F488246
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1015 | 439 | 2030 | 445 |
Family's Representative Sequence
| Representative Sequence | 3300046558|Ga0495633_0033108|Ga0495633_0033108_483_2027 |
| Length | 514 |
| Sequence | LNRNYADRARGATLFLEGLVSAGLFVQIIEERRLCIGRAGPLGIFGGGFLLSAKEKTMAQSPANQSSATPATPRHIKLGFILHGVGRTWNDWRHPGRDVNASTSLAYYQRQAASAERGKFDFLFVADSLSITEKSSPHYLNRFEPITILSALAATTSRIGLVATLTVSYSEPFNVARQFASLDHLSGGRAGWNIVTSWLGDTAANFSKTEHPPHNVRYRIAGEYLDVVQGLWDSWEEDAHVADKESGQFVDPDRLHRLDHKGEFFQVRGPLNIKRTPQGQPVIFQAGASEDGRNFAARRAEVIFTHAETQEQGQAYYADVKARAKGFGRNPDQLFILPGIAPIIGDTDDEADALYRELAALESIDTGLGFLSRTFNDHDFRQYDLDAPFPDVGHIGLNSQQSGTLRILAEVRAENLTLRQVAERLASPRGVFVGAAETVADRIQHWFESGTADGFVLFEPLPGQLDIFVDKVIPILQARGLFREEYEGTTFRAHLGLAEPDNRYGADKRAKDAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 98 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 157 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 169 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 186 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 190 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 191 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 192 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 193 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 194 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 195 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 196 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 197 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 198 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 199 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 276 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 277 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 278 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 279 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 289 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 290 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 291 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 292 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 298 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 299 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 300 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 301 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 303 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 304 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 306 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 307 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 308 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 309 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 311 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 313 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 314 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 315 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 316 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 317 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 318 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 319 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 320 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 321 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 322 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 323 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 324 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 325 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 326 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 327 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 328 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 329 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 330 | 2511231035 | Pantoea sp. GM01 | Isolate | Rhizosphere |
| 331 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 332 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 333 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 334 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 335 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 336 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 337 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 338 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 339 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 340 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 341 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 342 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 343 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 344 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 345 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 346 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 347 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 348 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 349 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 350 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 351 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 352 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 353 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 354 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 355 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 356 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 357 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 358 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 359 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 360 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 361 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 362 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 363 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 364 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 365 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 366 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 367 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 368 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 369 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 370 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 371 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 372 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 373 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 374 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 375 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 376 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 377 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 378 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 379 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 380 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 381 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 382 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 383 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 384 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 385 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 386 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 387 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 388 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 389 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 390 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 391 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 392 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 393 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 394 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 395 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 396 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 397 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 398 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 399 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 400 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 401 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 402 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 403 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 404 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 405 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 406 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 407 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 408 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 409 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 410 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 411 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 412 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 413 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 414 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 415 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 416 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 417 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 418 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 419 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 420 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 421 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 422 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 423 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 424 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 425 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 426 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 427 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 428 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 429 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 430 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 431 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 432 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 433 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 434 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 435 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 436 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 437 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 438 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 439 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.37 |
| Metatranscriptomes | 0 |
| Isolates | 11.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.33 |
| Nodule | 1.48 |
| Rhizoplane | 4.93 |
| Rhizosphere | 67.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495633_0033108 | 3300046558 | Bacteria | 2493 |
| 2 | MRS1b_contig_4057571 | 2162886011 | Bacteria | 2495 |
| 3 | JGI24740J21852_10000040 | 3300001979 | Bacteria | 43874 |
| 4 | JGI24740J21852_10003601 | 3300001979 | Bacteria | 6759 |
| 5 | JGI24740J21852_10003679 | 3300001979 | Bacteria | 6678 |
| 6 | JGI24740J21852_10005450 | 3300001979 | Bacteria | 5378 |
| 7 | JGI24740J21852_10036090 | 3300001979 | Bacteria | 1539 |
| 8 | JGI24739J22299_10000021 | 3300001989 | Bacteria | 46786 |
| 9 | JGI24739J22299_10004456 | 3300001989 | Bacteria | 5367 |
| 10 | JGI24739J22299_10005905 | 3300001989 | Bacteria | 4635 |
| 11 | JGI24737J22298_10001269 | 3300001990 | Bacteria | 8936 |
| 12 | JGI24737J22298_10009451 | 3300001990 | Bacteria | 3239 |
| 13 | JGI24737J22298_10019370 | 3300001990 | Bacteria | 2176 |
| 14 | JGI24735J21928_10002422 | 3300002067 | Bacteria | 6485 |
| 15 | JGI24735J21928_10003309 | 3300002067 | Bacteria | 5496 |
| 16 | JGI24738J21930_10000001 | 3300002075 | Bacteria | 133921 |
| 17 | JGI24751J29686_10001447 | 3300002459 | Bacteria | 4973 |
| 18 | JGI25162J39368_1000448 | 3300002737 | Bacteria | 32592 |
| 19 | JGI25163J39215_1000169 | 3300002771 | Bacteria | 25589 |
| 20 | JGI25164J39214_1000306 | 3300002772 | Bacteria | 32696 |
| 21 | JGI25165J46597_1000121 | 3300003214 | Bacteria | 132705 |
| 22 | JGI25153J46596_10000016 | 3300003215 | Bacteria | 285917 |
| 23 | JGI25153J46596_10031842 | 3300003215 | Bacteria | 1768 |
| 24 | rootH1_10266568 | 3300003323 | Bacteria | 2865 |
| 25 | Ga0055538_1001047 | 3300003751 | Bacteria | 6204 |
| 26 | Ga0055539_1000990 | 3300003752 | Bacteria | 6204 |
| 27 | Ga0055533_1001472 | 3300003756 | Bacteria | 6204 |
| 28 | Ga0055532_1001544 | 3300003758 | Bacteria | 6204 |
| 29 | Ga0055525_1001160 | 3300003759 | Bacteria | 6204 |
| 30 | Ga0055537_1003505 | 3300003773 | Bacteria | 4806 |
| 31 | Ga0055536_1000005 | 3300003781 | Bacteria | 383598 |
| 32 | Ga0055536_1000027 | 3300003781 | Bacteria | 164595 |
| 33 | Ga0055530_10000001 | 3300003791 | Bacteria | 383067 |
| 34 | Ga0055530_10000079 | 3300003791 | Bacteria | 83270 |
| 35 | Ga0055530_10000165 | 3300003791 | Bacteria | 60120 |
| 36 | Ga0055540_1000186 | 3300003792 | Bacteria | 60120 |
| 37 | Ga0055540_1000258 | 3300003792 | Bacteria | 47854 |
| 38 | Ga0055531_10014786 | 3300003794 | Bacteria | 3489 |
| 39 | Ga0055541_1001087 | 3300003841 | Bacteria | 6204 |
| 40 | Ga0065165_1002059 | 3300005262 | Bacteria | 18596 |
| 41 | Ga0065714_10005985 | 3300005288 | Bacteria | 7190 |
| 42 | Ga0065714_10008360 | 3300005288 | Bacteria | 4753 |
| 43 | Ga0065714_10064839 | 3300005288 | Bacteria | 17232 |
| 44 | Ga0065714_10077303 | 3300005288 | Bacteria | 2703 |
| 45 | Ga0065714_10085296 | 3300005288 | Bacteria | 2155 |
| 46 | Ga0065704_10006301 | 3300005289 | Bacteria | 2989 |
| 47 | Ga0065704_10072214 | 3300005289 | Bacteria | 8931 |
| 48 | Ga0065704_10082902 | 3300005289 | Bacteria | 3536 |
| 49 | Ga0065704_10085666 | 3300005289 | Bacteria | 3198 |
| 50 | Ga0065712_10068364 | 3300005290 | Bacteria | 11276 |
| 51 | Ga0065712_10094642 | 3300005290 | Bacteria | 2239 |
| 52 | Ga0065707_10001308 | 3300005295 | Bacteria | 8844 |
| 53 | Ga0070670_100002244 | 3300005331 | Bacteria | 15889 |
| 54 | Ga0070670_100005599 | 3300005331 | Bacteria | 10595 |
| 55 | Ga0070670_100069781 | 3300005331 | Bacteria | 3017 |
| 56 | Ga0070666_10002911 | 3300005335 | Bacteria | 10351 |
| 57 | Ga0070666_10081034 | 3300005335 | Bacteria | 2219 |
| 58 | Ga0070682_100048039 | 3300005337 | Bacteria | 2656 |
| 59 | Ga0070660_100022198 | 3300005339 | Bacteria | 4690 |
| 60 | Ga0070661_100000163 | 3300005344 | Bacteria | 54929 |
| 61 | Ga0070668_100000045 | 3300005347 | Bacteria | 77362 |
| 62 | Ga0070668_100002438 | 3300005347 | Bacteria | 13684 |
| 63 | Ga0070668_100008385 | 3300005347 | Bacteria | 7675 |
| 64 | Ga0070668_100014187 | 3300005347 | Bacteria | 5952 |
| 65 | Ga0070668_100021709 | 3300005347 | Bacteria | 4850 |
| 66 | Ga0070668_100022840 | 3300005347 | Bacteria | 4728 |
| 67 | Ga0070668_100033112 | 3300005347 | Bacteria | 3934 |
| 68 | Ga0070668_100037615 | 3300005347 | Bacteria | 3696 |
| 69 | Ga0070668_100060798 | 3300005347 | Bacteria | 2927 |
| 70 | Ga0070669_100005542 | 3300005353 | Bacteria | 9115 |
| 71 | Ga0070669_100011837 | 3300005353 | Bacteria | 6189 |
| 72 | Ga0070669_100043004 | 3300005353 | Bacteria | 3289 |
| 73 | Ga0070671_100000003 | 3300005355 | Bacteria | 270186 |
| 74 | Ga0070671_100002400 | 3300005355 | Bacteria | 14480 |
| 75 | Ga0070671_100015086 | 3300005355 | Bacteria | 6241 |
| 76 | Ga0070671_100196385 | 3300005355 | Bacteria | 1710 |
| 77 | Ga0070659_100029656 | 3300005366 | Bacteria | 4228 |
| 78 | Ga0070667_100000009 | 3300005367 | Bacteria | 281488 |
| 79 | Ga0070667_100000336 | 3300005367 | Bacteria | 52390 |
| 80 | Ga0070667_100003055 | 3300005367 | Bacteria | 14387 |
| 81 | Ga0070667_100040423 | 3300005367 | Bacteria | 3911 |
| 82 | Ga0070667_100141689 | 3300005367 | Bacteria | 2106 |
| 83 | Ga0070663_100004705 | 3300005455 | Bacteria | 8049 |
| 84 | Ga0070662_100004680 | 3300005457 | Bacteria | 8679 |
| 85 | Ga0070662_100041202 | 3300005457 | Bacteria | 3293 |
| 86 | Ga0070662_100103589 | 3300005457 | Bacteria | 2158 |
| 87 | Ga0070699_100047360 | 3300005518 | Bacteria | 3720 |
| 88 | Ga0068853_100000323 | 3300005539 | Bacteria | 33372 |
| 89 | Ga0068853_100006913 | 3300005539 | Bacteria | 9058 |
| 90 | Ga0068853_100012273 | 3300005539 | Bacteria | 6967 |
| 91 | Ga0068853_100044233 | 3300005539 | Bacteria | 3811 |
| 92 | Ga0068853_100103945 | 3300005539 | Bacteria | 2514 |
| 93 | Ga0070672_100024078 | 3300005543 | Bacteria | 4493 |
| 94 | Ga0070665_100000816 | 3300005548 | Bacteria | 40734 |
| 95 | Ga0070665_100005929 | 3300005548 | Bacteria | 12514 |
| 96 | Ga0068855_100040101 | 3300005563 | Bacteria | 5558 |
| 97 | Ga0070664_100000101 | 3300005564 | Bacteria | 54929 |
| 98 | Ga0068857_100017091 | 3300005577 | Bacteria | 6355 |
| 99 | Ga0068857_100035699 | 3300005577 | Bacteria | 4403 |
| 100 | Ga0068854_100000370 | 3300005578 | Bacteria | 28720 |
| 101 | Ga0068854_100026295 | 3300005578 | Bacteria | 3999 |
| 102 | Ga0068854_100040560 | 3300005578 | Bacteria | 3285 |
| 103 | Ga0068854_100080545 | 3300005578 | Bacteria | 2403 |
| 104 | Ga0068856_100000374 | 3300005614 | Bacteria | 49224 |
| 105 | Ga0068852_100007527 | 3300005616 | Bacteria | 7951 |
| 106 | Ga0068852_100015318 | 3300005616 | Bacteria | 5939 |
| 107 | Ga0068859_100021404 | 3300005617 | Bacteria | 6489 |
| 108 | Ga0068864_100041916 | 3300005618 | Bacteria | 3916 |
| 109 | Ga0068851_10000045 | 3300005834 | Bacteria | 80884 |
| 110 | Ga0068851_10000147 | 3300005834 | Bacteria | 37787 |
| 111 | Ga0068863_100000225 | 3300005841 | Bacteria | 59865 |
| 112 | Ga0068863_100033449 | 3300005841 | Bacteria | 4898 |
| 113 | Ga0068863_100070480 | 3300005841 | Bacteria | 3306 |
| 114 | Ga0068863_100080560 | 3300005841 | Bacteria | 3084 |
| 115 | Ga0068858_100001386 | 3300005842 | Bacteria | 24950 |
| 116 | Ga0068858_100037216 | 3300005842 | Bacteria | 4512 |
| 117 | Ga0068858_100050201 | 3300005842 | Bacteria | 3861 |
| 118 | Ga0068860_100000051 | 3300005843 | Bacteria | 208179 |
| 119 | Ga0068860_100000193 | 3300005843 | Bacteria | 97253 |
| 120 | Ga0068860_100001524 | 3300005843 | Bacteria | 24955 |
| 121 | Ga0068860_100004640 | 3300005843 | Bacteria | 14034 |
| 122 | Ga0068860_100006123 | 3300005843 | Bacteria | 12100 |
| 123 | Ga0068860_100008197 | 3300005843 | Bacteria | 10399 |
| 124 | Ga0068860_100011953 | 3300005843 | Bacteria | 8557 |
| 125 | Ga0068860_100040398 | 3300005843 | Bacteria | 4459 |
| 126 | Ga0068860_100178234 | 3300005843 | Unclassified | 2054 |
| 127 | Ga0068862_100000031 | 3300005844 | Bacteria | 180203 |
| 128 | Ga0068862_100000083 | 3300005844 | Bacteria | 112991 |
| 129 | Ga0068862_100004726 | 3300005844 | Bacteria | 11469 |
| 130 | Ga0068862_100010282 | 3300005844 | Bacteria | 7720 |
| 131 | Ga0068862_100011846 | 3300005844 | Bacteria | 7201 |
| 132 | Ga0081455_10000872 | 3300005937 | Bacteria | 38964 |
| 133 | Ga0081455_10007504 | 3300005937 | Bacteria | 11472 |
| 134 | Ga0075368_10000863 | 3300006042 | Bacteria | 9372 |
| 135 | Ga0075363_100001725 | 3300006048 | Bacteria | 8497 |
| 136 | Ga0075432_10018313 | 3300006058 | Bacteria | 2389 |
| 137 | Ga0075362_10023032 | 3300006177 | Bacteria | 2630 |
| 138 | Ga0075367_10000269 | 3300006178 | Bacteria | 17930 |
| 139 | Ga0075369_10001433 | 3300006186 | Bacteria | 8136 |
| 140 | Ga0075366_10035008 | 3300006195 | Bacteria | 2960 |
| 141 | Ga0075366_10069282 | 3300006195 | Bacteria | 2100 |
| 142 | Ga0075370_10008619 | 3300006353 | Bacteria | 5257 |
| 143 | Ga0075370_10081181 | 3300006353 | Bacteria | 1864 |
| 144 | Ga0097620_100021404 | 3300006931 | Bacteria | 6489 |
| 145 | Ga0079104_1000006 | 3300006946 | Bacteria | 396255 |
| 146 | Ga0105251_10000612 | 3300009011 | Bacteria | 32744 |
| 147 | Ga0105251_10001159 | 3300009011 | Bacteria | 22899 |
| 148 | Ga0105251_10001293 | 3300009011 | Bacteria | 21634 |
| 149 | Ga0105251_10004188 | 3300009011 | Bacteria | 9985 |
| 150 | Ga0105244_10000738 | 3300009036 | Bacteria | 27985 |
| 151 | Ga0105244_10002527 | 3300009036 | Bacteria | 13749 |
| 152 | Ga0105244_10005252 | 3300009036 | Bacteria | 8640 |
| 153 | Ga0105244_10009145 | 3300009036 | Bacteria | 6114 |
| 154 | Ga0105244_10019703 | 3300009036 | Bacteria | 3759 |
| 155 | Ga0105244_10075830 | 3300009036 | Bacteria | 1670 |
| 156 | Ga0105250_10000089 | 3300009092 | Bacteria | 80765 |
| 157 | Ga0105250_10000109 | 3300009092 | Bacteria | 74557 |
| 158 | Ga0105250_10015604 | 3300009092 | Bacteria | 3110 |
| 159 | Ga0105240_10000220 | 3300009093 | Bacteria | 115299 |
| 160 | Ga0105240_10006254 | 3300009093 | Bacteria | 17515 |
| 161 | Ga0105240_10228184 | 3300009093 | Bacteria | 2165 |
| 162 | Ga0105245_10000721 | 3300009098 | Bacteria | 29771 |
| 163 | Ga0105243_10000047 | 3300009148 | Bacteria | 154272 |
| 164 | Ga0105243_10017725 | 3300009148 | Bacteria | 5386 |
| 165 | Ga0105241_10022859 | 3300009174 | Bacteria | 4635 |
| 166 | Ga0105242_10013185 | 3300009176 | Bacteria | 6380 |
| 167 | Ga0105248_10003730 | 3300009177 | Bacteria | 16894 |
| 168 | Ga0105248_10031570 | 3300009177 | Bacteria | 5919 |
| 169 | Ga0105248_10068301 | 3300009177 | Bacteria | 3991 |
| 170 | Ga0105248_10096387 | 3300009177 | Bacteria | 3332 |
| 171 | Ga0105248_10111527 | 3300009177 | Bacteria | 3085 |
| 172 | Ga0105248_10150369 | 3300009177 | Bacteria | 2627 |
| 173 | Ga0105248_10188965 | 3300009177 | Bacteria | 2321 |
| 174 | Ga0105237_10000096 | 3300009545 | Bacteria | 121683 |
| 175 | Ga0105237_10000099 | 3300009545 | Bacteria | 120098 |
| 176 | Ga0105237_10020144 | 3300009545 | Bacteria | 6885 |
| 177 | Ga0105238_10091370 | 3300009551 | Bacteria | 3031 |
| 178 | Ga0105249_10000102 | 3300009553 | Bacteria | 119003 |
| 179 | Ga0105249_10002432 | 3300009553 | Bacteria | 16167 |
| 180 | Ga0105249_10011862 | 3300009553 | Bacteria | 7661 |
| 181 | Ga0105249_10016242 | 3300009553 | Bacteria | 6602 |
| 182 | Ga0105249_10113894 | 3300009553 | Bacteria | 2560 |
| 183 | Ga0105249_10191623 | 3300009553 | Bacteria | 1996 |
| 184 | Ga0105239_10000111 | 3300010375 | Bacteria | 115283 |
| 185 | Ga0105239_10014227 | 3300010375 | Bacteria | 8831 |
| 186 | Ga0105239_10048852 | 3300010375 | Bacteria | 4638 |
| 187 | Ga0105239_10179715 | 3300010375 | Bacteria | 2367 |
| 188 | Ga0105246_10011380 | 3300011119 | Bacteria | 5523 |
| 189 | Ga0157373_10008703 | 3300013100 | Bacteria | 7529 |
| 190 | Ga0157371_10000925 | 3300013102 | Bacteria | 32949 |
| 191 | Ga0157371_10001152 | 3300013102 | Bacteria | 28455 |
| 192 | Ga0157371_10005656 | 3300013102 | Bacteria | 10495 |
| 193 | Ga0157371_10034266 | 3300013102 | Bacteria | 3642 |
| 194 | Ga0157370_10001082 | 3300013104 | Bacteria | 34114 |
| 195 | Ga0157370_10032814 | 3300013104 | Bacteria | 5068 |
| 196 | Ga0157370_10094246 | 3300013104 | Bacteria | 2809 |
| 197 | Ga0157369_10003418 | 3300013105 | Bacteria | 18834 |
| 198 | Ga0157369_10005493 | 3300013105 | Bacteria | 14729 |
| 199 | Ga0157369_10014781 | 3300013105 | Bacteria | 8807 |
| 200 | Ga0163162_10000551 | 3300013306 | Bacteria | 34607 |
| 201 | Ga0163162_10009185 | 3300013306 | Bacteria | 9621 |
| 202 | Ga0157372_10000411 | 3300013307 | Bacteria | 46913 |
| 203 | Ga0157372_10011852 | 3300013307 | Bacteria | 9285 |
| 204 | Ga0157372_10043888 | 3300013307 | Bacteria | 4953 |
| 205 | Ga0157375_10000819 | 3300013308 | Bacteria | 27196 |
| 206 | Ga0157375_10036562 | 3300013308 | Bacteria | 4699 |
| 207 | Ga0157375_10047654 | 3300013308 | Bacteria | 4187 |
| 208 | Ga0157379_10003646 | 3300014968 | Bacteria | 13071 |
| 209 | Ga0157379_10053777 | 3300014968 | Bacteria | 3598 |
| 210 | Ga0182006_1002424 | 3300015261 | Bacteria | 10195 |
| 211 | Ga0182006_1003647 | 3300015261 | Bacteria | 7811 |
| 212 | Ga0182007_10000682 | 3300015262 | Bacteria | 19509 |
| 213 | Ga0182005_1004741 | 3300015265 | Bacteria | 4340 |
| 214 | Ga0163161_10008403 | 3300017792 | Bacteria | 7143 |
| 215 | Ga0163161_10102611 | 3300017792 | Bacteria | 2130 |
| 216 | Ga0213872_10005680 | 3300021361 | Bacteria | 6358 |
| 217 | Ga0209435_101060 | 3300025206 | Bacteria | 3879 |
| 218 | Ga0209760_100185 | 3300025207 | Bacteria | 32620 |
| 219 | Ga0209784_100065 | 3300025224 | Bacteria | 155963 |
| 220 | Ga0209566_100081 | 3300025225 | Bacteria | 155963 |
| 221 | Ga0209674_100101 | 3300025226 | Bacteria | 155963 |
| 222 | Ga0209147_100152 | 3300025229 | Bacteria | 100822 |
| 223 | Ga0209147_100919 | 3300025229 | Bacteria | 13186 |
| 224 | Ga0209563_100098 | 3300025230 | Bacteria | 155963 |
| 225 | Ga0207427_100014 | 3300025231 | Bacteria | 561361 |
| 226 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 227 | Ga0209437_104459 | 3300025233 | Bacteria | 2467 |
| 228 | Ga0209258_101731 | 3300025242 | Bacteria | 6782 |
| 229 | Ga0209646_1001452 | 3300025246 | Bacteria | 6331 |
| 230 | Ga0209677_100059 | 3300025253 | Bacteria | 155963 |
| 231 | Ga0209233_1000036 | 3300025261 | Bacteria | 561361 |
| 232 | Ga0209565_1000281 | 3300025263 | Bacteria | 50202 |
| 233 | Ga0209673_1001574 | 3300025273 | Bacteria | 20330 |
| 234 | Ga0209675_1006260 | 3300025291 | Bacteria | 4814 |
| 235 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 236 | Ga0209676_1000087 | 3300025292 | Bacteria | 263734 |
| 237 | Ga0209676_1001866 | 3300025292 | Bacteria | 17337 |
| 238 | Ga0209564_1005483 | 3300025295 | Bacteria | 7215 |
| 239 | Ga0209758_1000035 | 3300025297 | Bacteria | 448190 |
| 240 | Ga0209758_1000608 | 3300025297 | Bacteria | 55483 |
| 241 | Ga0209758_1015026 | 3300025297 | Bacteria | 4047 |
| 242 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 243 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 244 | Ga0209050_1000083 | 3300025298 | Bacteria | 263734 |
| 245 | Ga0209256_1006602 | 3300025299 | Bacteria | 6067 |
| 246 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 247 | Ga0209051_1000040 | 3300025303 | Bacteria | 315055 |
| 248 | Ga0209051_1008204 | 3300025303 | Bacteria | 5564 |
| 249 | Ga0209257_1000036 | 3300025304 | Bacteria | 616006 |
| 250 | Ga0209257_1001043 | 3300025304 | Bacteria | 36902 |
| 251 | Ga0209257_1002683 | 3300025304 | Bacteria | 17041 |
| 252 | Ga0207656_10000077 | 3300025321 | Bacteria | 36340 |
| 253 | Ga0207656_10000163 | 3300025321 | Bacteria | 24772 |
| 254 | Ga0207696_1000115 | 3300025711 | Bacteria | 150739 |
| 255 | Ga0207696_1000163 | 3300025711 | Bacteria | 106948 |
| 256 | Ga0207696_1032710 | 3300025711 | Bacteria | 1564 |
| 257 | Ga0207655_1000734 | 3300025728 | Bacteria | 36990 |
| 258 | Ga0207655_1001691 | 3300025728 | Bacteria | 19409 |
| 259 | Ga0207655_1002757 | 3300025728 | Bacteria | 13703 |
| 260 | Ga0207655_1032477 | 3300025728 | Bacteria | 2384 |
| 261 | Ga0207713_1000020 | 3300025735 | Bacteria | 359258 |
| 262 | Ga0207713_1000318 | 3300025735 | Bacteria | 54717 |
| 263 | Ga0207713_1001737 | 3300025735 | Bacteria | 16750 |
| 264 | Ga0207713_1003208 | 3300025735 | Bacteria | 11288 |
| 265 | Ga0207713_1003330 | 3300025735 | Bacteria | 11035 |
| 266 | Ga0207713_1006178 | 3300025735 | Bacteria | 7357 |
| 267 | Ga0207680_10001712 | 3300025903 | Bacteria | 10339 |
| 268 | Ga0207680_10007735 | 3300025903 | Bacteria | 5253 |
| 269 | Ga0207647_10024637 | 3300025904 | Bacteria | 3966 |
| 270 | Ga0207654_10020477 | 3300025911 | Bacteria | 3506 |
| 271 | Ga0207695_10000213 | 3300025913 | Bacteria | 155843 |
| 272 | Ga0207695_10011595 | 3300025913 | Bacteria | 10659 |
| 273 | Ga0207695_10062012 | 3300025913 | Bacteria | 3862 |
| 274 | Ga0207695_10165322 | 3300025913 | Bacteria | 2141 |
| 275 | Ga0207671_10000747 | 3300025914 | Bacteria | 41249 |
| 276 | Ga0207671_10000788 | 3300025914 | Bacteria | 40108 |
| 277 | Ga0207657_10063173 | 3300025919 | Bacteria | 3167 |
| 278 | Ga0207649_10000010 | 3300025920 | Bacteria | 284354 |
| 279 | Ga0207681_10000843 | 3300025923 | Bacteria | 20218 |
| 280 | Ga0207681_10003360 | 3300025923 | Bacteria | 10021 |
| 281 | Ga0207681_10005690 | 3300025923 | Bacteria | 7655 |
| 282 | Ga0207694_10116550 | 3300025924 | Bacteria | 2129 |
| 283 | Ga0207650_10000384 | 3300025925 | Bacteria | 40899 |
| 284 | Ga0207650_10001354 | 3300025925 | Bacteria | 17693 |
| 285 | Ga0207650_10011260 | 3300025925 | Bacteria | 6153 |
| 286 | Ga0207650_10023412 | 3300025925 | Bacteria | 4379 |
| 287 | Ga0207687_10000467 | 3300025927 | Bacteria | 27625 |
| 288 | Ga0207644_10000004 | 3300025931 | Bacteria | 566613 |
| 289 | Ga0207644_10000084 | 3300025931 | Bacteria | 69209 |
| 290 | Ga0207690_10011096 | 3300025932 | Bacteria | 5374 |
| 291 | Ga0207690_10025423 | 3300025932 | Bacteria | 3718 |
| 292 | Ga0207706_10000383 | 3300025933 | Bacteria | 48348 |
| 293 | Ga0207706_10003643 | 3300025933 | Bacteria | 14715 |
| 294 | Ga0207706_10059424 | 3300025933 | Bacteria | 3367 |
| 295 | Ga0207709_10000058 | 3300025935 | Bacteria | 212963 |
| 296 | Ga0207709_10007500 | 3300025935 | Bacteria | 6072 |
| 297 | Ga0207711_10001289 | 3300025941 | Bacteria | 23752 |
| 298 | Ga0207711_10062163 | 3300025941 | Bacteria | 3221 |
| 299 | Ga0207679_10000037 | 3300025945 | Bacteria | 133550 |
| 300 | Ga0207667_10048200 | 3300025949 | Bacteria | 4506 |
| 301 | Ga0207712_10000026 | 3300025961 | Bacteria | 271237 |
| 302 | Ga0207712_10012258 | 3300025961 | Bacteria | 5477 |
| 303 | Ga0207712_10013582 | 3300025961 | Bacteria | 5222 |
| 304 | Ga0207712_10165855 | 3300025961 | Bacteria | 1722 |
| 305 | Ga0207668_10000031 | 3300025972 | Bacteria | 122168 |
| 306 | Ga0207668_10000384 | 3300025972 | Bacteria | 28142 |
| 307 | Ga0207668_10000837 | 3300025972 | Bacteria | 18598 |
| 308 | Ga0207668_10003946 | 3300025972 | Bacteria | 8742 |
| 309 | Ga0207668_10005069 | 3300025972 | Bacteria | 7755 |
| 310 | Ga0207668_10005145 | 3300025972 | Bacteria | 7696 |
| 311 | Ga0207668_10027971 | 3300025972 | Bacteria | 3680 |
| 312 | Ga0207668_10030627 | 3300025972 | Bacteria | 3537 |
| 313 | Ga0207668_10054835 | 3300025972 | Bacteria | 2768 |
| 314 | Ga0207640_10000172 | 3300025981 | Bacteria | 47087 |
| 315 | Ga0207640_10010921 | 3300025981 | Bacteria | 5123 |
| 316 | Ga0207640_10021468 | 3300025981 | Bacteria | 3849 |
| 317 | Ga0207640_10032428 | 3300025981 | Bacteria | 3239 |
| 318 | Ga0207658_10000009 | 3300025986 | Bacteria | 264118 |
| 319 | Ga0207658_10000173 | 3300025986 | Bacteria | 69532 |
| 320 | Ga0207658_10002222 | 3300025986 | Bacteria | 14414 |
| 321 | Ga0207658_10004604 | 3300025986 | Bacteria | 9566 |
| 322 | Ga0207658_10006715 | 3300025986 | Bacteria | 7833 |
| 323 | Ga0207658_10114975 | 3300025986 | Bacteria | 2134 |
| 324 | Ga0207703_10005397 | 3300026035 | Bacteria | 10291 |
| 325 | Ga0207639_10001228 | 3300026041 | Bacteria | 17380 |
| 326 | Ga0207639_10001573 | 3300026041 | Bacteria | 15305 |
| 327 | Ga0207639_10010029 | 3300026041 | Bacteria | 6548 |
| 328 | Ga0207639_10071057 | 3300026041 | Bacteria | 2721 |
| 329 | Ga0207678_10012629 | 3300026067 | Bacteria | 7420 |
| 330 | Ga0207702_10001025 | 3300026078 | Bacteria | 28676 |
| 331 | Ga0207641_10000367 | 3300026088 | Bacteria | 53540 |
| 332 | Ga0207641_10004419 | 3300026088 | Bacteria | 12184 |
| 333 | Ga0207641_10005639 | 3300026088 | Bacteria | 10666 |
| 334 | Ga0207641_10016352 | 3300026088 | Bacteria | 6074 |
| 335 | Ga0207641_10023406 | 3300026088 | Bacteria | 5089 |
| 336 | Ga0207641_10054906 | 3300026088 | Bacteria | 3382 |
| 337 | Ga0207674_10025702 | 3300026116 | Bacteria | 6270 |
| 338 | Ga0207674_10047138 | 3300026116 | Bacteria | 4420 |
| 339 | Ga0207675_100039006 | 3300026118 | Bacteria | 4433 |
| 340 | Ga0207675_100063072 | 3300026118 | Bacteria | 3463 |
| 341 | Ga0207683_10058640 | 3300026121 | Bacteria | 3380 |
| 342 | Ga0207698_10018166 | 3300026142 | Bacteria | 4786 |
| 343 | Ga0209281_1000011 | 3300027111 | Bacteria | 695292 |
| 344 | Ga0209813_10000074 | 3300027866 | Bacteria | 36982 |
| 345 | Ga0268266_10000387 | 3300028379 | Bacteria | 67080 |
| 346 | Ga0268265_10000094 | 3300028380 | Bacteria | 113107 |
| 347 | Ga0268265_10000118 | 3300028380 | Bacteria | 99496 |
| 348 | Ga0268265_10002558 | 3300028380 | Bacteria | 13604 |
| 349 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 350 | Ga0268264_10000021 | 3300028381 | Bacteria | 481580 |
| 351 | Ga0268264_10000367 | 3300028381 | Bacteria | 66987 |
| 352 | Ga0268264_10002410 | 3300028381 | Bacteria | 16460 |
| 353 | Ga0268264_10008727 | 3300028381 | Bacteria | 8413 |
| 354 | Ga0268264_10059509 | 3300028381 | Bacteria | 3201 |
| 355 | Ga0265326_10018769 | 3300028558 | Bacteria | 1989 |
| 356 | Ga0265319_1013333 | 3300028563 | Bacteria | 3275 |
| 357 | Ga0265334_10010853 | 3300028573 | Bacteria | 3846 |
| 358 | Ga0265318_10000019 | 3300028577 | Bacteria | 169214 |
| 359 | Ga0307515_10068578 | 3300028794 | Bacteria | 4869 |
| 360 | Ga0307515_10091706 | 3300028794 | Bacteria | 3792 |
| 361 | Ga0307515_10136135 | 3300028794 | Bacteria | 2670 |
| 362 | Ga0307515_10247065 | 3300028794 | Bacteria | 1544 |
| 363 | Ga0265338_10108050 | 3300028800 | Bacteria | 2248 |
| 364 | Ga0268256_1019716 | 3300030500 | Bacteria | 1838 |
| 365 | Ga0316181_1279899 | 3300030744 | Bacteria | 3761 |
| 366 | Ga0265330_10000691 | 3300031235 | Bacteria | 21588 |
| 367 | Ga0265332_10000076 | 3300031238 | Bacteria | 84301 |
| 368 | Ga0265328_10038198 | 3300031239 | Bacteria | 1772 |
| 369 | Ga0265320_10000689 | 3300031240 | Bacteria | 25743 |
| 370 | Ga0265325_10000250 | 3300031241 | Bacteria | 38286 |
| 371 | Ga0265329_10000634 | 3300031242 | Bacteria | 17938 |
| 372 | Ga0265331_10000775 | 3300031250 | Bacteria | 26589 |
| 373 | Ga0265327_10007444 | 3300031251 | Bacteria | 8446 |
| 374 | Ga0265316_10000893 | 3300031344 | Bacteria | 32660 |
| 375 | Ga0265316_10006740 | 3300031344 | Bacteria | 10947 |
| 376 | Ga0307509_10008863 | 3300031507 | Bacteria | 12693 |
| 377 | Ga0307509_10185091 | 3300031507 | Bacteria | 1942 |
| 378 | Ga0307408_100051934 | 3300031548 | Bacteria | 2955 |
| 379 | Ga0307508_10000204 | 3300031616 | Bacteria | 71518 |
| 380 | Ga0265314_10002160 | 3300031711 | Bacteria | 20569 |
| 381 | Ga0265342_10001950 | 3300031712 | Bacteria | 18467 |
| 382 | Ga0307405_10000041 | 3300031731 | Bacteria | 81597 |
| 383 | Ga0307405_10003738 | 3300031731 | Bacteria | 7067 |
| 384 | Ga0307412_10002912 | 3300031911 | Bacteria | 9491 |
| 385 | Ga0307510_10095588 | 3300033180 | Bacteria | 2790 |
| 386 | Ga0373931_0027539 | 3300035691 | Bacteria | 2902 |
| 387 | Ga0373927_0042026 | 3300035695 | Bacteria | 2964 |
| 388 | Ga0395900_0217043 | 3300037418 | Bacteria | 1930 |
| 389 | Ga0436361_0551392 | 3300039447 | Bacteria | 9053 |
| 390 | Ga0436361_0863053 | 3300039447 | Bacteria | 2524 |
| 391 | Ga0439438_000544 | 3300041405 | Bacteria | 17157 |
| 392 | Ga0439438_000666 | 3300041405 | Bacteria | 15441 |
| 393 | Ga0439447_001030 | 3300041407 | Bacteria | 10122 |
| 394 | Ga0439466_0002734 | 3300041411 | Bacteria | 6902 |
| 395 | Ga0439441_003261 | 3300042001 | Bacteria | 2375 |
| 396 | Ga0439452_000115 | 3300042010 | Bacteria | 63101 |
| 397 | Ga0439456_002535 | 3300042013 | Bacteria | 3675 |
| 398 | Ga0450902_000434 | 3300042137 | Bacteria | 5171 |
| 399 | Ga0466968_0002632 | 3300044735 | Bacteria | 6606 |
| 400 | Ga0466970_0027931 | 3300044765 | Bacteria | 2963 |
| 401 | Ga0495617_000003 | 3300046452 | Bacteria | 541914 |
| 402 | Ga0495617_000044 | 3300046452 | Bacteria | 119709 |
| 403 | Ga0495617_000344 | 3300046452 | Bacteria | 25643 |
| 404 | Ga0495617_001200 | 3300046452 | Bacteria | 11655 |
| 405 | Ga0495617_011875 | 3300046452 | Bacteria | 2970 |
| 406 | Ga0495627_000008 | 3300046453 | Bacteria | 572150 |
| 407 | Ga0495627_000056 | 3300046453 | Bacteria | 147012 |
| 408 | Ga0495627_000084 | 3300046453 | Bacteria | 112950 |
| 409 | Ga0495627_000142 | 3300046453 | Bacteria | 85934 |
| 410 | Ga0495627_000334 | 3300046453 | Bacteria | 45155 |
| 411 | Ga0495627_001885 | 3300046453 | Bacteria | 11047 |
| 412 | Ga0495603_0000009 | 3300046455 | Bacteria | 72869 |
| 413 | Ga0495590_0000698 | 3300046457 | Bacteria | 15366 |
| 414 | Ga0495590_0001721 | 3300046457 | Bacteria | 9306 |
| 415 | Ga0495590_0003169 | 3300046457 | Bacteria | 6727 |
| 416 | Ga0495590_0030594 | 3300046457 | Bacteria | 1886 |
| 417 | Ga0495591_000088 | 3300046458 | Bacteria | 102486 |
| 418 | Ga0495591_000448 | 3300046458 | Bacteria | 33571 |
| 419 | Ga0495591_004529 | 3300046458 | Bacteria | 6749 |
| 420 | Ga0495591_009768 | 3300046458 | Bacteria | 3780 |
| 421 | Ga0495638_0000018 | 3300046460 | Bacteria | 389696 |
| 422 | Ga0495638_0000160 | 3300046460 | Bacteria | 105110 |
| 423 | Ga0495638_0000230 | 3300046460 | Bacteria | 76565 |
| 424 | Ga0495638_0000399 | 3300046460 | Bacteria | 53351 |
| 425 | Ga0495638_0004745 | 3300046460 | Bacteria | 10253 |
| 426 | Ga0495638_0015764 | 3300046460 | Bacteria | 5064 |
| 427 | Ga0495638_0016007 | 3300046460 | Bacteria | 5026 |
| 428 | Ga0495638_0018658 | 3300046460 | Bacteria | 4603 |
| 429 | Ga0495638_0074070 | 3300046460 | Bacteria | 2077 |
| 430 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 431 | Ga0495650_0000017 | 3300046471 | Bacteria | 542552 |
| 432 | Ga0495650_0000160 | 3300046471 | Bacteria | 152374 |
| 433 | Ga0495650_0002248 | 3300046471 | Bacteria | 16151 |
| 434 | Ga0495650_0003429 | 3300046471 | Bacteria | 11568 |
| 435 | Ga0495650_0003742 | 3300046471 | Bacteria | 10861 |
| 436 | Ga0495650_0005303 | 3300046471 | Bacteria | 8432 |
| 437 | Ga0495650_0012276 | 3300046471 | Bacteria | 4618 |
| 438 | Ga0495650_0022142 | 3300046471 | Bacteria | 3053 |
| 439 | Ga0495605_0000068 | 3300046474 | Bacteria | 137743 |
| 440 | Ga0495605_0000088 | 3300046474 | Bacteria | 119191 |
| 441 | Ga0495605_0000158 | 3300046474 | Bacteria | 86829 |
| 442 | Ga0495605_0000365 | 3300046474 | Bacteria | 43038 |
| 443 | Ga0495605_0000806 | 3300046474 | Bacteria | 22409 |
| 444 | Ga0495605_0002738 | 3300046474 | Bacteria | 10763 |
| 445 | Ga0495605_0004999 | 3300046474 | Bacteria | 7746 |
| 446 | Ga0495605_0011818 | 3300046474 | Bacteria | 4859 |
| 447 | Ga0495584_0000027 | 3300046491 | Bacteria | 112488 |
| 448 | Ga0495584_0000322 | 3300046491 | Bacteria | 33438 |
| 449 | Ga0495584_0000666 | 3300046491 | Bacteria | 22861 |
| 450 | Ga0495584_0001575 | 3300046491 | Bacteria | 13482 |
| 451 | Ga0495584_0003151 | 3300046491 | Bacteria | 9159 |
| 452 | Ga0495584_0018535 | 3300046491 | Bacteria | 3537 |
| 453 | Ga0495585_0000142 | 3300046492 | Bacteria | 79060 |
| 454 | Ga0495585_0006735 | 3300046492 | Bacteria | 7089 |
| 455 | Ga0495594_0002539 | 3300046499 | Bacteria | 9505 |
| 456 | Ga0495596_0000006 | 3300046500 | Bacteria | 161501 |
| 457 | Ga0495596_0000061 | 3300046500 | Bacteria | 79205 |
| 458 | Ga0495596_0001000 | 3300046500 | Bacteria | 16807 |
| 459 | Ga0495607_0000076 | 3300046501 | Bacteria | 99256 |
| 460 | Ga0495607_0000253 | 3300046501 | Bacteria | 57280 |
| 461 | Ga0495607_0007014 | 3300046501 | Bacteria | 7840 |
| 462 | Ga0495607_0012249 | 3300046501 | Bacteria | 5669 |
| 463 | Ga0495607_0016286 | 3300046501 | Bacteria | 4800 |
| 464 | Ga0495607_0029544 | 3300046501 | Bacteria | 3372 |
| 465 | Ga0495607_0029980 | 3300046501 | Bacteria | 3344 |
| 466 | Ga0495607_0050614 | 3300046501 | Bacteria | 2417 |
| 467 | Ga0495607_0075966 | 3300046501 | Bacteria | 1860 |
| 468 | Ga0495583_0000010 | 3300046506 | Bacteria | 353523 |
| 469 | Ga0495583_0000029 | 3300046506 | Bacteria | 255536 |
| 470 | Ga0495583_0000135 | 3300046506 | Bacteria | 123916 |
| 471 | Ga0495583_0000429 | 3300046506 | Bacteria | 63489 |
| 472 | Ga0495583_0000457 | 3300046506 | Bacteria | 60714 |
| 473 | Ga0495583_0001285 | 3300046506 | Bacteria | 26213 |
| 474 | Ga0495583_0002204 | 3300046506 | Bacteria | 17264 |
| 475 | Ga0495606_0000165 | 3300046507 | Bacteria | 116607 |
| 476 | Ga0495606_0000545 | 3300046507 | Bacteria | 60465 |
| 477 | Ga0495606_0000729 | 3300046507 | Bacteria | 50871 |
| 478 | Ga0495606_0000760 | 3300046507 | Bacteria | 49564 |
| 479 | Ga0495606_0004668 | 3300046507 | Bacteria | 13543 |
| 480 | Ga0495606_0007980 | 3300046507 | Bacteria | 9312 |
| 481 | Ga0495606_0021889 | 3300046507 | Bacteria | 4675 |
| 482 | Ga0495606_0034070 | 3300046507 | Bacteria | 3501 |
| 483 | Ga0495606_0054372 | 3300046507 | Bacteria | 2593 |
| 484 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 485 | Ga0495610_0000058 | 3300046512 | Bacteria | 137991 |
| 486 | Ga0495610_0000107 | 3300046512 | Bacteria | 97076 |
| 487 | Ga0495610_0001222 | 3300046512 | Bacteria | 23122 |
| 488 | Ga0495610_0002403 | 3300046512 | Bacteria | 15762 |
| 489 | Ga0495610_0002821 | 3300046512 | Bacteria | 14159 |
| 490 | Ga0495610_0006938 | 3300046512 | Bacteria | 7667 |
| 491 | Ga0495610_0007561 | 3300046512 | Bacteria | 7196 |
| 492 | Ga0495610_0009414 | 3300046512 | Bacteria | 6181 |
| 493 | Ga0495610_0017959 | 3300046512 | Bacteria | 4012 |
| 494 | Ga0495610_0024504 | 3300046512 | Bacteria | 3254 |
| 495 | Ga0495610_0032252 | 3300046512 | Bacteria | 2724 |
| 496 | Ga0495610_0038584 | 3300046512 | Bacteria | 2424 |
| 497 | Ga0495616_0000054 | 3300046513 | Bacteria | 104326 |
| 498 | Ga0495616_0000082 | 3300046513 | Bacteria | 80468 |
| 499 | Ga0495616_0000372 | 3300046513 | Bacteria | 34836 |
| 500 | Ga0495616_0000429 | 3300046513 | Bacteria | 32137 |
| 501 | Ga0495616_0027272 | 3300046513 | Bacteria | 3033 |
| 502 | Ga0495616_0034791 | 3300046513 | Bacteria | 2612 |
| 503 | Ga0495616_0045309 | 3300046513 | Bacteria | 2227 |
| 504 | Ga0495616_0049385 | 3300046513 | Bacteria | 2109 |
| 505 | Ga0495620_0000034 | 3300046515 | Bacteria | 117942 |
| 506 | Ga0495620_0000207 | 3300046515 | Bacteria | 44260 |
| 507 | Ga0495620_0005130 | 3300046515 | Bacteria | 7334 |
| 508 | Ga0495620_0022451 | 3300046515 | Bacteria | 3037 |
| 509 | Ga0495628_0036011 | 3300046516 | Bacteria | 3975 |
| 510 | Ga0495630_0000058 | 3300046517 | Bacteria | 90878 |
| 511 | Ga0495631_0000372 | 3300046518 | Bacteria | 30820 |
| 512 | Ga0495631_0013640 | 3300046518 | Bacteria | 3939 |
| 513 | Ga0495631_0033461 | 3300046518 | Bacteria | 2309 |
| 514 | Ga0495632_0000076 | 3300046519 | Bacteria | 101121 |
| 515 | Ga0495632_0000113 | 3300046519 | Bacteria | 83027 |
| 516 | Ga0495632_0000207 | 3300046519 | Bacteria | 59532 |
| 517 | Ga0495632_0000495 | 3300046519 | Bacteria | 37144 |
| 518 | Ga0495632_0000748 | 3300046519 | Bacteria | 29283 |
| 519 | Ga0495632_0000997 | 3300046519 | Bacteria | 24718 |
| 520 | Ga0495632_0007697 | 3300046519 | Bacteria | 6728 |
| 521 | Ga0495632_0009443 | 3300046519 | Bacteria | 5887 |
| 522 | Ga0495632_0013021 | 3300046519 | Bacteria | 4766 |
| 523 | Ga0495632_0014750 | 3300046519 | Bacteria | 4408 |
| 524 | Ga0495632_0017003 | 3300046519 | Bacteria | 4028 |
| 525 | Ga0495632_0040616 | 3300046519 | Bacteria | 2342 |
| 526 | Ga0495637_0000214 | 3300046520 | Bacteria | 45088 |
| 527 | Ga0495637_0000219 | 3300046520 | Bacteria | 44013 |
| 528 | Ga0495637_0001357 | 3300046520 | Bacteria | 14696 |
| 529 | Ga0495637_0001450 | 3300046520 | Bacteria | 13958 |
| 530 | Ga0495637_0001481 | 3300046520 | Bacteria | 13781 |
| 531 | Ga0495637_0002671 | 3300046520 | Bacteria | 9739 |
| 532 | Ga0495637_0004462 | 3300046520 | Bacteria | 7248 |
| 533 | Ga0495637_0005690 | 3300046520 | Bacteria | 6325 |
| 534 | Ga0495637_0007700 | 3300046520 | Bacteria | 5328 |
| 535 | Ga0495637_0013726 | 3300046520 | Bacteria | 3840 |
| 536 | Ga0495637_0016057 | 3300046520 | Bacteria | 3504 |
| 537 | Ga0495643_0000009 | 3300046522 | Bacteria | 344767 |
| 538 | Ga0495643_0000321 | 3300046522 | Bacteria | 65956 |
| 539 | Ga0495643_0000454 | 3300046522 | Bacteria | 52085 |
| 540 | Ga0495643_0001232 | 3300046522 | Bacteria | 24663 |
| 541 | Ga0495643_0002236 | 3300046522 | Bacteria | 15721 |
| 542 | Ga0495643_0005329 | 3300046522 | Bacteria | 8715 |
| 543 | Ga0495643_0018408 | 3300046522 | Bacteria | 4060 |
| 544 | Ga0495643_0020490 | 3300046522 | Bacteria | 3811 |
| 545 | Ga0495643_0045383 | 3300046522 | Bacteria | 2386 |
| 546 | Ga0495644_0000119 | 3300046523 | Bacteria | 37559 |
| 547 | Ga0495644_0013543 | 3300046523 | Bacteria | 3128 |
| 548 | Ga0495644_0019907 | 3300046523 | Bacteria | 2561 |
| 549 | Ga0495648_0000018 | 3300046524 | Bacteria | 282490 |
| 550 | Ga0495648_0000239 | 3300046524 | Bacteria | 62900 |
| 551 | Ga0495648_0001250 | 3300046524 | Bacteria | 25409 |
| 552 | Ga0495648_0001378 | 3300046524 | Bacteria | 23932 |
| 553 | Ga0495648_0008114 | 3300046524 | Bacteria | 8292 |
| 554 | Ga0495663_0000023 | 3300046525 | Bacteria | 105104 |
| 555 | Ga0495666_0061405 | 3300046526 | Bacteria | 1796 |
| 556 | Ga0495642_0000114 | 3300046528 | Bacteria | 45647 |
| 557 | Ga0495642_0000187 | 3300046528 | Bacteria | 36703 |
| 558 | Ga0495654_0000012 | 3300046530 | Bacteria | 328997 |
| 559 | Ga0495654_0000292 | 3300046530 | Bacteria | 45100 |
| 560 | Ga0495654_0000414 | 3300046530 | Bacteria | 36432 |
| 561 | Ga0495654_0001637 | 3300046530 | Bacteria | 15169 |
| 562 | Ga0495654_0001701 | 3300046530 | Bacteria | 14780 |
| 563 | Ga0495654_0009671 | 3300046530 | Bacteria | 5279 |
| 564 | Ga0495654_0014271 | 3300046530 | Bacteria | 4233 |
| 565 | Ga0495654_0017905 | 3300046530 | Bacteria | 3718 |
| 566 | Ga0495654_0023808 | 3300046530 | Bacteria | 3169 |
| 567 | Ga0495654_0033864 | 3300046530 | Bacteria | 2582 |
| 568 | Ga0495609_0000111 | 3300046538 | Bacteria | 94808 |
| 569 | Ga0495609_0000147 | 3300046538 | Bacteria | 73010 |
| 570 | Ga0495609_0000340 | 3300046538 | Bacteria | 41415 |
| 571 | Ga0495609_0000477 | 3300046538 | Bacteria | 32285 |
| 572 | Ga0495609_0008130 | 3300046538 | Bacteria | 5164 |
| 573 | Ga0495597_0000050 | 3300046542 | Bacteria | 98185 |
| 574 | Ga0495597_0006237 | 3300046542 | Bacteria | 6181 |
| 575 | Ga0495597_0016843 | 3300046542 | Bacteria | 3447 |
| 576 | Ga0495597_0025967 | 3300046542 | Bacteria | 2692 |
| 577 | Ga0495597_0054533 | 3300046542 | Bacteria | 1755 |
| 578 | Ga0495633_0000190 | 3300046558 | Bacteria | 79967 |
| 579 | Ga0495633_0000316 | 3300046558 | Bacteria | 54818 |
| 580 | Ga0495633_0000397 | 3300046558 | Bacteria | 45712 |
| 581 | Ga0495633_0000446 | 3300046558 | Bacteria | 42633 |
| 582 | Ga0495633_0002823 | 3300046558 | Bacteria | 11981 |
| 583 | Ga0495633_0021779 | 3300046558 | Bacteria | 3200 |
| 584 | Ga0495633_0028857 | 3300046558 | Bacteria | 2701 |
| 585 | Ga0495633_0048981 | 3300046558 | Bacteria | 1995 |
| 586 | Ga0495656_0061486 | 3300046615 | Bacteria | 1640 |
| 587 | Ga0495668_0000512 | 3300046616 | Bacteria | 48355 |
| 588 | Ga0495668_0001601 | 3300046616 | Bacteria | 21209 |
| 589 | Ga0495668_0007940 | 3300046616 | Bacteria | 6694 |
| 590 | Ga0495668_0010946 | 3300046616 | Bacteria | 5461 |
| 591 | Ga0495668_0022182 | 3300046616 | Bacteria | 3630 |
| 592 | Ga0495611_0001119 | 3300046648 | Bacteria | 14092 |
| 593 | Ga0495611_0001477 | 3300046648 | Bacteria | 11678 |
| 594 | Ga0495625_0000162 | 3300046660 | Bacteria | 103961 |
| 595 | Ga0495625_0001294 | 3300046660 | Bacteria | 31403 |
| 596 | Ga0495625_0002544 | 3300046660 | Bacteria | 19610 |
| 597 | Ga0495625_0004436 | 3300046660 | Bacteria | 13280 |
| 598 | Ga0495625_0011232 | 3300046660 | Bacteria | 7323 |
| 599 | Ga0495625_0018010 | 3300046660 | Bacteria | 5519 |
| 600 | Ga0495625_0033878 | 3300046660 | Bacteria | 3772 |
| 601 | Ga0495625_0051682 | 3300046660 | Bacteria | 2946 |
| 602 | Ga0495625_0063521 | 3300046660 | Bacteria | 2607 |
| 603 | Ga0495661_0000078 | 3300046665 | Bacteria | 119097 |
| 604 | Ga0495661_0000138 | 3300046665 | Bacteria | 85693 |
| 605 | Ga0495661_0000513 | 3300046665 | Bacteria | 40214 |
| 606 | Ga0495661_0001164 | 3300046665 | Bacteria | 22955 |
| 607 | Ga0495661_0003700 | 3300046665 | Bacteria | 11231 |
| 608 | Ga0495661_0017049 | 3300046665 | Bacteria | 4799 |
| 609 | Ga0495661_0017264 | 3300046665 | Bacteria | 4767 |
| 610 | Ga0495661_0020353 | 3300046665 | Bacteria | 4334 |
| 611 | Ga0495661_0058967 | 3300046665 | Bacteria | 2286 |
| 612 | Ga0495588_0000391 | 3300046674 | Bacteria | 24911 |
| 613 | Ga0495623_0128494 | 3300046679 | Bacteria | 1520 |
| 614 | Ga0495670_0016537 | 3300046691 | Bacteria | 3626 |
| 615 | Ga0495670_0030426 | 3300046691 | Bacteria | 2681 |
| 616 | Ga0495670_0059391 | 3300046691 | Bacteria | 1920 |
| 617 | Ga0495670_0078325 | 3300046691 | Bacteria | 1681 |
| 618 | Ga0495671_0000010 | 3300046692 | Bacteria | 368641 |
| 619 | Ga0495671_0000011 | 3300046692 | Bacteria | 365582 |
| 620 | Ga0495671_0000013 | 3300046692 | Bacteria | 344767 |
| 621 | Ga0495671_0000052 | 3300046692 | Bacteria | 133684 |
| 622 | Ga0495671_0006188 | 3300046692 | Bacteria | 6944 |
| 623 | Ga0495671_0006726 | 3300046692 | Bacteria | 6618 |
| 624 | Ga0495671_0011811 | 3300046692 | Bacteria | 4788 |
| 625 | Ga0495671_0018251 | 3300046692 | Bacteria | 3724 |
| 626 | Ga0495649_0000091 | 3300046694 | Bacteria | 77817 |
| 627 | Ga0495649_0000106 | 3300046694 | Bacteria | 74615 |
| 628 | Ga0495649_0005407 | 3300046694 | Bacteria | 8127 |
| 629 | Ga0495589_0001063 | 3300046794 | Bacteria | 16487 |
| 630 | Ga0495589_0001115 | 3300046794 | Bacteria | 16012 |
| 631 | Ga0495589_0001135 | 3300046794 | Bacteria | 15823 |
| 632 | Ga0495589_0005638 | 3300046794 | Bacteria | 6601 |
| 633 | Ga0495589_0025245 | 3300046794 | Bacteria | 3017 |
| 634 | Ga0495589_0041889 | 3300046794 | Bacteria | 2283 |
| 635 | Ga0495660_0000118 | 3300046810 | Bacteria | 85202 |
| 636 | Ga0495660_0000920 | 3300046810 | Bacteria | 21658 |
| 637 | Ga0495660_0001366 | 3300046810 | Bacteria | 16808 |
| 638 | Ga0495660_0002313 | 3300046810 | Bacteria | 12218 |
| 639 | Ga0495660_0009066 | 3300046810 | Bacteria | 5810 |
| 640 | Ga0495660_0012438 | 3300046810 | Bacteria | 4941 |
| 641 | Ga0495660_0026044 | 3300046810 | Bacteria | 3318 |
| 642 | Ga0495660_0029529 | 3300046810 | Bacteria | 3092 |
| 643 | Ga0495604_0084815 | 3300047317 | Bacteria | 2365 |
| 644 | Ga0495636_0000127 | 3300047318 | Bacteria | 31014 |
| 645 | Ga0495636_0000221 | 3300047318 | Bacteria | 22484 |
| 646 | Ga0495672_0000868 | 3300047320 | Bacteria | 31821 |
| 647 | Ga0495672_0001535 | 3300047320 | Bacteria | 22596 |
| 648 | Ga0495672_0001946 | 3300047320 | Bacteria | 19522 |
| 649 | Ga0495672_0002724 | 3300047320 | Bacteria | 15866 |
| 650 | Ga0495672_0003990 | 3300047320 | Bacteria | 12347 |
| 651 | Ga0495672_0018611 | 3300047320 | Bacteria | 4604 |
| 652 | Ga0495672_0021254 | 3300047320 | Bacteria | 4236 |
| 653 | Ga0495672_0050139 | 3300047320 | Bacteria | 2467 |
| 654 | Ga0495672_0080428 | 3300047320 | Bacteria | 1817 |
| 655 | Ga0495676_0064662 | 3300047321 | Bacteria | 2842 |
| 656 | Ga0495683_0000108 | 3300047323 | Bacteria | 84498 |
| 657 | Ga0495683_0001247 | 3300047323 | Bacteria | 17258 |
| 658 | Ga0495683_0002624 | 3300047323 | Bacteria | 10750 |
| 659 | Ga0495683_0012170 | 3300047323 | Bacteria | 4522 |
| 660 | Ga0495687_000045 | 3300047443 | Bacteria | 211968 |
| 661 | Ga0495687_000572 | 3300047443 | Bacteria | 43367 |
| 662 | Ga0495687_000642 | 3300047443 | Bacteria | 40071 |
| 663 | Ga0495687_001017 | 3300047443 | Bacteria | 27988 |
| 664 | Ga0495687_001130 | 3300047443 | Bacteria | 25900 |
| 665 | Ga0495687_009882 | 3300047443 | Bacteria | 5285 |
| 666 | Ga0495687_015678 | 3300047443 | Bacteria | 3843 |
| 667 | Ga0495675_0000016 | 3300047444 | Bacteria | 129732 |
| 668 | Ga0495677_0000249 | 3300047445 | Bacteria | 23579 |
| 669 | Ga0495677_0002252 | 3300047445 | Bacteria | 7626 |
| 670 | Ga0495679_000198 | 3300047446 | Bacteria | 53238 |
| 671 | Ga0495679_001113 | 3300047446 | Bacteria | 16209 |
| 672 | Ga0495679_004175 | 3300047446 | Bacteria | 6740 |
| 673 | Ga0495679_004666 | 3300047446 | Bacteria | 6244 |
| 674 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 675 | Ga0495673_0000013 | 3300047469 | Bacteria | 612902 |
| 676 | Ga0495673_0000016 | 3300047469 | Bacteria | 580643 |
| 677 | Ga0495673_0000035 | 3300047469 | Bacteria | 316861 |
| 678 | Ga0495673_0000078 | 3300047469 | Bacteria | 203066 |
| 679 | Ga0495673_0000190 | 3300047469 | Bacteria | 97539 |
| 680 | Ga0495673_0000321 | 3300047469 | Bacteria | 61858 |
| 681 | Ga0495673_0001285 | 3300047469 | Bacteria | 20490 |
| 682 | Ga0495673_0003373 | 3300047469 | Bacteria | 10563 |
| 683 | Ga0495673_0003734 | 3300047469 | Bacteria | 9891 |
| 684 | Ga0495673_0005427 | 3300047469 | Bacteria | 7708 |
| 685 | Ga0495673_0019601 | 3300047469 | Bacteria | 3386 |
| 686 | Ga0495673_0073541 | 3300047469 | Bacteria | 1432 |
| 687 | Ga0495681_0000009 | 3300047470 | Bacteria | 205224 |
| 688 | Ga0495681_0000257 | 3300047470 | Bacteria | 43264 |
| 689 | Ga0495681_0001074 | 3300047470 | Bacteria | 20845 |
| 690 | Ga0495681_0001750 | 3300047470 | Bacteria | 16011 |
| 691 | Ga0495681_0005751 | 3300047470 | Bacteria | 8246 |
| 692 | Ga0495681_0012346 | 3300047470 | Bacteria | 5025 |
| 693 | Ga0495681_0036771 | 3300047470 | Bacteria | 2418 |
| 694 | Ga0495684_0021654 | 3300047471 | Bacteria | 4950 |
| 695 | Ga0495686_0000161 | 3300047472 | Bacteria | 126951 |
| 696 | Ga0495686_0000284 | 3300047472 | Bacteria | 89023 |
| 697 | Ga0495686_0000503 | 3300047472 | Bacteria | 57024 |
| 698 | Ga0495686_0000633 | 3300047472 | Bacteria | 48475 |
| 699 | Ga0495686_0001069 | 3300047472 | Bacteria | 32620 |
| 700 | Ga0495686_0032516 | 3300047472 | Bacteria | 3376 |
| 701 | Ga0495686_0052738 | 3300047472 | Bacteria | 2549 |
| 702 | Ga0495602_0134294 | 3300048088 | Bacteria | 1968 |
| 703 | Ga0495615_0000107 | 3300048090 | Bacteria | 22549 |
| 704 | Ga0495626_0000015 | 3300048091 | Bacteria | 232238 |
| 705 | Ga0495626_0000033 | 3300048091 | Bacteria | 184008 |
| 706 | Ga0495626_0000963 | 3300048091 | Bacteria | 24947 |
| 707 | Ga0495626_0002074 | 3300048091 | Bacteria | 14590 |
| 708 | Ga0495626_0019293 | 3300048091 | Bacteria | 3411 |
| 709 | Ga0495626_0034107 | 3300048091 | Bacteria | 2436 |
| 710 | Ga0496101_0009417 | 3300048904 | Bacteria | 6420 |
| 711 | Ga0496101_0077336 | 3300048904 | Bacteria | 2452 |
| 712 | Ga0496102_0000143 | 3300048905 | Bacteria | 96813 |
| 713 | Ga0496102_0000613 | 3300048905 | Bacteria | 36995 |
| 714 | Ga0496102_0083762 | 3300048905 | Bacteria | 2942 |
| 715 | Ga0496102_0092328 | 3300048905 | Bacteria | 2803 |
| 716 | Ga0496103_0000098 | 3300048906 | Bacteria | 96109 |
| 717 | Ga0496103_0000163 | 3300048906 | Bacteria | 70387 |
| 718 | Ga0496103_0001372 | 3300048906 | Bacteria | 16427 |
| 719 | Ga0496103_0008348 | 3300048906 | Bacteria | 6153 |
| 720 | Ga0496103_0019032 | 3300048906 | Bacteria | 4123 |
| 721 | Ga0496104_0003754 | 3300048907 | Bacteria | 13131 |
| 722 | Ga0496104_0007054 | 3300048907 | Bacteria | 9911 |
| 723 | Ga0496104_0279447 | 3300048907 | Bacteria | 1583 |
| 724 | Ga0496105_0001309 | 3300048908 | Bacteria | 17421 |
| 725 | Ga0496105_0005911 | 3300048908 | Bacteria | 9334 |
| 726 | Ga0496105_0123836 | 3300048908 | Bacteria | 2131 |
| 727 | Ga0496106_0000233 | 3300048909 | Bacteria | 38847 |
| 728 | Ga0496106_0007898 | 3300048909 | Bacteria | 7864 |
| 729 | Ga0496106_0030871 | 3300048909 | Bacteria | 3995 |
| 730 | Ga0496107_0000019 | 3300048910 | Bacteria | 150224 |
| 731 | Ga0496107_0000100 | 3300048910 | Bacteria | 41794 |
| 732 | Ga0496108_0135122 | 3300048911 | Bacteria | 2121 |
| 733 | Ga0496108_0146923 | 3300048911 | Bacteria | 2033 |
| 734 | Ga0496109_0028123 | 3300048912 | Bacteria | 5027 |
| 735 | Ga0496110_0226498 | 3300048913 | Bacteria | 1700 |
| 736 | Ga0496111_0216837 | 3300048914 | Bacteria | 1422 |
| 737 | Ga0496112_0000267 | 3300048915 | Bacteria | 33517 |
| 738 | Ga0496113_0000031 | 3300048916 | Bacteria | 59792 |
| 739 | Ga0496113_0000081 | 3300048916 | Bacteria | 42072 |
| 740 | Ga0496114_0055201 | 3300048917 | Bacteria | 3313 |
| 741 | Ga0496114_0055235 | 3300048917 | Bacteria | 3313 |
| 742 | Ga0496115_0003823 | 3300048918 | Bacteria | 10850 |
| 743 | Ga0496115_0009634 | 3300048918 | Bacteria | 7187 |
| 744 | Ga0496116_0001473 | 3300048919 | Bacteria | 26338 |
| 745 | Ga0496116_0008741 | 3300048919 | Bacteria | 8737 |
| 746 | Ga0496116_0041734 | 3300048919 | Bacteria | 3144 |
| 747 | Ga0496116_0097053 | 3300048919 | Bacteria | 1773 |
| 748 | Ga0496117_0000121 | 3300048920 | Bacteria | 171532 |
| 749 | Ga0496117_0005261 | 3300048920 | Bacteria | 13731 |
| 750 | Ga0496117_0005816 | 3300048920 | Bacteria | 12774 |
| 751 | Ga0496117_0010277 | 3300048920 | Bacteria | 8559 |
| 752 | Ga0496117_0011270 | 3300048920 | Bacteria | 8022 |
| 753 | Ga0496117_0020317 | 3300048920 | Bacteria | 5417 |
| 754 | Ga0496117_0048689 | 3300048920 | Bacteria | 3023 |
| 755 | Ga0496117_0062535 | 3300048920 | Bacteria | 2551 |
| 756 | Ga0496118_0000095 | 3300048921 | Bacteria | 164850 |
| 757 | Ga0496118_0003634 | 3300048921 | Bacteria | 19147 |
| 758 | Ga0496118_0004347 | 3300048921 | Bacteria | 16869 |
| 759 | Ga0496118_0005130 | 3300048921 | Bacteria | 15035 |
| 760 | Ga0496118_0006175 | 3300048921 | Bacteria | 13276 |
| 761 | Ga0496118_0007255 | 3300048921 | Bacteria | 11823 |
| 762 | Ga0496118_0008390 | 3300048921 | Bacteria | 10687 |
| 763 | Ga0496118_0029942 | 3300048921 | Bacteria | 4555 |
| 764 | Ga0496118_0119532 | 3300048921 | Bacteria | 1722 |
| 765 | Ga0496119_0012070 | 3300048922 | Bacteria | 7060 |
| 766 | Ga0496119_0020493 | 3300048922 | Bacteria | 4824 |
| 767 | Ga0496119_0034497 | 3300048922 | Bacteria | 3331 |
| 768 | Ga0496119_0073860 | 3300048922 | Bacteria | 1988 |
| 769 | Ga0496120_0007164 | 3300048923 | Bacteria | 8361 |
| 770 | Ga0496121_0000067 | 3300048924 | Bacteria | 261543 |
| 771 | Ga0496121_0000097 | 3300048924 | Bacteria | 201224 |
| 772 | Ga0496121_0000098 | 3300048924 | Bacteria | 200516 |
| 773 | Ga0496121_0000624 | 3300048924 | Bacteria | 65948 |
| 774 | Ga0496121_0004401 | 3300048924 | Bacteria | 18985 |
| 775 | Ga0496121_0006234 | 3300048924 | Bacteria | 14940 |
| 776 | Ga0496121_0007968 | 3300048924 | Bacteria | 12653 |
| 777 | Ga0496121_0029800 | 3300048924 | Bacteria | 5031 |
| 778 | Ga0496122_0000092 | 3300048925 | Bacteria | 204463 |
| 779 | Ga0496122_0001234 | 3300048925 | Bacteria | 43175 |
| 780 | Ga0496122_0004452 | 3300048925 | Bacteria | 17372 |
| 781 | Ga0496122_0004540 | 3300048925 | Bacteria | 17113 |
| 782 | Ga0496122_0005467 | 3300048925 | Bacteria | 15122 |
| 783 | Ga0496122_0005743 | 3300048925 | Bacteria | 14625 |
| 784 | Ga0496122_0010593 | 3300048925 | Bacteria | 9468 |
| 785 | Ga0496122_0012169 | 3300048925 | Bacteria | 8604 |
| 786 | Ga0496122_0029147 | 3300048925 | Bacteria | 4663 |
| 787 | Ga0496122_0032481 | 3300048925 | Bacteria | 4315 |
| 788 | Ga0496122_0066270 | 3300048925 | Bacteria | 2611 |
| 789 | Ga0496122_0070000 | 3300048925 | Bacteria | 2509 |
| 790 | Ga0496123_0000028 | 3300048926 | Bacteria | 306006 |
| 791 | Ga0496123_0000598 | 3300048926 | Bacteria | 61286 |
| 792 | Ga0496123_0001346 | 3300048926 | Bacteria | 34633 |
| 793 | Ga0496123_0002700 | 3300048926 | Bacteria | 21334 |
| 794 | Ga0496123_0005386 | 3300048926 | Bacteria | 12895 |
| 795 | Ga0496123_0006893 | 3300048926 | Bacteria | 10874 |
| 796 | Ga0496123_0036538 | 3300048926 | Bacteria | 3482 |
| 797 | Ga0496123_0042003 | 3300048926 | Bacteria | 3162 |
| 798 | Ga0496123_0055407 | 3300048926 | Bacteria | 2601 |
| 799 | Ga0496123_0095090 | 3300048926 | Bacteria | 1754 |
| 800 | Ga0496124_0000119 | 3300048927 | Bacteria | 163996 |
| 801 | Ga0496124_0000812 | 3300048927 | Bacteria | 50806 |
| 802 | Ga0496124_0000873 | 3300048927 | Bacteria | 49224 |
| 803 | Ga0496124_0018216 | 3300048927 | Bacteria | 6586 |
| 804 | Ga0496124_0018404 | 3300048927 | Bacteria | 6541 |
| 805 | Ga0496124_0019199 | 3300048927 | Bacteria | 6373 |
| 806 | Ga0496124_0020785 | 3300048927 | Bacteria | 6058 |
| 807 | Ga0496124_0045554 | 3300048927 | Bacteria | 3759 |
| 808 | Ga0496124_0051057 | 3300048927 | Bacteria | 3520 |
| 809 | Ga0496124_0063227 | 3300048927 | Bacteria | 3093 |
| 810 | Ga0496124_0077237 | 3300048927 | Bacteria | 2747 |
| 811 | Ga0496124_0125839 | 3300048927 | Bacteria | 2042 |
| 812 | Ga0496125_0000038 | 3300048928 | Bacteria | 328120 |
| 813 | Ga0496125_0001250 | 3300048928 | Bacteria | 37917 |
| 814 | Ga0496125_0001903 | 3300048928 | Bacteria | 28565 |
| 815 | Ga0496125_0005821 | 3300048928 | Bacteria | 13544 |
| 816 | Ga0496125_0007696 | 3300048928 | Bacteria | 11418 |
| 817 | Ga0496125_0020652 | 3300048928 | Bacteria | 6176 |
| 818 | Ga0496125_0071493 | 3300048928 | Bacteria | 2709 |
| 819 | Ga0496125_0100470 | 3300048928 | Bacteria | 2132 |
| 820 | Ga0496125_0104213 | 3300048928 | Bacteria | 2078 |
| 821 | Ga0496126_0000688 | 3300048929 | Bacteria | 61933 |
| 822 | Ga0496126_0002234 | 3300048929 | Bacteria | 26775 |
| 823 | Ga0496126_0004349 | 3300048929 | Bacteria | 16993 |
| 824 | Ga0496126_0006740 | 3300048929 | Bacteria | 12749 |
| 825 | Ga0496126_0022348 | 3300048929 | Bacteria | 6157 |
| 826 | Ga0496126_0025214 | 3300048929 | Bacteria | 5725 |
| 827 | Ga0496126_0084425 | 3300048929 | Bacteria | 2801 |
| 828 | Ga0496126_0136434 | 3300048929 | Bacteria | 2116 |
| 829 | Ga0495678_000032 | 3300049459 | Bacteria | 212537 |
| 830 | Ga0495678_000081 | 3300049459 | Bacteria | 118700 |
| 831 | Ga0495678_000583 | 3300049459 | Bacteria | 34467 |
| 832 | Ga0495678_001014 | 3300049459 | Bacteria | 24007 |
| 833 | Ga0495678_002176 | 3300049459 | Bacteria | 13770 |
| 834 | Ga0495678_003272 | 3300049459 | Bacteria | 10125 |
| 835 | Ga0495678_007623 | 3300049459 | Bacteria | 5585 |
| 836 | Ga0495678_008247 | 3300049459 | Bacteria | 5280 |
| 837 | Ga0495678_026617 | 3300049459 | Bacteria | 2465 |
| 838 | Ga0495682_0000013 | 3300049460 | Bacteria | 259670 |
| 839 | Ga0495682_0000150 | 3300049460 | Bacteria | 59591 |
| 840 | Ga0495682_0000702 | 3300049460 | Bacteria | 21923 |
| 841 | Ga0495682_0003894 | 3300049460 | Bacteria | 6522 |
| 842 | Ga0495682_0007634 | 3300049460 | Bacteria | 4292 |
| 843 | Ga0501249_000141 | 3300049679 | Bacteria | 22514 |
| 844 | Ga0501249_000857 | 3300049679 | Bacteria | 6739 |
| 845 | Ga0501257_013040 | 3300049686 | Bacteria | 1904 |
| 846 | Ga0501266_000087 | 3300049763 | Bacteria | 11514 |
| 847 | Ga0501269_000169 | 3300049766 | Bacteria | 19940 |
| 848 | nmdc:mga03683_2471_c1 | 3300050489 | Bacteria | 3788 |
| 849 | nmdc:mga03n38_2748_c1 | 3300050490 | Bacteria | 5515 |
| 850 | nmdc:mga0k408_37235_c1 | 3300050493 | Bacteria | 2792 |
| 851 | nmdc:mga06z11_8_c1 | 3300050494 | Bacteria | 115826 |
| 852 | nmdc:mga04h51_8_c1 | 3300050495 | Bacteria | 107557 |
| 853 | nmdc:mga07m45_13206_c1 | 3300050496 | Bacteria | 4376 |
| 854 | nmdc:mga07m45_26754_c1 | 3300050496 | Bacteria | 3171 |
| 855 | nmdc:mga0sz30_1693_c1 | 3300050516 | Bacteria | 7833 |
| 856 | Ga0500578_0000234 | 3300053086 | Bacteria | 68455 |
| 857 | Ga0500643_000503 | 3300053087 | Bacteria | 27831 |
| 858 | Ga0500643_005015 | 3300053087 | Bacteria | 5800 |
| 859 | Ga0500644_0000189 | 3300053088 | Bacteria | 38264 |
| 860 | Ga0500647_0047334 | 3300053091 | Bacteria | 2067 |
| 861 | Ga0500555_000799 | 3300053103 | Bacteria | 11353 |
| 862 | Ga0500556_0001301 | 3300053104 | Bacteria | 11228 |
| 863 | Ga0500594_0000022 | 3300053118 | Bacteria | 54062 |
| 864 | Ga0500607_000035 | 3300053121 | Bacteria | 87430 |
| 865 | Ga0500607_000058 | 3300053121 | Bacteria | 77958 |
| 866 | Ga0500608_000076 | 3300053122 | Bacteria | 42438 |
| 867 | Ga0500608_000400 | 3300053122 | Bacteria | 16661 |
| 868 | Ga0500618_000066 | 3300053125 | Bacteria | 89937 |
| 869 | Ga0500618_000430 | 3300053125 | Bacteria | 27901 |
| 870 | Ga0500658_0013135 | 3300053134 | Bacteria | 3057 |
| 871 | Ga0500559_0000058 | 3300053136 | Bacteria | 88268 |
| 872 | Ga0500559_0001018 | 3300053136 | Bacteria | 17198 |
| 873 | Ga0500559_0001082 | 3300053136 | Bacteria | 16527 |
| 874 | Ga0500559_0002704 | 3300053136 | Bacteria | 9010 |
| 875 | Ga0500559_0003584 | 3300053136 | Bacteria | 7594 |
| 876 | Ga0500559_0005739 | 3300053136 | Bacteria | 5670 |
| 877 | Ga0500559_0024248 | 3300053136 | Bacteria | 2580 |
| 878 | Ga0500564_000059 | 3300053138 | Bacteria | 29435 |
| 879 | Ga0500573_0000053 | 3300053140 | Bacteria | 92344 |
| 880 | Ga0500573_0010835 | 3300053140 | Bacteria | 5093 |
| 881 | Ga0500586_001720 | 3300053145 | Bacteria | 4727 |
| 882 | Ga0500604_0005543 | 3300053151 | Bacteria | 3332 |
| 883 | Ga0500622_0000047 | 3300053156 | Bacteria | 149427 |
| 884 | Ga0500622_0005400 | 3300053156 | Bacteria | 7686 |
| 885 | Ga0500622_0028425 | 3300053156 | Bacteria | 2944 |
| 886 | Ga0500624_000017 | 3300053157 | Bacteria | 132088 |
| 887 | Ga0500627_0001133 | 3300053158 | Bacteria | 7295 |
| 888 | Ga0500627_0008343 | 3300053158 | Bacteria | 3674 |
| 889 | Ga0500634_0022859 | 3300053161 | Bacteria | 3395 |
| 890 | Ga0500567_001470 | 3300053723 | Bacteria | 9527 |
| 891 | Ga0500611_000783 | 3300053727 | Bacteria | 3290 |
| 892 | Ga0500625_000001 | 3300053729 | Bacteria | 395993 |
| 893 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 894 | Ga0500645_000196 | 3300053730 | Bacteria | 47064 |
| 895 | Ga0500645_001940 | 3300053730 | Bacteria | 9809 |
| 896 | Ga0500645_004520 | 3300053730 | Bacteria | 5309 |
| 897 | Ga0500645_006527 | 3300053730 | Bacteria | 4149 |
| 898 | 2509074668 | 2508501114 | Bacteria | 7082538 |
| 899 | 2511120360 | 2510917020 | Bacteria | 5657507 |
| 900 | 2511253368 | 2511231004 | Bacteria | 6669789 |
| 901 | 2511269615 | 2511231007 | Bacteria | 6306603 |
| 902 | 2511280838 | 2511231008 | Bacteria | 6624100 |
| 903 | 2511324219 | 2511231016 | Bacteria | 6704427 |
| 904 | 2511359945 | 2511231021 | Bacteria | 7302637 |
| 905 | 2511433098 | 2511231035 | Bacteria | 5341610 |
| 906 | 2512326218 | 2512047018 | Bacteria | 6663241 |
| 907 | 2512642368 | 2512564014 | Bacteria | 4639632 |
| 908 | 2583792561 | 2582580891 | Bacteria | 6800976 |
| 909 | 2585149462 | 2582581279 | Bacteria | 4980720 |
| 910 | 2585153315 | 2582581280 | Bacteria | 5994497 |
| 911 | 2585197004 | 2582581293 | Bacteria | 5907401 |
| 912 | 2585563968 | 2585427531 | Bacteria | 6992870 |
| 913 | 2587917624 | 2585428106 | Bacteria | 5179711 |
| 914 | 2597864393 | 2597489888 | Bacteria | 6179543 |
| 915 | 2599399280 | 2599185167 | Bacteria | 6353609 |
| 916 | 2599453618 | 2599185179 | Bacteria | 6611171 |
| 917 | 2599510714 | 2599185189 | Bacteria | 5862825 |
| 918 | 2599513773 | 2599185190 | Bacteria | 6285678 |
| 919 | 2599518953 | 2599185191 | Bacteria | 6297582 |
| 920 | 2599880105 | 2599185288 | Bacteria | 6666191 |
| 921 | 2599892830 | 2599185290 | Bacteria | 6289611 |
| 922 | 2599947185 | 2599185303 | Bacteria | 6512725 |
| 923 | 2600021791 | 2599185316 | Bacteria | 6320029 |
| 924 | 2600030839 | 2599185317 | Bacteria | 6435722 |
| 925 | 2600075064 | 2599185325 | Bacteria | 6324919 |
| 926 | 2600200643 | 2599185354 | Bacteria | 4398675 |
| 927 | 2600360644 | 2600254930 | Bacteria | 6431253 |
| 928 | 2601625367 | 2600255283 | Bacteria | 6061572 |
| 929 | 2601691541 | 2600255296 | Bacteria | 5784754 |
| 930 | 2621300365 | 2619619299 | Bacteria | 6649820 |
| 931 | 2624491727 | 2623620446 | Bacteria | 6500345 |
| 932 | 2643778390 | 2643221552 | Bacteria | 5708754 |
| 933 | 2643924771 | 2643221583 | Bacteria | 5218014 |
| 934 | 2643927350 | 2643221584 | Bacteria | 5511711 |
| 935 | 2644001321 | 2643221598 | Bacteria | 4578346 |
| 936 | 2644063261 | 2643221609 | Bacteria | 6756331 |
| 937 | 2644071744 | 2643221611 | Bacteria | 6820941 |
| 938 | 2644620593 | 2643221713 | Bacteria | 6554480 |
| 939 | 2652543960 | 2651869719 | Bacteria | 6047974 |
| 940 | 2671126875 | 2667528176 | Bacteria | 6724917 |
| 941 | 2677899125 | 2675903420 | Bacteria | 6247433 |
| 942 | 2723248359 | 2721755607 | Bacteria | 5841722 |
| 943 | 2738675425 | 2738541265 | Bacteria | 6594665 |
| 944 | 2738753828 | 2738541282 | Bacteria | 6593925 |
| 945 | 2738806326 | 2738541294 | Bacteria | 6925949 |
| 946 | 2738829803 | 2738541297 | Bacteria | 6549566 |
| 947 | 2738862877 | 2738541303 | Bacteria | 6591772 |
| 948 | 2738893686 | 2738541309 | Bacteria | 6926455 |
| 949 | 2739153599 | 2738541357 | Bacteria | 6549408 |
| 950 | 2739195519 | 2738543003 | Bacteria | 6549560 |
| 951 | 2739246375 | 2738543012 | Bacteria | 7115078 |
| 952 | 2739321995 | 2738543026 | Bacteria | 6549408 |
| 953 | 2739340236 | 2738543029 | Bacteria | 6549249 |
| 954 | 2743737698 | 2740892503 | Bacteria | 6855563 |
| 955 | 2776914038 | 2775507049 | Bacteria | 6284736 |
| 956 | 2792462396 | 2791355048 | Bacteria | 5832535 |
| 957 | 2793184147 | 2791355222 | Bacteria | 5898266 |
| 958 | 2816475409 | 2816332133 | Bacteria | 7249298 |
| 959 | 2817490563 | 2816332298 | Bacteria | 6852809 |
| 960 | 2819537359 | 2818991435 | Bacteria | 5433759 |
| 961 | 2819646579 | 2818991454 | Bacteria | 5563326 |
| 962 | 2821131760 | 2821131069 | Bacteria | 6108407 |
| 963 | 2826585021 | 2826581358 | Bacteria | 5963467 |
| 964 | 2840764384 | 2840764183 | Bacteria | 6358399 |
| 965 | 2842827320 | 2842826826 | Bacteria | 5974129 |
| 966 | 2842841734 | 2842837860 | Bacteria | 6066181 |
| 967 | 2842850998 | 2842849001 | Bacteria | 5924277 |
| 968 | 2843748728 | 2843744320 | Bacteria | 5659202 |
| 969 | 2844322842 | 2844315083 | Bacteria | 8138177 |
| 970 | 2849565298 | 2849560528 | Bacteria | 5393480 |
| 971 | 2851156530 | 2851153111 | Bacteria | 5542585 |
| 972 | 2857507762 | 2857504554 | Bacteria | 5369913 |
| 973 | 2857555982 | 2857553236 | Bacteria | 6166726 |
| 974 | 2860870250 | 2860867994 | Bacteria | 5645326 |
| 975 | 2874173005 | 2874168670 | Bacteria | 8062617 |
| 976 | 2898330200 | 2898329390 | Bacteria | 5168154 |
| 977 | 2903734642 | 2903727486 | Bacteria | 8281579 |
| 978 | 2904115983 | 2904113452 | Bacteria | 7796941 |
| 979 | 2904425783 | 2904424332 | Bacteria | 7633521 |
| 980 | 2906605047 | 2906602504 | Bacteria | 8295279 |
| 981 | 2909401126 | 2909399089 | Bacteria | 3922598 |
| 982 | 2919141860 | 2919138771 | Bacteria | 5281312 |
| 983 | 2919710837 | 2919709256 | Bacteria | 4318106 |
| 984 | 2923156743 | 2923153595 | Bacteria | 6870622 |
| 985 | 2923588020 | 2923586266 | Bacteria | 6565975 |
| 986 | 2928533758 | 2928531327 | Bacteria | 5101314 |
| 987 | 2928961966 | 2928959182 | Bacteria | 4725774 |
| 988 | 2929192985 | 2929189879 | Bacteria | 5930554 |
| 989 | 2931374713 | 2931369376 | Bacteria | 6847892 |
| 990 | 2931394402 | 2931390751 | Bacteria | 6273349 |
| 991 | 2931401295 | 2931396565 | Bacteria | 7251677 |
| 992 | 2937838510 | 2937836603 | Bacteria | 6811263 |
| 993 | 2945962994 | 2945961074 | Bacteria | 7342064 |
| 994 | 2946010565 | 2946006987 | Bacteria | 6705746 |
| 995 | 2946030483 | 2946027586 | Bacteria | 6049274 |
| 996 | 2980184152 | 2980182181 | Bacteria | 9454109 |
| 997 | 2980185828 | 2980182181 | Bacteria | 9454109 |
| 998 | 3005602563 | 3005594810 | Bacteria | 8716512 |
| 999 | 3005726033 | 3005718088 | Bacteria | 8283608 |
| 1000 | 3007396554 | 3007395558 | Bacteria | 6755444 |
| 1001 | 3007873812 | 3007872151 | Bacteria | 5268868 |
| 1002 | 8015690963 | 8015687852 | Bacteria | 6613826 |
| 1003 | 8054286676 | 8054285046 | Bacteria | 6919322 |
| 1004 | 8054304600 | 8054302542 | Bacteria | 5698134 |
| 1005 | 8054347907 | 8054347763 | Bacteria | 5901107 |
| 1006 | 8054506715 | 8054503363 | Bacteria | 6101651 |
| 1007 | 8054797880 | 8054795415 | Bacteria | 9785225 |
| 1008 | 8055774103 | 8055770955 | Bacteria | 6827675 |
| 1009 | 8055820344 | 8055817908 | Bacteria | 6609162 |
| 1010 | 8056134352 | 8056131705 | Bacteria | 6107031 |
| 1011 | 8056139505 | 8056137416 | Bacteria | 6147080 |
| 1012 | 8056179005 | 8056177738 | Bacteria | 6748268 |
| 1013 | 8056536957 | 8056533031 | Bacteria | 8964429 |
| 1014 | 8056976496 | 8056967851 | Bacteria | 9038162 |
| 1015 | 8057473980 | 8057473075 | Bacteria | 5892720 |
| 1016 | Ga0495633_0033108 | |||
| 1017 | MRS1b_contig_4057571 | |||
| 1018 | JGI24740J21852_10000040 | |||
| 1019 | JGI24740J21852_10003601 | |||
| 1020 | JGI24740J21852_10003679 | |||
| 1021 | JGI24740J21852_10005450 | |||
| 1022 | JGI24740J21852_10036090 | |||
| 1023 | JGI24739J22299_10000021 | |||
| 1024 | JGI24739J22299_10004456 | |||
| 1025 | JGI24739J22299_10005905 | |||
| 1026 | JGI24737J22298_10001269 | |||
| 1027 | JGI24737J22298_10009451 | |||
| 1028 | JGI24737J22298_10019370 | |||
| 1029 | JGI24735J21928_10002422 | |||
| 1030 | JGI24735J21928_10003309 | |||
| 1031 | JGI24738J21930_10000001 | |||
| 1032 | JGI24751J29686_10001447 | |||
| 1033 | JGI25162J39368_1000448 | |||
| 1034 | JGI25163J39215_1000169 | |||
| 1035 | JGI25164J39214_1000306 | |||
| 1036 | JGI25165J46597_1000121 | |||
| 1037 | JGI25153J46596_10000016 | |||
| 1038 | JGI25153J46596_10031842 | |||
| 1039 | rootH1_10266568 | |||
| 1040 | Ga0055538_1001047 | |||
| 1041 | Ga0055539_1000990 | |||
| 1042 | Ga0055533_1001472 | |||
| 1043 | Ga0055532_1001544 | |||
| 1044 | Ga0055525_1001160 | |||
| 1045 | Ga0055537_1003505 | |||
| 1046 | Ga0055536_1000005 | |||
| 1047 | Ga0055536_1000027 | |||
| 1048 | Ga0055530_10000001 | |||
| 1049 | Ga0055530_10000079 | |||
| 1050 | Ga0055530_10000165 | |||
| 1051 | Ga0055540_1000186 | |||
| 1052 | Ga0055540_1000258 | |||
| 1053 | Ga0055531_10014786 | |||
| 1054 | Ga0055541_1001087 | |||
| 1055 | Ga0065165_1002059 | |||
| 1056 | Ga0065714_10005985 | |||
| 1057 | Ga0065714_10008360 | |||
| 1058 | Ga0065714_10064839 | |||
| 1059 | Ga0065714_10077303 | |||
| 1060 | Ga0065714_10085296 | |||
| 1061 | Ga0065704_10006301 | |||
| 1062 | Ga0065704_10072214 | |||
| 1063 | Ga0065704_10082902 | |||
| 1064 | Ga0065704_10085666 | |||
| 1065 | Ga0065712_10068364 | |||
| 1066 | Ga0065712_10094642 | |||
| 1067 | Ga0065707_10001308 | |||
| 1068 | Ga0070670_100002244 | |||
| 1069 | Ga0070670_100005599 | |||
| 1070 | Ga0070670_100069781 | |||
| 1071 | Ga0070666_10002911 | |||
| 1072 | Ga0070666_10081034 | |||
| 1073 | Ga0070682_100048039 | |||
| 1074 | Ga0070660_100022198 | |||
| 1075 | Ga0070661_100000163 | |||
| 1076 | Ga0070668_100000045 | |||
| 1077 | Ga0070668_100002438 | |||
| 1078 | Ga0070668_100008385 | |||
| 1079 | Ga0070668_100014187 | |||
| 1080 | Ga0070668_100021709 | |||
| 1081 | Ga0070668_100022840 | |||
| 1082 | Ga0070668_100033112 | |||
| 1083 | Ga0070668_100037615 | |||
| 1084 | Ga0070668_100060798 | |||
| 1085 | Ga0070669_100005542 | |||
| 1086 | Ga0070669_100011837 | |||
| 1087 | Ga0070669_100043004 | |||
| 1088 | Ga0070671_100000003 | |||
| 1089 | Ga0070671_100002400 | |||
| 1090 | Ga0070671_100015086 | |||
| 1091 | Ga0070671_100196385 | |||
| 1092 | Ga0070659_100029656 | |||
| 1093 | Ga0070667_100000009 | |||
| 1094 | Ga0070667_100000336 | |||
| 1095 | Ga0070667_100003055 | |||
| 1096 | Ga0070667_100040423 | |||
| 1097 | Ga0070667_100141689 | |||
| 1098 | Ga0070663_100004705 | |||
| 1099 | Ga0070662_100004680 | |||
| 1100 | Ga0070662_100041202 | |||
| 1101 | Ga0070662_100103589 | |||
| 1102 | Ga0070699_100047360 | |||
| 1103 | Ga0068853_100000323 | |||
| 1104 | Ga0068853_100006913 | |||
| 1105 | Ga0068853_100012273 | |||
| 1106 | Ga0068853_100044233 | |||
| 1107 | Ga0068853_100103945 | |||
| 1108 | Ga0070672_100024078 | |||
| 1109 | Ga0070665_100000816 | |||
| 1110 | Ga0070665_100005929 | |||
| 1111 | Ga0068855_100040101 | |||
| 1112 | Ga0070664_100000101 | |||
| 1113 | Ga0068857_100017091 | |||
| 1114 | Ga0068857_100035699 | |||
| 1115 | Ga0068854_100000370 | |||
| 1116 | Ga0068854_100026295 | |||
| 1117 | Ga0068854_100040560 | |||
| 1118 | Ga0068854_100080545 | |||
| 1119 | Ga0068856_100000374 | |||
| 1120 | Ga0068852_100007527 | |||
| 1121 | Ga0068852_100015318 | |||
| 1122 | Ga0068859_100021404 | |||
| 1123 | Ga0068864_100041916 | |||
| 1124 | Ga0068851_10000045 | |||
| 1125 | Ga0068851_10000147 | |||
| 1126 | Ga0068863_100000225 | |||
| 1127 | Ga0068863_100033449 | |||
| 1128 | Ga0068863_100070480 | |||
| 1129 | Ga0068863_100080560 | |||
| 1130 | Ga0068858_100001386 | |||
| 1131 | Ga0068858_100037216 | |||
| 1132 | Ga0068858_100050201 | |||
| 1133 | Ga0068860_100000051 | |||
| 1134 | Ga0068860_100000193 | |||
| 1135 | Ga0068860_100001524 | |||
| 1136 | Ga0068860_100004640 | |||
| 1137 | Ga0068860_100006123 | |||
| 1138 | Ga0068860_100008197 | |||
| 1139 | Ga0068860_100011953 | |||
| 1140 | Ga0068860_100040398 | |||
| 1141 | Ga0068860_100178234 | |||
| 1142 | Ga0068862_100000031 | |||
| 1143 | Ga0068862_100000083 | |||
| 1144 | Ga0068862_100004726 | |||
| 1145 | Ga0068862_100010282 | |||
| 1146 | Ga0068862_100011846 | |||
| 1147 | Ga0081455_10000872 | |||
| 1148 | Ga0081455_10007504 | |||
| 1149 | Ga0075368_10000863 | |||
| 1150 | Ga0075363_100001725 | |||
| 1151 | Ga0075432_10018313 | |||
| 1152 | Ga0075362_10023032 | |||
| 1153 | Ga0075367_10000269 | |||
| 1154 | Ga0075369_10001433 | |||
| 1155 | Ga0075366_10035008 | |||
| 1156 | Ga0075366_10069282 | |||
| 1157 | Ga0075370_10008619 | |||
| 1158 | Ga0075370_10081181 | |||
| 1159 | Ga0097620_100021404 | |||
| 1160 | Ga0079104_1000006 | |||
| 1161 | Ga0105251_10000612 | |||
| 1162 | Ga0105251_10001159 | |||
| 1163 | Ga0105251_10001293 | |||
| 1164 | Ga0105251_10004188 | |||
| 1165 | Ga0105244_10000738 | |||
| 1166 | Ga0105244_10002527 | |||
| 1167 | Ga0105244_10005252 | |||
| 1168 | Ga0105244_10009145 | |||
| 1169 | Ga0105244_10019703 | |||
| 1170 | Ga0105244_10075830 | |||
| 1171 | Ga0105250_10000089 | |||
| 1172 | Ga0105250_10000109 | |||
| 1173 | Ga0105250_10015604 | |||
| 1174 | Ga0105240_10000220 | |||
| 1175 | Ga0105240_10006254 | |||
| 1176 | Ga0105240_10228184 | |||
| 1177 | Ga0105245_10000721 | |||
| 1178 | Ga0105243_10000047 | |||
| 1179 | Ga0105243_10017725 | |||
| 1180 | Ga0105241_10022859 | |||
| 1181 | Ga0105242_10013185 | |||
| 1182 | Ga0105248_10003730 | |||
| 1183 | Ga0105248_10031570 | |||
| 1184 | Ga0105248_10068301 | |||
| 1185 | Ga0105248_10096387 | |||
| 1186 | Ga0105248_10111527 | |||
| 1187 | Ga0105248_10150369 | |||
| 1188 | Ga0105248_10188965 | |||
| 1189 | Ga0105237_10000096 | |||
| 1190 | Ga0105237_10000099 | |||
| 1191 | Ga0105237_10020144 | |||
| 1192 | Ga0105238_10091370 | |||
| 1193 | Ga0105249_10000102 | |||
| 1194 | Ga0105249_10002432 | |||
| 1195 | Ga0105249_10011862 | |||
| 1196 | Ga0105249_10016242 | |||
| 1197 | Ga0105249_10113894 | |||
| 1198 | Ga0105249_10191623 | |||
| 1199 | Ga0105239_10000111 | |||
| 1200 | Ga0105239_10014227 | |||
| 1201 | Ga0105239_10048852 | |||
| 1202 | Ga0105239_10179715 | |||
| 1203 | Ga0105246_10011380 | |||
| 1204 | Ga0157373_10008703 | |||
| 1205 | Ga0157371_10000925 | |||
| 1206 | Ga0157371_10001152 | |||
| 1207 | Ga0157371_10005656 | |||
| 1208 | Ga0157371_10034266 | |||
| 1209 | Ga0157370_10001082 | |||
| 1210 | Ga0157370_10032814 | |||
| 1211 | Ga0157370_10094246 | |||
| 1212 | Ga0157369_10003418 | |||
| 1213 | Ga0157369_10005493 | |||
| 1214 | Ga0157369_10014781 | |||
| 1215 | Ga0163162_10000551 | |||
| 1216 | Ga0163162_10009185 | |||
| 1217 | Ga0157372_10000411 | |||
| 1218 | Ga0157372_10011852 | |||
| 1219 | Ga0157372_10043888 | |||
| 1220 | Ga0157375_10000819 | |||
| 1221 | Ga0157375_10036562 | |||
| 1222 | Ga0157375_10047654 | |||
| 1223 | Ga0157379_10003646 | |||
| 1224 | Ga0157379_10053777 | |||
| 1225 | Ga0182006_1002424 | |||
| 1226 | Ga0182006_1003647 | |||
| 1227 | Ga0182007_10000682 | |||
| 1228 | Ga0182005_1004741 | |||
| 1229 | Ga0163161_10008403 | |||
| 1230 | Ga0163161_10102611 | |||
| 1231 | Ga0213872_10005680 | |||
| 1232 | Ga0209435_101060 | |||
| 1233 | Ga0209760_100185 | |||
| 1234 | Ga0209784_100065 | |||
| 1235 | Ga0209566_100081 | |||
| 1236 | Ga0209674_100101 | |||
| 1237 | Ga0209147_100152 | |||
| 1238 | Ga0209147_100919 | |||
| 1239 | Ga0209563_100098 | |||
| 1240 | Ga0207427_100014 | |||
| 1241 | Ga0209437_100016 | |||
| 1242 | Ga0209437_104459 | |||
| 1243 | Ga0209258_101731 | |||
| 1244 | Ga0209646_1001452 | |||
| 1245 | Ga0209677_100059 | |||
| 1246 | Ga0209233_1000036 | |||
| 1247 | Ga0209565_1000281 | |||
| 1248 | Ga0209673_1001574 | |||
| 1249 | Ga0209675_1006260 | |||
| 1250 | Ga0209676_1000003 | |||
| 1251 | Ga0209676_1000087 | |||
| 1252 | Ga0209676_1001866 | |||
| 1253 | Ga0209564_1005483 | |||
| 1254 | Ga0209758_1000035 | |||
| 1255 | Ga0209758_1000608 | |||
| 1256 | Ga0209758_1015026 | |||
| 1257 | Ga0209050_1000004 | |||
| 1258 | Ga0209050_1000037 | |||
| 1259 | Ga0209050_1000083 | |||
| 1260 | Ga0209256_1006602 | |||
| 1261 | Ga0209051_1000006 | |||
| 1262 | Ga0209051_1000040 | |||
| 1263 | Ga0209051_1008204 | |||
| 1264 | Ga0209257_1000036 | |||
| 1265 | Ga0209257_1001043 | |||
| 1266 | Ga0209257_1002683 | |||
| 1267 | Ga0207656_10000077 | |||
| 1268 | Ga0207656_10000163 | |||
| 1269 | Ga0207696_1000115 | |||
| 1270 | Ga0207696_1000163 | |||
| 1271 | Ga0207696_1032710 | |||
| 1272 | Ga0207655_1000734 | |||
| 1273 | Ga0207655_1001691 | |||
| 1274 | Ga0207655_1002757 | |||
| 1275 | Ga0207655_1032477 | |||
| 1276 | Ga0207713_1000020 | |||
| 1277 | Ga0207713_1000318 | |||
| 1278 | Ga0207713_1001737 | |||
| 1279 | Ga0207713_1003208 | |||
| 1280 | Ga0207713_1003330 | |||
| 1281 | Ga0207713_1006178 | |||
| 1282 | Ga0207680_10001712 | |||
| 1283 | Ga0207680_10007735 | |||
| 1284 | Ga0207647_10024637 | |||
| 1285 | Ga0207654_10020477 | |||
| 1286 | Ga0207695_10000213 | |||
| 1287 | Ga0207695_10011595 | |||
| 1288 | Ga0207695_10062012 | |||
| 1289 | Ga0207695_10165322 | |||
| 1290 | Ga0207671_10000747 | |||
| 1291 | Ga0207671_10000788 | |||
| 1292 | Ga0207657_10063173 | |||
| 1293 | Ga0207649_10000010 | |||
| 1294 | Ga0207681_10000843 | |||
| 1295 | Ga0207681_10003360 | |||
| 1296 | Ga0207681_10005690 | |||
| 1297 | Ga0207694_10116550 | |||
| 1298 | Ga0207650_10000384 | |||
| 1299 | Ga0207650_10001354 | |||
| 1300 | Ga0207650_10011260 | |||
| 1301 | Ga0207650_10023412 | |||
| 1302 | Ga0207687_10000467 | |||
| 1303 | Ga0207644_10000004 | |||
| 1304 | Ga0207644_10000084 | |||
| 1305 | Ga0207690_10011096 | |||
| 1306 | Ga0207690_10025423 | |||
| 1307 | Ga0207706_10000383 | |||
| 1308 | Ga0207706_10003643 | |||
| 1309 | Ga0207706_10059424 | |||
| 1310 | Ga0207709_10000058 | |||
| 1311 | Ga0207709_10007500 | |||
| 1312 | Ga0207711_10001289 | |||
| 1313 | Ga0207711_10062163 | |||
| 1314 | Ga0207679_10000037 | |||
| 1315 | Ga0207667_10048200 | |||
| 1316 | Ga0207712_10000026 | |||
| 1317 | Ga0207712_10012258 | |||
| 1318 | Ga0207712_10013582 | |||
| 1319 | Ga0207712_10165855 | |||
| 1320 | Ga0207668_10000031 | |||
| 1321 | Ga0207668_10000384 | |||
| 1322 | Ga0207668_10000837 | |||
| 1323 | Ga0207668_10003946 | |||
| 1324 | Ga0207668_10005069 | |||
| 1325 | Ga0207668_10005145 | |||
| 1326 | Ga0207668_10027971 | |||
| 1327 | Ga0207668_10030627 | |||
| 1328 | Ga0207668_10054835 | |||
| 1329 | Ga0207640_10000172 | |||
| 1330 | Ga0207640_10010921 | |||
| 1331 | Ga0207640_10021468 | |||
| 1332 | Ga0207640_10032428 | |||
| 1333 | Ga0207658_10000009 | |||
| 1334 | Ga0207658_10000173 | |||
| 1335 | Ga0207658_10002222 | |||
| 1336 | Ga0207658_10004604 | |||
| 1337 | Ga0207658_10006715 | |||
| 1338 | Ga0207658_10114975 | |||
| 1339 | Ga0207703_10005397 | |||
| 1340 | Ga0207639_10001228 | |||
| 1341 | Ga0207639_10001573 | |||
| 1342 | Ga0207639_10010029 | |||
| 1343 | Ga0207639_10071057 | |||
| 1344 | Ga0207678_10012629 | |||
| 1345 | Ga0207702_10001025 | |||
| 1346 | Ga0207641_10000367 | |||
| 1347 | Ga0207641_10004419 | |||
| 1348 | Ga0207641_10005639 | |||
| 1349 | Ga0207641_10016352 | |||
| 1350 | Ga0207641_10023406 | |||
| 1351 | Ga0207641_10054906 | |||
| 1352 | Ga0207674_10025702 | |||
| 1353 | Ga0207674_10047138 | |||
| 1354 | Ga0207675_100039006 | |||
| 1355 | Ga0207675_100063072 | |||
| 1356 | Ga0207683_10058640 | |||
| 1357 | Ga0207698_10018166 | |||
| 1358 | Ga0209281_1000011 | |||
| 1359 | Ga0209813_10000074 | |||
| 1360 | Ga0268266_10000387 | |||
| 1361 | Ga0268265_10000094 | |||
| 1362 | Ga0268265_10000118 | |||
| 1363 | Ga0268265_10002558 | |||
| 1364 | Ga0268264_10000001 | |||
| 1365 | Ga0268264_10000021 | |||
| 1366 | Ga0268264_10000367 | |||
| 1367 | Ga0268264_10002410 | |||
| 1368 | Ga0268264_10008727 | |||
| 1369 | Ga0268264_10059509 | |||
| 1370 | Ga0265326_10018769 | |||
| 1371 | Ga0265319_1013333 | |||
| 1372 | Ga0265334_10010853 | |||
| 1373 | Ga0265318_10000019 | |||
| 1374 | Ga0307515_10068578 | |||
| 1375 | Ga0307515_10091706 | |||
| 1376 | Ga0307515_10136135 | |||
| 1377 | Ga0307515_10247065 | |||
| 1378 | Ga0265338_10108050 | |||
| 1379 | Ga0268256_1019716 | |||
| 1380 | Ga0316181_1279899 | |||
| 1381 | Ga0265330_10000691 | |||
| 1382 | Ga0265332_10000076 | |||
| 1383 | Ga0265328_10038198 | |||
| 1384 | Ga0265320_10000689 | |||
| 1385 | Ga0265325_10000250 | |||
| 1386 | Ga0265329_10000634 | |||
| 1387 | Ga0265331_10000775 | |||
| 1388 | Ga0265327_10007444 | |||
| 1389 | Ga0265316_10000893 | |||
| 1390 | Ga0265316_10006740 | |||
| 1391 | Ga0307509_10008863 | |||
| 1392 | Ga0307509_10185091 | |||
| 1393 | Ga0307408_100051934 | |||
| 1394 | Ga0307508_10000204 | |||
| 1395 | Ga0265314_10002160 | |||
| 1396 | Ga0265342_10001950 | |||
| 1397 | Ga0307405_10000041 | |||
| 1398 | Ga0307405_10003738 | |||
| 1399 | Ga0307412_10002912 | |||
| 1400 | Ga0307510_10095588 | |||
| 1401 | Ga0373931_0027539 | |||
| 1402 | Ga0373927_0042026 | |||
| 1403 | Ga0395900_0217043 | |||
| 1404 | Ga0436361_0551392 | |||
| 1405 | Ga0436361_0863053 | |||
| 1406 | Ga0439438_000544 | |||
| 1407 | Ga0439438_000666 | |||
| 1408 | Ga0439447_001030 | |||
| 1409 | Ga0439466_0002734 | |||
| 1410 | Ga0439441_003261 | |||
| 1411 | Ga0439452_000115 | |||
| 1412 | Ga0439456_002535 | |||
| 1413 | Ga0450902_000434 | |||
| 1414 | Ga0466968_0002632 | |||
| 1415 | Ga0466970_0027931 | |||
| 1416 | Ga0495617_000003 | |||
| 1417 | Ga0495617_000044 | |||
| 1418 | Ga0495617_000344 | |||
| 1419 | Ga0495617_001200 | |||
| 1420 | Ga0495617_011875 | |||
| 1421 | Ga0495627_000008 | |||
| 1422 | Ga0495627_000056 | |||
| 1423 | Ga0495627_000084 | |||
| 1424 | Ga0495627_000142 | |||
| 1425 | Ga0495627_000334 | |||
| 1426 | Ga0495627_001885 | |||
| 1427 | Ga0495603_0000009 | |||
| 1428 | Ga0495590_0000698 | |||
| 1429 | Ga0495590_0001721 | |||
| 1430 | Ga0495590_0003169 | |||
| 1431 | Ga0495590_0030594 | |||
| 1432 | Ga0495591_000088 | |||
| 1433 | Ga0495591_000448 | |||
| 1434 | Ga0495591_004529 | |||
| 1435 | Ga0495591_009768 | |||
| 1436 | Ga0495638_0000018 | |||
| 1437 | Ga0495638_0000160 | |||
| 1438 | Ga0495638_0000230 | |||
| 1439 | Ga0495638_0000399 | |||
| 1440 | Ga0495638_0004745 | |||
| 1441 | Ga0495638_0015764 | |||
| 1442 | Ga0495638_0016007 | |||
| 1443 | Ga0495638_0018658 | |||
| 1444 | Ga0495638_0074070 | |||
| 1445 | Ga0495653_0000002 | |||
| 1446 | Ga0495650_0000017 | |||
| 1447 | Ga0495650_0000160 | |||
| 1448 | Ga0495650_0002248 | |||
| 1449 | Ga0495650_0003429 | |||
| 1450 | Ga0495650_0003742 | |||
| 1451 | Ga0495650_0005303 | |||
| 1452 | Ga0495650_0012276 | |||
| 1453 | Ga0495650_0022142 | |||
| 1454 | Ga0495605_0000068 | |||
| 1455 | Ga0495605_0000088 | |||
| 1456 | Ga0495605_0000158 | |||
| 1457 | Ga0495605_0000365 | |||
| 1458 | Ga0495605_0000806 | |||
| 1459 | Ga0495605_0002738 | |||
| 1460 | Ga0495605_0004999 | |||
| 1461 | Ga0495605_0011818 | |||
| 1462 | Ga0495584_0000027 | |||
| 1463 | Ga0495584_0000322 | |||
| 1464 | Ga0495584_0000666 | |||
| 1465 | Ga0495584_0001575 | |||
| 1466 | Ga0495584_0003151 | |||
| 1467 | Ga0495584_0018535 | |||
| 1468 | Ga0495585_0000142 | |||
| 1469 | Ga0495585_0006735 | |||
| 1470 | Ga0495594_0002539 | |||
| 1471 | Ga0495596_0000006 | |||
| 1472 | Ga0495596_0000061 | |||
| 1473 | Ga0495596_0001000 | |||
| 1474 | Ga0495607_0000076 | |||
| 1475 | Ga0495607_0000253 | |||
| 1476 | Ga0495607_0007014 | |||
| 1477 | Ga0495607_0012249 | |||
| 1478 | Ga0495607_0016286 | |||
| 1479 | Ga0495607_0029544 | |||
| 1480 | Ga0495607_0029980 | |||
| 1481 | Ga0495607_0050614 | |||
| 1482 | Ga0495607_0075966 | |||
| 1483 | Ga0495583_0000010 | |||
| 1484 | Ga0495583_0000029 | |||
| 1485 | Ga0495583_0000135 | |||
| 1486 | Ga0495583_0000429 | |||
| 1487 | Ga0495583_0000457 | |||
| 1488 | Ga0495583_0001285 | |||
| 1489 | Ga0495583_0002204 | |||
| 1490 | Ga0495606_0000165 | |||
| 1491 | Ga0495606_0000545 | |||
| 1492 | Ga0495606_0000729 | |||
| 1493 | Ga0495606_0000760 | |||
| 1494 | Ga0495606_0004668 | |||
| 1495 | Ga0495606_0007980 | |||
| 1496 | Ga0495606_0021889 | |||
| 1497 | Ga0495606_0034070 | |||
| 1498 | Ga0495606_0054372 | |||
| 1499 | Ga0495610_0000003 | |||
| 1500 | Ga0495610_0000058 | |||
| 1501 | Ga0495610_0000107 | |||
| 1502 | Ga0495610_0001222 | |||
| 1503 | Ga0495610_0002403 | |||
| 1504 | Ga0495610_0002821 | |||
| 1505 | Ga0495610_0006938 | |||
| 1506 | Ga0495610_0007561 | |||
| 1507 | Ga0495610_0009414 | |||
| 1508 | Ga0495610_0017959 | |||
| 1509 | Ga0495610_0024504 | |||
| 1510 | Ga0495610_0032252 | |||
| 1511 | Ga0495610_0038584 | |||
| 1512 | Ga0495616_0000054 | |||
| 1513 | Ga0495616_0000082 | |||
| 1514 | Ga0495616_0000372 | |||
| 1515 | Ga0495616_0000429 | |||
| 1516 | Ga0495616_0027272 | |||
| 1517 | Ga0495616_0034791 | |||
| 1518 | Ga0495616_0045309 | |||
| 1519 | Ga0495616_0049385 | |||
| 1520 | Ga0495620_0000034 | |||
| 1521 | Ga0495620_0000207 | |||
| 1522 | Ga0495620_0005130 | |||
| 1523 | Ga0495620_0022451 | |||
| 1524 | Ga0495628_0036011 | |||
| 1525 | Ga0495630_0000058 | |||
| 1526 | Ga0495631_0000372 | |||
| 1527 | Ga0495631_0013640 | |||
| 1528 | Ga0495631_0033461 | |||
| 1529 | Ga0495632_0000076 | |||
| 1530 | Ga0495632_0000113 | |||
| 1531 | Ga0495632_0000207 | |||
| 1532 | Ga0495632_0000495 | |||
| 1533 | Ga0495632_0000748 | |||
| 1534 | Ga0495632_0000997 | |||
| 1535 | Ga0495632_0007697 | |||
| 1536 | Ga0495632_0009443 | |||
| 1537 | Ga0495632_0013021 | |||
| 1538 | Ga0495632_0014750 | |||
| 1539 | Ga0495632_0017003 | |||
| 1540 | Ga0495632_0040616 | |||
| 1541 | Ga0495637_0000214 | |||
| 1542 | Ga0495637_0000219 | |||
| 1543 | Ga0495637_0001357 | |||
| 1544 | Ga0495637_0001450 | |||
| 1545 | Ga0495637_0001481 | |||
| 1546 | Ga0495637_0002671 | |||
| 1547 | Ga0495637_0004462 | |||
| 1548 | Ga0495637_0005690 | |||
| 1549 | Ga0495637_0007700 | |||
| 1550 | Ga0495637_0013726 | |||
| 1551 | Ga0495637_0016057 | |||
| 1552 | Ga0495643_0000009 | |||
| 1553 | Ga0495643_0000321 | |||
| 1554 | Ga0495643_0000454 | |||
| 1555 | Ga0495643_0001232 | |||
| 1556 | Ga0495643_0002236 | |||
| 1557 | Ga0495643_0005329 | |||
| 1558 | Ga0495643_0018408 | |||
| 1559 | Ga0495643_0020490 | |||
| 1560 | Ga0495643_0045383 | |||
| 1561 | Ga0495644_0000119 | |||
| 1562 | Ga0495644_0013543 | |||
| 1563 | Ga0495644_0019907 | |||
| 1564 | Ga0495648_0000018 | |||
| 1565 | Ga0495648_0000239 | |||
| 1566 | Ga0495648_0001250 | |||
| 1567 | Ga0495648_0001378 | |||
| 1568 | Ga0495648_0008114 | |||
| 1569 | Ga0495663_0000023 | |||
| 1570 | Ga0495666_0061405 | |||
| 1571 | Ga0495642_0000114 | |||
| 1572 | Ga0495642_0000187 | |||
| 1573 | Ga0495654_0000012 | |||
| 1574 | Ga0495654_0000292 | |||
| 1575 | Ga0495654_0000414 | |||
| 1576 | Ga0495654_0001637 | |||
| 1577 | Ga0495654_0001701 | |||
| 1578 | Ga0495654_0009671 | |||
| 1579 | Ga0495654_0014271 | |||
| 1580 | Ga0495654_0017905 | |||
| 1581 | Ga0495654_0023808 | |||
| 1582 | Ga0495654_0033864 | |||
| 1583 | Ga0495609_0000111 | |||
| 1584 | Ga0495609_0000147 | |||
| 1585 | Ga0495609_0000340 | |||
| 1586 | Ga0495609_0000477 | |||
| 1587 | Ga0495609_0008130 | |||
| 1588 | Ga0495597_0000050 | |||
| 1589 | Ga0495597_0006237 | |||
| 1590 | Ga0495597_0016843 | |||
| 1591 | Ga0495597_0025967 | |||
| 1592 | Ga0495597_0054533 | |||
| 1593 | Ga0495633_0000190 | |||
| 1594 | Ga0495633_0000316 | |||
| 1595 | Ga0495633_0000397 | |||
| 1596 | Ga0495633_0000446 | |||
| 1597 | Ga0495633_0002823 | |||
| 1598 | Ga0495633_0021779 | |||
| 1599 | Ga0495633_0028857 | |||
| 1600 | Ga0495633_0048981 | |||
| 1601 | Ga0495656_0061486 | |||
| 1602 | Ga0495668_0000512 | |||
| 1603 | Ga0495668_0001601 | |||
| 1604 | Ga0495668_0007940 | |||
| 1605 | Ga0495668_0010946 | |||
| 1606 | Ga0495668_0022182 | |||
| 1607 | Ga0495611_0001119 | |||
| 1608 | Ga0495611_0001477 | |||
| 1609 | Ga0495625_0000162 | |||
| 1610 | Ga0495625_0001294 | |||
| 1611 | Ga0495625_0002544 | |||
| 1612 | Ga0495625_0004436 | |||
| 1613 | Ga0495625_0011232 | |||
| 1614 | Ga0495625_0018010 | |||
| 1615 | Ga0495625_0033878 | |||
| 1616 | Ga0495625_0051682 | |||
| 1617 | Ga0495625_0063521 | |||
| 1618 | Ga0495661_0000078 | |||
| 1619 | Ga0495661_0000138 | |||
| 1620 | Ga0495661_0000513 | |||
| 1621 | Ga0495661_0001164 | |||
| 1622 | Ga0495661_0003700 | |||
| 1623 | Ga0495661_0017049 | |||
| 1624 | Ga0495661_0017264 | |||
| 1625 | Ga0495661_0020353 | |||
| 1626 | Ga0495661_0058967 | |||
| 1627 | Ga0495588_0000391 | |||
| 1628 | Ga0495623_0128494 | |||
| 1629 | Ga0495670_0016537 | |||
| 1630 | Ga0495670_0030426 | |||
| 1631 | Ga0495670_0059391 | |||
| 1632 | Ga0495670_0078325 | |||
| 1633 | Ga0495671_0000010 | |||
| 1634 | Ga0495671_0000011 | |||
| 1635 | Ga0495671_0000013 | |||
| 1636 | Ga0495671_0000052 | |||
| 1637 | Ga0495671_0006188 | |||
| 1638 | Ga0495671_0006726 | |||
| 1639 | Ga0495671_0011811 | |||
| 1640 | Ga0495671_0018251 | |||
| 1641 | Ga0495649_0000091 | |||
| 1642 | Ga0495649_0000106 | |||
| 1643 | Ga0495649_0005407 | |||
| 1644 | Ga0495589_0001063 | |||
| 1645 | Ga0495589_0001115 | |||
| 1646 | Ga0495589_0001135 | |||
| 1647 | Ga0495589_0005638 | |||
| 1648 | Ga0495589_0025245 | |||
| 1649 | Ga0495589_0041889 | |||
| 1650 | Ga0495660_0000118 | |||
| 1651 | Ga0495660_0000920 | |||
| 1652 | Ga0495660_0001366 | |||
| 1653 | Ga0495660_0002313 | |||
| 1654 | Ga0495660_0009066 | |||
| 1655 | Ga0495660_0012438 | |||
| 1656 | Ga0495660_0026044 | |||
| 1657 | Ga0495660_0029529 | |||
| 1658 | Ga0495604_0084815 | |||
| 1659 | Ga0495636_0000127 | |||
| 1660 | Ga0495636_0000221 | |||
| 1661 | Ga0495672_0000868 | |||
| 1662 | Ga0495672_0001535 | |||
| 1663 | Ga0495672_0001946 | |||
| 1664 | Ga0495672_0002724 | |||
| 1665 | Ga0495672_0003990 | |||
| 1666 | Ga0495672_0018611 | |||
| 1667 | Ga0495672_0021254 | |||
| 1668 | Ga0495672_0050139 | |||
| 1669 | Ga0495672_0080428 | |||
| 1670 | Ga0495676_0064662 | |||
| 1671 | Ga0495683_0000108 | |||
| 1672 | Ga0495683_0001247 | |||
| 1673 | Ga0495683_0002624 | |||
| 1674 | Ga0495683_0012170 | |||
| 1675 | Ga0495687_000045 | |||
| 1676 | Ga0495687_000572 | |||
| 1677 | Ga0495687_000642 | |||
| 1678 | Ga0495687_001017 | |||
| 1679 | Ga0495687_001130 | |||
| 1680 | Ga0495687_009882 | |||
| 1681 | Ga0495687_015678 | |||
| 1682 | Ga0495675_0000016 | |||
| 1683 | Ga0495677_0000249 | |||
| 1684 | Ga0495677_0002252 | |||
| 1685 | Ga0495679_000198 | |||
| 1686 | Ga0495679_001113 | |||
| 1687 | Ga0495679_004175 | |||
| 1688 | Ga0495679_004666 | |||
| 1689 | Ga0495673_0000003 | |||
| 1690 | Ga0495673_0000013 | |||
| 1691 | Ga0495673_0000016 | |||
| 1692 | Ga0495673_0000035 | |||
| 1693 | Ga0495673_0000078 | |||
| 1694 | Ga0495673_0000190 | |||
| 1695 | Ga0495673_0000321 | |||
| 1696 | Ga0495673_0001285 | |||
| 1697 | Ga0495673_0003373 | |||
| 1698 | Ga0495673_0003734 | |||
| 1699 | Ga0495673_0005427 | |||
| 1700 | Ga0495673_0019601 | |||
| 1701 | Ga0495673_0073541 | |||
| 1702 | Ga0495681_0000009 | |||
| 1703 | Ga0495681_0000257 | |||
| 1704 | Ga0495681_0001074 | |||
| 1705 | Ga0495681_0001750 | |||
| 1706 | Ga0495681_0005751 | |||
| 1707 | Ga0495681_0012346 | |||
| 1708 | Ga0495681_0036771 | |||
| 1709 | Ga0495684_0021654 | |||
| 1710 | Ga0495686_0000161 | |||
| 1711 | Ga0495686_0000284 | |||
| 1712 | Ga0495686_0000503 | |||
| 1713 | Ga0495686_0000633 | |||
| 1714 | Ga0495686_0001069 | |||
| 1715 | Ga0495686_0032516 | |||
| 1716 | Ga0495686_0052738 | |||
| 1717 | Ga0495602_0134294 | |||
| 1718 | Ga0495615_0000107 | |||
| 1719 | Ga0495626_0000015 | |||
| 1720 | Ga0495626_0000033 | |||
| 1721 | Ga0495626_0000963 | |||
| 1722 | Ga0495626_0002074 | |||
| 1723 | Ga0495626_0019293 | |||
| 1724 | Ga0495626_0034107 | |||
| 1725 | Ga0496101_0009417 | |||
| 1726 | Ga0496101_0077336 | |||
| 1727 | Ga0496102_0000143 | |||
| 1728 | Ga0496102_0000613 | |||
| 1729 | Ga0496102_0083762 | |||
| 1730 | Ga0496102_0092328 | |||
| 1731 | Ga0496103_0000098 | |||
| 1732 | Ga0496103_0000163 | |||
| 1733 | Ga0496103_0001372 | |||
| 1734 | Ga0496103_0008348 | |||
| 1735 | Ga0496103_0019032 | |||
| 1736 | Ga0496104_0003754 | |||
| 1737 | Ga0496104_0007054 | |||
| 1738 | Ga0496104_0279447 | |||
| 1739 | Ga0496105_0001309 | |||
| 1740 | Ga0496105_0005911 | |||
| 1741 | Ga0496105_0123836 | |||
| 1742 | Ga0496106_0000233 | |||
| 1743 | Ga0496106_0007898 | |||
| 1744 | Ga0496106_0030871 | |||
| 1745 | Ga0496107_0000019 | |||
| 1746 | Ga0496107_0000100 | |||
| 1747 | Ga0496108_0135122 | |||
| 1748 | Ga0496108_0146923 | |||
| 1749 | Ga0496109_0028123 | |||
| 1750 | Ga0496110_0226498 | |||
| 1751 | Ga0496111_0216837 | |||
| 1752 | Ga0496112_0000267 | |||
| 1753 | Ga0496113_0000031 | |||
| 1754 | Ga0496113_0000081 | |||
| 1755 | Ga0496114_0055201 | |||
| 1756 | Ga0496114_0055235 | |||
| 1757 | Ga0496115_0003823 | |||
| 1758 | Ga0496115_0009634 | |||
| 1759 | Ga0496116_0001473 | |||
| 1760 | Ga0496116_0008741 | |||
| 1761 | Ga0496116_0041734 | |||
| 1762 | Ga0496116_0097053 | |||
| 1763 | Ga0496117_0000121 | |||
| 1764 | Ga0496117_0005261 | |||
| 1765 | Ga0496117_0005816 | |||
| 1766 | Ga0496117_0010277 | |||
| 1767 | Ga0496117_0011270 | |||
| 1768 | Ga0496117_0020317 | |||
| 1769 | Ga0496117_0048689 | |||
| 1770 | Ga0496117_0062535 | |||
| 1771 | Ga0496118_0000095 | |||
| 1772 | Ga0496118_0003634 | |||
| 1773 | Ga0496118_0004347 | |||
| 1774 | Ga0496118_0005130 | |||
| 1775 | Ga0496118_0006175 | |||
| 1776 | Ga0496118_0007255 | |||
| 1777 | Ga0496118_0008390 | |||
| 1778 | Ga0496118_0029942 | |||
| 1779 | Ga0496118_0119532 | |||
| 1780 | Ga0496119_0012070 | |||
| 1781 | Ga0496119_0020493 | |||
| 1782 | Ga0496119_0034497 | |||
| 1783 | Ga0496119_0073860 | |||
| 1784 | Ga0496120_0007164 | |||
| 1785 | Ga0496121_0000067 | |||
| 1786 | Ga0496121_0000097 | |||
| 1787 | Ga0496121_0000098 | |||
| 1788 | Ga0496121_0000624 | |||
| 1789 | Ga0496121_0004401 | |||
| 1790 | Ga0496121_0006234 | |||
| 1791 | Ga0496121_0007968 | |||
| 1792 | Ga0496121_0029800 | |||
| 1793 | Ga0496122_0000092 | |||
| 1794 | Ga0496122_0001234 | |||
| 1795 | Ga0496122_0004452 | |||
| 1796 | Ga0496122_0004540 | |||
| 1797 | Ga0496122_0005467 | |||
| 1798 | Ga0496122_0005743 | |||
| 1799 | Ga0496122_0010593 | |||
| 1800 | Ga0496122_0012169 | |||
| 1801 | Ga0496122_0029147 | |||
| 1802 | Ga0496122_0032481 | |||
| 1803 | Ga0496122_0066270 | |||
| 1804 | Ga0496122_0070000 | |||
| 1805 | Ga0496123_0000028 | |||
| 1806 | Ga0496123_0000598 | |||
| 1807 | Ga0496123_0001346 | |||
| 1808 | Ga0496123_0002700 | |||
| 1809 | Ga0496123_0005386 | |||
| 1810 | Ga0496123_0006893 | |||
| 1811 | Ga0496123_0036538 | |||
| 1812 | Ga0496123_0042003 | |||
| 1813 | Ga0496123_0055407 | |||
| 1814 | Ga0496123_0095090 | |||
| 1815 | Ga0496124_0000119 | |||
| 1816 | Ga0496124_0000812 | |||
| 1817 | Ga0496124_0000873 | |||
| 1818 | Ga0496124_0018216 | |||
| 1819 | Ga0496124_0018404 | |||
| 1820 | Ga0496124_0019199 | |||
| 1821 | Ga0496124_0020785 | |||
| 1822 | Ga0496124_0045554 | |||
| 1823 | Ga0496124_0051057 | |||
| 1824 | Ga0496124_0063227 | |||
| 1825 | Ga0496124_0077237 | |||
| 1826 | Ga0496124_0125839 | |||
| 1827 | Ga0496125_0000038 | |||
| 1828 | Ga0496125_0001250 | |||
| 1829 | Ga0496125_0001903 | |||
| 1830 | Ga0496125_0005821 | |||
| 1831 | Ga0496125_0007696 | |||
| 1832 | Ga0496125_0020652 | |||
| 1833 | Ga0496125_0071493 | |||
| 1834 | Ga0496125_0100470 | |||
| 1835 | Ga0496125_0104213 | |||
| 1836 | Ga0496126_0000688 | |||
| 1837 | Ga0496126_0002234 | |||
| 1838 | Ga0496126_0004349 | |||
| 1839 | Ga0496126_0006740 | |||
| 1840 | Ga0496126_0022348 | |||
| 1841 | Ga0496126_0025214 | |||
| 1842 | Ga0496126_0084425 | |||
| 1843 | Ga0496126_0136434 | |||
| 1844 | Ga0495678_000032 | |||
| 1845 | Ga0495678_000081 | |||
| 1846 | Ga0495678_000583 | |||
| 1847 | Ga0495678_001014 | |||
| 1848 | Ga0495678_002176 | |||
| 1849 | Ga0495678_003272 | |||
| 1850 | Ga0495678_007623 | |||
| 1851 | Ga0495678_008247 | |||
| 1852 | Ga0495678_026617 | |||
| 1853 | Ga0495682_0000013 | |||
| 1854 | Ga0495682_0000150 | |||
| 1855 | Ga0495682_0000702 | |||
| 1856 | Ga0495682_0003894 | |||
| 1857 | Ga0495682_0007634 | |||
| 1858 | Ga0501249_000141 | |||
| 1859 | Ga0501249_000857 | |||
| 1860 | Ga0501257_013040 | |||
| 1861 | Ga0501266_000087 | |||
| 1862 | Ga0501269_000169 | |||
| 1863 | nmdc:mga03683_2471_c1 | |||
| 1864 | nmdc:mga03n38_2748_c1 | |||
| 1865 | nmdc:mga0k408_37235_c1 | |||
| 1866 | nmdc:mga06z11_8_c1 | |||
| 1867 | nmdc:mga04h51_8_c1 | |||
| 1868 | nmdc:mga07m45_13206_c1 | |||
| 1869 | nmdc:mga07m45_26754_c1 | |||
| 1870 | nmdc:mga0sz30_1693_c1 | |||
| 1871 | Ga0500578_0000234 | |||
| 1872 | Ga0500643_000503 | |||
| 1873 | Ga0500643_005015 | |||
| 1874 | Ga0500644_0000189 | |||
| 1875 | Ga0500647_0047334 | |||
| 1876 | Ga0500555_000799 | |||
| 1877 | Ga0500556_0001301 | |||
| 1878 | Ga0500594_0000022 | |||
| 1879 | Ga0500607_000035 | |||
| 1880 | Ga0500607_000058 | |||
| 1881 | Ga0500608_000076 | |||
| 1882 | Ga0500608_000400 | |||
| 1883 | Ga0500618_000066 | |||
| 1884 | Ga0500618_000430 | |||
| 1885 | Ga0500658_0013135 | |||
| 1886 | Ga0500559_0000058 | |||
| 1887 | Ga0500559_0001018 | |||
| 1888 | Ga0500559_0001082 | |||
| 1889 | Ga0500559_0002704 | |||
| 1890 | Ga0500559_0003584 | |||
| 1891 | Ga0500559_0005739 | |||
| 1892 | Ga0500559_0024248 | |||
| 1893 | Ga0500564_000059 | |||
| 1894 | Ga0500573_0000053 | |||
| 1895 | Ga0500573_0010835 | |||
| 1896 | Ga0500586_001720 | |||
| 1897 | Ga0500604_0005543 | |||
| 1898 | Ga0500622_0000047 | |||
| 1899 | Ga0500622_0005400 | |||
| 1900 | Ga0500622_0028425 | |||
| 1901 | Ga0500624_000017 | |||
| 1902 | Ga0500627_0001133 | |||
| 1903 | Ga0500627_0008343 | |||
| 1904 | Ga0500634_0022859 | |||
| 1905 | Ga0500567_001470 | |||
| 1906 | Ga0500611_000783 | |||
| 1907 | Ga0500625_000001 | |||
| 1908 | Ga0500645_000001 | |||
| 1909 | Ga0500645_000196 | |||
| 1910 | Ga0500645_001940 | |||
| 1911 | Ga0500645_004520 | |||
| 1912 | Ga0500645_006527 | |||
| 1913 | 2509074668 | |||
| 1914 | 2511120360 | |||
| 1915 | 2511253368 | |||
| 1916 | 2511269615 | |||
| 1917 | 2511280838 | |||
| 1918 | 2511324219 | |||
| 1919 | 2511359945 | |||
| 1920 | 2511433098 | |||
| 1921 | 2512326218 | |||
| 1922 | 2512642368 | |||
| 1923 | 2583792561 | |||
| 1924 | 2585149462 | |||
| 1925 | 2585153315 | |||
| 1926 | 2585197004 | |||
| 1927 | 2585563968 | |||
| 1928 | 2587917624 | |||
| 1929 | 2597864393 | |||
| 1930 | 2599399280 | |||
| 1931 | 2599453618 | |||
| 1932 | 2599510714 | |||
| 1933 | 2599513773 | |||
| 1934 | 2599518953 | |||
| 1935 | 2599880105 | |||
| 1936 | 2599892830 | |||
| 1937 | 2599947185 | |||
| 1938 | 2600021791 | |||
| 1939 | 2600030839 | |||
| 1940 | 2600075064 | |||
| 1941 | 2600200643 | |||
| 1942 | 2600360644 | |||
| 1943 | 2601625367 | |||
| 1944 | 2601691541 | |||
| 1945 | 2621300365 | |||
| 1946 | 2624491727 | |||
| 1947 | 2643778390 | |||
| 1948 | 2643924771 | |||
| 1949 | 2643927350 | |||
| 1950 | 2644001321 | |||
| 1951 | 2644063261 | |||
| 1952 | 2644071744 | |||
| 1953 | 2644620593 | |||
| 1954 | 2652543960 | |||
| 1955 | 2671126875 | |||
| 1956 | 2677899125 | |||
| 1957 | 2723248359 | |||
| 1958 | 2738675425 | |||
| 1959 | 2738753828 | |||
| 1960 | 2738806326 | |||
| 1961 | 2738829803 | |||
| 1962 | 2738862877 | |||
| 1963 | 2738893686 | |||
| 1964 | 2739153599 | |||
| 1965 | 2739195519 | |||
| 1966 | 2739246375 | |||
| 1967 | 2739321995 | |||
| 1968 | 2739340236 | |||
| 1969 | 2743737698 | |||
| 1970 | 2776914038 | |||
| 1971 | 2792462396 | |||
| 1972 | 2793184147 | |||
| 1973 | 2816475409 | |||
| 1974 | 2817490563 | |||
| 1975 | 2819537359 | |||
| 1976 | 2819646579 | |||
| 1977 | 2821131760 | |||
| 1978 | 2826585021 | |||
| 1979 | 2840764384 | |||
| 1980 | 2842827320 | |||
| 1981 | 2842841734 | |||
| 1982 | 2842850998 | |||
| 1983 | 2843748728 | |||
| 1984 | 2844322842 | |||
| 1985 | 2849565298 | |||
| 1986 | 2851156530 | |||
| 1987 | 2857507762 | |||
| 1988 | 2857555982 | |||
| 1989 | 2860870250 | |||
| 1990 | 2874173005 | |||
| 1991 | 2898330200 | |||
| 1992 | 2903734642 | |||
| 1993 | 2904115983 | |||
| 1994 | 2904425783 | |||
| 1995 | 2906605047 | |||
| 1996 | 2909401126 | |||
| 1997 | 2919141860 | |||
| 1998 | 2919710837 | |||
| 1999 | 2923156743 | |||
| 2000 | 2923588020 | |||
| 2001 | 2928533758 | |||
| 2002 | 2928961966 | |||
| 2003 | 2929192985 | |||
| 2004 | 2931374713 | |||
| 2005 | 2931394402 | |||
| 2006 | 2931401295 | |||
| 2007 | 2937838510 | |||
| 2008 | 2945962994 | |||
| 2009 | 2946010565 | |||
| 2010 | 2946030483 | |||
| 2011 | 2980184152 | |||
| 2012 | 2980185828 | |||
| 2013 | 3005602563 | |||
| 2014 | 3005726033 | |||
| 2015 | 3007396554 | |||
| 2016 | 3007873812 | |||
| 2017 | 8015690963 | |||
| 2018 | 8054286676 | |||
| 2019 | 8054304600 | |||
| 2020 | 8054347907 | |||
| 2021 | 8054506715 | |||
| 2022 | 8054797880 | |||
| 2023 | 8055774103 | |||
| 2024 | 8055820344 | |||
| 2025 | 8056134352 | |||
| 2026 | 8056139505 | |||
| 2027 | 8056179005 | |||
| 2028 | 8056536957 | |||
| 2029 | 8056976496 | |||
| 2030 | 8057473980 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1yw1-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis in complex with fmn | 0.9596 | 3 | 431 |
| 1tvl-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis | 0.9591 | 3 | 431 |
| 1yw1-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis in complex with fmn | 0.9572 | 3 | 431 |
| 1tvl-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis | 0.9543 | 3 | 431 |
| 3sdo-assembly1.cif.gz_B | structure of a nitrilotriacetate monooxygenase from burkholderia pseudomallei | 0.9492 | 4 | 436 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3sdoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9492 | 4 | 436 | 3.20.20.30 |
| 3sdoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9469 | 4 | 436 | 3.20.20.30 |
| 6aslA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9313 | 3 | 431 | 3.20.20.30 |
| 6aslA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9272 | 3 | 431 | 3.20.20.30 |
| 5tlcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8965 | 6 | 428 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F0FZG7-F1-model_v4 | Flavin-dependent oxidoreductase | 0.9929 | 12 | 159 |
GO:0016705
|
| AF-W1DL73-F1-model_v4 | Nitrilotriacetate monooxygenase component A (EC 1.14.13.-) | 0.9869 | 22 | 231 |
GO:0004497
GO:0016705 |
| AF-A0A7G2IVK8-F1-model_v4 | Nitrilotriacetate monooxygenase component A (EC 1.14.13.-) | 0.9868 | 23 | 181 |
GO:0004497
GO:0016705 |
| AF-W7YU60-F1-model_v4 | Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase | 0.9844 | 1 | 195 |
GO:0004497
GO:0016705 |
| AF-A0A529XC09-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9835 | 75 | 220 |
GO:0016705
|