F488247

General Info

Members Datasets Scaffolds Average Seq Length
1015 401 2030 50

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0346911|Ga0496124_0346911_202_381
Length 59
Sequence MAFNPGKEHHMHISQLALTPLISLIAGVLILVMPRLLNYIVALYLIVVGLLGLFPQLAG

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
101 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
138 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
142 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
143 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
213 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
214 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
232 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
233 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
234 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
239 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
240 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
241 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
252 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
253 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
254 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
255 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
256 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
257 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
258 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
259 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
260 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
261 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
262 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
263 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
268 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
279 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
280 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
281 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
282 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
285 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
286 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
289 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
290 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
291 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
292 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
293 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
297 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
304 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
326 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
327 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
328 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
329 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
330 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
331 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
332 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
333 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
334 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
335 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
336 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
360 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
363 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
376 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
377 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
378 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
379 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
380 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
381 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
382 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
383 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
384 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
385 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
388 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
389 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
390 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
391 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
392 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
393 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
394 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
395 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
396 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
397 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.5
Nodule 0.39
Rhizoplane 3.74
Rhizosphere 73.69
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0346911 3300048927 Bacteria 1052
2 JGI24740J21852_10013514 3300001979 Bacteria 3041
3 JGI24740J21852_10047535 3300001979 Bacteria 1252
4 JGI24739J22299_10002039 3300001989 Bacteria 7740
5 JGI24735J21928_10002948 3300002067 Bacteria 5851
6 JGI24735J21928_10040493 3300002067 Bacteria 1360
7 JGI25155J39150_1000285 3300002704 Bacteria 17934
8 JGI25156J39149_1000168 3300002705 Bacteria 47907
9 JGI25156J39149_1004985 3300002705 Bacteria 3921
10 JGI25156J39149_1014953 3300002705 Bacteria 1575
11 JGI25162J39368_1003783 3300002737 Bacteria 4036
12 JGI25154J39366_1000185 3300002738 Bacteria 47907
13 JGI25154J39366_1000245 3300002738 Bacteria 35470
14 JGI25157J39369_1000429 3300002741 Bacteria 27371
15 JGI25157J39369_1001872 3300002741 Bacteria 6455
16 JGI25165J46597_1000147 3300003214 Bacteria 116564
17 rootH1_10060681 3300003316 Bacteria 1897
18 JGI25160J50197_1042927 3300003354 Bacteria 1024
19 Ga0055532_1000050 3300003758 Bacteria 169240
20 Ga0055535_1008146 3300003761 Bacteria 1918
21 Ga0055529_1009834 3300003763 Bacteria 1248
22 Ga0055528_1052701 3300003790 Bacteria 811
23 Ga0055530_10008439 3300003791 Bacteria 4126
24 Ga0065165_1009352 3300005262 Bacteria 4407
25 Ga0065165_1103783 3300005262 Bacteria 708
26 Ga0065704_10223530 3300005289 Bacteria 1053
27 Ga0065704_10292439 3300005289 Bacteria 901
28 Ga0065707_10300891 3300005295 Bacteria 989
29 Ga0070658_10314433 3300005327 Bacteria 1337
30 Ga0070658_11172460 3300005327 Unclassified 668
31 Ga0070658_11255454 3300005327 Bacteria 644
32 Ga0070658_11335603 3300005327 Bacteria 622
33 Ga0070676_10504095 3300005328 Bacteria 860
34 Ga0070676_10544954 3300005328 Bacteria 830
35 Ga0070676_11449390 3300005328 Bacteria 528
36 Ga0070683_100517115 3300005329 Bacteria 1141
37 Ga0070683_100823835 3300005329 Bacteria 890
38 Ga0070690_100767971 3300005330 Bacteria 745
39 Ga0070690_101565610 3300005330 Bacteria 534
40 Ga0070670_100066337 3300005331 Bacteria 3097
41 Ga0070670_100371230 3300005331 Bacteria 1259
42 Ga0068869_100230828 3300005334 Bacteria 1470
43 Ga0068869_100373316 3300005334 Bacteria 1167
44 Ga0070666_10004869 3300005335 Bacteria 8206
45 Ga0070666_10250629 3300005335 Bacteria 1254
46 Ga0070682_100894205 3300005337 Bacteria 729
47 Ga0068868_100363275 3300005338 Bacteria 1242
48 Ga0068868_100399695 3300005338 Bacteria 1186
49 Ga0070660_100179601 3300005339 Bacteria 1712
50 Ga0070660_100920092 3300005339 Bacteria 738
51 Ga0070660_101873411 3300005339 Unclassified 511
52 Ga0070689_101003968 3300005340 Bacteria 742
53 Ga0070691_10077465 3300005341 Bacteria 1623
54 Ga0070691_10363956 3300005341 Bacteria 806
55 Ga0070691_10446418 3300005341 Bacteria 738
56 Ga0070691_11014139 3300005341 Bacteria 519
57 Ga0070687_100047222 3300005343 Bacteria 2208
58 Ga0070661_100046521 3300005344 Bacteria 3174
59 Ga0070661_100886922 3300005344 Bacteria 736
60 Ga0070661_101079581 3300005344 Bacteria 668
61 Ga0070692_10904175 3300005345 Bacteria 610
62 Ga0070668_100219865 3300005347 Bacteria 1566
63 Ga0070668_100294462 3300005347 Bacteria 1359
64 Ga0070668_100382004 3300005347 Bacteria 1199
65 Ga0070668_100908346 3300005347 Bacteria 787
66 Ga0070669_100262145 3300005353 Bacteria 1379
67 Ga0070669_100753245 3300005353 Bacteria 825
68 Ga0070669_100850399 3300005353 Bacteria 777
69 Ga0070669_101702996 3300005353 Bacteria 549
70 Ga0070675_100049484 3300005354 Bacteria 3450
71 Ga0070675_100269594 3300005354 Bacteria 1493
72 Ga0070675_100942679 3300005354 Bacteria 792
73 Ga0070675_101080373 3300005354 Bacteria 737
74 Ga0070671_100442975 3300005355 Bacteria 1114
75 Ga0070674_100287186 3300005356 Bacteria 1306
76 Ga0070674_100412160 3300005356 Bacteria 1107
77 Ga0070674_102115227 3300005356 Bacteria 513
78 Ga0070673_100421894 3300005364 Bacteria 1196
79 Ga0070673_100947910 3300005364 Bacteria 800
80 Ga0070688_100070462 3300005365 Bacteria 2235
81 Ga0070659_100349804 3300005366 Bacteria 1239
82 Ga0070659_100376180 3300005366 Bacteria 1196
83 Ga0070659_101440702 3300005366 Bacteria 613
84 Ga0070659_101461581 3300005366 Bacteria 608
85 Ga0070667_100014791 3300005367 Bacteria 6447
86 Ga0070667_100037624 3300005367 Bacteria 4057
87 Ga0070667_100220162 3300005367 Bacteria 1689
88 Ga0070667_100414315 3300005367 Bacteria 1228
89 Ga0070667_100516892 3300005367 Bacteria 1095
90 Ga0070667_101498056 3300005367 Bacteria 633
91 Ga0070714_100020874 3300005435 Bacteria 5354
92 Ga0070714_100161864 3300005435 Bacteria 2025
93 Ga0070714_100221090 3300005435 Bacteria 1740
94 Ga0070714_101733893 3300005435 Bacteria 610
95 Ga0070713_100021206 3300005436 Bacteria 4993
96 Ga0070711_100462835 3300005439 Bacteria 1040
97 Ga0070700_100054334 3300005441 Bacteria 2502
98 Ga0070700_101345854 3300005441 Bacteria 602
99 Ga0070694_100038566 3300005444 Bacteria 3175
100 Ga0070694_100531411 3300005444 Bacteria 939
101 Ga0070663_100023376 3300005455 Bacteria 4142
102 Ga0070663_100031241 3300005455 Bacteria 3659
103 Ga0070663_100158000 3300005455 Bacteria 1743
104 Ga0070663_100244805 3300005455 Bacteria 1417
105 Ga0070663_100256293 3300005455 Bacteria 1386
106 Ga0070663_100287791 3300005455 Bacteria 1311
107 Ga0070663_100289085 3300005455 Bacteria 1309
108 Ga0070663_100711292 3300005455 Bacteria 855
109 Ga0070663_100725075 3300005455 Bacteria 847
110 Ga0070663_101417682 3300005455 Bacteria 616
111 Ga0070663_101836544 3300005455 Bacteria 544
112 Ga0070663_101863546 3300005455 Bacteria 540
113 Ga0070678_100186469 3300005456 Bacteria 1702
114 Ga0070678_100204119 3300005456 Bacteria 1633
115 Ga0070678_100884653 3300005456 Bacteria 816
116 Ga0070678_100898688 3300005456 Bacteria 809
117 Ga0070678_100943929 3300005456 Bacteria 790
118 Ga0070678_101255587 3300005456 Bacteria 688
119 Ga0070662_100005114 3300005457 Bacteria 8361
120 Ga0070681_11087527 3300005458 Bacteria 720
121 Ga0070706_100018724 3300005467 Bacteria 6384
122 Ga0070706_100623902 3300005467 Bacteria 1001
123 Ga0070698_100054973 3300005471 Bacteria 4040
124 Ga0070698_100067072 3300005471 Unclassified 3610
125 Ga0070698_101296037 3300005471 Bacteria 678
126 Ga0070699_100585868 3300005518 Bacteria 1017
127 Ga0070684_100524449 3300005535 Bacteria 1098
128 Ga0070697_101840214 3300005536 Bacteria 542
129 Ga0068853_100029492 3300005539 Bacteria 4626
130 Ga0068853_100319291 3300005539 Bacteria 1439
131 Ga0068853_100341109 3300005539 Bacteria 1392
132 Ga0068853_100381560 3300005539 Bacteria 1316
133 Ga0068853_100703249 3300005539 Bacteria 964
134 Ga0068853_100727705 3300005539 Bacteria 947
135 Ga0068853_100951970 3300005539 Bacteria 826
136 Ga0068853_101209781 3300005539 Bacteria 729
137 Ga0068853_101680477 3300005539 Bacteria 615
138 Ga0068853_102366403 3300005539 Bacteria 514
139 Ga0070672_101702862 3300005543 Bacteria 566
140 Ga0070695_100085770 3300005545 Bacteria 2091
141 Ga0070695_100351489 3300005545 Bacteria 1104
142 Ga0070695_101777788 3300005545 Bacteria 517
143 Ga0070693_100499626 3300005547 Bacteria 862
144 Ga0070665_100000778 3300005548 Bacteria 41953
145 Ga0070665_100001771 3300005548 Bacteria 24595
146 Ga0070665_100021841 3300005548 Bacteria 6436
147 Ga0070665_100050498 3300005548 Bacteria 4173
148 Ga0070665_100171044 3300005548 Bacteria 2174
149 Ga0070665_100190059 3300005548 Bacteria 2054
150 Ga0070665_100227245 3300005548 Bacteria 1866
151 Ga0070665_100439706 3300005548 Bacteria 1313
152 Ga0070665_102113295 3300005548 Bacteria 568
153 Ga0068855_100018720 3300005563 Bacteria 8326
154 Ga0068855_100387978 3300005563 Bacteria 1532
155 Ga0068855_100697493 3300005563 Bacteria 1087
156 Ga0068855_101283159 3300005563 Bacteria 759
157 Ga0068855_101426752 3300005563 Bacteria 713
158 Ga0070664_100140986 3300005564 Bacteria 2122
159 Ga0070664_100229728 3300005564 Bacteria 1663
160 Ga0070664_101117259 3300005564 Bacteria 743
161 Ga0070664_101754108 3300005564 Bacteria 589
162 Ga0068854_100156413 3300005578 Bacteria 1762
163 Ga0068854_101058707 3300005578 Bacteria 721
164 Ga0068854_101536123 3300005578 Bacteria 605
165 Ga0068856_100028271 3300005614 Bacteria 5475
166 Ga0068856_100138824 3300005614 Bacteria 2437
167 Ga0068856_100385836 3300005614 Bacteria 1420
168 Ga0068856_100408509 3300005614 Bacteria 1377
169 Ga0068856_100504705 3300005614 Bacteria 1231
170 Ga0068856_100790700 3300005614 Bacteria 968
171 Ga0068856_101154138 3300005614 Bacteria 791
172 Ga0068852_100143206 3300005616 Bacteria 2214
173 Ga0068852_100289998 3300005616 Bacteria 1580
174 Ga0068852_100746806 3300005616 Bacteria 990
175 Ga0068852_100756000 3300005616 Bacteria 984
176 Ga0068852_101033037 3300005616 Bacteria 841
177 Ga0068852_101274626 3300005616 Bacteria 756
178 Ga0068859_100069591 3300005617 Bacteria 3554
179 Ga0068859_100069885 3300005617 Bacteria 3547
180 Ga0068859_101799198 3300005617 Bacteria 677
181 Ga0068864_100528729 3300005618 Bacteria 1138
182 Ga0068864_101001603 3300005618 Bacteria 829
183 Ga0068864_102445082 3300005618 Bacteria 529
184 Ga0068861_100159665 3300005719 Bacteria 1858
185 Ga0068861_100759481 3300005719 Bacteria 906
186 Ga0068861_101082105 3300005719 Bacteria 770
187 Ga0068861_102694114 3300005719 Bacteria 501
188 Ga0068851_10011579 3300005834 Bacteria 4139
189 Ga0068851_10256520 3300005834 Bacteria 993
190 Ga0068851_10761710 3300005834 Bacteria 599
191 Ga0068851_10951395 3300005834 Bacteria 540
192 Ga0068870_10463712 3300005840 Bacteria 837
193 Ga0068863_100008576 3300005841 Bacteria 9990
194 Ga0068863_100316694 3300005841 Bacteria 1515
195 Ga0068863_101348929 3300005841 Bacteria 720
196 Ga0068863_102199813 3300005841 Bacteria 561
197 Ga0068858_100002518 3300005842 Bacteria 18454
198 Ga0068858_100008681 3300005842 Bacteria 9755
199 Ga0068858_102506059 3300005842 Bacteria 509
200 Ga0068860_100064420 3300005843 Bacteria 3481
201 Ga0068860_100228673 3300005843 Bacteria 1807
202 Ga0068860_100393836 3300005843 Bacteria 1369
203 Ga0068860_101024800 3300005843 Bacteria 844
204 Ga0068860_102276117 3300005843 Bacteria 562
205 Ga0068860_102769293 3300005843 Bacteria 508
206 Ga0068862_100005681 3300005844 Bacteria 10409
207 Ga0068862_100359643 3300005844 Bacteria 1352
208 Ga0068862_100373904 3300005844 Bacteria 1327
209 Ga0068862_100737249 3300005844 Bacteria 957
210 Ga0068862_101011478 3300005844 Bacteria 822
211 Ga0081538_10056531 3300005981 Bacteria 2297
212 Ga0070717_10356939 3300006028 Bacteria 1308
213 Ga0070717_10579511 3300006028 Bacteria 1017
214 Ga0075365_10008054 3300006038 Bacteria 5951
215 Ga0075365_10019410 3300006038 Bacteria 4195
216 Ga0075365_10042042 3300006038 Bacteria 2987
217 Ga0075365_10050844 3300006038 Bacteria 2735
218 Ga0075365_10136515 3300006038 Bacteria 1700
219 Ga0075365_10219305 3300006038 Bacteria 1334
220 Ga0075365_10366096 3300006038 Bacteria 1016
221 Ga0075368_10010145 3300006042 Bacteria 3403
222 Ga0075368_10059835 3300006042 Bacteria 1524
223 Ga0075368_10084686 3300006042 Bacteria 1292
224 Ga0075368_10357698 3300006042 Bacteria 636
225 Ga0075363_100016696 3300006048 Bacteria 3630
226 Ga0075363_100048225 3300006048 Bacteria 2264
227 Ga0075363_100109067 3300006048 Bacteria 1537
228 Ga0075363_100164697 3300006048 Bacteria 1257
229 Ga0075363_100255157 3300006048 Bacteria 1010
230 Ga0075363_100767230 3300006048 Bacteria 585
231 Ga0075364_10013967 3300006051 Bacteria 4949
232 Ga0075364_10081007 3300006051 Bacteria 2146
233 Ga0075364_10144673 3300006051 Bacteria 1600
234 Ga0075364_10686839 3300006051 Bacteria 699
235 Ga0070716_100262904 3300006173 Bacteria 1182
236 Ga0070712_100489010 3300006175 Bacteria 1030
237 Ga0075362_10034290 3300006177 Bacteria 2212
238 Ga0075362_10043133 3300006177 Bacteria 1996
239 Ga0075362_10047661 3300006177 Bacteria 1909
240 Ga0075362_10081871 3300006177 Bacteria 1489
241 Ga0075362_10094100 3300006177 Bacteria 1394
242 Ga0075362_10210340 3300006177 Bacteria 949
243 Ga0075367_10010494 3300006178 Bacteria 4868
244 Ga0075367_10030565 3300006178 Bacteria 3088
245 Ga0075367_10059422 3300006178 Bacteria 2276
246 Ga0075367_10080622 3300006178 Bacteria 1968
247 Ga0075367_10132711 3300006178 Bacteria 1540
248 Ga0075367_10326650 3300006178 Bacteria 967
249 Ga0075367_10432529 3300006178 Bacteria 833
250 Ga0075367_10519804 3300006178 Bacteria 755
251 Ga0075367_10751006 3300006178 Bacteria 621
252 Ga0075369_10014365 3300006186 Bacteria 3162
253 Ga0075369_10015191 3300006186 Bacteria 3087
254 Ga0075369_10207810 3300006186 Bacteria 904
255 Ga0075366_10043033 3300006195 Bacteria 2675
256 Ga0075366_10131825 3300006195 Bacteria 1508
257 Ga0075366_10883572 3300006195 Bacteria 557
258 Ga0097621_100263485 3300006237 Bacteria 1513
259 Ga0097621_101110566 3300006237 Bacteria 743
260 Ga0097621_101845026 3300006237 Bacteria 577
261 Ga0097621_101872621 3300006237 Bacteria 572
262 Ga0075370_10007676 3300006353 Bacteria 5508
263 Ga0075370_10082152 3300006353 Bacteria 1852
264 Ga0075370_10200649 3300006353 Bacteria 1177
265 Ga0075370_10384002 3300006353 Bacteria 841
266 Ga0068871_100640227 3300006358 Bacteria 970
267 Ga0068871_101116781 3300006358 Bacteria 737
268 Ga0068871_102006879 3300006358 Bacteria 551
269 Ga0075428_100044800 3300006844 Bacteria 4861
270 Ga0075428_100066058 3300006844 Bacteria 3961
271 Ga0075428_101572210 3300006844 Bacteria 688
272 Ga0075430_100921741 3300006846 Bacteria 720
273 Ga0075430_101408962 3300006846 Bacteria 573
274 Ga0075431_100149210 3300006847 Bacteria 2408
275 Ga0075431_100204554 3300006847 Bacteria 2019
276 Ga0075433_10845724 3300006852 Bacteria 799
277 Ga0075429_100001760 3300006880 Bacteria 17924
278 Ga0075429_100568100 3300006880 Bacteria 994
279 Ga0068865_100505232 3300006881 Bacteria 1008
280 Ga0068865_100756977 3300006881 Bacteria 835
281 Ga0068865_101013723 3300006881 Bacteria 727
282 Ga0068865_101100683 3300006881 Bacteria 700
283 Ga0097620_100069591 3300006931 Bacteria 3554
284 Ga0097620_100069885 3300006931 Bacteria 3547
285 Ga0097620_101799161 3300006931 Bacteria 677
286 Ga0079104_1000056 3300006946 Bacteria 166276
287 Ga0099826_10157999 3300006948 Bacteria 1288
288 Ga0105251_10001596 3300009011 Bacteria 19332
289 Ga0105244_10269823 3300009036 Bacteria 790
290 Ga0105250_10112457 3300009092 Bacteria 1116
291 Ga0105250_10212425 3300009092 Bacteria 818
292 Ga0105250_10283495 3300009092 Bacteria 713
293 Ga0105240_10008179 3300009093 Bacteria 14996
294 Ga0105240_10059150 3300009093 Bacteria 4784
295 Ga0105240_10061454 3300009093 Bacteria 4681
296 Ga0105240_10127106 3300009093 Bacteria 3062
297 Ga0105240_10519837 3300009093 Bacteria 1321
298 Ga0105240_10757023 3300009093 Bacteria 1055
299 Ga0105240_10762312 3300009093 Bacteria 1051
300 Ga0105240_11107972 3300009093 Bacteria 842
301 Ga0105240_11111977 3300009093 Bacteria 840
302 Ga0105240_11497022 3300009093 Bacteria 708
303 Ga0105240_11904074 3300009093 Bacteria 619
304 Ga0105240_11967403 3300009093 Bacteria 608
305 Ga0105240_12300583 3300009093 Bacteria 558
306 Ga0105240_12371562 3300009093 Unclassified 549
307 Ga0111539_10619587 3300009094 Bacteria 1260
308 Ga0111539_10739501 3300009094 Bacteria 1145
309 Ga0105245_10440947 3300009098 Bacteria 1309
310 Ga0105245_10707052 3300009098 Bacteria 1041
311 Ga0105245_12451026 3300009098 Bacteria 575
312 Ga0105247_10083289 3300009101 Bacteria 2020
313 Ga0105247_10448093 3300009101 Bacteria 930
314 Ga0105247_10942533 3300009101 Bacteria 670
315 Ga0105247_11002055 3300009101 Bacteria 652
316 Ga0105247_11750672 3300009101 Bacteria 515
317 Ga0114129_10005806 3300009147 Bacteria 17476
318 Ga0114129_10451997 3300009147 Bacteria 1685
319 Ga0105243_10301244 3300009148 Bacteria 1453
320 Ga0105243_11420752 3300009148 Bacteria 715
321 Ga0105243_11691615 3300009148 Bacteria 661
322 Ga0105243_12610887 3300009148 Bacteria 545
323 Ga0105241_10081072 3300009174 Bacteria 2541
324 Ga0105241_10253459 3300009174 Bacteria 1493
325 Ga0105241_11211629 3300009174 Unclassified 715
326 Ga0105241_11354902 3300009174 Bacteria 680
327 Ga0105241_11461227 3300009174 Bacteria 656
328 Ga0105241_12008479 3300009174 Bacteria 569
329 Ga0105241_12483104 3300009174 Bacteria 519
330 Ga0105242_10086392 3300009176 Bacteria 2632
331 Ga0105248_10074394 3300009177 Bacteria 3818
332 Ga0105248_10173347 3300009177 Bacteria 2431
333 Ga0105248_10703108 3300009177 Bacteria 1140
334 Ga0105248_12077331 3300009177 Bacteria 646
335 Ga0105237_10009094 3300009545 Bacteria 10676
336 Ga0105237_10138333 3300009545 Bacteria 2430
337 Ga0105237_10381952 3300009545 Bacteria 1413
338 Ga0105237_10473466 3300009545 Bacteria 1258
339 Ga0105237_10799817 3300009545 Bacteria 950
340 Ga0105237_10947979 3300009545 Bacteria 867
341 Ga0105237_11106922 3300009545 Bacteria 799
342 Ga0105237_11295390 3300009545 Bacteria 735
343 Ga0105237_11980845 3300009545 Bacteria 591
344 Ga0105238_10003517 3300009551 Bacteria 15606
345 Ga0105238_10052215 3300009551 Bacteria 4110
346 Ga0105238_10122725 3300009551 Bacteria 2577
347 Ga0105238_10191520 3300009551 Bacteria 2021
348 Ga0105238_10254791 3300009551 Bacteria 1734
349 Ga0105238_10282932 3300009551 Bacteria 1640
350 Ga0105238_10291740 3300009551 Bacteria 1613
351 Ga0105238_12250467 3300009551 Unclassified 580
352 Ga0105238_12982749 3300009551 Bacteria 509
353 Ga0105249_10092339 3300009553 Bacteria 2834
354 Ga0105249_10098527 3300009553 Bacteria 2746
355 Ga0105249_10391235 3300009553 Bacteria 1418
356 Ga0105249_11867444 3300009553 Bacteria 673
357 Ga0105249_13359691 3300009553 Bacteria 515
358 Ga0105239_10099609 3300010375 Bacteria 3213
359 Ga0105239_10118616 3300010375 Bacteria 2936
360 Ga0105239_10158197 3300010375 Bacteria 2531
361 Ga0105239_10164361 3300010375 Bacteria 2481
362 Ga0105239_10171834 3300010375 Bacteria 2424
363 Ga0105239_10181533 3300010375 Bacteria 2355
364 Ga0105239_10209027 3300010375 Bacteria 2187
365 Ga0105239_10267037 3300010375 Bacteria 1924
366 Ga0105239_10335177 3300010375 Bacteria 1707
367 Ga0105239_10436143 3300010375 Bacteria 1485
368 Ga0105239_10540272 3300010375 Bacteria 1327
369 Ga0105239_10729445 3300010375 Bacteria 1134
370 Ga0105239_10759015 3300010375 Bacteria 1110
371 Ga0105239_11388705 3300010375 Bacteria 811
372 Ga0105239_11599131 3300010375 Bacteria 754
373 Ga0105239_11626254 3300010375 Bacteria 747
374 Ga0105239_13094065 3300010375 Bacteria 542
375 Ga0105246_10217503 3300011119 Bacteria 1495
376 Ga0105246_10529946 3300011119 Bacteria 1006
377 Ga0105246_11262369 3300011119 Bacteria 683
378 Ga0105246_11439485 3300011119 Bacteria 644
379 Ga0157338_1036967 3300012515 Bacteria 649
380 Ga0157373_10093661 3300013100 Bacteria 2116
381 Ga0157371_11198026 3300013102 Bacteria 585
382 Ga0157370_10180720 3300013104 Bacteria 1960
383 Ga0157370_10220044 3300013104 Bacteria 1759
384 Ga0157369_10171634 3300013105 Bacteria 2285
385 Ga0157369_10497695 3300013105 Bacteria 1261
386 Ga0157369_10783890 3300013105 Bacteria 980
387 Ga0157369_10791152 3300013105 Bacteria 975
388 Ga0157369_10967080 3300013105 Bacteria 872
389 Ga0157374_10051579 3300013296 Bacteria 3829
390 Ga0157374_10076369 3300013296 Bacteria 3168
391 Ga0157374_10193082 3300013296 Bacteria 1992
392 Ga0157374_10279860 3300013296 Bacteria 1647
393 Ga0157378_10146986 3300013297 Bacteria 2193
394 Ga0157378_11134251 3300013297 Bacteria 820
395 Ga0157378_11250949 3300013297 Bacteria 782
396 Ga0163162_10001141 3300013306 Bacteria 24740
397 Ga0163162_10139381 3300013306 Bacteria 2537
398 Ga0163162_10218040 3300013306 Bacteria 2038
399 Ga0163162_10686908 3300013306 Bacteria 1146
400 Ga0163162_10711412 3300013306 Bacteria 1126
401 Ga0163162_11585151 3300013306 Bacteria 747
402 Ga0157372_10494947 3300013307 Bacteria 1425
403 Ga0157372_12018395 3300013307 Bacteria 663
404 Ga0157372_12240842 3300013307 Bacteria 627
405 Ga0157375_10764093 3300013308 Bacteria 1117
406 Ga0157375_11849920 3300013308 Bacteria 716
407 Ga0157375_12814828 3300013308 Bacteria 581
408 Ga0163163_10151077 3300014325 Bacteria 2366
409 Ga0163163_10942931 3300014325 Bacteria 926
410 Ga0163163_11149683 3300014325 Bacteria 839
411 Ga0157380_10441108 3300014326 Bacteria 1248
412 Ga0157380_10977078 3300014326 Bacteria 878
413 Ga0157380_12210898 3300014326 Bacteria 614
414 Ga0182008_10006567 3300014497 Bacteria 6492
415 Ga0182008_10249686 3300014497 Bacteria 915
416 Ga0157377_10648699 3300014745 Bacteria 759
417 Ga0157377_11732632 3300014745 Bacteria 505
418 Ga0157379_10362897 3300014968 Bacteria 1328
419 Ga0157379_10513640 3300014968 Bacteria 1111
420 Ga0157379_10617552 3300014968 Bacteria 1013
421 Ga0157379_12208812 3300014968 Bacteria 547
422 Ga0157376_10080368 3300014969 Bacteria 2796
423 Ga0157376_10852888 3300014969 Bacteria 926
424 Ga0157376_10877451 3300014969 Bacteria 914
425 Ga0157376_10975918 3300014969 Bacteria 869
426 Ga0157376_11410968 3300014969 Bacteria 728
427 Ga0157376_12423676 3300014969 Unclassified 564
428 Ga0182006_1061542 3300015261 Bacteria 1415
429 Ga0182006_1178185 3300015261 Bacteria 710
430 Ga0163161_10109379 3300017792 Bacteria 2065
431 Ga0163161_10110584 3300017792 Bacteria 2054
432 Ga0163161_10580314 3300017792 Bacteria 922
433 Ga0209435_100029 3300025206 Bacteria 176358
434 Ga0209435_100195 3300025206 Bacteria 17815
435 Ga0209435_110508 3300025206 Bacteria 1002
436 Ga0209147_100004 3300025229 Bacteria 1371850
437 Ga0209437_100053 3300025233 Bacteria 375580
438 Ga0209258_100396 3300025242 Bacteria 54877
439 Ga0209646_1000073 3300025246 Bacteria 224301
440 Ga0209646_1000109 3300025246 Bacteria 158348
441 Ga0209646_1037415 3300025246 Bacteria 625
442 Ga0209026_1000050 3300025250 Bacteria 254994
443 Ga0209026_1000124 3300025250 Bacteria 125673
444 Ga0209026_1003015 3300025250 Bacteria 5811
445 Ga0209026_1035417 3300025250 Bacteria 732
446 Ga0209026_1062093 3300025250 Bacteria 524
447 Ga0209148_1000032 3300025254 Bacteria 557660
448 Ga0209759_1000108 3300025256 Bacteria 146393
449 Ga0209759_1000706 3300025256 Bacteria 29792
450 Ga0209759_1000891 3300025256 Bacteria 22544
451 Ga0209759_1051238 3300025256 Bacteria 634
452 Ga0209233_1000034 3300025261 Bacteria 578898
453 Ga0209233_1012371 3300025261 Bacteria 2477
454 Ga0209233_1060313 3300025261 Bacteria 734
455 Ga0209455_1014667 3300025272 Bacteria 1762
456 Ga0209673_1001490 3300025273 Bacteria 21797
457 Ga0209673_1080125 3300025273 Bacteria 751
458 Ga0209675_1045396 3300025291 Bacteria 935
459 Ga0209758_1008143 3300025297 Bacteria 6890
460 Ga0209050_1000202 3300025298 Bacteria 133468
461 Ga0209050_1006802 3300025298 Bacteria 6657
462 Ga0209256_1000049 3300025299 Bacteria 310696
463 Ga0207426_1002546 3300025302 Bacteria 11425
464 Ga0209051_1011287 3300025303 Bacteria 4425
465 Ga0207697_10416142 3300025315 Bacteria 597
466 Ga0207656_10112723 3300025321 Bacteria 1258
467 Ga0207656_10235560 3300025321 Bacteria 893
468 Ga0207656_10397757 3300025321 Bacteria 692
469 Ga0207656_10427162 3300025321 Bacteria 668
470 Ga0207696_1100059 3300025711 Bacteria 790
471 Ga0207655_1231614 3300025728 Bacteria 533
472 Ga0207713_1003598 3300025735 Bacteria 10451
473 Ga0207642_10252153 3300025899 Bacteria 1002
474 Ga0207710_10088493 3300025900 Bacteria 1446
475 Ga0207710_10144651 3300025900 Bacteria 1150
476 Ga0207710_10333561 3300025900 Bacteria 770
477 Ga0207688_10350052 3300025901 Bacteria 910
478 Ga0207688_10983844 3300025901 Bacteria 533
479 Ga0207680_10147902 3300025903 Bacteria 1564
480 Ga0207680_10404237 3300025903 Bacteria 965
481 Ga0207647_10002871 3300025904 Bacteria 12977
482 Ga0207647_10140070 3300025904 Bacteria 1418
483 Ga0207647_10157711 3300025904 Bacteria 1325
484 Ga0207647_10167001 3300025904 Bacteria 1282
485 Ga0207647_10290538 3300025904 Bacteria 932
486 Ga0207647_10343297 3300025904 Bacteria 846
487 Ga0207647_10423436 3300025904 Bacteria 748
488 Ga0207645_10514842 3300025907 Bacteria 811
489 Ga0207643_10042620 3300025908 Bacteria 2559
490 Ga0207705_10074750 3300025909 Bacteria 2460
491 Ga0207684_10021192 3300025910 Bacteria 5550
492 Ga0207684_10235133 3300025910 Bacteria 1581
493 Ga0207654_10000942 3300025911 Bacteria 15994
494 Ga0207654_10035690 3300025911 Bacteria 2772
495 Ga0207654_10050624 3300025911 Bacteria 2388
496 Ga0207654_10097988 3300025911 Bacteria 1801
497 Ga0207654_10464192 3300025911 Bacteria 890
498 Ga0207695_10004636 3300025913 Bacteria 18634
499 Ga0207695_10044260 3300025913 Bacteria 4735
500 Ga0207695_10063100 3300025913 Bacteria 3820
501 Ga0207695_10068811 3300025913 Bacteria 3626
502 Ga0207695_10241541 3300025913 Bacteria 1707
503 Ga0207695_10426029 3300025913 Bacteria 1211
504 Ga0207695_10616805 3300025913 Bacteria 966
505 Ga0207695_10854637 3300025913 Bacteria 790
506 Ga0207695_11040740 3300025913 Unclassified 698
507 Ga0207671_10052890 3300025914 Bacteria 3010
508 Ga0207671_10180471 3300025914 Bacteria 1643
509 Ga0207671_10835395 3300025914 Bacteria 730
510 Ga0207671_10858431 3300025914 Bacteria 719
511 Ga0207671_11052088 3300025914 Bacteria 640
512 Ga0207693_10156578 3300025915 Bacteria 1792
513 Ga0207662_10475311 3300025918 Bacteria 858
514 Ga0207657_10121959 3300025919 Bacteria 2144
515 Ga0207649_10827859 3300025920 Bacteria 723
516 Ga0207649_11109882 3300025920 Bacteria 624
517 Ga0207681_10221538 3300025923 Bacteria 1464
518 Ga0207681_10779388 3300025923 Bacteria 798
519 Ga0207681_10986082 3300025923 Bacteria 707
520 Ga0207694_10114041 3300025924 Bacteria 2152
521 Ga0207694_10175086 3300025924 Bacteria 1739
522 Ga0207694_10563001 3300025924 Bacteria 957
523 Ga0207694_10904764 3300025924 Bacteria 746
524 Ga0207694_10949165 3300025924 Bacteria 727
525 Ga0207650_10049617 3300025925 Bacteria 3100
526 Ga0207650_10529854 3300025925 Bacteria 986
527 Ga0207650_10624944 3300025925 Bacteria 907
528 Ga0207659_10035830 3300025926 Bacteria 3433
529 Ga0207659_11225866 3300025926 Bacteria 645
530 Ga0207659_11571856 3300025926 Bacteria 562
531 Ga0207687_11165520 3300025927 Bacteria 662
532 Ga0207687_11653120 3300025927 Bacteria 549
533 Ga0207664_10129489 3300025929 Bacteria 2123
534 Ga0207644_11793311 3300025931 Bacteria 513
535 Ga0207690_10685398 3300025932 Bacteria 842
536 Ga0207690_10756531 3300025932 Bacteria 801
537 Ga0207690_11210805 3300025932 Bacteria 631
538 Ga0207690_11263468 3300025932 Bacteria 617
539 Ga0207706_10001802 3300025933 Bacteria 21049
540 Ga0207706_10302853 3300025933 Bacteria 1392
541 Ga0207706_10632786 3300025933 Bacteria 917
542 Ga0207686_10281454 3300025934 Bacteria 1228
543 Ga0207709_11305995 3300025935 Bacteria 600
544 Ga0207669_10089611 3300025937 Bacteria 1998
545 Ga0207669_10280034 3300025937 Bacteria 1257
546 Ga0207669_10761588 3300025937 Bacteria 800
547 Ga0207704_10099540 3300025938 Bacteria 1934
548 Ga0207704_10657184 3300025938 Bacteria 864
549 Ga0207704_10900818 3300025938 Bacteria 744
550 Ga0207704_11021919 3300025938 Bacteria 700
551 Ga0207665_10208107 3300025939 Bacteria 1428
552 Ga0207691_10116511 3300025940 Bacteria 2371
553 Ga0207691_10970442 3300025940 Bacteria 710
554 Ga0207711_10062500 3300025941 Bacteria 3212
555 Ga0207711_10113619 3300025941 Bacteria 2411
556 Ga0207711_10413166 3300025941 Bacteria 1254
557 Ga0207689_10162491 3300025942 Bacteria 1840
558 Ga0207689_10636036 3300025942 Bacteria 898
559 Ga0207689_10800584 3300025942 Bacteria 796
560 Ga0207679_10203273 3300025945 Bacteria 1656
561 Ga0207679_10285030 3300025945 Bacteria 1418
562 Ga0207679_10868108 3300025945 Bacteria 824
563 Ga0207667_10041465 3300025949 Bacteria 4895
564 Ga0207667_10080924 3300025949 Bacteria 3365
565 Ga0207667_10124951 3300025949 Bacteria 2650
566 Ga0207667_10246887 3300025949 Bacteria 1826
567 Ga0207651_10109903 3300025960 Bacteria 2067
568 Ga0207712_10000286 3300025961 Bacteria 48199
569 Ga0207712_10102427 3300025961 Bacteria 2131
570 Ga0207712_10282290 3300025961 Bacteria 1356
571 Ga0207712_10752865 3300025961 Bacteria 853
572 Ga0207712_12135776 3300025961 Bacteria 501
573 Ga0207668_10058070 3300025972 Bacteria 2702
574 Ga0207668_10634649 3300025972 Bacteria 933
575 Ga0207668_10823577 3300025972 Bacteria 823
576 Ga0207668_10938668 3300025972 Bacteria 771
577 Ga0207640_10334562 3300025981 Bacteria 1211
578 Ga0207640_11206571 3300025981 Bacteria 673
579 Ga0207640_11782461 3300025981 Bacteria 556
580 Ga0207658_10017165 3300025986 Bacteria 4986
581 Ga0207658_10019417 3300025986 Bacteria 4700
582 Ga0207658_10121969 3300025986 Bacteria 2080
583 Ga0207658_10675122 3300025986 Bacteria 932
584 Ga0207658_11037226 3300025986 Bacteria 748
585 Ga0207677_10506838 3300026023 Bacteria 1044
586 Ga0207703_10002368 3300026035 Bacteria 16400
587 Ga0207703_10005498 3300026035 Bacteria 10186
588 Ga0207703_11395769 3300026035 Bacteria 674
589 Ga0207639_10001087 3300026041 Bacteria 18462
590 Ga0207639_10055044 3300026041 Bacteria 3043
591 Ga0207639_10167800 3300026041 Bacteria 1856
592 Ga0207639_10261893 3300026041 Bacteria 1513
593 Ga0207639_10265260 3300026041 Bacteria 1504
594 Ga0207639_10342719 3300026041 Bacteria 1333
595 Ga0207639_10615886 3300026041 Bacteria 1002
596 Ga0207678_10005043 3300026067 Bacteria 11847
597 Ga0207678_10025302 3300026067 Bacteria 5182
598 Ga0207678_10068252 3300026067 Bacteria 3051
599 Ga0207678_10082193 3300026067 Bacteria 2756
600 Ga0207678_10159219 3300026067 Bacteria 1928
601 Ga0207678_10229319 3300026067 Bacteria 1590
602 Ga0207678_10260325 3300026067 Bacteria 1487
603 Ga0207678_10291214 3300026067 Bacteria 1402
604 Ga0207678_10631644 3300026067 Bacteria 940
605 Ga0207678_10706969 3300026067 Bacteria 887
606 Ga0207678_10864583 3300026067 Bacteria 799
607 Ga0207678_11262943 3300026067 Bacteria 654
608 Ga0207678_11282106 3300026067 Bacteria 648
609 Ga0207708_10550510 3300026075 Bacteria 973
610 Ga0207708_11149689 3300026075 Bacteria 678
611 Ga0207702_10020035 3300026078 Bacteria 5543
612 Ga0207702_10094264 3300026078 Bacteria 2627
613 Ga0207702_10102388 3300026078 Bacteria 2531
614 Ga0207702_10124196 3300026078 Bacteria 2314
615 Ga0207702_10289519 3300026078 Bacteria 1551
616 Ga0207702_10481096 3300026078 Bacteria 1208
617 Ga0207641_10000702 3300026088 Bacteria 36039
618 Ga0207641_11005709 3300026088 Bacteria 830
619 Ga0207641_11344920 3300026088 Bacteria 715
620 Ga0207648_10511798 3300026089 Bacteria 1099
621 Ga0207648_10561872 3300026089 Bacteria 1049
622 Ga0207676_10185626 3300026095 Bacteria 1825
623 Ga0207674_10826329 3300026116 Bacteria 894
624 Ga0207675_100682955 3300026118 Bacteria 1035
625 Ga0207683_10093051 3300026121 Bacteria 2686
626 Ga0207683_10161505 3300026121 Bacteria 2026
627 Ga0207683_10217267 3300026121 Bacteria 1741
628 Ga0207683_10364050 3300026121 Bacteria 1328
629 Ga0207683_12020586 3300026121 Bacteria 525
630 Ga0207698_10339836 3300026142 Bacteria 1414
631 Ga0207698_10340571 3300026142 Bacteria 1412
632 Ga0207698_10466812 3300026142 Bacteria 1222
633 Ga0207698_11138772 3300026142 Bacteria 793
634 Ga0207698_11277228 3300026142 Bacteria 749
635 Ga0209281_1000125 3300027111 Bacteria 200371
636 Ga0209282_1159044 3300027666 Bacteria 1082
637 Ga0209813_10042291 3300027866 Bacteria 1392
638 Ga0209813_10411684 3300027866 Bacteria 547
639 Ga0209974_10336904 3300027876 Bacteria 583
640 Ga0207428_10474748 3300027907 Bacteria 910
641 Ga0268266_10000007 3300028379 Bacteria 1372921
642 Ga0268266_10001711 3300028379 Bacteria 25121
643 Ga0268266_10002582 3300028379 Bacteria 19210
644 Ga0268266_10013394 3300028379 Bacteria 7063
645 Ga0268266_10052877 3300028379 Bacteria 3489
646 Ga0268266_10215044 3300028379 Bacteria 1764
647 Ga0268266_10264158 3300028379 Bacteria 1596
648 Ga0268266_10276694 3300028379 Bacteria 1560
649 Ga0268266_11789772 3300028379 Bacteria 589
650 Ga0268265_10011961 3300028380 Bacteria 5872
651 Ga0268265_10060136 3300028380 Bacteria 2910
652 Ga0268265_10293536 3300028380 Bacteria 1460
653 Ga0268265_10350717 3300028380 Bacteria 1347
654 Ga0268265_10366679 3300028380 Bacteria 1320
655 Ga0268265_10421317 3300028380 Bacteria 1239
656 Ga0268264_10000375 3300028381 Bacteria 65683
657 Ga0268264_11457193 3300028381 Bacteria 695
658 Ga0268264_11533885 3300028381 Bacteria 677
659 Ga0268264_11543635 3300028381 Bacteria 675
660 Ga0268264_11640070 3300028381 Bacteria 654
661 Ga0307517_10157202 3300028786 Unclassified 1538
662 Ga0307515_10213160 3300028794 Bacteria 1770
663 Ga0307515_10373703 3300028794 Bacteria 1061
664 Ga0265760_10346975 3300031090 Bacteria 531
665 Ga0265330_10472371 3300031235 Bacteria 533
666 Ga0265316_10403623 3300031344 Bacteria 984
667 Ga0307513_10000121 3300031456 Bacteria 109551
668 Ga0307513_10454646 3300031456 Bacteria 1004
669 Ga0307513_10503613 3300031456 Unclassified 928
670 Ga0307408_100051176 3300031548 Bacteria 2974
671 Ga0307408_100274192 3300031548 Bacteria 1402
672 Ga0307508_10509540 3300031616 Bacteria 799
673 Ga0307508_10553188 3300031616 Bacteria 749
674 Ga0265314_10643553 3300031711 Bacteria 541
675 Ga0307516_10002590 3300031730 Bacteria 24022
676 Ga0307516_10107182 3300031730 Bacteria 2603
677 Ga0307516_10487987 3300031730 Bacteria 887
678 Ga0307405_11566839 3300031731 Bacteria 580
679 Ga0307405_11983046 3300031731 Unclassified 521
680 Ga0307413_10221922 3300031824 Bacteria 1381
681 Ga0307413_10290712 3300031824 Bacteria 1234
682 Ga0307413_10425752 3300031824 Bacteria 1047
683 Ga0307410_10467495 3300031852 Bacteria 1032
684 Ga0307410_11824187 3300031852 Bacteria 540
685 Ga0307406_10000135 3300031901 Bacteria 43972
686 Ga0307406_10083585 3300031901 Bacteria 2129
687 Ga0307406_10714645 3300031901 Bacteria 838
688 Ga0307407_10554041 3300031903 Bacteria 850
689 Ga0307407_11289045 3300031903 Bacteria 573
690 Ga0307412_10649076 3300031911 Bacteria 900
691 Ga0307412_10758187 3300031911 Bacteria 838
692 Ga0307412_11221729 3300031911 Bacteria 674
693 Ga0307412_12268184 3300031911 Bacteria 506
694 Ga0307409_100093371 3300031995 Bacteria 2472
695 Ga0307409_102760842 3300031995 Bacteria 519
696 Ga0307416_100055412 3300032002 Bacteria 3193
697 Ga0307416_100103487 3300032002 Bacteria 2486
698 Ga0307416_100356145 3300032002 Bacteria 1483
699 Ga0307414_10151785 3300032004 Bacteria 1829
700 Ga0307411_10074054 3300032005 Bacteria 2319
701 Ga0307411_10366901 3300032005 Bacteria 1179
702 Ga0307415_100147801 3300032126 Bacteria 1804
703 Ga0307415_101624461 3300032126 Bacteria 621
704 Ga0307415_101642738 3300032126 Bacteria 618
705 Ga0307510_10000001 3300033180 Bacteria 1172244
706 Ga0307510_10416343 3300033180 Bacteria 786
707 Ga0373941_0268881 3300035115 Bacteria 671
708 Ga0373960_0313034 3300035121 Bacteria 587
709 Ga0372808_031413 3300036459 Bacteria 762
710 Ga0373925_1348402 3300037068 Bacteria 585
711 Ga0395899_0001320 3300037312 Bacteria 21369
712 Ga0395899_0077287 3300037312 Bacteria 2428
713 Ga0395899_0292198 3300037312 Bacteria 1105
714 Ga0395900_0063330 3300037418 Bacteria 3801
715 Ga0395900_0080559 3300037418 Bacteria 3346
716 Ga0395900_0140821 3300037418 Bacteria 2470
717 Ga0395900_0193173 3300037418 Bacteria 2064
718 Ga0395900_0606959 3300037418 Bacteria 1034
719 Ga0395898_0129537 3300037466 Bacteria 2417
720 Ga0395898_0903223 3300037466 Bacteria 821
721 Ga0395905_0017216 3300037471 Bacteria 6865
722 Ga0395905_0082683 3300037471 Bacteria 3009
723 Ga0395905_0142672 3300037471 Bacteria 2253
724 Ga0395905_0373161 3300037471 Bacteria 1320
725 Ga0395905_0750857 3300037471 Bacteria 878
726 Ga0395905_1463581 3300037471 Bacteria 587
727 Ga0395901_0012451 3300038443 Bacteria 8633
728 Ga0395901_0128021 3300038443 Bacteria 2669
729 Ga0395901_0128937 3300038443 Bacteria 2658
730 Ga0395901_0259946 3300038443 Bacteria 1807
731 Ga0395901_0673417 3300038443 Bacteria 1035
732 Ga0395901_0678497 3300038443 Bacteria 1030
733 Ga0436361_0582197 3300039447 Bacteria 1003
734 Ga0436361_1152275 3300039447 Bacteria 616
735 Ga0436361_1209085 3300039447 Unclassified 547
736 Ga0436363_0335585 3300039450 Bacteria 588
737 Ga0436363_1712487 3300039450 Bacteria 1382
738 Ga0451789_0699448 3300041443 Bacteria 578
739 Ga0451791_1322022 3300041451 Bacteria 817
740 Ga0451797_0765934 3300041453 Bacteria 514
741 Ga0451795_0778622 3300041456 Bacteria 677
742 Ga0451798_1024392 3300041458 Bacteria 647
743 Ga0451802_0028054 3300041460 Bacteria 585
744 Ga0451807_1395372 3300041486 Bacteria 728
745 Ga0451807_1424292 3300041486 Bacteria 1059
746 Ga0451833_0278061 3300041491 Bacteria 1228
747 Ga0451837_0136122 3300041494 Bacteria 540
748 Ga0451837_1562523 3300041494 Bacteria 569
749 Ga0451837_1750542 3300041494 Bacteria 552
750 Ga0451841_0543752 3300041498 Bacteria 523
751 Ga0451845_0714657 3300041501 Bacteria 503
752 Ga0451853_1863186 3300041512 Bacteria 504
753 Ga0451853_2014640 3300041512 Bacteria 792
754 Ga0451853_2303321 3300041512 Bacteria 673
755 Ga0451853_3343357 3300041512 Bacteria 543
756 Ga0450900_070252 3300042136 Bacteria 555
757 Ga0466972_0015806 3300044658 Bacteria 3773
758 Ga0466972_0158797 3300044658 Bacteria 1062
759 Ga0466972_0462217 3300044658 Bacteria 596
760 Ga0466966_0162359 3300044684 Bacteria 1360
761 Ga0466961_0832242 3300044693 Bacteria 550
762 Ga0466963_0180843 3300044694 Bacteria 1472
763 Ga0466968_0178091 3300044735 Bacteria 988
764 Ga0466957_0707196 3300044842 Bacteria 711
765 Ga0466960_0015562 3300044901 Bacteria 3281
766 Ga0466959_0138528 3300045049 Bacteria 1721
767 Ga0466958_0136574 3300045836 Bacteria 1542
768 Ga0495590_0011663 3300046457 Bacteria 3282
769 Ga0495580_0035215 3300046472 Bacteria 3600
770 Ga0495605_0076541 3300046474 Bacteria 1571
771 Ga0495585_0167869 3300046492 Bacteria 1135
772 Ga0495594_0152315 3300046499 Bacteria 1313
773 Ga0495596_0255550 3300046500 Bacteria 680
774 Ga0495606_0090373 3300046507 Bacteria 1885
775 Ga0495606_0532206 3300046507 Bacteria 588
776 Ga0495606_0558899 3300046507 Unclassified 568
777 Ga0495620_0063158 3300046515 Bacteria 1536
778 Ga0495620_0289251 3300046515 Bacteria 623
779 Ga0495630_0640351 3300046517 Bacteria 814
780 Ga0495631_0230041 3300046518 Bacteria 791
781 Ga0495632_0128243 3300046519 Bacteria 1182
782 Ga0495632_0303925 3300046519 Bacteria 707
783 Ga0495643_0186616 3300046522 Bacteria 1004
784 Ga0495643_0196006 3300046522 Bacteria 972
785 Ga0495643_0350809 3300046522 Bacteria 661
786 Ga0495648_0187270 3300046524 Unclassified 1047
787 Ga0495648_0512882 3300046524 Bacteria 512
788 Ga0495663_0037129 3300046525 Bacteria 1468
789 Ga0495666_0039580 3300046526 Bacteria 2288
790 Ga0495642_0225414 3300046528 Bacteria 818
791 Ga0495665_0292850 3300046531 Bacteria 834
792 Ga0495609_0464035 3300046538 Bacteria 502
793 Ga0495597_0159457 3300046542 Bacteria 921
794 Ga0495645_0096835 3300046543 Bacteria 2102
795 Ga0495633_0350884 3300046558 Bacteria 668
796 Ga0495634_0211403 3300046642 Bacteria 1201
797 Ga0495611_0138254 3300046648 Bacteria 1137
798 Ga0495625_0002652 3300046660 Bacteria 19076
799 Ga0495625_0171020 3300046660 Bacteria 1451
800 Ga0495625_0497612 3300046660 Bacteria 746
801 Ga0495588_0270199 3300046674 Bacteria 896
802 Ga0495599_0207120 3300046678 Bacteria 1204
803 Ga0495623_0090213 3300046679 Bacteria 1882
804 Ga0495624_0080889 3300046690 Bacteria 2013
805 Ga0495624_0833692 3300046690 Bacteria 544
806 Ga0495670_0006980 3300046691 Bacteria 5565
807 Ga0495670_0103497 3300046691 Bacteria 1468
808 Ga0495649_0229977 3300046694 Bacteria 957
809 Ga0495649_0355223 3300046694 Bacteria 740
810 Ga0495660_0201499 3300046810 Bacteria 950
811 Ga0495636_0166326 3300047318 Bacteria 995
812 Ga0495687_010536 3300047443 Bacteria 5063
813 Ga0495687_053816 3300047443 Bacteria 1693
814 Ga0495677_0217048 3300047445 Bacteria 745
815 Ga0495681_0082998 3300047470 Bacteria 1427
816 Ga0495686_0100077 3300047472 Bacteria 1749
817 Ga0495686_0211033 3300047472 Bacteria 1109
818 Ga0495686_0236703 3300047472 Bacteria 1031
819 Ga0495686_0238201 3300047472 Bacteria 1027
820 Ga0495686_0340068 3300047472 Bacteria 818
821 Ga0495593_0026405 3300047673 Bacteria 3207
822 Ga0495602_0734669 3300048088 Bacteria 667
823 Ga0496100_0143738 3300048903 Bacteria 1694
824 Ga0496102_0237931 3300048905 Bacteria 1717
825 Ga0496102_0582595 3300048905 Bacteria 1042
826 Ga0496102_0603027 3300048905 Bacteria 1021
827 Ga0496102_0609196 3300048905 Bacteria 1015
828 Ga0496102_0823480 3300048905 Bacteria 850
829 Ga0496102_1197689 3300048905 Bacteria 679
830 Ga0496103_0330136 3300048906 Bacteria 981
831 Ga0496103_0392709 3300048906 Bacteria 891
832 Ga0496103_0572233 3300048906 Bacteria 720
833 Ga0496103_0758974 3300048906 Bacteria 613
834 Ga0496104_0254658 3300048907 Bacteria 1668
835 Ga0496104_0670317 3300048907 Bacteria 946
836 Ga0496104_0896937 3300048907 Bacteria 792
837 Ga0496105_0915586 3300048908 Bacteria 660
838 Ga0496106_1174352 3300048909 Bacteria 599
839 Ga0496107_0971821 3300048910 Bacteria 617
840 Ga0496110_0345184 3300048913 Bacteria 1356
841 Ga0496110_0389745 3300048913 Bacteria 1270
842 Ga0496110_0811729 3300048913 Bacteria 840
843 Ga0496112_0534093 3300048915 Bacteria 1107
844 Ga0496112_0674996 3300048915 Bacteria 962
845 Ga0496112_0923917 3300048915 Bacteria 794
846 Ga0496113_0232009 3300048916 Bacteria 1472
847 Ga0496113_0328191 3300048916 Bacteria 1227
848 Ga0496113_1453958 3300048916 Bacteria 530
849 Ga0496114_0007282 3300048917 Bacteria 8734
850 Ga0496114_0522183 3300048917 Bacteria 1050
851 Ga0496114_0573759 3300048917 Bacteria 996
852 Ga0496115_0289106 3300048918 Bacteria 1345
853 Ga0496116_0003419 3300048919 Bacteria 15693
854 Ga0496117_0268786 3300048920 Bacteria 920
855 Ga0496118_0185063 3300048921 Bacteria 1253
856 Ga0496119_0008928 3300048922 Bacteria 8707
857 Ga0496119_0061788 3300048922 Bacteria 2235
858 Ga0496119_0089279 3300048922 Bacteria 1755
859 Ga0496119_0452284 3300048922 Bacteria 605
860 Ga0496119_0558548 3300048922 Bacteria 525
861 Ga0496120_0000104 3300048923 Bacteria 140731
862 Ga0496120_0000455 3300048923 Bacteria 64606
863 Ga0496120_0134647 3300048923 Bacteria 1261
864 Ga0496120_0206465 3300048923 Bacteria 948
865 Ga0496120_0274723 3300048923 Bacteria 781
866 Ga0496120_0442601 3300048923 Bacteria 567
867 Ga0496121_0004934 3300048924 Bacteria 17501
868 Ga0496121_0293030 3300048924 Bacteria 1108
869 Ga0496121_0365369 3300048924 Bacteria 957
870 Ga0496121_0457284 3300048924 Bacteria 821
871 Ga0496121_0774082 3300048924 Bacteria 567
872 Ga0496122_0000472 3300048925 Bacteria 83803
873 Ga0496122_0049301 3300048925 Bacteria 3227
874 Ga0496122_0258255 3300048925 Bacteria 969
875 Ga0496123_0000361 3300048926 Bacteria 85609
876 Ga0496124_0000108 3300048927 Bacteria 167473
877 Ga0496124_0099925 3300048927 Bacteria 2352
878 Ga0496125_0000424 3300048928 Bacteria 78587
879 Ga0496125_0013473 3300048928 Bacteria 8033
880 Ga0496125_0027239 3300048928 Bacteria 5185
881 Ga0496125_0043904 3300048928 Bacteria 3788
882 Ga0496125_0052760 3300048928 Bacteria 3341
883 Ga0496125_0110752 3300048928 Bacteria 1989
884 Ga0496125_0615608 3300048928 Bacteria 590
885 Ga0496125_0749497 3300048928 Bacteria 512
886 Ga0496126_0116420 3300048929 Bacteria 2323
887 Ga0496126_0120695 3300048929 Bacteria 2274
888 Ga0496126_0303753 3300048929 Bacteria 1315
889 Ga0496126_0487172 3300048929 Bacteria 987
890 Ga0495682_0189213 3300049460 Bacteria 731
891 Ga0501300_019362 3300049523 Bacteria 994
892 Ga0501031_0005336 3300049568 Bacteria 8371
893 Ga0501031_1087203 3300049568 Bacteria 510
894 Ga0501032_0000067 3300049569 Bacteria 89910
895 Ga0501032_0409610 3300049569 Bacteria 870
896 Ga0501032_0636923 3300049569 Bacteria 677
897 Ga0501032_1054198 3300049569 Bacteria 510
898 Ga0501033_0000117 3300049570 Bacteria 75935
899 Ga0501033_0075134 3300049570 Bacteria 2480
900 Ga0501033_0280842 3300049570 Bacteria 1175
901 Ga0501034_0000153 3300049571 Bacteria 129892
902 Ga0501034_0062525 3300049571 Bacteria 3738
903 Ga0501036_0008779 3300049572 Bacteria 8296
904 Ga0501036_0040926 3300049572 Bacteria 3921
905 Ga0501037_0000081 3300049573 Bacteria 86623
906 Ga0501038_0000033 3300049574 Bacteria 129840
907 Ga0501038_0079637 3300049574 Bacteria 2762
908 Ga0501039_0000031 3300049575 Bacteria 129814
909 Ga0501039_0523466 3300049575 Bacteria 931
910 Ga0501043_0000009 3300049579 Bacteria 214823
911 Ga0501043_0000044 3300049579 Bacteria 114304
912 Ga0501043_0038431 3300049579 Bacteria 3763
913 Ga0501046_0000022 3300049580 Bacteria 215451
914 Ga0501046_0083687 3300049580 Bacteria 2462
915 Ga0501046_0085538 3300049580 Bacteria 2431
916 Ga0501047_0000021 3300049581 Bacteria 254841
917 Ga0501047_0159538 3300049581 Bacteria 2127
918 Ga0501047_0341253 3300049581 Bacteria 1335
919 Ga0501047_1039152 3300049581 Bacteria 632
920 Ga0501048_0000311 3300049582 Bacteria 33197
921 Ga0501048_0198999 3300049582 Bacteria 1420
922 Ga0501068_0947563 3300049584 Bacteria 567
923 Ga0501070_0388710 3300049586 Bacteria 1129
924 Ga0501070_0997363 3300049586 Bacteria 650
925 Ga0501073_0172446 3300049589 Bacteria 1497
926 Ga0501073_0304222 3300049589 Bacteria 1100
927 Ga0501076_0221660 3300049592 Bacteria 1546
928 Ga0501080_0067730 3300049742 Bacteria 3320
929 Ga0501083_0101224 3300049744 Bacteria 1900
930 Ga0501083_0172642 3300049744 Bacteria 1413
931 Ga0501280_006305 3300049776 Bacteria 1675
932 Ga0501035_0000472 3300049822 Bacteria 45098
933 Ga0501035_0110226 3300049822 Bacteria 2412
934 Ga0501044_0014405 3300049823 Bacteria 8538
935 Ga0501044_0439552 3300049823 Bacteria 1212
936 Ga0501044_0472110 3300049823 Bacteria 1158
937 Ga0501044_0475613 3300049823 Bacteria 1153
938 Ga0501045_0041678 3300049824 Bacteria 3341
939 nmdc:mga03683_271346_c1 3300050489 Bacteria 791
940 nmdc:mga03683_29779_c1 3300050489 Bacteria 2180
941 nmdc:mga03n38_103058_c1 3300050490 Bacteria 1379
942 nmdc:mga03n38_155457_c1 3300050490 Bacteria 1154
943 nmdc:mga03n38_53598_c1 3300050490 Bacteria 1809
944 nmdc:mga00v17_144100_c1 3300050491 Bacteria 1529
945 nmdc:mga00v17_21915_c1 3300050491 Bacteria 3680
946 nmdc:mga00v17_672799_c1 3300050491 Bacteria 665
947 nmdc:mga00v17_81391_c1 3300050491 Bacteria 2022
948 nmdc:mga00v17_84199_c1 3300050491 Bacteria 1990
949 nmdc:mga0yw44_159047_c1 3300050492 Bacteria 1478
950 nmdc:mga0yw44_253999_c1 3300050492 Bacteria 1171
951 nmdc:mga0yw44_256489_c1 3300050492 Bacteria 1165
952 nmdc:mga0yw44_3044_c1 3300050492 Bacteria 7334
953 nmdc:mga0yw44_438721_c1 3300050492 Bacteria 885
954 nmdc:mga0yw44_44151_c1 3300050492 Bacteria 2665
955 nmdc:mga0yw44_47931_c1 3300050492 Bacteria 2574
956 nmdc:mga0yw44_54408_c1 3300050492 Bacteria 2432
957 nmdc:mga0k408_142381_c1 3300050493 Bacteria 1427
958 nmdc:mga0k408_434742_c1 3300050493 Bacteria 780
959 nmdc:mga0k408_547213_c1 3300050493 Bacteria 684
960 nmdc:mga0k408_636169_c1 3300050493 Bacteria 628
961 nmdc:mga06z11_13238_c1 3300050494 Bacteria 3615
962 nmdc:mga06z11_178799_c1 3300050494 Bacteria 1222
963 nmdc:mga06z11_290636_c1 3300050494 Bacteria 970
964 nmdc:mga06z11_389451_c1 3300050494 Bacteria 838
965 nmdc:mga06z11_415692_c1 3300050494 Bacteria 810
966 nmdc:mga04h51_304655_c1 3300050495 Bacteria 650
967 nmdc:mga04h51_69223_c1 3300050495 Bacteria 1228
968 nmdc:mga07m45_264384_c1 3300050496 Bacteria 1001
969 nmdc:mga07m45_32868_c1 3300050496 Bacteria 2878
970 nmdc:mga07m45_332704_c1 3300050496 Bacteria 883
971 nmdc:mga07m45_751787_c1 3300050496 Bacteria 560
972 nmdc:mga05p37_397580_c1 3300050507 Bacteria 1610
973 nmdc:mga05p37_56596_c1 3300050507 Bacteria 4829
974 nmdc:mga09592_142_c2 3300050508 Bacteria 23737
975 nmdc:mga0qj67_1135337_c1 3300050509 Bacteria 609
976 nmdc:mga06r32_187262_c1 3300050510 Bacteria 2057
977 nmdc:mga06r32_192796_c1 3300050510 Bacteria 2025
978 nmdc:mga08y16_2132907_c1 3300050511 Bacteria 508
979 nmdc:mga0a205_388080_c2 3300050515 Bacteria 878
980 nmdc:mga0sz30_36074_c1 3300050516 Bacteria 2066
981 Ga0495601_0343647 3300053077 Bacteria 971
982 Ga0500610_0012946 3300053079 Bacteria 3861
983 Ga0500610_0192265 3300053079 Bacteria 990
984 Ga0495655_0032605 3300053083 Bacteria 1276
985 Ga0500578_0000327 3300053086 Bacteria 57988
986 Ga0500646_0012843 3300053090 Bacteria 2166
987 Ga0500583_0023535 3300053092 Bacteria 2598
988 Ga0500566_0530955 3300053094 Bacteria 502
989 Ga0500641_0003956 3300053096 Bacteria 5237
990 Ga0500641_0010765 3300053096 Bacteria 3312
991 Ga0500650_0383878 3300053098 Bacteria 610
992 Ga0500654_152786 3300053099 Bacteria 806
993 Ga0500556_0067354 3300053104 Bacteria 1331
994 Ga0500594_0021092 3300053118 Bacteria 1631
995 Ga0500595_013715 3300053119 Bacteria 3099
996 Ga0500595_041988 3300053119 Bacteria 1467
997 Ga0500595_192134 3300053119 Bacteria 564
998 Ga0500559_0235384 3300053136 Unclassified 863
999 Ga0500568_0021526 3300053139 Bacteria 2772
1000 Ga0500568_0286850 3300053139 Bacteria 598
1001 Ga0500589_178529 3300053147 Bacteria 836
1002 Ga0500590_173236 3300053148 Unclassified 946
1003 Ga0500604_0029850 3300053151 Bacteria 1592
1004 Ga0500604_0265557 3300053151 Bacteria 594
1005 Ga0500620_010708 3300053155 Bacteria 2428
1006 Ga0500620_098708 3300053155 Bacteria 1021
1007 Ga0500627_0146894 3300053158 Bacteria 1065
1008 Ga0500611_022925 3300053727 Bacteria 1210
1009 Ga0500645_082862 3300053730 Bacteria 914
1010 Ga0500587_032830 3300053739 Bacteria 719
1011 Ga0587073_0284930 3300059492 Bacteria 532
1012 Ga0587106_128633 3300059605 Bacteria 545
1013 Ga0587072_154827 3300059643 Bacteria 556
1014 Ga0587114_093791 3300059655 Bacteria 576
1015 Ga0501082_1098539 3300060353 Bacteria 695
1016 Ga0496124_0346911
1017 JGI24740J21852_10013514
1018 JGI24740J21852_10047535
1019 JGI24739J22299_10002039
1020 JGI24735J21928_10002948
1021 JGI24735J21928_10040493
1022 JGI25155J39150_1000285
1023 JGI25156J39149_1000168
1024 JGI25156J39149_1004985
1025 JGI25156J39149_1014953
1026 JGI25162J39368_1003783
1027 JGI25154J39366_1000185
1028 JGI25154J39366_1000245
1029 JGI25157J39369_1000429
1030 JGI25157J39369_1001872
1031 JGI25165J46597_1000147
1032 rootH1_10060681
1033 JGI25160J50197_1042927
1034 Ga0055532_1000050
1035 Ga0055535_1008146
1036 Ga0055529_1009834
1037 Ga0055528_1052701
1038 Ga0055530_10008439
1039 Ga0065165_1009352
1040 Ga0065165_1103783
1041 Ga0065704_10223530
1042 Ga0065704_10292439
1043 Ga0065707_10300891
1044 Ga0070658_10314433
1045 Ga0070658_11172460
1046 Ga0070658_11255454
1047 Ga0070658_11335603
1048 Ga0070676_10504095
1049 Ga0070676_10544954
1050 Ga0070676_11449390
1051 Ga0070683_100517115
1052 Ga0070683_100823835
1053 Ga0070690_100767971
1054 Ga0070690_101565610
1055 Ga0070670_100066337
1056 Ga0070670_100371230
1057 Ga0068869_100230828
1058 Ga0068869_100373316
1059 Ga0070666_10004869
1060 Ga0070666_10250629
1061 Ga0070682_100894205
1062 Ga0068868_100363275
1063 Ga0068868_100399695
1064 Ga0070660_100179601
1065 Ga0070660_100920092
1066 Ga0070660_101873411
1067 Ga0070689_101003968
1068 Ga0070691_10077465
1069 Ga0070691_10363956
1070 Ga0070691_10446418
1071 Ga0070691_11014139
1072 Ga0070687_100047222
1073 Ga0070661_100046521
1074 Ga0070661_100886922
1075 Ga0070661_101079581
1076 Ga0070692_10904175
1077 Ga0070668_100219865
1078 Ga0070668_100294462
1079 Ga0070668_100382004
1080 Ga0070668_100908346
1081 Ga0070669_100262145
1082 Ga0070669_100753245
1083 Ga0070669_100850399
1084 Ga0070669_101702996
1085 Ga0070675_100049484
1086 Ga0070675_100269594
1087 Ga0070675_100942679
1088 Ga0070675_101080373
1089 Ga0070671_100442975
1090 Ga0070674_100287186
1091 Ga0070674_100412160
1092 Ga0070674_102115227
1093 Ga0070673_100421894
1094 Ga0070673_100947910
1095 Ga0070688_100070462
1096 Ga0070659_100349804
1097 Ga0070659_100376180
1098 Ga0070659_101440702
1099 Ga0070659_101461581
1100 Ga0070667_100014791
1101 Ga0070667_100037624
1102 Ga0070667_100220162
1103 Ga0070667_100414315
1104 Ga0070667_100516892
1105 Ga0070667_101498056
1106 Ga0070714_100020874
1107 Ga0070714_100161864
1108 Ga0070714_100221090
1109 Ga0070714_101733893
1110 Ga0070713_100021206
1111 Ga0070711_100462835
1112 Ga0070700_100054334
1113 Ga0070700_101345854
1114 Ga0070694_100038566
1115 Ga0070694_100531411
1116 Ga0070663_100023376
1117 Ga0070663_100031241
1118 Ga0070663_100158000
1119 Ga0070663_100244805
1120 Ga0070663_100256293
1121 Ga0070663_100287791
1122 Ga0070663_100289085
1123 Ga0070663_100711292
1124 Ga0070663_100725075
1125 Ga0070663_101417682
1126 Ga0070663_101836544
1127 Ga0070663_101863546
1128 Ga0070678_100186469
1129 Ga0070678_100204119
1130 Ga0070678_100884653
1131 Ga0070678_100898688
1132 Ga0070678_100943929
1133 Ga0070678_101255587
1134 Ga0070662_100005114
1135 Ga0070681_11087527
1136 Ga0070706_100018724
1137 Ga0070706_100623902
1138 Ga0070698_100054973
1139 Ga0070698_100067072
1140 Ga0070698_101296037
1141 Ga0070699_100585868
1142 Ga0070684_100524449
1143 Ga0070697_101840214
1144 Ga0068853_100029492
1145 Ga0068853_100319291
1146 Ga0068853_100341109
1147 Ga0068853_100381560
1148 Ga0068853_100703249
1149 Ga0068853_100727705
1150 Ga0068853_100951970
1151 Ga0068853_101209781
1152 Ga0068853_101680477
1153 Ga0068853_102366403
1154 Ga0070672_101702862
1155 Ga0070695_100085770
1156 Ga0070695_100351489
1157 Ga0070695_101777788
1158 Ga0070693_100499626
1159 Ga0070665_100000778
1160 Ga0070665_100001771
1161 Ga0070665_100021841
1162 Ga0070665_100050498
1163 Ga0070665_100171044
1164 Ga0070665_100190059
1165 Ga0070665_100227245
1166 Ga0070665_100439706
1167 Ga0070665_102113295
1168 Ga0068855_100018720
1169 Ga0068855_100387978
1170 Ga0068855_100697493
1171 Ga0068855_101283159
1172 Ga0068855_101426752
1173 Ga0070664_100140986
1174 Ga0070664_100229728
1175 Ga0070664_101117259
1176 Ga0070664_101754108
1177 Ga0068854_100156413
1178 Ga0068854_101058707
1179 Ga0068854_101536123
1180 Ga0068856_100028271
1181 Ga0068856_100138824
1182 Ga0068856_100385836
1183 Ga0068856_100408509
1184 Ga0068856_100504705
1185 Ga0068856_100790700
1186 Ga0068856_101154138
1187 Ga0068852_100143206
1188 Ga0068852_100289998
1189 Ga0068852_100746806
1190 Ga0068852_100756000
1191 Ga0068852_101033037
1192 Ga0068852_101274626
1193 Ga0068859_100069591
1194 Ga0068859_100069885
1195 Ga0068859_101799198
1196 Ga0068864_100528729
1197 Ga0068864_101001603
1198 Ga0068864_102445082
1199 Ga0068861_100159665
1200 Ga0068861_100759481
1201 Ga0068861_101082105
1202 Ga0068861_102694114
1203 Ga0068851_10011579
1204 Ga0068851_10256520
1205 Ga0068851_10761710
1206 Ga0068851_10951395
1207 Ga0068870_10463712
1208 Ga0068863_100008576
1209 Ga0068863_100316694
1210 Ga0068863_101348929
1211 Ga0068863_102199813
1212 Ga0068858_100002518
1213 Ga0068858_100008681
1214 Ga0068858_102506059
1215 Ga0068860_100064420
1216 Ga0068860_100228673
1217 Ga0068860_100393836
1218 Ga0068860_101024800
1219 Ga0068860_102276117
1220 Ga0068860_102769293
1221 Ga0068862_100005681
1222 Ga0068862_100359643
1223 Ga0068862_100373904
1224 Ga0068862_100737249
1225 Ga0068862_101011478
1226 Ga0081538_10056531
1227 Ga0070717_10356939
1228 Ga0070717_10579511
1229 Ga0075365_10008054
1230 Ga0075365_10019410
1231 Ga0075365_10042042
1232 Ga0075365_10050844
1233 Ga0075365_10136515
1234 Ga0075365_10219305
1235 Ga0075365_10366096
1236 Ga0075368_10010145
1237 Ga0075368_10059835
1238 Ga0075368_10084686
1239 Ga0075368_10357698
1240 Ga0075363_100016696
1241 Ga0075363_100048225
1242 Ga0075363_100109067
1243 Ga0075363_100164697
1244 Ga0075363_100255157
1245 Ga0075363_100767230
1246 Ga0075364_10013967
1247 Ga0075364_10081007
1248 Ga0075364_10144673
1249 Ga0075364_10686839
1250 Ga0070716_100262904
1251 Ga0070712_100489010
1252 Ga0075362_10034290
1253 Ga0075362_10043133
1254 Ga0075362_10047661
1255 Ga0075362_10081871
1256 Ga0075362_10094100
1257 Ga0075362_10210340
1258 Ga0075367_10010494
1259 Ga0075367_10030565
1260 Ga0075367_10059422
1261 Ga0075367_10080622
1262 Ga0075367_10132711
1263 Ga0075367_10326650
1264 Ga0075367_10432529
1265 Ga0075367_10519804
1266 Ga0075367_10751006
1267 Ga0075369_10014365
1268 Ga0075369_10015191
1269 Ga0075369_10207810
1270 Ga0075366_10043033
1271 Ga0075366_10131825
1272 Ga0075366_10883572
1273 Ga0097621_100263485
1274 Ga0097621_101110566
1275 Ga0097621_101845026
1276 Ga0097621_101872621
1277 Ga0075370_10007676
1278 Ga0075370_10082152
1279 Ga0075370_10200649
1280 Ga0075370_10384002
1281 Ga0068871_100640227
1282 Ga0068871_101116781
1283 Ga0068871_102006879
1284 Ga0075428_100044800
1285 Ga0075428_100066058
1286 Ga0075428_101572210
1287 Ga0075430_100921741
1288 Ga0075430_101408962
1289 Ga0075431_100149210
1290 Ga0075431_100204554
1291 Ga0075433_10845724
1292 Ga0075429_100001760
1293 Ga0075429_100568100
1294 Ga0068865_100505232
1295 Ga0068865_100756977
1296 Ga0068865_101013723
1297 Ga0068865_101100683
1298 Ga0097620_100069591
1299 Ga0097620_100069885
1300 Ga0097620_101799161
1301 Ga0079104_1000056
1302 Ga0099826_10157999
1303 Ga0105251_10001596
1304 Ga0105244_10269823
1305 Ga0105250_10112457
1306 Ga0105250_10212425
1307 Ga0105250_10283495
1308 Ga0105240_10008179
1309 Ga0105240_10059150
1310 Ga0105240_10061454
1311 Ga0105240_10127106
1312 Ga0105240_10519837
1313 Ga0105240_10757023
1314 Ga0105240_10762312
1315 Ga0105240_11107972
1316 Ga0105240_11111977
1317 Ga0105240_11497022
1318 Ga0105240_11904074
1319 Ga0105240_11967403
1320 Ga0105240_12300583
1321 Ga0105240_12371562
1322 Ga0111539_10619587
1323 Ga0111539_10739501
1324 Ga0105245_10440947
1325 Ga0105245_10707052
1326 Ga0105245_12451026
1327 Ga0105247_10083289
1328 Ga0105247_10448093
1329 Ga0105247_10942533
1330 Ga0105247_11002055
1331 Ga0105247_11750672
1332 Ga0114129_10005806
1333 Ga0114129_10451997
1334 Ga0105243_10301244
1335 Ga0105243_11420752
1336 Ga0105243_11691615
1337 Ga0105243_12610887
1338 Ga0105241_10081072
1339 Ga0105241_10253459
1340 Ga0105241_11211629
1341 Ga0105241_11354902
1342 Ga0105241_11461227
1343 Ga0105241_12008479
1344 Ga0105241_12483104
1345 Ga0105242_10086392
1346 Ga0105248_10074394
1347 Ga0105248_10173347
1348 Ga0105248_10703108
1349 Ga0105248_12077331
1350 Ga0105237_10009094
1351 Ga0105237_10138333
1352 Ga0105237_10381952
1353 Ga0105237_10473466
1354 Ga0105237_10799817
1355 Ga0105237_10947979
1356 Ga0105237_11106922
1357 Ga0105237_11295390
1358 Ga0105237_11980845
1359 Ga0105238_10003517
1360 Ga0105238_10052215
1361 Ga0105238_10122725
1362 Ga0105238_10191520
1363 Ga0105238_10254791
1364 Ga0105238_10282932
1365 Ga0105238_10291740
1366 Ga0105238_12250467
1367 Ga0105238_12982749
1368 Ga0105249_10092339
1369 Ga0105249_10098527
1370 Ga0105249_10391235
1371 Ga0105249_11867444
1372 Ga0105249_13359691
1373 Ga0105239_10099609
1374 Ga0105239_10118616
1375 Ga0105239_10158197
1376 Ga0105239_10164361
1377 Ga0105239_10171834
1378 Ga0105239_10181533
1379 Ga0105239_10209027
1380 Ga0105239_10267037
1381 Ga0105239_10335177
1382 Ga0105239_10436143
1383 Ga0105239_10540272
1384 Ga0105239_10729445
1385 Ga0105239_10759015
1386 Ga0105239_11388705
1387 Ga0105239_11599131
1388 Ga0105239_11626254
1389 Ga0105239_13094065
1390 Ga0105246_10217503
1391 Ga0105246_10529946
1392 Ga0105246_11262369
1393 Ga0105246_11439485
1394 Ga0157338_1036967
1395 Ga0157373_10093661
1396 Ga0157371_11198026
1397 Ga0157370_10180720
1398 Ga0157370_10220044
1399 Ga0157369_10171634
1400 Ga0157369_10497695
1401 Ga0157369_10783890
1402 Ga0157369_10791152
1403 Ga0157369_10967080
1404 Ga0157374_10051579
1405 Ga0157374_10076369
1406 Ga0157374_10193082
1407 Ga0157374_10279860
1408 Ga0157378_10146986
1409 Ga0157378_11134251
1410 Ga0157378_11250949
1411 Ga0163162_10001141
1412 Ga0163162_10139381
1413 Ga0163162_10218040
1414 Ga0163162_10686908
1415 Ga0163162_10711412
1416 Ga0163162_11585151
1417 Ga0157372_10494947
1418 Ga0157372_12018395
1419 Ga0157372_12240842
1420 Ga0157375_10764093
1421 Ga0157375_11849920
1422 Ga0157375_12814828
1423 Ga0163163_10151077
1424 Ga0163163_10942931
1425 Ga0163163_11149683
1426 Ga0157380_10441108
1427 Ga0157380_10977078
1428 Ga0157380_12210898
1429 Ga0182008_10006567
1430 Ga0182008_10249686
1431 Ga0157377_10648699
1432 Ga0157377_11732632
1433 Ga0157379_10362897
1434 Ga0157379_10513640
1435 Ga0157379_10617552
1436 Ga0157379_12208812
1437 Ga0157376_10080368
1438 Ga0157376_10852888
1439 Ga0157376_10877451
1440 Ga0157376_10975918
1441 Ga0157376_11410968
1442 Ga0157376_12423676
1443 Ga0182006_1061542
1444 Ga0182006_1178185
1445 Ga0163161_10109379
1446 Ga0163161_10110584
1447 Ga0163161_10580314
1448 Ga0209435_100029
1449 Ga0209435_100195
1450 Ga0209435_110508
1451 Ga0209147_100004
1452 Ga0209437_100053
1453 Ga0209258_100396
1454 Ga0209646_1000073
1455 Ga0209646_1000109
1456 Ga0209646_1037415
1457 Ga0209026_1000050
1458 Ga0209026_1000124
1459 Ga0209026_1003015
1460 Ga0209026_1035417
1461 Ga0209026_1062093
1462 Ga0209148_1000032
1463 Ga0209759_1000108
1464 Ga0209759_1000706
1465 Ga0209759_1000891
1466 Ga0209759_1051238
1467 Ga0209233_1000034
1468 Ga0209233_1012371
1469 Ga0209233_1060313
1470 Ga0209455_1014667
1471 Ga0209673_1001490
1472 Ga0209673_1080125
1473 Ga0209675_1045396
1474 Ga0209758_1008143
1475 Ga0209050_1000202
1476 Ga0209050_1006802
1477 Ga0209256_1000049
1478 Ga0207426_1002546
1479 Ga0209051_1011287
1480 Ga0207697_10416142
1481 Ga0207656_10112723
1482 Ga0207656_10235560
1483 Ga0207656_10397757
1484 Ga0207656_10427162
1485 Ga0207696_1100059
1486 Ga0207655_1231614
1487 Ga0207713_1003598
1488 Ga0207642_10252153
1489 Ga0207710_10088493
1490 Ga0207710_10144651
1491 Ga0207710_10333561
1492 Ga0207688_10350052
1493 Ga0207688_10983844
1494 Ga0207680_10147902
1495 Ga0207680_10404237
1496 Ga0207647_10002871
1497 Ga0207647_10140070
1498 Ga0207647_10157711
1499 Ga0207647_10167001
1500 Ga0207647_10290538
1501 Ga0207647_10343297
1502 Ga0207647_10423436
1503 Ga0207645_10514842
1504 Ga0207643_10042620
1505 Ga0207705_10074750
1506 Ga0207684_10021192
1507 Ga0207684_10235133
1508 Ga0207654_10000942
1509 Ga0207654_10035690
1510 Ga0207654_10050624
1511 Ga0207654_10097988
1512 Ga0207654_10464192
1513 Ga0207695_10004636
1514 Ga0207695_10044260
1515 Ga0207695_10063100
1516 Ga0207695_10068811
1517 Ga0207695_10241541
1518 Ga0207695_10426029
1519 Ga0207695_10616805
1520 Ga0207695_10854637
1521 Ga0207695_11040740
1522 Ga0207671_10052890
1523 Ga0207671_10180471
1524 Ga0207671_10835395
1525 Ga0207671_10858431
1526 Ga0207671_11052088
1527 Ga0207693_10156578
1528 Ga0207662_10475311
1529 Ga0207657_10121959
1530 Ga0207649_10827859
1531 Ga0207649_11109882
1532 Ga0207681_10221538
1533 Ga0207681_10779388
1534 Ga0207681_10986082
1535 Ga0207694_10114041
1536 Ga0207694_10175086
1537 Ga0207694_10563001
1538 Ga0207694_10904764
1539 Ga0207694_10949165
1540 Ga0207650_10049617
1541 Ga0207650_10529854
1542 Ga0207650_10624944
1543 Ga0207659_10035830
1544 Ga0207659_11225866
1545 Ga0207659_11571856
1546 Ga0207687_11165520
1547 Ga0207687_11653120
1548 Ga0207664_10129489
1549 Ga0207644_11793311
1550 Ga0207690_10685398
1551 Ga0207690_10756531
1552 Ga0207690_11210805
1553 Ga0207690_11263468
1554 Ga0207706_10001802
1555 Ga0207706_10302853
1556 Ga0207706_10632786
1557 Ga0207686_10281454
1558 Ga0207709_11305995
1559 Ga0207669_10089611
1560 Ga0207669_10280034
1561 Ga0207669_10761588
1562 Ga0207704_10099540
1563 Ga0207704_10657184
1564 Ga0207704_10900818
1565 Ga0207704_11021919
1566 Ga0207665_10208107
1567 Ga0207691_10116511
1568 Ga0207691_10970442
1569 Ga0207711_10062500
1570 Ga0207711_10113619
1571 Ga0207711_10413166
1572 Ga0207689_10162491
1573 Ga0207689_10636036
1574 Ga0207689_10800584
1575 Ga0207679_10203273
1576 Ga0207679_10285030
1577 Ga0207679_10868108
1578 Ga0207667_10041465
1579 Ga0207667_10080924
1580 Ga0207667_10124951
1581 Ga0207667_10246887
1582 Ga0207651_10109903
1583 Ga0207712_10000286
1584 Ga0207712_10102427
1585 Ga0207712_10282290
1586 Ga0207712_10752865
1587 Ga0207712_12135776
1588 Ga0207668_10058070
1589 Ga0207668_10634649
1590 Ga0207668_10823577
1591 Ga0207668_10938668
1592 Ga0207640_10334562
1593 Ga0207640_11206571
1594 Ga0207640_11782461
1595 Ga0207658_10017165
1596 Ga0207658_10019417
1597 Ga0207658_10121969
1598 Ga0207658_10675122
1599 Ga0207658_11037226
1600 Ga0207677_10506838
1601 Ga0207703_10002368
1602 Ga0207703_10005498
1603 Ga0207703_11395769
1604 Ga0207639_10001087
1605 Ga0207639_10055044
1606 Ga0207639_10167800
1607 Ga0207639_10261893
1608 Ga0207639_10265260
1609 Ga0207639_10342719
1610 Ga0207639_10615886
1611 Ga0207678_10005043
1612 Ga0207678_10025302
1613 Ga0207678_10068252
1614 Ga0207678_10082193
1615 Ga0207678_10159219
1616 Ga0207678_10229319
1617 Ga0207678_10260325
1618 Ga0207678_10291214
1619 Ga0207678_10631644
1620 Ga0207678_10706969
1621 Ga0207678_10864583
1622 Ga0207678_11262943
1623 Ga0207678_11282106
1624 Ga0207708_10550510
1625 Ga0207708_11149689
1626 Ga0207702_10020035
1627 Ga0207702_10094264
1628 Ga0207702_10102388
1629 Ga0207702_10124196
1630 Ga0207702_10289519
1631 Ga0207702_10481096
1632 Ga0207641_10000702
1633 Ga0207641_11005709
1634 Ga0207641_11344920
1635 Ga0207648_10511798
1636 Ga0207648_10561872
1637 Ga0207676_10185626
1638 Ga0207674_10826329
1639 Ga0207675_100682955
1640 Ga0207683_10093051
1641 Ga0207683_10161505
1642 Ga0207683_10217267
1643 Ga0207683_10364050
1644 Ga0207683_12020586
1645 Ga0207698_10339836
1646 Ga0207698_10340571
1647 Ga0207698_10466812
1648 Ga0207698_11138772
1649 Ga0207698_11277228
1650 Ga0209281_1000125
1651 Ga0209282_1159044
1652 Ga0209813_10042291
1653 Ga0209813_10411684
1654 Ga0209974_10336904
1655 Ga0207428_10474748
1656 Ga0268266_10000007
1657 Ga0268266_10001711
1658 Ga0268266_10002582
1659 Ga0268266_10013394
1660 Ga0268266_10052877
1661 Ga0268266_10215044
1662 Ga0268266_10264158
1663 Ga0268266_10276694
1664 Ga0268266_11789772
1665 Ga0268265_10011961
1666 Ga0268265_10060136
1667 Ga0268265_10293536
1668 Ga0268265_10350717
1669 Ga0268265_10366679
1670 Ga0268265_10421317
1671 Ga0268264_10000375
1672 Ga0268264_11457193
1673 Ga0268264_11533885
1674 Ga0268264_11543635
1675 Ga0268264_11640070
1676 Ga0307517_10157202
1677 Ga0307515_10213160
1678 Ga0307515_10373703
1679 Ga0265760_10346975
1680 Ga0265330_10472371
1681 Ga0265316_10403623
1682 Ga0307513_10000121
1683 Ga0307513_10454646
1684 Ga0307513_10503613
1685 Ga0307408_100051176
1686 Ga0307408_100274192
1687 Ga0307508_10509540
1688 Ga0307508_10553188
1689 Ga0265314_10643553
1690 Ga0307516_10002590
1691 Ga0307516_10107182
1692 Ga0307516_10487987
1693 Ga0307405_11566839
1694 Ga0307405_11983046
1695 Ga0307413_10221922
1696 Ga0307413_10290712
1697 Ga0307413_10425752
1698 Ga0307410_10467495
1699 Ga0307410_11824187
1700 Ga0307406_10000135
1701 Ga0307406_10083585
1702 Ga0307406_10714645
1703 Ga0307407_10554041
1704 Ga0307407_11289045
1705 Ga0307412_10649076
1706 Ga0307412_10758187
1707 Ga0307412_11221729
1708 Ga0307412_12268184
1709 Ga0307409_100093371
1710 Ga0307409_102760842
1711 Ga0307416_100055412
1712 Ga0307416_100103487
1713 Ga0307416_100356145
1714 Ga0307414_10151785
1715 Ga0307411_10074054
1716 Ga0307411_10366901
1717 Ga0307415_100147801
1718 Ga0307415_101624461
1719 Ga0307415_101642738
1720 Ga0307510_10000001
1721 Ga0307510_10416343
1722 Ga0373941_0268881
1723 Ga0373960_0313034
1724 Ga0372808_031413
1725 Ga0373925_1348402
1726 Ga0395899_0001320
1727 Ga0395899_0077287
1728 Ga0395899_0292198
1729 Ga0395900_0063330
1730 Ga0395900_0080559
1731 Ga0395900_0140821
1732 Ga0395900_0193173
1733 Ga0395900_0606959
1734 Ga0395898_0129537
1735 Ga0395898_0903223
1736 Ga0395905_0017216
1737 Ga0395905_0082683
1738 Ga0395905_0142672
1739 Ga0395905_0373161
1740 Ga0395905_0750857
1741 Ga0395905_1463581
1742 Ga0395901_0012451
1743 Ga0395901_0128021
1744 Ga0395901_0128937
1745 Ga0395901_0259946
1746 Ga0395901_0673417
1747 Ga0395901_0678497
1748 Ga0436361_0582197
1749 Ga0436361_1152275
1750 Ga0436361_1209085
1751 Ga0436363_0335585
1752 Ga0436363_1712487
1753 Ga0451789_0699448
1754 Ga0451791_1322022
1755 Ga0451797_0765934
1756 Ga0451795_0778622
1757 Ga0451798_1024392
1758 Ga0451802_0028054
1759 Ga0451807_1395372
1760 Ga0451807_1424292
1761 Ga0451833_0278061
1762 Ga0451837_0136122
1763 Ga0451837_1562523
1764 Ga0451837_1750542
1765 Ga0451841_0543752
1766 Ga0451845_0714657
1767 Ga0451853_1863186
1768 Ga0451853_2014640
1769 Ga0451853_2303321
1770 Ga0451853_3343357
1771 Ga0450900_070252
1772 Ga0466972_0015806
1773 Ga0466972_0158797
1774 Ga0466972_0462217
1775 Ga0466966_0162359
1776 Ga0466961_0832242
1777 Ga0466963_0180843
1778 Ga0466968_0178091
1779 Ga0466957_0707196
1780 Ga0466960_0015562
1781 Ga0466959_0138528
1782 Ga0466958_0136574
1783 Ga0495590_0011663
1784 Ga0495580_0035215
1785 Ga0495605_0076541
1786 Ga0495585_0167869
1787 Ga0495594_0152315
1788 Ga0495596_0255550
1789 Ga0495606_0090373
1790 Ga0495606_0532206
1791 Ga0495606_0558899
1792 Ga0495620_0063158
1793 Ga0495620_0289251
1794 Ga0495630_0640351
1795 Ga0495631_0230041
1796 Ga0495632_0128243
1797 Ga0495632_0303925
1798 Ga0495643_0186616
1799 Ga0495643_0196006
1800 Ga0495643_0350809
1801 Ga0495648_0187270
1802 Ga0495648_0512882
1803 Ga0495663_0037129
1804 Ga0495666_0039580
1805 Ga0495642_0225414
1806 Ga0495665_0292850
1807 Ga0495609_0464035
1808 Ga0495597_0159457
1809 Ga0495645_0096835
1810 Ga0495633_0350884
1811 Ga0495634_0211403
1812 Ga0495611_0138254
1813 Ga0495625_0002652
1814 Ga0495625_0171020
1815 Ga0495625_0497612
1816 Ga0495588_0270199
1817 Ga0495599_0207120
1818 Ga0495623_0090213
1819 Ga0495624_0080889
1820 Ga0495624_0833692
1821 Ga0495670_0006980
1822 Ga0495670_0103497
1823 Ga0495649_0229977
1824 Ga0495649_0355223
1825 Ga0495660_0201499
1826 Ga0495636_0166326
1827 Ga0495687_010536
1828 Ga0495687_053816
1829 Ga0495677_0217048
1830 Ga0495681_0082998
1831 Ga0495686_0100077
1832 Ga0495686_0211033
1833 Ga0495686_0236703
1834 Ga0495686_0238201
1835 Ga0495686_0340068
1836 Ga0495593_0026405
1837 Ga0495602_0734669
1838 Ga0496100_0143738
1839 Ga0496102_0237931
1840 Ga0496102_0582595
1841 Ga0496102_0603027
1842 Ga0496102_0609196
1843 Ga0496102_0823480
1844 Ga0496102_1197689
1845 Ga0496103_0330136
1846 Ga0496103_0392709
1847 Ga0496103_0572233
1848 Ga0496103_0758974
1849 Ga0496104_0254658
1850 Ga0496104_0670317
1851 Ga0496104_0896937
1852 Ga0496105_0915586
1853 Ga0496106_1174352
1854 Ga0496107_0971821
1855 Ga0496110_0345184
1856 Ga0496110_0389745
1857 Ga0496110_0811729
1858 Ga0496112_0534093
1859 Ga0496112_0674996
1860 Ga0496112_0923917
1861 Ga0496113_0232009
1862 Ga0496113_0328191
1863 Ga0496113_1453958
1864 Ga0496114_0007282
1865 Ga0496114_0522183
1866 Ga0496114_0573759
1867 Ga0496115_0289106
1868 Ga0496116_0003419
1869 Ga0496117_0268786
1870 Ga0496118_0185063
1871 Ga0496119_0008928
1872 Ga0496119_0061788
1873 Ga0496119_0089279
1874 Ga0496119_0452284
1875 Ga0496119_0558548
1876 Ga0496120_0000104
1877 Ga0496120_0000455
1878 Ga0496120_0134647
1879 Ga0496120_0206465
1880 Ga0496120_0274723
1881 Ga0496120_0442601
1882 Ga0496121_0004934
1883 Ga0496121_0293030
1884 Ga0496121_0365369
1885 Ga0496121_0457284
1886 Ga0496121_0774082
1887 Ga0496122_0000472
1888 Ga0496122_0049301
1889 Ga0496122_0258255
1890 Ga0496123_0000361
1891 Ga0496124_0000108
1892 Ga0496124_0099925
1893 Ga0496125_0000424
1894 Ga0496125_0013473
1895 Ga0496125_0027239
1896 Ga0496125_0043904
1897 Ga0496125_0052760
1898 Ga0496125_0110752
1899 Ga0496125_0615608
1900 Ga0496125_0749497
1901 Ga0496126_0116420
1902 Ga0496126_0120695
1903 Ga0496126_0303753
1904 Ga0496126_0487172
1905 Ga0495682_0189213
1906 Ga0501300_019362
1907 Ga0501031_0005336
1908 Ga0501031_1087203
1909 Ga0501032_0000067
1910 Ga0501032_0409610
1911 Ga0501032_0636923
1912 Ga0501032_1054198
1913 Ga0501033_0000117
1914 Ga0501033_0075134
1915 Ga0501033_0280842
1916 Ga0501034_0000153
1917 Ga0501034_0062525
1918 Ga0501036_0008779
1919 Ga0501036_0040926
1920 Ga0501037_0000081
1921 Ga0501038_0000033
1922 Ga0501038_0079637
1923 Ga0501039_0000031
1924 Ga0501039_0523466
1925 Ga0501043_0000009
1926 Ga0501043_0000044
1927 Ga0501043_0038431
1928 Ga0501046_0000022
1929 Ga0501046_0083687
1930 Ga0501046_0085538
1931 Ga0501047_0000021
1932 Ga0501047_0159538
1933 Ga0501047_0341253
1934 Ga0501047_1039152
1935 Ga0501048_0000311
1936 Ga0501048_0198999
1937 Ga0501068_0947563
1938 Ga0501070_0388710
1939 Ga0501070_0997363
1940 Ga0501073_0172446
1941 Ga0501073_0304222
1942 Ga0501076_0221660
1943 Ga0501080_0067730
1944 Ga0501083_0101224
1945 Ga0501083_0172642
1946 Ga0501280_006305
1947 Ga0501035_0000472
1948 Ga0501035_0110226
1949 Ga0501044_0014405
1950 Ga0501044_0439552
1951 Ga0501044_0472110
1952 Ga0501044_0475613
1953 Ga0501045_0041678
1954 nmdc:mga03683_271346_c1
1955 nmdc:mga03683_29779_c1
1956 nmdc:mga03n38_103058_c1
1957 nmdc:mga03n38_155457_c1
1958 nmdc:mga03n38_53598_c1
1959 nmdc:mga00v17_144100_c1
1960 nmdc:mga00v17_21915_c1
1961 nmdc:mga00v17_672799_c1
1962 nmdc:mga00v17_81391_c1
1963 nmdc:mga00v17_84199_c1
1964 nmdc:mga0yw44_159047_c1
1965 nmdc:mga0yw44_253999_c1
1966 nmdc:mga0yw44_256489_c1
1967 nmdc:mga0yw44_3044_c1
1968 nmdc:mga0yw44_438721_c1
1969 nmdc:mga0yw44_44151_c1
1970 nmdc:mga0yw44_47931_c1
1971 nmdc:mga0yw44_54408_c1
1972 nmdc:mga0k408_142381_c1
1973 nmdc:mga0k408_434742_c1
1974 nmdc:mga0k408_547213_c1
1975 nmdc:mga0k408_636169_c1
1976 nmdc:mga06z11_13238_c1
1977 nmdc:mga06z11_178799_c1
1978 nmdc:mga06z11_290636_c1
1979 nmdc:mga06z11_389451_c1
1980 nmdc:mga06z11_415692_c1
1981 nmdc:mga04h51_304655_c1
1982 nmdc:mga04h51_69223_c1
1983 nmdc:mga07m45_264384_c1
1984 nmdc:mga07m45_32868_c1
1985 nmdc:mga07m45_332704_c1
1986 nmdc:mga07m45_751787_c1
1987 nmdc:mga05p37_397580_c1
1988 nmdc:mga05p37_56596_c1
1989 nmdc:mga09592_142_c2
1990 nmdc:mga0qj67_1135337_c1
1991 nmdc:mga06r32_187262_c1
1992 nmdc:mga06r32_192796_c1
1993 nmdc:mga08y16_2132907_c1
1994 nmdc:mga0a205_388080_c2
1995 nmdc:mga0sz30_36074_c1
1996 Ga0495601_0343647
1997 Ga0500610_0012946
1998 Ga0500610_0192265
1999 Ga0495655_0032605
2000 Ga0500578_0000327
2001 Ga0500646_0012843
2002 Ga0500583_0023535
2003 Ga0500566_0530955
2004 Ga0500641_0003956
2005 Ga0500641_0010765
2006 Ga0500650_0383878
2007 Ga0500654_152786
2008 Ga0500556_0067354
2009 Ga0500594_0021092
2010 Ga0500595_013715
2011 Ga0500595_041988
2012 Ga0500595_192134
2013 Ga0500559_0235384
2014 Ga0500568_0021526
2015 Ga0500568_0286850
2016 Ga0500589_178529
2017 Ga0500590_173236
2018 Ga0500604_0029850
2019 Ga0500604_0265557
2020 Ga0500620_010708
2021 Ga0500620_098708
2022 Ga0500627_0146894
2023 Ga0500611_022925
2024 Ga0500645_082862
2025 Ga0500587_032830
2026 Ga0587073_0284930
2027 Ga0587106_128633
2028 Ga0587072_154827
2029 Ga0587114_093791
2030 Ga0501082_1098539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11295

DUF3096

Protein of unknown function (DUF3096)

20

56

0.97

Map