162_10611109 3300013306 Bacteria 1216
432 Ga0163162_10912003 3300013306 Bacteria 991
433 Ga0157372_10000073 3300013307 Bacteria 107356
434 Ga0157372_10001839 3300013307 Bacteria 22988
435 Ga0157372_10002319 3300013307 Bacteria 20622
436 Ga0157372_10005120 3300013307 Bacteria 13929
437 Ga0157372_10006129 3300013307 Bacteria 12780
438 Ga0157372_10015677 3300013307 Bacteria 8127
439 Ga0157372_10030154 3300013307 Bacteria 5931
440 Ga0157372_10034703 3300013307 Bacteria 5548
441 Ga0157372_10070619 3300013307 Bacteria 3930
442 Ga0157372_10082045 3300013307 Bacteria 3650
443 Ga0157372_10082743 3300013307 Bacteria 3634
444 Ga0157372_10106606 3300013307 Unclassified 3205
445 Ga0157372_10118909 3300013307 Unclassified 3033
446 Ga0157372_10170040 3300013307 Bacteria 2521
447 Ga0157372_10230100 3300013307 Bacteria 2149
448 Ga0157372_10230257 3300013307 Bacteria 2148
449 Ga0157372_10386104 3300013307 Unclassified 1631
450 Ga0157372_10420886 3300013307 Bacteria 1557
451 Ga0157372_10556954 3300013307 Bacteria 1336
452 Ga0157375_10003126 3300013308 Bacteria 14379
453 Ga0157375_10008904 3300013308 Bacteria 8784
454 Ga0157375_10010047 3300013308 Bacteria 8321
455 Ga0157375_10015961 3300013308 Bacteria 6736
456 Ga0157375_10016953 3300013308 Bacteria 6564
457 Ga0157375_10093626 3300013308 Bacteria 3071
458 Ga0157375_10124312 3300013308 Unclassified 2693
459 Ga0157375_10134199 3300013308 Bacteria 2597
460 Ga0157375_10250437 3300013308 Bacteria 1932
461 Ga0157375_10261104 3300013308 Bacteria 1893
462 Ga0157375_10673574 3300013308 Bacteria 1189
463 Ga0157375_11560824 3300013308 Unclassified 780
464 Ga0163163_10004021 3300014325 Bacteria 12540
465 Ga0163163_10221276 3300014325 Bacteria 1942
466 Ga0163163_10337801 3300014325 Bacteria 1561
467 Ga0163163_10662153 3300014325 Unclassified 1107
468 Ga0182008_10000017 3300014497 Bacteria 235130
469 Ga0182008_10000043 3300014497 Bacteria 117076
470 Ga0182008_10000934 3300014497 Bacteria 20353
471 Ga0182008_10047424 3300014497 Bacteria 2134
472 Ga0182008_10134310 3300014497 Unclassified 1235
473 Ga0157377_10002355 3300014745 Bacteria 8336
474 Ga0157377_10042679 3300014745 Bacteria 2520
475 Ga0157379_10038425 3300014968 Bacteria 4271
476 Ga0157379_10046246 3300014968 Bacteria 3883
477 Ga0157379_10047442 3300014968 Bacteria 3832
478 Ga0157379_10053941 3300014968 Bacteria 3592
479 Ga0157379_10122600 3300014968 Bacteria 2339
480 Ga0157379_10326861 3300014968 Bacteria 1401
481 Ga0157379_10461283 3300014968 Unclassified 1174
482 Ga0157376_10003029 3300014969 Bacteria 11517
483 Ga0157376_10011262 3300014969 Bacteria 6584
484 Ga0157376_10189803 3300014969 Unclassified 1884
485 Ga0157376_10655895 3300014969 Bacteria 1050
486 Ga0182006_1000128 3300015261 Bacteria 81425
487 Ga0182006_1001058 3300015261 Bacteria 17753
488 Ga0182006_1003032 3300015261 Bacteria 8833
489 Ga0182006_1026274 3300015261 Bacteria 2384
490 Ga0182006_1052740 3300015261 Bacteria 1561
491 Ga0182007_10000054 3300015262 Bacteria 91906
492 Ga0182007_10018595 3300015262 Bacteria 2515
493 Ga0182007_10047834 3300015262 Bacteria 1414
494 Ga0183373_1015 3300015682 Bacteria 63862
495 Ga0163161_10001077 3300017792 Bacteria 20663
496 Ga0163161_10001415 3300017792 Bacteria 17712
497 Ga0163161_10003355 3300017792 Bacteria 11229
498 Ga0163161_10009075 3300017792 Bacteria 6878
499 Ga0163161_10011686 3300017792 Bacteria 6092
500 Ga0163161_10020964 3300017792 Bacteria 4592
501 Ga0163161_10111331 3300017792 Bacteria 2047
502 Ga0163161_10263964 3300017792 Bacteria 1346
503 Ga0163161_10899461 3300017792 Bacteria 750
504 Ga0206351_10643466 3300020077 Unclassified 1171
505 Ga0213872_10024047 3300021361 Bacteria 2802
506 Ga0213876_10004951 3300021384 Bacteria 7368
507 Ga0207427_100025 3300025231 Bacteria 433726
508 Ga0209437_100010 3300025233 Bacteria 838447
509 Ga0209437_100148 3300025233 Bacteria 158795
510 Ga0209258_112460 3300025242 Bacteria 1041
511 Ga0207425_1000004 3300025245 Bacteria 1092421
512 Ga0209026_1000805 3300025250 Bacteria 17035
513 Ga0209026_1000875 3300025250 Bacteria 15683
514 Ga0209129_1000005 3300025258 Bacteria 777812
515 Ga0209129_1010719 3300025258 Bacteria 2256
516 Ga0209233_1000017 3300025261 Bacteria 898076
517 Ga0209233_1008486 3300025261 Bacteria 3178
518 Ga0209455_1004412 3300025272 Bacteria 4618
519 Ga0209676_1000058 3300025292 Bacteria 345185
520 Ga0209025_1000009 3300025294 Bacteria 1092561
521 Ga0209758_1000010 3300025297 Bacteria 1092782
522 Ga0209050_1000054 3300025298 Bacteria 345186
523 Ga0207426_1000030 3300025302 Bacteria 461478
524 Ga0209257_1000025 3300025304 Bacteria 724838
525 Ga0207697_10051715 3300025315 Bacteria 1698
526 Ga0207656_10009859 3300025321 Bacteria 3556
527 Ga0207642_10010276 3300025899 Bacteria 3293
528 Ga0207642_10147018 3300025899 Bacteria 1250
529 Ga0207642_10206662 3300025899 Bacteria 1088
530 Ga0207642_10252843 3300025899 Bacteria 1001
531 Ga0207680_10410355 3300025903 Bacteria 958
532 Ga0207647_10000022 3300025904 Bacteria 118094
533 Ga0207647_10000499 3300025904 Bacteria 31400
534 Ga0207647_10004321 3300025904 Bacteria 10533
535 Ga0207647_10338523 3300025904 Bacteria 853
536 Ga0207645_10000151 3300025907 Bacteria 54588
537 Ga0207645_10000885 3300025907 Bacteria 24873
538 Ga0207645_10015713 3300025907 Bacteria 5021
539 Ga0207643_10004003 3300025908 Bacteria 7927
540 Ga0207705_10000045 3300025909 Bacteria 180625
541 Ga0207705_10008413 3300025909 Bacteria 7533
542 Ga0207705_10017000 3300025909 Bacteria 5210
543 Ga0207705_10044405 3300025909 Bacteria 3194
544 Ga0207705_10485749 3300025909 Bacteria 959
545 Ga0207654_10002120 3300025911 Bacteria 10159
546 Ga0207654_10157450 3300025911 Bacteria 1464
547 Ga0207654_10164806 3300025911 Bacteria 1434
548 Ga0207654_10411554 3300025911 Bacteria 942
549 Ga0207654_10426098 3300025911 Bacteria 927
550 Ga0207707_10005461 3300025912 Bacteria 11112
551 Ga0207695_10000019 3300025913 Bacteria 732137
552 Ga0207695_10000020 3300025913 Bacteria 723025
553 Ga0207695_10003958 3300025913 Bacteria 20474
554 Ga0207695_10008283 3300025913 Bacteria 13039
555 Ga0207695_10014224 3300025913 Bacteria 9439
556 Ga0207695_10018922 3300025913 Bacteria 7946
557 Ga0207695_10046570 3300025913 Bacteria 4596
558 Ga0207695_10167957 3300025913 Bacteria 2121
559 Ga0207695_10237931 3300025913 Bacteria 1723
560 Ga0207695_10259311 3300025913 Bacteria 1636
561 Ga0207695_10273487 3300025913 Bacteria 1584
562 Ga0207671_10000030 3300025914 Bacteria 248197
563 Ga0207671_10000598 3300025914 Bacteria 48008
564 Ga0207671_10003239 3300025914 Bacteria 16379
565 Ga0207671_10011028 3300025914 Bacteria 7399
566 Ga0207671_10026560 3300025914 Bacteria 4336
567 Ga0207671_10055827 3300025914 Bacteria 2926
568 Ga0207671_10058076 3300025914 Unclassified 2868
569 Ga0207671_10071906 3300025914 Bacteria 2580
570 Ga0207671_10143677 3300025914 Bacteria 1840
571 Ga0207660_10006965 3300025917 Bacteria 7323
572 Ga0207660_10051946 3300025917 Bacteria 2916
573 Ga0207660_10215945 3300025917 Bacteria 1503
574 Ga0207660_10347568 3300025917 Bacteria 1188
575 Ga0207662_10027483 3300025918 Bacteria 3283
576 Ga0207662_10067807 3300025918 Bacteria 2153
577 Ga0207657_10001634 3300025919 Bacteria 24147
578 Ga0207657_10004444 3300025919 Bacteria 14832
579 Ga0207657_10010980 3300025919 Bacteria 9002
580 Ga0207657_10011267 3300025919 Bacteria 8883
581 Ga0207657_10076883 3300025919 Bacteria 2815
582 Ga0207657_10085863 3300025919 Bacteria 2635
583 Ga0207657_10251887 3300025919 Bacteria 1407
584 Ga0207657_10352626 3300025919 Bacteria 1160
585 Ga0207657_10442178 3300025919 Bacteria 1021
586 Ga0207657_10472136 3300025919 Bacteria 984
587 Ga0207649_10003318 3300025920 Bacteria 8812
588 Ga0207649_10397148 3300025920 Bacteria 1031
589 Ga0207652_10000101 3300025921 Bacteria 93033
590 Ga0207652_10000616 3300025921 Bacteria 35409
591 Ga0207652_10066856 3300025921 Bacteria 3116
592 Ga0207652_10125949 3300025921 Bacteria 2282
593 Ga0207652_10154826 3300025921 Unclassified 2053
594 Ga0207652_10395785 3300025921 Bacteria 1247
595 Ga0207681_10064578 3300025923 Bacteria 2528
596 Ga0207681_10187533 3300025923 Bacteria 1580
597 Ga0207681_10342378 3300025923 Unclassified 1195
598 Ga0207694_10018165 3300025924 Bacteria 5317
599 Ga0207694_10161145 3300025924 Bacteria 1812
600 Ga0207650_10008032 3300025925 Bacteria 7192
601 Ga0207650_10126189 3300025925 Bacteria 1998
602 Ga0207650_10145444 3300025925 Bacteria 1867
603 Ga0207659_10036403 3300025926 Bacteria 3409
604 Ga0207644_10010200 3300025931 Bacteria 6190
605 Ga0207644_10071321 3300025931 Bacteria 2541
606 Ga0207644_10080754 3300025931 Bacteria 2402
607 Ga0207644_10178546 3300025931 Bacteria 1663
608 Ga0207644_10439473 3300025931 Bacteria 1071
609 Ga0207690_10029414 3300025932 Bacteria 3493
610 Ga0207690_10187068 3300025932 Bacteria 1563
611 Ga0207690_10255898 3300025932 Bacteria 1355
612 Ga0207706_10000047 3300025933 Bacteria 119022
613 Ga0207706_10002437 3300025933 Bacteria 18156
614 Ga0207706_10004864 3300025933 Bacteria 12575
615 Ga0207706_10068732 3300025933 Bacteria 3116
616 Ga0207706_10142600 3300025933 Bacteria 2107
617 Ga0207686_10155289 3300025934 Unclassified 1598
618 Ga0207709_10000006 3300025935 Bacteria 800946
619 Ga0207670_10126009 3300025936 Bacteria 1869
620 Ga0207669_10142655 3300025937 Bacteria 1665
621 Ga0207704_10000077 3300025938 Bacteria 60841
622 Ga0207704_10006021 3300025938 Bacteria 5623
623 Ga0207704_10105746 3300025938 Bacteria 1889
624 Ga0207691_10038025 3300025940 Bacteria 4453
625 Ga0207691_10054995 3300025940 Bacteria 3630
626 Ga0207691_10225154 3300025940 Bacteria 1625
627 Ga0207711_10020688 3300025941 Bacteria 5490
628 Ga0207689_10013159 3300025942 Bacteria 7060
629 Ga0207689_10018391 3300025942 Bacteria 5896
630 Ga0207689_10019124 3300025942 Bacteria 5775
631 Ga0207689_10199952 3300025942 Bacteria 1649
632 Ga0207661_10011467 3300025944 Bacteria 6423
633 Ga0207661_10041731 3300025944 Bacteria 3613
634 Ga0207661_10048489 3300025944 Bacteria 3376
635 Ga0207679_10004167 3300025945 Bacteria 8985
636 Ga0207679_10460266 3300025945 Bacteria 1129
637 Ga0207667_10000015 3300025949 Bacteria 417534
638 Ga0207667_10001154 3300025949 Bacteria 33200
639 Ga0207667_10001998 3300025949 Bacteria 25593
640 Ga0207667_10100799 3300025949 Bacteria 2979
641 Ga0207667_10130653 3300025949 Bacteria 2587
642 Ga0207667_10184001 3300025949 Bacteria 2145
643 Ga0207667_10413063 3300025949 Bacteria 1373
644 Ga0207667_10497882 3300025949 Bacteria 1236
645 Ga0207667_10877522 3300025949 Unclassified 890
646 Ga0207667_10903059 3300025949 Bacteria 875
647 Ga0207651_10013162 3300025960 Bacteria 4721
648 Ga0207651_10015118 3300025960 Unclassified 4476
649 Ga0207651_10016093 3300025960 Bacteria 4369
650 Ga0207651_10163018 3300025960 Bacteria 1750
651 Ga0207651_10193239 3300025960 Bacteria 1625
652 Ga0207712_10115130 3300025961 Bacteria 2024
653 Ga0207668_10217307 3300025972 Unclassified 1532
654 Ga0207640_10172991 3300025981 Bacteria 1611
655 Ga0207658_10069256 3300025986 Bacteria 2665
656 Ga0207658_10081452 3300025986 Bacteria 2482
657 Ga0207677_10020944 3300026023 Bacteria 3984
658 Ga0207677_10080635 3300026023 Bacteria 2332
659 Ga0207677_10122710 3300026023 Bacteria 1957
660 Ga0207677_10350945 3300026023 Bacteria 1236
661 Ga0207703_10094545 3300026035 Bacteria 2520
662 Ga0207639_10006130 3300026041 Bacteria 8161
663 Ga0207639_10137462 3300026041 Bacteria 2031
664 Ga0207639_10270931 3300026041 Bacteria 1489
665 Ga0207678_10052971 3300026067 Bacteria 3498
666 Ga0207678_10176787 3300026067 Bacteria 1823
667 Ga0207702_10000249 3300026078 Bacteria 62542
668 Ga0207702_10009673 3300026078 Bacteria 8093
669 Ga0207702_10010544 3300026078 Bacteria 7725
670 Ga0207702_10035034 3300026078 Bacteria 4197
671 Ga0207702_10036092 3300026078 Bacteria 4134
672 Ga0207702_10204751 3300026078 Unclassified 1831
673 Ga0207702_10714360 3300026078 Bacteria 988
674 Ga0207702_11078720 3300026078 Bacteria 797
675 Ga0207641_10007365 3300026088 Bacteria 9163
676 Ga0207641_10120909 3300026088 Bacteria 2337
677 Ga0207641_10415418 3300026088 Bacteria 1294
678 Ga0207648_10000510 3300026089 Bacteria 43437
679 Ga0207648_10001095 3300026089 Bacteria 30359
680 Ga0207648_10021772 3300026089 Bacteria 5759
681 Ga0207648_10055384 3300026089 Bacteria 3462
682 Ga0207648_10083555 3300026089 Bacteria 2785
683 Ga0207648_10092067 3300026089 Bacteria 2651
684 Ga0207648_10178422 3300026089 Bacteria 1879
685 Ga0207676_10011977 3300026095 Bacteria 6207
686 Ga0207676_10050878 3300026095 Bacteria 3233
687 Ga0207676_10116109 3300026095 Bacteria 2249
688 Ga0207676_11049257 3300026095 Bacteria 804
689 Ga0207674_10008194 3300026116 Bacteria 12110
690 Ga0207674_10009099 3300026116 Bacteria 11397
691 Ga0207674_10041481 3300026116 Bacteria 4760
692 Ga0207674_10097503 3300026116 Bacteria 2924
693 Ga0207674_10126818 3300026116 Unclassified 2518
694 Ga0207674_10218084 3300026116 Bacteria 1856
695 Ga0207674_10346348 3300026116 Bacteria 1437
696 Ga0207675_100024542 3300026118 Bacteria 5605
697 Ga0207675_100856970 3300026118 Bacteria 924
698 Ga0207683_10005179 3300026121 Bacteria 11193
699 Ga0207683_10061266 3300026121 Bacteria 3311
700 Ga0207683_10122996 3300026121 Bacteria 2331
701 Ga0207683_10556700 3300026121 Bacteria 1060
702 Ga0207698_10022714 3300026142 Bacteria 4367
703 Ga0207698_10191858 3300026142 Unclassified 1821
704 Ga0268266_10000030 3300028379 Bacteria 417120
705 Ga0268266_10000845 3300028379 Bacteria 39924
706 Ga0268266_10052969 3300028379 Bacteria 3485
707 Ga0268264_10100624 3300028381 Bacteria 2511
708 Ga0268264_10214036 3300028381 Bacteria 1771
709 Ga0268264_10224140 3300028381 Unclassified 1732
710 Ga0268264_10514284 3300028381 Bacteria 1169
711 Ga0307517_10039555 3300028786 Bacteria 5174
712 Ga0307515_10000859 3300028794 Bacteria 69963
713 Ga0307515_10001574 3300028794 Bacteria 50970
714 Ga0307515_10099128 3300028794 Unclassified 3541
715 Ga0316177_1082586 3300030731 Bacteria 11362
716 Ga0316176_1049708 3300030732 Bacteria 17137
717 Ga0316183_1098942 3300030742 Bacteria 10393
718 Ga0316181_1041568 3300030744 Bacteria 14224
719 Ga0265327_10000026 3300031251 Bacteria 379288
720 Ga0265327_10000030 3300031251 Bacteria 333531
721 Ga0265327_10000137 3300031251 Bacteria 160704
722 Ga0265327_10053815 3300031251 Bacteria 2086
723 Ga0265327_10102367 3300031251 Bacteria 1380
724 Ga0265327_10189712 3300031251 Bacteria 936
725 Ga0307509_10062346 3300031507 Bacteria 3932
726 Ga0307408_100003148 3300031548 Bacteria 11370
727 Ga0307408_100004875 3300031548 Bacteria 9039
728 Ga0307408_100007443 3300031548 Bacteria 7243
729 Ga0307405_10000481 3300031731 Bacteria 14975
730 Ga0307405_10047381 3300031731 Bacteria 2646
731 Ga0307407_10000041 3300031903 Bacteria 65180
732 Ga0307412_10000142 3300031911 Bacteria 51770
733 Ga0307412_10000823 3300031911 Bacteria 17889
734 Ga0307412_10027106 3300031911 Bacteria 3569
735 Ga0307412_10100605 3300031911 Bacteria 2044
736 Ga0307416_100000029 3300032002 Bacteria 164815
737 Ga0307414_10000269 3300032004 Bacteria 32505
738 Ga0307414_10000504 3300032004 Bacteria 20317
739 Ga0307414_10011832 3300032004 Bacteria 5137
740 Ga0307414_10032775 3300032004 Bacteria 3426
741 Ga0307414_10396129 3300032004 Bacteria 1198
742 Ga0307411_10301092 3300032005 Bacteria 1286
743 Ga0307415_100536055 3300032126 Bacteria 1030
744 Ga0307507_10000510 3300033179 Bacteria 81853
745 Ga0373924_0028945 3300035410 Bacteria 2211
746 Ga0373933_0067349 3300035724 Bacteria 2172
747 Ga0395899_0000002 3300037312 Bacteria 1324310
748 Ga0395899_0000209 3300037312 Bacteria 85489
749 Ga0395899_0000526 3300037312 Bacteria 42013
750 Ga0395899_0000749 3300037312 Bacteria 32276
751 Ga0395899_0003678 3300037312 Bacteria 12144
752 Ga0395899_0045558 3300037312 Bacteria 3268
753 Ga0395899_0058035 3300037312 Bacteria 2855
754 Ga0395899_0296586 3300037312 Bacteria 1095
755 Ga0395900_0000406 3300037418 Bacteria 62078
756 Ga0395900_0021329 3300037418 Bacteria 6622
757 Ga0395900_0029525 3300037418 Bacteria 5624
758 Ga0395900_0032777 3300037418 Bacteria 5344
759 Ga0395900_0046849 3300037418 Bacteria 4451
760 Ga0395900_0056520 3300037418 Bacteria 4039
761 Ga0395900_0115526 3300037418 Bacteria 2754
762 Ga0395900_0127250 3300037418 Bacteria 2612
763 Ga0395900_0128798 3300037418 Bacteria 2594
764 Ga0395900_0146344 3300037418 Bacteria 2415
765 Ga0395900_0305199 3300037418 Bacteria 1576
766 Ga0395898_0003004 3300037466 Bacteria 19122
767 Ga0395898_0004432 3300037466 Bacteria 15361
768 Ga0395898_0016694 3300037466 Bacteria 7503
769 Ga0395898_0016836 3300037466 Bacteria 7467
770 Ga0395898_0058458 3300037466 Bacteria 3753
771 Ga0395898_0103450 3300037466 Bacteria 2732
772 Ga0395905_0000003 3300037471 Bacteria 1347396
773 Ga0395905_0000175 3300037471 Bacteria 104024
774 Ga0395905_0000376 3300037471 Bacteria 63695
775 Ga0395905_0000981 3300037471 Bacteria 36581
776 Ga0395905_0034059 3300037471 Bacteria 4783
777 Ga0395905_0146663 3300037471 Bacteria 2220
778 Ga0395901_0000313 3300038443 Bacteria 59766
779 Ga0395901_0001780 3300038443 Bacteria 22229
780 Ga0395901_0008545 3300038443 Bacteria 10348
781 Ga0395901_0021706 3300038443 Bacteria 6578
782 Ga0395901_0123470 3300038443 Bacteria 2721
783 Ga0395901_0158398 3300038443 Bacteria 2378
784 Ga0395901_0274631 3300038443 Bacteria 1752
785 Ga0395901_0634788 3300038443 Bacteria 1073
786 Ga0436365_0614130 3300039437 Bacteria 27402
787 Ga0436365_1285215 3300039437 Bacteria 11167
788 Ga0436361_0793109 3300039447 Bacteria 21720
789 Ga0451791_1548410 3300041451 Bacteria 1261
790 Ga0451795_0579925 3300041456 Bacteria 1084
791 Ga0451807_1215663 3300041486 Unclassified 781
792 Ga0451855_0129897 3300041511 Unclassified 1767
793 Ga0439445_0002151 3300042004 Bacteria 4362
794 Ga0439455_0079953 3300042012 Bacteria 887
795 Ga0451577_0123928 3300042876 Bacteria 2316
796 Ga0451577_0127077 3300042876 Bacteria 2285
797 Ga0451577_0833259 3300042876 Bacteria 832
798 Ga0466972_0000055 3300044658 Bacteria 111338
799 Ga0453683_0170060 3300044673 Bacteria 1380
800 Ga0466965_0290632 3300044683 Bacteria 885
801 Ga0466966_0166267 3300044684 Bacteria 1341
802 Ga0466961_0029110 3300044693 Bacteria 3551
803 Ga0453684_0010580 3300044712 Bacteria 15739
804 Ga0453684_0042221 3300044712 Bacteria 6151
805 Ga0453684_0212825 3300044712 Bacteria 2245
806 Ga0453684_0376747 3300044712 Bacteria 1594
807 Ga0453684_0823714 3300044712 Bacteria 999
808 Ga0466970_0001040 3300044765 Bacteria 13412
809 Ga0466970_0023647 3300044765 Bacteria 3211
810 Ga0451576_0000012 3300045051 Bacteria 674684
811 Ga0466958_0045640 3300045836 Bacteria 2644
812 Ga0466967_0240144 3300045976 Bacteria 1728
813 Ga0495627_000881 3300046453 Bacteria 21138
814 Ga0495638_0140896 3300046460 Bacteria 1408
815 Ga0495651_0076728 3300046462 Bacteria 2531
816 Ga0495651_0242095 3300046462 Bacteria 1237
817 Ga0495650_0001050 3300046471 Bacteria 30706
818 Ga0495650_0057509 3300046471 Bacteria 1574
819 Ga0495585_0000153 3300046492 Bacteria 74267
820 Ga0495594_0302665 3300046499 Bacteria 911
821 Ga0495583_0076587 3300046506 Bacteria 1461
822 Ga0495606_0000033 3300046507 Bacteria 247739
823 Ga0495606_0009027 3300046507 Bacteria 8517
824 Ga0495606_0234457 3300046507 Unclassified 1027
825 Ga0495610_0000093 3300046512 Bacteria 105873
826 Ga0495610_0002547 3300046512 Bacteria 15174
827 Ga0495610_0002700 3300046512 Bacteria 14625
828 Ga0495616_0051386 3300046513 Bacteria 2056
829 Ga0495618_0057138 3300046514 Bacteria 2471
830 Ga0495630_0018579 3300046517 Bacteria 5109
831 Ga0495631_0178872 3300046518 Bacteria 909
832 Ga0495637_0055151 3300046520 Bacteria 1649
833 Ga0495644_0008891 3300046523 Bacteria 3863
834 Ga0495648_0008346 3300046524 Bacteria 8165
835 Ga0495642_0108783 3300046528 Bacteria 1184
836 Ga0495652_0138696 3300046529 Bacteria 1915
837 Ga0495586_0293154 3300046535 Bacteria 932
838 Ga0495633_0000137 3300046558 Bacteria 96876
839 Ga0495633_0004346 3300046558 Bacteria 9047
840 Ga0495668_0000009 3300046616 Bacteria 492623
841 Ga0495668_0000187 3300046616 Bacteria 92571
842 Ga0495668_0034499 3300046616 Bacteria 2838
843 Ga0495668_0221517 3300046616 Bacteria 1036
844 Ga0495611_0280244 3300046648 Unclassified 770
845 Ga0495625_0000131 3300046660 Bacteria 117738
846 Ga0495625_0000385 3300046660 Bacteria 67419
847 Ga0495625_0001975 3300046660 Bacteria 23138
848 Ga0495625_0038288 3300046660 Bacteria 3512
849 Ga0495625_0471515 3300046660 Bacteria 772
850 Ga0495661_0005299 3300046665 Bacteria 9169
851 Ga0495661_0043674 3300046665 Bacteria 2753
852 Ga0495661_0071661 3300046665 Bacteria 2024
853 Ga0495658_0037745 3300046683 Bacteria 2672
854 Ga0495669_0169611 3300046684 Unclassified 1038
855 Ga0495671_0206250 3300046692 Bacteria 953
856 Ga0495649_0000009 3300046694 Bacteria 451725
857 Ga0495660_0007516 3300046810 Bacteria 6396
858 Ga0495680_0125309 3300047322 Bacteria 1893
859 Ga0495687_000483 3300047443 Bacteria 48330
860 Ga0495687_000882 3300047443 Bacteria 31691
861 Ga0495685_078947 3300047447 Bacteria 1097
862 Ga0495673_0054749 3300047469 Bacteria 1734
863 Ga0495681_0212897 3300047470 Bacteria 778
864 Ga0495684_0172942 3300047471 Bacteria 1605
865 Ga0495686_0000299 3300047472 Bacteria 85384
866 Ga0495686_0001086 3300047472 Bacteria 32331
867 Ga0495686_0006681 3300047472 Bacteria 8778
868 Ga0495686_0153381 3300047472 Bacteria 1351
869 Ga0495686_0159993 3300047472 Bacteria 1316
870 Ga0495686_0199183 3300047472 Unclassified 1150
871 Ga0495686_0227655 3300047472 Bacteria 1057
872 Ga0495614_0014365 3300048089 Bacteria 3466
873 Ga0496101_0112180 3300048904 Bacteria 2054
874 Ga0496105_0201029 3300048908 Unclassified 1627
875 Ga0496106_0235653 3300048909 Bacteria 1462
876 Ga0496106_0588096 3300048909 Bacteria 892
877 Ga0496108_0533744 3300048911 Bacteria 1024
878 Ga0496114_0000420 3300048917 Bacteria 31391
879 Ga0496116_0001546 3300048919 Bacteria 25478
880 Ga0496117_0007089 3300048920 Bacteria 11078
881 Ga0496121_0000010 3300048924 Bacteria 793488
882 Ga0496122_0000014 3300048925 Bacteria 491410
883 Ga0496122_0000479 3300048925 Bacteria 83186
884 Ga0496122_0005425 3300048925 Bacteria 15202
885 Ga0496123_0004038 3300048926 Bacteria 15821
886 Ga0496123_0007432 3300048926 Bacteria 10318
887 Ga0496123_0246268 3300048926 Bacteria 884
888 Ga0496124_0023126 3300048927 Bacteria 5683
889 Ga0496125_0085272 3300048928 Bacteria 2394
890 Ga0496126_0000019 3300048929 Bacteria 564723
891 Ga0496126_0033933 3300048929 Bacteria 4799
892 Ga0495682_0034191 3300049460 Bacteria 1875
893 Ga0501031_0000222 3300049568 Bacteria 32499
894 Ga0501032_0002894 3300049569 Bacteria 13347
895 Ga0501032_0020282 3300049569 Bacteria 4632
896 Ga0501032_0189343 3300049569 Bacteria 1345
897 Ga0501032_0395420 3300049569 Bacteria 888
898 Ga0501033_0000042 3300049570 Bacteria 137850
899 Ga0501033_0105401 3300049570 Bacteria 2055
900 Ga0501033_0122732 3300049570 Bacteria 1884
901 Ga0501033_0156647 3300049570 Unclassified 1641
902 Ga0501034_0000575 3300049571 Bacteria 58033
903 Ga0501034_0022033 3300049571 Bacteria 6491
904 Ga0501034_0024146 3300049571 Bacteria 6184
905 Ga0501034_0086406 3300049571 Bacteria 3137
906 Ga0501034_0133366 3300049571 Bacteria 2466
907 Ga0501034_0702248 3300049571 Unclassified 910
908 Ga0501036_0003797 3300049572 Bacteria 12116
909 Ga0501036_0057048 3300049572 Bacteria 3308
910 Ga0501037_0005070 3300049573 Bacteria 9585
911 Ga0501037_0146479 3300049573 Bacteria 1689
912 Ga0501037_0351035 3300049573 Bacteria 1018
913 Ga0501038_0001828 3300049574 Bacteria 19698
914 Ga0501038_0039950 3300049574 Bacteria 4101
915 Ga0501039_0013235 3300049575 Bacteria 6307
916 Ga0501039_0352633 3300049575 Unclassified 1156
917 Ga0501043_0000859 3300049579 Bacteria 26938
918 Ga0501043_0011914 3300049579 Bacteria 6803
919 Ga0501046_0048029 3300049580 Bacteria 3381
920 Ga0501047_0005599 3300049581 Bacteria 11829
921 Ga0501048_0116409 3300049582 Bacteria 1888
922 Ga0501067_0096778 3300049583 Bacteria 1639
923 Ga0501070_0044371 3300049586 Unclassified 3700
924 Ga0501070_0075600 3300049586 Bacteria 2789
925 Ga0501073_0001109 3300049589 Bacteria 19534
926 Ga0501077_0164726 3300049593 Bacteria 1408
927 Ga0501198_006634 3300049649 Bacteria 1652
928 Ga0501208_075185 3300049655 Bacteria 686
929 Ga0501223_001002 3300049663 Bacteria 6680
930 Ga0501252_023451 3300049682 Bacteria 820
931 Ga0501083_0020863 3300049744 Bacteria 4554
932 Ga0501241_000831 3300049758 Bacteria 6554
933 Ga0501241_047490 3300049758 Bacteria 843
934 Ga0501035_0001848 3300049822 Bacteria 21321
935 Ga0501035_0019376 3300049822 Bacteria 6259
936 Ga0501035_0081243 3300049822 Unclassified 2861
937 Ga0501035_0456697 3300049822 Bacteria 1056
938 Ga0501044_0000452 3300049823 Bacteria 49992
939 Ga0501044_0036729 3300049823 Bacteria 5124
940 Ga0501044_0096944 3300049823 Bacteria 2970
941 Ga0501044_0400073 3300049823 Bacteria 1286
942 Ga0501045_0000439 3300049824 Bacteria 25508
943 nmdc:mga0k408_22137_c2 3300050493 Bacteria 3111
944 nmdc:mga0k408_282_c1 3300050493 Bacteria 27609
945 nmdc:mga0k408_544_c1 3300050493 Bacteria 15911
946 nmdc:mga0k408_65692_c1 3300050493 Bacteria 2112
947 nmdc:mga07m45_168818_c1 3300050496 Bacteria 1271
948 Ga0500635_0001217 3300053080 Bacteria 6162
949 Ga0495619_0092134 3300053085 Bacteria 2053
950 Ga0500644_0009828 3300053088 Bacteria 2571
951 Ga0500581_059254 3300053089 Bacteria 1942
952 Ga0500651_0000280 3300053093 Bacteria 29979
953 Ga0500566_0004444 3300053094 Bacteria 8366
954 Ga0500556_0017841 3300053104 Bacteria 2230
955 Ga0500562_000083 3300053108 Bacteria 41350
956 Ga0500608_019222 3300053122 Bacteria 3128
957 Ga0500614_014079 3300053123 Bacteria 1766
958 Ga0500618_000012 3300053125 Bacteria 185382
959 Ga0500577_0104140 3300053142 Bacteria 1164
960 Ga0500616_0004942 3300053153 Bacteria 9255
961 Ga0500616_0044650 3300053153 Bacteria 2364
962 Ga0500616_0080489 3300053153 Bacteria 1638
963 Ga0500622_0000051 3300053156 Bacteria 145514
964 Ga0500622_0001321 3300053156 Bacteria 20162
965 Ga0500622_0003294 3300053156 Bacteria 10940
966 Ga0500624_000281 3300053157 Bacteria 17593
967 Ga0500627_0024315 3300053158 Bacteria 2478
968 Ga0500645_019587 3300053730 Bacteria 2104
969 Ga0500645_022425 3300053730 Bacteria 1942
970 Ga0500661_003766 3300055283 Bacteria 2847
971 Ga0500661_028909 3300055283 Bacteria 977
972 2586210491 2585427687 Bacteria 5544917
973 2599480366 2599185184 Bacteria 6430550
974 2722728755 2721755487 Bacteria 6357185
975 2738758039 2738541283 Bacteria 7222293
976 2738763759 2738541284 Bacteria 5199923
977 2738852329 2738541302 Bacteria 5944758
978 2739304474 2738543023 Bacteria 6767879
979 2739589781 2739367651 Bacteria 6359826
980 2739617926 2739367656 Bacteria 5152243
981 2739644122 2739367663 Bacteria 5040914
982 2776614896 2775506987 Bacteria 5373360
983 2819550305 2818991437 Bacteria 5805520
984 2819586850 2818991444 Bacteria 6968812
985 2819680619 2818991460 Bacteria 7595395
986 2842722486 2842722452 Bacteria 6263924
987 2842906776 2842903701 Bacteria 6986368
988 2842914593 2842909656 Bacteria 6185908
989 2849287082 2849281842 Bacteria 6065644
990 2852624780 2852623160 Bacteria 4376875
991 2852630013 2852627209 Bacteria 5896285
992 2857632359 2857627736 Bacteria 5625397
993 2884936331 2884933994 Bacteria 4535041
994 2890738609 2890737413 Bacteria 4269751
995 2896317934 2896317667 Bacteria 4606601
996 2896344932 2896344016 Bacteria 3811746
997 2898715251 2898713307 Bacteria 4110805
998 2902050224 2902048731 Bacteria 4976191
999 2904449402 2904445276 Bacteria 5310396
1000 2904784256 2904780799 Bacteria 5840761
1001 2919179120 2919177583 Bacteria 5641607
1002 2919188305 2919186247 Bacteria 6244071
1003 2919438218 2919437846 Bacteria 6199444
1004 2928083392 2928078545 Bacteria 6534839
1005 2928151345 2928147474 Bacteria 6512076
1006 2928520333 2928519762 Bacteria 1953908
1007 2929157003 2929154850 Bacteria 6753285
1008 2929245044 2929239360 Bacteria 7745570
1009 2932087263 2932082852 Bacteria 6563563
1010 2939664428 2939664404 Bacteria 6364494
1011 2945999440 2945997725 Bacteria 6404843
1012 2954016171 2954016120 Bacteria 6446024
1013 2977236040 2977232053 Bacteria 5485925
1014 3003233809 3003233435 Bacteria 4458031
1015 8055589100 8055588893 Bacteria 3619545
1016 Ga0307510_10005801
1017 SwRhRL2b_contig_1283784
1018 SwRhRL2b_contig_1663050
1019 SwRhRL2b_contig_1916358
1020 SwRhRL2b_contig_2744323
1021 SwRhRL2b_contig_3708819
1022 JGI24741J21665_1018335
1023 JGI24740J21852_10010217
1024 JGI24740J21852_10025264
1025 JGI24740J21852_10047026
1026 JGI24739J22299_10009023
1027 JGI24737J22298_10016579
1028 JGI24735J21928_10000013
1029 JGI24744J21845_10002459
1030 JGI24744J21845_10011147
1031 JGI25162J39368_1000180
1032 JGI25162J39368_1001035
1033 JGI25164J39214_1001426
1034 JGI25152J39213_1000160
1035 JGI25150J39212_1000002
1036 JGI25151J46595_10000003
1037 JGI25406J46586_10000320
1038 JGI25153J46596_10000003
1039 rootH1_10018516
1040 rootH1_10020058
1041 rootH1_10162869
1042 rootH1_10188534
1043 rootH2_10005336
1044 rootH2_10039401
1045 rootH2_10041787
1046 rootH2_10050610
1047 rootH2_10078540
1048 rootH2_10096793
1049 rootH2_10312559
1050 rootL2_10077558
1051 rootL2_10138667
1052 rootL2_10142782
1053 rootL2_10189067
1054 rootL2_10233241
1055 rootH1_10000549
1056 rootH1_10065836
1057 rootH1_10105207
1058 rootH1_10136684
1059 rootH1_10165942
1060 rootH1_10217929
1061 rootH1_10284471
1062 rootH1_10312356
1063 rootH1_10314976
1064 JGI25160J50197_1000809
1065 JGI25160J50197_1003840
1066 Ga0055536_1000007
1067 Ga0055528_1002286
1068 Ga0055530_10001851
1069 Ga0055530_10002693
1070 Ga0055531_10000237
1071 Ga0065165_1000190
1072 Ga0065714_10002536
1073 Ga0065714_10002974
1074 Ga0065714_10007179
1075 Ga0065714_10064993
1076 Ga0065714_10065917
1077 Ga0065714_10083180
1078 Ga0065714_10104208
1079 Ga0065714_10133435
1080 Ga0065704_10070140
1081 Ga0065704_10070358
1082 Ga0065704_10071378
1083 Ga0065704_10078114
1084 Ga0065704_10080198
1085 Ga0065704_10081542
1086 Ga0065712_10003463
1087 Ga0065712_10316161
1088 Ga0070658_10000028
1089 Ga0070658_10084497
1090 Ga0070658_10091213
1091 Ga0070658_10274336
1092 Ga0070658_10296353
1093 Ga0070658_10334546
1094 Ga0070658_10507700
1095 Ga0070676_10000004
1096 Ga0070676_10000426
1097 Ga0070676_10328403
1098 Ga0070683_100013700
1099 Ga0070683_100027378
1100 Ga0070683_100032351
1101 Ga0070683_100065783
1102 Ga0070690_100015759
1103 Ga0070670_100030789
1104 Ga0070670_100045950
1105 Ga0070670_100060851
1106 Ga0070670_100375219
1107 Ga0068869_100019499
1108 Ga0068869_100044739
1109 Ga0068869_100201745
1110 Ga0070666_10024416
1111 Ga0070666_10030332
1112 Ga0070680_100011331
1113 Ga0070680_100035814
1114 Ga0070680_100046874
1115 Ga0070680_100060193
1116 Ga0070680_100265533
1117 Ga0070682_100018125
1118 Ga0068868_100001148
1119 Ga0068868_100008840
1120 Ga0068868_100061888
1121 Ga0068868_100442776
1122 Ga0068868_100592463
1123 Ga0070660_100003457
1124 Ga0070660_100020931
1125 Ga0070660_100029171
1126 Ga0070660_100076358
1127 Ga0070660_100113149
1128 Ga0070660_100115650
1129 Ga0070660_100385728
1130 Ga0070689_100309053
1131 Ga0070691_10024526
1132 Ga0070687_100076750
1133 Ga0070687_100141208
1134 Ga0070661_100023853
1135 Ga0070661_100547611
1136 Ga0070668_100295137
1137 Ga0070669_100010920
1138 Ga0070675_100013072
1139 Ga0070675_100150274
1140 Ga0070675_100297976
1141 Ga0070675_100756468
1142 Ga0070671_100028142
1143 Ga0070671_100095618
1144 Ga0070674_100020850
1145 Ga0070674_100113808
1146 Ga0070673_100093542
1147 Ga0070673_100128526
1148 Ga0070673_100184295
1149 Ga0070673_100507900
1150 Ga0070688_100075431
1151 Ga0070688_100386269
1152 Ga0070659_100000100
1153 Ga0070659_100004457
1154 Ga0070659_100015244
1155 Ga0070659_100035543
1156 Ga0070659_100042935
1157 Ga0070659_100142050
1158 Ga0070667_100006801
1159 Ga0070667_100060914
1160 Ga0070667_100062397
1161 Ga0070667_100239016
1162 Ga0070663_100004723
1163 Ga0070663_100154470
1164 Ga0070678_100001206
1165 Ga0070678_100029061
1166 Ga0070678_100039826
1167 Ga0070678_100306542
1168 Ga0070678_100681287
1169 Ga0070662_100000014
1170 Ga0070662_100003803
1171 Ga0070662_100059800
1172 Ga0070662_100082408
1173 Ga0070662_100359515
1174 Ga0070662_100418845
1175 Ga0070681_10002077
1176 Ga0070681_10908519
1177 Ga0068867_100000636
1178 Ga0068867_100035731
1179 Ga0068867_100043873
1180 Ga0068867_100047846
1181 Ga0068867_100069414
1182 Ga0068867_100089400
1183 Ga0068867_100283141
1184 Ga0068867_100753280
1185 Ga0070685_10076041
1186 Ga0070679_100000517
1187 Ga0070679_100031317
1188 Ga0070679_100064164
1189 Ga0070679_100099245
1190 Ga0070679_100107216
1191 Ga0070679_100188124
1192 Ga0070684_100020461
1193 Ga0070684_100047930
1194 Ga0070684_100060599
1195 Ga0070684_100801724
1196 Ga0068853_100008704
1197 Ga0068853_100011075
1198 Ga0068853_100050481
1199 Ga0068853_100301312
1200 Ga0068853_100330101
1201 Ga0068853_100344676
1202 Ga0068853_100354133
1203 Ga0068853_100367136
1204 Ga0068853_100500516
1205 Ga0068853_100574457
1206 Ga0068853_100766468
1207 Ga0070672_100041407
1208 Ga0070672_100113426
1209 Ga0070672_100124147
1210 Ga0070672_100186605
1211 Ga0070665_100000032
1212 Ga0070665_100000442
1213 Ga0070665_100059771
1214 Ga0070665_100161785
1215 Ga0070704_100700516
1216 Ga0068855_100000049
1217 Ga0068855_100000658
1218 Ga0068855_100004342
1219 Ga0068855_100012340
1220 Ga0068855_100030872
1221 Ga0068855_100101452
1222 Ga0068855_100143256
1223 Ga0068855_100152064
1224 Ga0068855_100176779
1225 Ga0068855_100233879
1226 Ga0068855_100445914
1227 Ga0068855_100540825
1228 Ga0070664_100018922
1229 Ga0070664_100070386
1230 Ga0070664_100217692
1231 Ga0070664_100236044
1232 Ga0070664_100363996
1233 Ga0070664_100374788
1234 Ga0068857_100016681
1235 Ga0068857_100334011
1236 Ga0068854_100213658
1237 Ga0068854_100460043
1238 Ga0068856_100000005
1239 Ga0068856_100000424
1240 Ga0068856_100045491
1241 Ga0068856_100060542
1242 Ga0068856_100161706
1243 Ga0068856_100246115
1244 Ga0068856_100264731
1245 Ga0068856_100575876
1246 Ga0068856_100910564
1247 Ga0068856_101151736
1248 Ga0070702_100065400
1249 Ga0068852_100055520
1250 Ga0068852_100208765
1251 Ga0068852_100659888
1252 Ga0068852_100759826
1253 Ga0068859_100249854
1254 Ga0068859_100250268
1255 Ga0068859_100795592
1256 Ga0068859_101006713
1257 Ga0068864_100020770
1258 Ga0068864_100051272
1259 Ga0068864_100053174
1260 Ga0068864_100149758
1261 Ga0068864_100214985
1262 Ga0068861_100079101
1263 Ga0068861_100398783
1264 Ga0068851_10012608
1265 Ga0068870_10009985
1266 Ga0068870_10169029
1267 Ga0068870_10188031
1268 Ga0068863_100033510
1269 Ga0068863_100489852
1270 Ga0068860_100023461
1271 Ga0068860_100066819
1272 Ga0068860_100120755
1273 Ga0068860_100132142
1274 Ga0068860_100190085
1275 Ga0068860_100707649
1276 Ga0068862_100086787
1277 Ga0081539_10000147
1278 Ga0070716_100146709
1279 Ga0075366_10000173
1280 Ga0075366_10000703
1281 Ga0075366_10021146
1282 Ga0075366_10024166
1283 Ga0075366_10059185
1284 Ga0097621_100000224
1285 Ga0097621_100002869
1286 Ga0097621_100009933
1287 Ga0097621_100021511
1288 Ga0097621_100098964
1289 Ga0068871_100000021
1290 Ga0068871_100005685
1291 Ga0068871_100020267
1292 Ga0068871_100156684
1293 Ga0068871_100229905
1294 Ga0068871_100455356
1295 Ga0068865_100000045
1296 Ga0068865_100008014
1297 Ga0068865_100123051
1298 Ga0097620_100249847
1299 Ga0097620_100250272
1300 Ga0097620_100795580
1301 Ga0097620_101006767
1302 Ga0105240_10000010
1303 Ga0105240_10000692
1304 Ga0105240_10007157
1305 Ga0105240_10028192
1306 Ga0105240_10049783
1307 Ga0105240_10099660
1308 Ga0105240_10160652
1309 Ga0105240_10238146
1310 Ga0105240_10248064
1311 Ga0105240_10331948
1312 Ga0105240_10443708
1313 Ga0111539_10465879
1314 Ga0111539_10632079
1315 Ga0105243_10000008
1316 Ga0105243_10338653
1317 Ga0105241_10000305
1318 Ga0105241_10016108
1319 Ga0105241_10087436
1320 Ga0105241_10114250
1321 Ga0105241_10172562
1322 Ga0105241_10190247
1323 Ga0105241_11063497
1324 Ga0105242_10030783
1325 Ga0105242_10040564
1326 Ga0105242_10142514
1327 Ga0105242_10196246
1328 Ga0105242_10197403
1329 Ga0105242_10734019
1330 Ga0105248_10035252
1331 Ga0105248_10531310
1332 Ga0105237_10001165
1333 Ga0105237_10002429
1334 Ga0105237_10003157
1335 Ga0105237_10008501
1336 Ga0105237_10019154
1337 Ga0105237_10038945
1338 Ga0105237_10156842
1339 Ga0105237_10198468
1340 Ga0105237_10215980
1341 Ga0105237_10390870
1342 Ga0105237_10835725
1343 Ga0105238_10002640
1344 Ga0105238_10281978
1345 Ga0105249_10030794
1346 Ga0105239_10000001
1347 Ga0105239_10000222
1348 Ga0105239_10003907
1349 Ga0105239_10004417
1350 Ga0105239_10007756
1351 Ga0105239_10025053
1352 Ga0105239_10027624
1353 Ga0105239_10035531
1354 Ga0105239_10040221
1355 Ga0105239_10047543
1356 Ga0105239_10048999
1357 Ga0105239_10329326
1358 Ga0105239_10939077
1359 Ga0105246_10016055
1360 Ga0105246_10157981
1361 Ga0157373_10000493
1362 Ga0157373_10001010
1363 Ga0157373_10008371
1364 Ga0157373_10023213
1365 Ga0157373_10027560
1366 Ga0157373_10038323
1367 Ga0157373_10060689
1368 Ga0157373_10112851
1369 Ga0157373_10151139
1370 Ga0157373_10165048
1371 Ga0157371_10000266
1372 Ga0157371_10001322
1373 Ga0157371_10001388
1374 Ga0157371_10001945
1375 Ga0157371_10002423
1376 Ga0157371_10002458
1377 Ga0157371_10002705
1378 Ga0157371_10003231
1379 Ga0157371_10006449
1380 Ga0157371_10027274
1381 Ga0157371_10048234
1382 Ga0157371_10048377
1383 Ga0157371_10052792
1384 Ga0157371_10064467
1385 Ga0157371_10070397
1386 Ga0157371_10176376
1387 Ga0157371_10208448
1388 Ga0157371_10240181
1389 Ga0157370_10004347
1390 Ga0157370_10009076
1391 Ga0157370_10010549
1392 Ga0157370_10016108
1393 Ga0157370_10023734
1394 Ga0157370_10026762
1395 Ga0157370_10041735
1396 Ga0157370_10051988
1397 Ga0157370_10085326
1398 Ga0157370_10088382
1399 Ga0157370_10106422
1400 Ga0157370_10159379
1401 Ga0157370_10235881
1402 Ga0157369_10000441
1403 Ga0157369_10023235
1404 Ga0157369_10092464
1405 Ga0157369_10104538
1406 Ga0157369_10140329
1407 Ga0157369_10279306
1408 Ga0157369_10337914
1409 Ga0157369_10348473
1410 Ga0157369_10516288
1411 Ga0157374_10001269
1412 Ga0157374_10008592
1413 Ga0157374_10013320
1414 Ga0157374_10017554
1415 Ga0157374_10032990
1416 Ga0157374_10034886
1417 Ga0157374_10188789
1418 Ga0157374_10399683
1419 Ga0157374_10551995
1420 Ga0157378_10001566
1421 Ga0157378_10003663
1422 Ga0157378_10012150
1423 Ga0157378_10026674
1424 Ga0157378_10028410
1425 Ga0157378_10034723
1426 Ga0157378_10144673
1427 Ga0157378_10150800
1428 Ga0157378_10257215
1429 Ga0157378_10270077
1430 Ga0157378_11064414
1431 Ga0163162_10000010
1432 Ga0163162_10001751
1433 Ga0163162_10002720
1434 Ga0163162_10004021
1435 Ga0163162_10034404
1436 Ga0163162_10046160
1437 Ga0163162_10147273
1438 Ga0163162_10157820
1439 Ga0163162_10258188
1440 Ga0163162_10264563
1441 Ga0163162_10294345
1442 Ga0163162_10324809
1443 Ga0163162_10371489
1444 Ga0163162_10466857
1445 Ga0163162_10593162
1446 Ga0163162_10611109
1447 Ga0163162_10912003
1448 Ga0157372_10000073
1449 Ga0157372_10001839
1450 Ga0157372_10002319
1451 Ga0157372_10005120
1452 Ga0157372_10006129
1453 Ga0157372_10015677
1454 Ga0157372_10030154
1455 Ga0157372_10034703
1456 Ga0157372_10070619
1457 Ga0157372_10082045
1458 Ga0157372_10082743
1459 Ga0157372_10106606
1460 Ga0157372_10118909
1461 Ga0157372_10170040
1462 Ga0157372_10230100
1463 Ga0157372_10230257
1464 Ga0157372_10386104
1465 Ga0157372_10420886
1466 Ga0157372_10556954
1467 Ga0157375_10003126
1468 Ga0157375_10008904
1469 Ga0157375_10010047
1470 Ga0157375_10015961
1471 Ga0157375_10016953
1472 Ga0157375_10093626
1473 Ga0157375_10124312
1474 Ga0157375_10134199
1475 Ga0157375_10250437
1476 Ga0157375_10261104
1477 Ga0157375_10673574
1478 Ga0157375_11560824
1479 Ga0163163_10004021
1480 Ga0163163_10221276
1481 Ga0163163_10337801
1482 Ga0163163_10662153
1483 Ga0182008_10000017
1484 Ga0182008_10000043
1485 Ga0182008_10000934
1486 Ga0182008_10047424
1487 Ga0182008_10134310
1488 Ga0157377_10002355
1489 Ga0157377_10042679
1490 Ga0157379_10038425
1491 Ga0157379_10046246
1492 Ga0157379_10047442
1493 Ga0157379_10053941
1494 Ga0157379_10122600
1495 Ga0157379_10326861
1496 Ga0157379_10461283
1497 Ga0157376_10003029
1498 Ga0157376_10011262
1499 Ga0157376_10189803
1500 Ga0157376_10655895
1501 Ga0182006_1000128
1502 Ga0182006_1001058
1503 Ga0182006_1003032
1504 Ga0182006_1026274
1505 Ga0182006_1052740
1506 Ga0182007_10000054
1507 Ga0182007_10018595
1508 Ga0182007_10047834
1509 Ga0183373_1015
1510 Ga0163161_10001077
1511 Ga0163161_10001415
1512 Ga0163161_10003355
1513 Ga0163161_10009075
1514 Ga0163161_10011686
1515 Ga0163161_10020964
1516 Ga0163161_10111331
1517 Ga0163161_10263964
1518 Ga0163161_10899461
1519 Ga0206351_10643466
1520 Ga0213872_10024047
1521 Ga0213876_10004951
1522 Ga0207427_100025
1523 Ga0209437_100010
1524 Ga0209437_100148
1525 Ga0209258_112460
1526 Ga0207425_1000004
1527 Ga0209026_1000805
1528 Ga0209026_1000875
1529 Ga0209129_1000005
1530 Ga0209129_1010719
1531 Ga0209233_1000017
1532 Ga0209233_1008486
1533 Ga0209455_1004412
1534 Ga0209676_1000058
1535 Ga0209025_1000009
1536 Ga0209758_1000010
1537 Ga0209050_1000054
1538 Ga0207426_1000030
1539 Ga0209257_1000025
1540 Ga0207697_10051715
1541 Ga0207656_10009859
1542 Ga0207642_10010276
1543 Ga0207642_10147018
1544 Ga0207642_10206662
1545 Ga0207642_10252843
1546 Ga0207680_10410355
1547 Ga0207647_10000022
1548 Ga0207647_10000499
1549 Ga0207647_10004321
1550 Ga0207647_10338523
1551 Ga0207645_10000151
1552 Ga0207645_10000885
1553 Ga0207645_10015713
1554 Ga0207643_10004003
1555 Ga0207705_10000045
1556 Ga0207705_10008413
1557 Ga0207705_10017000
1558 Ga0207705_10044405
1559 Ga0207705_10485749
1560 Ga0207654_10002120
1561 Ga0207654_10157450
1562 Ga0207654_10164806
1563 Ga0207654_10411554
1564 Ga0207654_10426098
1565 Ga0207707_10005461
1566 Ga0207695_10000019
1567 Ga0207695_10000020
1568 Ga0207695_10003958
1569 Ga0207695_10008283
1570 Ga0207695_10014224
1571 Ga0207695_10018922
1572 Ga0207695_10046570
1573 Ga0207695_10167957
1574 Ga0207695_10237931
1575 Ga0207695_10259311
1576 Ga0207695_10273487
1577 Ga0207671_10000030
1578 Ga0207671_10000598
1579 Ga0207671_10003239
1580 Ga0207671_10011028
1581 Ga0207671_10026560
1582 Ga0207671_10055827
1583 Ga0207671_10058076
1584 Ga0207671_10071906
1585 Ga0207671_10143677
1586 Ga0207660_10006965
1587 Ga0207660_10051946
1588 Ga0207660_10215945
1589 Ga0207660_10347568
1590 Ga0207662_10027483
1591 Ga0207662_10067807
1592 Ga0207657_10001634
1593 Ga0207657_10004444
1594 Ga0207657_10010980
1595 Ga0207657_10011267
1596 Ga0207657_10076883
1597 Ga0207657_10085863
1598 Ga0207657_10251887
1599 Ga0207657_10352626
1600 Ga0207657_10442178
1601 Ga0207657_10472136
1602 Ga0207649_10003318
1603 Ga0207649_10397148
1604 Ga0207652_10000101
1605 Ga0207652_10000616
1606 Ga0207652_10066856
1607 Ga0207652_10125949
1608 Ga0207652_10154826
1609 Ga0207652_10395785
1610 Ga0207681_10064578
1611 Ga0207681_10187533
1612 Ga0207681_10342378
1613 Ga0207694_10018165
1614 Ga0207694_10161145
1615 Ga0207650_10008032
1616 Ga0207650_10126189
1617 Ga0207650_10145444
1618 Ga0207659_10036403
1619 Ga0207644_10010200
1620 Ga0207644_10071321
1621 Ga0207644_10080754
1622 Ga0207644_10178546
1623 Ga0207644_10439473
1624 Ga0207690_10029414
1625 Ga0207690_10187068
1626 Ga0207690_10255898
1627 Ga0207706_10000047
1628 Ga0207706_10002437
1629 Ga0207706_10004864
1630 Ga0207706_10068732
1631 Ga0207706_10142600
1632 Ga0207686_10155289
1633 Ga0207709_10000006
1634 Ga0207670_10126009
1635 Ga0207669_10142655
1636 Ga0207704_10000077
1637 Ga0207704_10006021
1638 Ga0207704_10105746
1639 Ga0207691_10038025
1640 Ga0207691_10054995
1641 Ga0207691_10225154
1642 Ga0207711_10020688
1643 Ga0207689_10013159
1644 Ga0207689_10018391
1645 Ga0207689_10019124
1646 Ga0207689_10199952
1647 Ga0207661_10011467
1648 Ga0207661_10041731
1649 Ga0207661_10048489
1650 Ga0207679_10004167
1651 Ga0207679_10460266
1652 Ga0207667_10000015
1653 Ga0207667_10001154
1654 Ga0207667_10001998
1655 Ga0207667_10100799
1656 Ga0207667_10130653
1657 Ga0207667_10184001
1658 Ga0207667_10413063
1659 Ga0207667_10497882
1660 Ga0207667_10877522
1661 Ga0207667_10903059
1662 Ga0207651_10013162
1663 Ga0207651_10015118
1664 Ga0207651_10016093
1665 Ga0207651_10163018
1666 Ga0207651_10193239
1667 Ga0207712_10115130
1668 Ga0207668_10217307
1669 Ga0207640_10172991
1670 Ga0207658_10069256
1671 Ga0207658_10081452
1672 Ga0207677_10020944
1673 Ga0207677_10080635
1674 Ga0207677_10122710
1675 Ga0207677_10350945
1676 Ga0207703_10094545
1677 Ga0207639_10006130
1678 Ga0207639_10137462
1679 Ga0207639_10270931
1680 Ga0207678_10052971
1681 Ga0207678_10176787
1682 Ga0207702_10000249
1683 Ga0207702_10009673
1684 Ga0207702_10010544
1685 Ga0207702_10035034
1686 Ga0207702_10036092
1687 Ga0207702_10204751
1688 Ga0207702_10714360
1689 Ga0207702_11078720
1690 Ga0207641_10007365
1691 Ga0207641_10120909
1692 Ga0207641_10415418
1693 Ga0207648_10000510
1694 Ga0207648_10001095
1695 Ga0207648_10021772
1696 Ga0207648_10055384
1697 Ga0207648_10083555
1698 Ga0207648_10092067
1699 Ga0207648_10178422
1700 Ga0207676_10011977
1701 Ga0207676_10050878
1702 Ga0207676_10116109
1703 Ga0207676_11049257
1704 Ga0207674_10008194
1705 Ga0207674_10009099
1706 Ga0207674_10041481
1707 Ga0207674_10097503
1708 Ga0207674_10126818
1709 Ga0207674_10218084
1710 Ga0207674_10346348
1711 Ga0207675_100024542
1712 Ga0207675_100856970
1713 Ga0207683_10005179
1714 Ga0207683_10061266
1715 Ga0207683_10122996
1716 Ga0207683_10556700
1717 Ga0207698_10022714
1718 Ga0207698_10191858
1719 Ga0268266_10000030
1720 Ga0268266_10000845
1721 Ga0268266_10052969
1722 Ga0268264_10100624
1723 Ga0268264_10214036
1724 Ga0268264_10224140
1725 Ga0268264_10514284
1726 Ga0307517_10039555
1727 Ga0307515_10000859
1728 Ga0307515_10001574
1729 Ga0307515_10099128
1730 Ga0316177_1082586
1731 Ga0316176_1049708
1732 Ga0316183_1098942
1733 Ga0316181_1041568
1734 Ga0265327_10000026
1735 Ga0265327_10000030
1736 Ga0265327_10000137
1737 Ga0265327_10053815
1738 Ga0265327_10102367
1739 Ga0265327_10189712
1740 Ga0307509_10062346
1741 Ga0307408_100003148
1742 Ga0307408_100004875
1743 Ga0307408_100007443
1744 Ga0307405_10000481
1745 Ga0307405_10047381
1746 Ga0307407_10000041
1747 Ga0307412_10000142
1748 Ga0307412_10000823
1749 Ga0307412_10027106
1750 Ga0307412_10100605
1751 Ga0307416_100000029
1752 Ga0307414_10000269
1753 Ga0307414_10000504
1754 Ga0307414_10011832
1755 Ga0307414_10032775
1756 Ga0307414_10396129
1757 Ga0307411_10301092
1758 Ga0307415_100536055
1759 Ga0307507_10000510
1760 Ga0373924_0028945
1761 Ga0373933_0067349
1762 Ga0395899_0000002
1763 Ga0395899_0000209
1764 Ga0395899_0000526
1765 Ga0395899_0000749
1766 Ga0395899_0003678
1767 Ga0395899_0045558
1768 Ga0395899_0058035
1769 Ga0395899_0296586
1770 Ga0395900_0000406
1771 Ga0395900_0021329
1772 Ga0395900_0029525
1773 Ga0395900_0032777
1774 Ga0395900_0046849
1775 Ga0395900_0056520
1776 Ga0395900_0115526
1777 Ga0395900_0127250
1778 Ga0395900_0128798
1779 Ga0395900_0146344
1780 Ga0395900_0305199
1781 Ga0395898_0003004
1782 Ga0395898_0004432
1783 Ga0395898_0016694
1784 Ga0395898_0016836
1785 Ga0395898_0058458
1786 Ga0395898_0103450
1787 Ga0395905_0000003
1788 Ga0395905_0000175
1789 Ga0395905_0000376
1790 Ga0395905_0000981
1791 Ga0395905_0034059
1792 Ga0395905_0146663
1793 Ga0395901_0000313
1794 Ga0395901_0001780
1795 Ga0395901_0008545
1796 Ga0395901_0021706
1797 Ga0395901_0123470
1798 Ga0395901_0158398
1799 Ga0395901_0274631
1800 Ga0395901_0634788
1801 Ga0436365_0614130
1802 Ga0436365_1285215
1803 Ga0436361_0793109
1804 Ga0451791_1548410
1805 Ga0451795_0579925
1806 Ga0451807_1215663
1807 Ga0451855_0129897
1808 Ga0439445_0002151
1809 Ga0439455_0079953
1810 Ga0451577_0123928
1811 Ga0451577_0127077
1812 Ga0451577_0833259
1813 Ga0466972_0000055
1814 Ga0453683_0170060
1815 Ga0466965_0290632
1816 Ga0466966_0166267
1817 Ga0466961_0029110
1818 Ga0453684_0010580
1819 Ga0453684_0042221
1820 Ga0453684_0212825
1821 Ga0453684_0376747
1822 Ga0453684_0823714
1823 Ga0466970_0001040
1824 Ga0466970_0023647
1825 Ga0451576_0000012
1826 Ga0466958_0045640
1827 Ga0466967_0240144
1828 Ga0495627_000881
1829 Ga0495638_0140896
1830 Ga0495651_0076728
1831 Ga0495651_0242095
1832 Ga0495650_0001050
1833 Ga0495650_0057509
1834 Ga0495585_0000153
1835 Ga0495594_0302665
1836 Ga0495583_0076587
1837 Ga0495606_0000033
1838 Ga0495606_0009027
1839 Ga0495606_0234457
1840 Ga0495610_0000093
1841 Ga0495610_0002547
1842 Ga0495610_0002700
1843 Ga0495616_0051386
1844 Ga0495618_0057138
1845 Ga0495630_0018579
1846 Ga0495631_0178872
1847 Ga0495637_0055151
1848 Ga0495644_0008891
1849 Ga0495648_0008346
1850 Ga0495642_0108783
1851 Ga0495652_0138696
1852 Ga0495586_0293154
1853 Ga0495633_0000137
1854 Ga0495633_0004346
1855 Ga0495668_0000009
1856 Ga0495668_0000187
1857 Ga0495668_0034499
1858 Ga0495668_0221517
1859 Ga0495611_0280244
1860 Ga0495625_0000131
1861 Ga0495625_0000385
1862 Ga0495625_0001975
1863 Ga0495625_0038288
1864 Ga0495625_0471515
1865 Ga0495661_0005299
1866 Ga0495661_0043674
1867 Ga0495661_0071661
1868 Ga0495658_0037745
1869 Ga0495669_0169611
1870 Ga0495671_0206250
1871 Ga0495649_0000009
1872 Ga0495660_0007516
1873 Ga0495680_0125309
1874 Ga0495687_000483
1875 Ga0495687_000882
1876 Ga0495685_078947
1877 Ga0495673_0054749
1878 Ga0495681_0212897
1879 Ga0495684_0172942
1880 Ga0495686_0000299
1881 Ga0495686_0001086
1882 Ga0495686_0006681
1883 Ga0495686_0153381
1884 Ga0495686_0159993
1885 Ga0495686_0199183
1886 Ga0495686_0227655
1887 Ga0495614_0014365
1888 Ga0496101_0112180
1889 Ga0496105_0201029
1890 Ga0496106_0235653
1891 Ga0496106_0588096
1892 Ga0496108_0533744
1893 Ga0496114_0000420
1894 Ga0496116_0001546
1895 Ga0496117_0007089
1896 Ga0496121_0000010
1897 Ga0496122_0000014
1898 Ga0496122_0000479
1899 Ga0496122_0005425
1900 Ga0496123_0004038
1901 Ga0496123_0007432
1902 Ga0496123_0246268
1903 Ga0496124_0023126
1904 Ga0496125_0085272
1905 Ga0496126_0000019
1906 Ga0496126_0033933
1907 Ga0495682_0034191
1908 Ga0501031_0000222
1909 Ga0501032_0002894
1910 Ga0501032_0020282
1911 Ga0501032_0189343
1912 Ga0501032_0395420
1913 Ga0501033_0000042
1914 Ga0501033_0105401
1915 Ga0501033_0122732
1916 Ga0501033_0156647
1917 Ga0501034_0000575
1918 Ga0501034_0022033
1919 Ga0501034_0024146
1920 Ga0501034_0086406
1921 Ga0501034_0133366
1922 Ga0501034_0702248
1923 Ga0501036_0003797
1924 Ga0501036_0057048
1925 Ga0501037_0005070
1926 Ga0501037_0146479
1927 Ga0501037_0351035
1928 Ga0501038_0001828
1929 Ga0501038_0039950
1930 Ga0501039_0013235
1931 Ga0501039_0352633
1932 Ga0501043_0000859
1933 Ga0501043_0011914
1934 Ga0501046_0048029
1935 Ga0501047_0005599
1936 Ga0501048_0116409
1937 Ga0501067_0096778
1938 Ga0501070_0044371
1939 Ga0501070_0075600
1940 Ga0501073_0001109
1941 Ga0501077_0164726
1942 Ga0501198_006634
1943 Ga0501208_075185
1944 Ga0501223_001002
1945 Ga0501252_023451
1946 Ga0501083_0020863
1947 Ga0501241_000831
1948 Ga0501241_047490
1949 Ga0501035_0001848
1950 Ga0501035_0019376
1951 Ga0501035_0081243
1952 Ga0501035_0456697
1953 Ga0501044_0000452
1954 Ga0501044_0036729
1955 Ga0501044_0096944
1956 Ga0501044_0400073
1957 Ga0501045_0000439
1958 nmdc:mga0k408_22137_c2
1959 nmdc:mga0k408_282_c1
1960 nmdc:mga0k408_544_c1
1961 nmdc:mga0k408_65692_c1
1962 nmdc:mga07m45_168818_c1
1963 Ga0500635_0001217
1964 Ga0495619_0092134
1965 Ga0500644_0009828
1966 Ga0500581_059254
1967 Ga0500651_0000280
1968 Ga0500566_0004444
1969 Ga0500556_0017841
1970 Ga0500562_000083
1971 Ga0500608_019222
1972 Ga0500614_014079
1973 Ga0500618_000012
1974 Ga0500577_0104140
1975 Ga0500616_0004942
1976 Ga0500616_0044650
1977 Ga0500616_0080489
1978 Ga0500622_0000051
1979 Ga0500622_0001321
1980 Ga0500622_0003294
1981 Ga0500624_000281
1982 Ga0500627_0024315
1983 Ga0500645_019587
1984 Ga0500645_022425
1985 Ga0500661_003766
1986 Ga0500661_028909
1987 2586210491
1988 2599480366
1989 2722728755
1990 2738758039
1991 2738763759
1992 2738852329
1993 2739304474
1994 2739589781
1995 2739617926
1996 2739644122
1997 2776614896
1998 2819550305
1999 2819586850
2000 2819680619
2001 2842722486
2002 2842906776
2003 2842914593
2004 2849287082
2005 2852624780
2006 2852630013
2007 2857632359
2008 2884936331
2009 2890738609
2010 2896317934
2011 2896344932
2012 2898715251
2013 2902050224
2014 2904449402
2015 2904784256
2016 2919179120
2017 2919188305
2018 2919438218
2019 2928083392
2020 2928151345
2021 2928520333
2022 2929157003
2023 2929245044
2024 2932087263
2025 2939664428
2026 2945999440
2027 2954016171
2028 2977236040
2029 3003233809
2030 8055589100

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

45

259

0.97

PF13189

Cytidylate_kin2

Cytidylate kinase-like family

44

227

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kdt-assembly1.cif.gz_A cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate 0.9401 4 225
4die-assembly6.cif.gz_D crystal structure of a cytidylate kinase cmk from mycobacterium abscessus bound to cytidine-5'-monophosphate 0.9351 4 223
4die-assembly5.cif.gz_C crystal structure of a cytidylate kinase cmk from mycobacterium abscessus bound to cytidine-5'-monophosphate 0.933 4 223
3r8c-assembly1.cif.gz_B crystal structure of cytidylate kinase (cmk) from mycobacterium abscessus 0.9327 4 223
2feo-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp 0.9327 4 222
ID Description Score Start End Superfamily
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9316 4 223 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9272 4 223 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9215 5 222 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9093 5 222 3.40.50.300
af_Q2FYF5_1_183_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9064 39 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A519SHQ1-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9833 1 226 GO:0005524
GO:0005829
GO:0006220
GO:0015949
GO:0036430
GO:0036431
AF-A0A7C5PM03-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9829 6 222 GO:0004127
GO:0005524
GO:0005829
GO:0006220
GO:0015949
AF-A0A381TJ57-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9798 5 222 GO:0003729
GO:0003735
GO:0004127
GO:0005524
GO:0006412
GO:0022627
AF-A0A382BMV1-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.9797 5 119 GO:0004127
GO:0005524
AF-A0A4Q7MLT9-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9796 3 224 GO:0005524
GO:0005829
GO:0006220
GO:0015949
GO:0036430
GO:0036431

Map