F488248
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1015 | 320 | 1015 | 402 |
Family's Representative Sequence
| Representative Sequence | 3300049593|Ga0501077_0081414|Ga0501077_0081414_331_1632 |
| Length | 433 |
| Sequence | MSNTSDLKVGAAGSVRTHSTRMPIAEISDKVRGGERLERAEALELYLTAPTPLLGRLADEVRALKHPLGIVTYIIDRNVNYTNVCVARCNFCAFYRPVGSDEGYVLAFDEIFRKIDETIAVGGGQLLLQGGHNPDLPLEWYEDLFRAVKQRYPAFRLHALSPPEVIHLSRLSRLPVPQVIERLVAVGLDSIPGGGAEILVDRVRKLLNCYGKATADEWLDVMRHAHLAGLRTTATMMYGTVETMEERLEHLFRLREVQDETGGFTAFIAWSYQPEHTELGGGEATGIDYLRTLAMARLVLDNFDNLQSSWVTQGGKVGQLSLGFGANDMGSVMIEENVVRAAGASYCMDEIEIVRNIENAGFVPKRRNMHYEILGDPIFRERDVPRMLELAVARADGDASRSPEINRYPAKSAAEKRARQAGPPSPELRRTPH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 178 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 180 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 204 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 205 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 206 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 207 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 208 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 209 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 210 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 211 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 212 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 213 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 214 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 215 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 216 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 291 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 292 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 310 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 311 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 312 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 313 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 314 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 316 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 317 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 318 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 319 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.74 |
| Nodule | 0 |
| Rhizoplane | 2.96 |
| Rhizosphere | 92.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000226 | 3300001977 | Bacteria | 7749 |
| 2 | JGI25406J46586_10003400 | 3300003203 | Bacteria | 7487 |
| 3 | rootH2_10032907 | 3300003320 | Bacteria | 16130 |
| 4 | Ga0065704_10079193 | 3300005289 | Bacteria | 4227 |
| 5 | Ga0065704_10083391 | 3300005289 | Bacteria | 3454 |
| 6 | Ga0065712_10007258 | 3300005290 | Bacteria | 3310 |
| 7 | Ga0065712_10011325 | 3300005290 | Bacteria | 2658 |
| 8 | Ga0065712_10068725 | 3300005290 | Bacteria | 9225 |
| 9 | Ga0065712_10077341 | 3300005290 | Bacteria | 3511 |
| 10 | Ga0065712_10080235 | 3300005290 | Bacteria | 3121 |
| 11 | Ga0065712_10135542 | 3300005290 | Bacteria | 1501 |
| 12 | Ga0065715_10090819 | 3300005293 | Bacteria | 6413 |
| 13 | Ga0065715_10102890 | 3300005293 | Bacteria | 3077 |
| 14 | Ga0065715_10110296 | 3300005293 | Bacteria | 2627 |
| 15 | Ga0065715_10132562 | 3300005293 | Bacteria | 1984 |
| 16 | Ga0065715_10150068 | 3300005293 | Bacteria | 1740 |
| 17 | Ga0065715_10192023 | 3300005293 | Bacteria | 1409 |
| 18 | Ga0065707_10000725 | 3300005295 | Bacteria | 18952 |
| 19 | Ga0065707_10008899 | 3300005295 | Bacteria | 3502 |
| 20 | Ga0065707_10011370 | 3300005295 | Bacteria | 3916 |
| 21 | Ga0065707_10094284 | 3300005295 | Bacteria | 3516 |
| 22 | Ga0065707_10099266 | 3300005295 | Bacteria | 3015 |
| 23 | Ga0070658_10025668 | 3300005327 | Bacteria | 4722 |
| 24 | Ga0070676_10001466 | 3300005328 | Bacteria | 11939 |
| 25 | Ga0070676_10041319 | 3300005328 | Bacteria | 2674 |
| 26 | Ga0070676_10065562 | 3300005328 | Bacteria | 2168 |
| 27 | Ga0070683_100009233 | 3300005329 | Bacteria | 8424 |
| 28 | Ga0070683_100040413 | 3300005329 | Bacteria | 4289 |
| 29 | Ga0070690_100025084 | 3300005330 | Bacteria | 3670 |
| 30 | Ga0070690_100120191 | 3300005330 | Bacteria | 1762 |
| 31 | Ga0070670_100006839 | 3300005331 | Bacteria | 9662 |
| 32 | Ga0070670_100008844 | 3300005331 | Bacteria | 8597 |
| 33 | Ga0070670_100037970 | 3300005331 | Bacteria | 4142 |
| 34 | Ga0070670_100099279 | 3300005331 | Bacteria | 2505 |
| 35 | Ga0070670_100123603 | 3300005331 | Bacteria | 2233 |
| 36 | Ga0070677_10001126 | 3300005333 | Bacteria | 8600 |
| 37 | Ga0068869_100002498 | 3300005334 | Bacteria | 11086 |
| 38 | Ga0068869_100009274 | 3300005334 | Bacteria | 6381 |
| 39 | Ga0068869_100013680 | 3300005334 | Bacteria | 5405 |
| 40 | Ga0068869_100022727 | 3300005334 | Bacteria | 4325 |
| 41 | Ga0070666_10008944 | 3300005335 | Bacteria | 6236 |
| 42 | Ga0070666_10029308 | 3300005335 | Bacteria | 3617 |
| 43 | Ga0070666_10029797 | 3300005335 | Bacteria | 3590 |
| 44 | Ga0070666_10112000 | 3300005335 | Bacteria | 1888 |
| 45 | Ga0070666_10139271 | 3300005335 | Bacteria | 1690 |
| 46 | Ga0070666_10178262 | 3300005335 | Bacteria | 1490 |
| 47 | Ga0068868_100194480 | 3300005338 | Bacteria | 1688 |
| 48 | Ga0070689_100035932 | 3300005340 | Bacteria | 3788 |
| 49 | Ga0070689_100060359 | 3300005340 | Bacteria | 2948 |
| 50 | Ga0070689_100075253 | 3300005340 | Bacteria | 2643 |
| 51 | Ga0070689_100090596 | 3300005340 | Bacteria | 2410 |
| 52 | Ga0070689_100162245 | 3300005340 | Bacteria | 1807 |
| 53 | Ga0070691_10000205 | 3300005341 | Bacteria | 19816 |
| 54 | Ga0070687_100018084 | 3300005343 | Bacteria | 3252 |
| 55 | Ga0070692_10008777 | 3300005345 | Bacteria | 4522 |
| 56 | Ga0070668_100116014 | 3300005347 | Bacteria | 2135 |
| 57 | Ga0070668_100125037 | 3300005347 | Bacteria | 2059 |
| 58 | Ga0070668_100193341 | 3300005347 | Bacteria | 1667 |
| 59 | Ga0070669_100000448 | 3300005353 | Bacteria | 31480 |
| 60 | Ga0070669_100006945 | 3300005353 | Bacteria | 8135 |
| 61 | Ga0070669_100013978 | 3300005353 | Bacteria | 5708 |
| 62 | Ga0070669_100030385 | 3300005353 | Bacteria | 3898 |
| 63 | Ga0070669_100031848 | 3300005353 | Bacteria | 3808 |
| 64 | Ga0070669_100080683 | 3300005353 | Bacteria | 2422 |
| 65 | Ga0070669_100147150 | 3300005353 | Bacteria | 1821 |
| 66 | Ga0070669_100156427 | 3300005353 | Bacteria | 1768 |
| 67 | Ga0070675_100000079 | 3300005354 | Bacteria | 56265 |
| 68 | Ga0070675_100001092 | 3300005354 | Bacteria | 19569 |
| 69 | Ga0070675_100004445 | 3300005354 | Bacteria | 10689 |
| 70 | Ga0070675_100030474 | 3300005354 | Bacteria | 4355 |
| 71 | Ga0070675_100041404 | 3300005354 | Bacteria | 3763 |
| 72 | Ga0070675_100090370 | 3300005354 | Bacteria | 2565 |
| 73 | Ga0070675_100150010 | 3300005354 | Bacteria | 1998 |
| 74 | Ga0070671_100009064 | 3300005355 | Bacteria | 7987 |
| 75 | Ga0070671_100037811 | 3300005355 | Bacteria | 4005 |
| 76 | Ga0070671_100129684 | 3300005355 | Bacteria | 2123 |
| 77 | Ga0070671_100135395 | 3300005355 | Bacteria | 2077 |
| 78 | Ga0070671_100142785 | 3300005355 | Bacteria | 2020 |
| 79 | Ga0070671_100347063 | 3300005355 | Bacteria | 1267 |
| 80 | Ga0070674_100000386 | 3300005356 | Bacteria | 22108 |
| 81 | Ga0070674_100005303 | 3300005356 | Bacteria | 7427 |
| 82 | Ga0070674_100008928 | 3300005356 | Bacteria | 5987 |
| 83 | Ga0070674_100191155 | 3300005356 | Bacteria | 1575 |
| 84 | Ga0070673_100004167 | 3300005364 | Bacteria | 9112 |
| 85 | Ga0070673_100024924 | 3300005364 | Bacteria | 4394 |
| 86 | Ga0070673_100025921 | 3300005364 | Bacteria | 4323 |
| 87 | Ga0070673_100061982 | 3300005364 | Bacteria | 2969 |
| 88 | Ga0070673_100097137 | 3300005364 | Bacteria | 2419 |
| 89 | Ga0070673_100126424 | 3300005364 | Bacteria | 2140 |
| 90 | Ga0070673_100155285 | 3300005364 | Bacteria | 1942 |
| 91 | Ga0070673_100158533 | 3300005364 | Bacteria | 1923 |
| 92 | Ga0070688_100077951 | 3300005365 | Bacteria | 2137 |
| 93 | Ga0070688_100093483 | 3300005365 | Bacteria | 1969 |
| 94 | Ga0070659_100207275 | 3300005366 | Bacteria | 1615 |
| 95 | Ga0070659_100277527 | 3300005366 | Bacteria | 1394 |
| 96 | Ga0070667_100031743 | 3300005367 | Bacteria | 4403 |
| 97 | Ga0070703_10034019 | 3300005406 | Bacteria | 1554 |
| 98 | Ga0070709_10004714 | 3300005434 | Bacteria | 7368 |
| 99 | Ga0070714_100111001 | 3300005435 | Bacteria | 2428 |
| 100 | Ga0070713_100099511 | 3300005436 | Bacteria | 2516 |
| 101 | Ga0070701_10031960 | 3300005438 | Bacteria | 2617 |
| 102 | Ga0070701_10058005 | 3300005438 | Bacteria | 2031 |
| 103 | Ga0070701_10078031 | 3300005438 | Bacteria | 1786 |
| 104 | Ga0070705_100003620 | 3300005440 | Bacteria | 7565 |
| 105 | Ga0070705_100006536 | 3300005440 | Bacteria | 5720 |
| 106 | Ga0070705_100016983 | 3300005440 | Bacteria | 3792 |
| 107 | Ga0070700_100002568 | 3300005441 | Bacteria | 9280 |
| 108 | Ga0070700_100017254 | 3300005441 | Bacteria | 4124 |
| 109 | Ga0070700_100148097 | 3300005441 | Bacteria | 1602 |
| 110 | Ga0070694_100001458 | 3300005444 | Bacteria | 13864 |
| 111 | Ga0070694_100142600 | 3300005444 | Bacteria | 1742 |
| 112 | Ga0070708_100056855 | 3300005445 | Bacteria | 3481 |
| 113 | Ga0070678_100002634 | 3300005456 | Bacteria | 9876 |
| 114 | Ga0070678_100046333 | 3300005456 | Bacteria | 3117 |
| 115 | Ga0070678_100109597 | 3300005456 | Bacteria | 2157 |
| 116 | Ga0070662_100003754 | 3300005457 | Bacteria | 9506 |
| 117 | Ga0070681_10058453 | 3300005458 | Bacteria | 3836 |
| 118 | Ga0070681_10227774 | 3300005458 | Bacteria | 1778 |
| 119 | Ga0068867_100000717 | 3300005459 | Bacteria | 22125 |
| 120 | Ga0068867_100021865 | 3300005459 | Bacteria | 4567 |
| 121 | Ga0068867_100206901 | 3300005459 | Bacteria | 1574 |
| 122 | Ga0070685_10003826 | 3300005466 | Bacteria | 7615 |
| 123 | Ga0070685_10041476 | 3300005466 | Bacteria | 2622 |
| 124 | Ga0070707_100287150 | 3300005468 | Bacteria | 1599 |
| 125 | Ga0070698_100058674 | 3300005471 | Bacteria | 3890 |
| 126 | Ga0070698_100144729 | 3300005471 | Bacteria | 2327 |
| 127 | Ga0070698_100209682 | 3300005471 | Bacteria | 1883 |
| 128 | Ga0070698_100233180 | 3300005471 | Bacteria | 1774 |
| 129 | Ga0070699_100001760 | 3300005518 | Bacteria | 19739 |
| 130 | Ga0070699_100005713 | 3300005518 | Bacteria | 10893 |
| 131 | Ga0070699_100017167 | 3300005518 | Bacteria | 6216 |
| 132 | Ga0070699_100030946 | 3300005518 | Bacteria | 4620 |
| 133 | Ga0070699_100047938 | 3300005518 | Bacteria | 3697 |
| 134 | Ga0070679_100169943 | 3300005530 | Bacteria | 2153 |
| 135 | Ga0070684_100001529 | 3300005535 | Bacteria | 16721 |
| 136 | Ga0070684_100020841 | 3300005535 | Bacteria | 5440 |
| 137 | Ga0070684_100021042 | 3300005535 | Bacteria | 5420 |
| 138 | Ga0070697_100079448 | 3300005536 | Bacteria | 2700 |
| 139 | Ga0070697_100120214 | 3300005536 | Bacteria | 2197 |
| 140 | Ga0070672_100006035 | 3300005543 | Bacteria | 8093 |
| 141 | Ga0070672_100046395 | 3300005543 | Bacteria | 3366 |
| 142 | Ga0070672_100055481 | 3300005543 | Bacteria | 3104 |
| 143 | Ga0070672_100061481 | 3300005543 | Bacteria | 2961 |
| 144 | Ga0070672_100086262 | 3300005543 | Bacteria | 2524 |
| 145 | Ga0070672_100125233 | 3300005543 | Bacteria | 2107 |
| 146 | Ga0070672_100295807 | 3300005543 | Bacteria | 1371 |
| 147 | Ga0070686_100015636 | 3300005544 | Bacteria | 4401 |
| 148 | Ga0070686_100023538 | 3300005544 | Bacteria | 3682 |
| 149 | Ga0070686_100026138 | 3300005544 | Bacteria | 3520 |
| 150 | Ga0070695_100000171 | 3300005545 | Bacteria | 30974 |
| 151 | Ga0070695_100002328 | 3300005545 | Bacteria | 10903 |
| 152 | Ga0070696_100000124 | 3300005546 | Bacteria | 40765 |
| 153 | Ga0070696_100020430 | 3300005546 | Bacteria | 4489 |
| 154 | Ga0070665_100000030 | 3300005548 | Bacteria | 335245 |
| 155 | Ga0070665_100001511 | 3300005548 | Bacteria | 27024 |
| 156 | Ga0070665_100003106 | 3300005548 | Bacteria | 17884 |
| 157 | Ga0070665_100045245 | 3300005548 | Bacteria | 4420 |
| 158 | Ga0070665_100047420 | 3300005548 | Bacteria | 4312 |
| 159 | Ga0070665_100172675 | 3300005548 | Bacteria | 2162 |
| 160 | Ga0070704_100000145 | 3300005549 | Bacteria | 26912 |
| 161 | Ga0070704_100013345 | 3300005549 | Bacteria | 5097 |
| 162 | Ga0070704_100013519 | 3300005549 | Bacteria | 5067 |
| 163 | Ga0070704_100030556 | 3300005549 | Bacteria | 3611 |
| 164 | Ga0070704_100040574 | 3300005549 | Bacteria | 3205 |
| 165 | Ga0070704_100040593 | 3300005549 | Bacteria | 3205 |
| 166 | Ga0070704_100045242 | 3300005549 | Bacteria | 3062 |
| 167 | Ga0070704_100058374 | 3300005549 | Bacteria | 2748 |
| 168 | Ga0068855_100023926 | 3300005563 | Bacteria | 7315 |
| 169 | Ga0068855_100238144 | 3300005563 | Bacteria | 2034 |
| 170 | Ga0070664_100002901 | 3300005564 | Bacteria | 13874 |
| 171 | Ga0070664_100014926 | 3300005564 | Bacteria | 6338 |
| 172 | Ga0070664_100032600 | 3300005564 | Bacteria | 4358 |
| 173 | Ga0070664_100094327 | 3300005564 | Bacteria | 2595 |
| 174 | Ga0070664_100094406 | 3300005564 | Bacteria | 2594 |
| 175 | Ga0070664_100163921 | 3300005564 | Bacteria | 1968 |
| 176 | Ga0068854_100134749 | 3300005578 | Bacteria | 1890 |
| 177 | Ga0070702_100008169 | 3300005615 | Bacteria | 5056 |
| 178 | Ga0070702_100013036 | 3300005615 | Bacteria | 4187 |
| 179 | Ga0070702_100078660 | 3300005615 | Bacteria | 1969 |
| 180 | Ga0068859_100002171 | 3300005617 | Bacteria | 19940 |
| 181 | Ga0068859_100016970 | 3300005617 | Bacteria | 7308 |
| 182 | Ga0068859_100020062 | 3300005617 | Bacteria | 6711 |
| 183 | Ga0068859_100029009 | 3300005617 | Bacteria | 5551 |
| 184 | Ga0068859_100080713 | 3300005617 | Bacteria | 3294 |
| 185 | Ga0068859_100141712 | 3300005617 | Bacteria | 2477 |
| 186 | Ga0068859_100152747 | 3300005617 | Bacteria | 2384 |
| 187 | Ga0068859_100225870 | 3300005617 | Bacteria | 1960 |
| 188 | Ga0068864_100010029 | 3300005618 | Bacteria | 7821 |
| 189 | Ga0068864_100019648 | 3300005618 | Bacteria | 5650 |
| 190 | Ga0068864_100051184 | 3300005618 | Bacteria | 3557 |
| 191 | Ga0068864_100125007 | 3300005618 | Bacteria | 2304 |
| 192 | Ga0068866_10003215 | 3300005718 | Bacteria | 6738 |
| 193 | Ga0068861_100004810 | 3300005719 | Bacteria | 9079 |
| 194 | Ga0068861_100007457 | 3300005719 | Bacteria | 7497 |
| 195 | Ga0068861_100009126 | 3300005719 | Bacteria | 6837 |
| 196 | Ga0068861_100024227 | 3300005719 | Bacteria | 4387 |
| 197 | Ga0068861_100088181 | 3300005719 | Bacteria | 2443 |
| 198 | Ga0068861_100136399 | 3300005719 | Bacteria | 1997 |
| 199 | Ga0068870_10008434 | 3300005840 | Bacteria | 4636 |
| 200 | Ga0068870_10037466 | 3300005840 | Bacteria | 2500 |
| 201 | Ga0068870_10066607 | 3300005840 | Bacteria | 1951 |
| 202 | Ga0068863_100001409 | 3300005841 | Bacteria | 23845 |
| 203 | Ga0068863_100009990 | 3300005841 | Bacteria | 9240 |
| 204 | Ga0068863_100027693 | 3300005841 | Bacteria | 5407 |
| 205 | Ga0068863_100122832 | 3300005841 | Bacteria | 2477 |
| 206 | Ga0068863_100156929 | 3300005841 | Bacteria | 2179 |
| 207 | Ga0068863_100279305 | 3300005841 | Bacteria | 1618 |
| 208 | Ga0068858_100002245 | 3300005842 | Bacteria | 19525 |
| 209 | Ga0068858_100002257 | 3300005842 | Bacteria | 19485 |
| 210 | Ga0068858_100006285 | 3300005842 | Bacteria | 11570 |
| 211 | Ga0068858_100006973 | 3300005842 | Bacteria | 10975 |
| 212 | Ga0068858_100018755 | 3300005842 | Bacteria | 6472 |
| 213 | Ga0068858_100020921 | 3300005842 | Bacteria | 6113 |
| 214 | Ga0068858_100191854 | 3300005842 | Bacteria | 1931 |
| 215 | Ga0068858_100222249 | 3300005842 | Bacteria | 1789 |
| 216 | Ga0068858_100232534 | 3300005842 | Bacteria | 1748 |
| 217 | Ga0068860_100014536 | 3300005843 | Bacteria | 7702 |
| 218 | Ga0068862_100004218 | 3300005844 | Bacteria | 12175 |
| 219 | Ga0068862_100022724 | 3300005844 | Bacteria | 5248 |
| 220 | Ga0068862_100034614 | 3300005844 | Bacteria | 4275 |
| 221 | Ga0068862_100291939 | 3300005844 | Bacteria | 1497 |
| 222 | Ga0081538_10083325 | 3300005981 | Bacteria | 1690 |
| 223 | Ga0081539_10000122 | 3300005985 | Bacteria | 183393 |
| 224 | Ga0081539_10000251 | 3300005985 | Bacteria | 125220 |
| 225 | Ga0081539_10001218 | 3300005985 | Bacteria | 45966 |
| 226 | Ga0081539_10014209 | 3300005985 | Bacteria | 5911 |
| 227 | Ga0081539_10023830 | 3300005985 | Bacteria | 3993 |
| 228 | Ga0075365_10011187 | 3300006038 | Bacteria | 5267 |
| 229 | Ga0075365_10091209 | 3300006038 | Bacteria | 2076 |
| 230 | Ga0075368_10002646 | 3300006042 | Bacteria | 5889 |
| 231 | Ga0075368_10010743 | 3300006042 | Bacteria | 3317 |
| 232 | Ga0075368_10011178 | 3300006042 | Bacteria | 3262 |
| 233 | Ga0075364_10005997 | 3300006051 | Bacteria | 7102 |
| 234 | Ga0075364_10024627 | 3300006051 | Bacteria | 3823 |
| 235 | Ga0075364_10038767 | 3300006051 | Bacteria | 3088 |
| 236 | Ga0075432_10012783 | 3300006058 | Bacteria | 2852 |
| 237 | Ga0075362_10001506 | 3300006177 | Bacteria | 7493 |
| 238 | Ga0075367_10036553 | 3300006178 | Bacteria | 2849 |
| 239 | Ga0075367_10044818 | 3300006178 | Bacteria | 2594 |
| 240 | Ga0075366_10019632 | 3300006195 | Bacteria | 3915 |
| 241 | Ga0075366_10026713 | 3300006195 | Bacteria | 3382 |
| 242 | Ga0075366_10099884 | 3300006195 | Bacteria | 1741 |
| 243 | Ga0075366_10111235 | 3300006195 | Bacteria | 1647 |
| 244 | Ga0097621_100014408 | 3300006237 | Bacteria | 5916 |
| 245 | Ga0097621_100025908 | 3300006237 | Bacteria | 4594 |
| 246 | Ga0097621_100031186 | 3300006237 | Bacteria | 4228 |
| 247 | Ga0097621_100041097 | 3300006237 | Bacteria | 3720 |
| 248 | Ga0097621_100090819 | 3300006237 | Bacteria | 2556 |
| 249 | Ga0097621_100134430 | 3300006237 | Bacteria | 2108 |
| 250 | Ga0075370_10016777 | 3300006353 | Bacteria | 3945 |
| 251 | Ga0075370_10024577 | 3300006353 | Bacteria | 3329 |
| 252 | Ga0068871_100006379 | 3300006358 | Bacteria | 8339 |
| 253 | Ga0068871_100006536 | 3300006358 | Bacteria | 8258 |
| 254 | Ga0068871_100013495 | 3300006358 | Bacteria | 6065 |
| 255 | Ga0068871_100015641 | 3300006358 | Bacteria | 5686 |
| 256 | Ga0068871_100029695 | 3300006358 | Bacteria | 4297 |
| 257 | Ga0068871_100038339 | 3300006358 | Bacteria | 3826 |
| 258 | Ga0075428_100000607 | 3300006844 | Bacteria | 36552 |
| 259 | Ga0075428_100004905 | 3300006844 | Bacteria | 14858 |
| 260 | Ga0075428_100005950 | 3300006844 | Bacteria | 13556 |
| 261 | Ga0075428_100006210 | 3300006844 | Bacteria | 13292 |
| 262 | Ga0075428_100008246 | 3300006844 | Bacteria | 11550 |
| 263 | Ga0075428_100012598 | 3300006844 | Bacteria | 9402 |
| 264 | Ga0075428_100016111 | 3300006844 | Bacteria | 8264 |
| 265 | Ga0075428_100016407 | 3300006844 | Bacteria | 8184 |
| 266 | Ga0075428_100023613 | 3300006844 | Bacteria | 6807 |
| 267 | Ga0075428_100099420 | 3300006844 | Bacteria | 3172 |
| 268 | Ga0075428_100113085 | 3300006844 | Bacteria | 2957 |
| 269 | Ga0075428_100167471 | 3300006844 | Bacteria | 2383 |
| 270 | Ga0075430_100000792 | 3300006846 | Bacteria | 24519 |
| 271 | Ga0075430_100002319 | 3300006846 | Bacteria | 15813 |
| 272 | Ga0075430_100024767 | 3300006846 | Bacteria | 5104 |
| 273 | Ga0075430_100038845 | 3300006846 | Bacteria | 4031 |
| 274 | Ga0075430_100106553 | 3300006846 | Bacteria | 2338 |
| 275 | Ga0075431_100003925 | 3300006847 | Bacteria | 14484 |
| 276 | Ga0075431_100004102 | 3300006847 | Bacteria | 14228 |
| 277 | Ga0075431_100011761 | 3300006847 | Bacteria | 8830 |
| 278 | Ga0075431_100017152 | 3300006847 | Bacteria | 7360 |
| 279 | Ga0075431_100018285 | 3300006847 | Bacteria | 7131 |
| 280 | Ga0075431_100029812 | 3300006847 | Bacteria | 5618 |
| 281 | Ga0075431_100040075 | 3300006847 | Bacteria | 4827 |
| 282 | Ga0075431_100097966 | 3300006847 | Bacteria | 3028 |
| 283 | Ga0075431_100128295 | 3300006847 | Bacteria | 2617 |
| 284 | Ga0075431_100154780 | 3300006847 | Bacteria | 2359 |
| 285 | Ga0075431_100305073 | 3300006847 | Bacteria | 1608 |
| 286 | Ga0075431_100412836 | 3300006847 | Bacteria | 1350 |
| 287 | Ga0075433_10000117 | 3300006852 | Bacteria | 39826 |
| 288 | Ga0075433_10001282 | 3300006852 | Bacteria | 18351 |
| 289 | Ga0075433_10003276 | 3300006852 | Bacteria | 12499 |
| 290 | Ga0075433_10032388 | 3300006852 | Bacteria | 4478 |
| 291 | Ga0075433_10058992 | 3300006852 | Bacteria | 3357 |
| 292 | Ga0075433_10070161 | 3300006852 | Bacteria | 3079 |
| 293 | Ga0075433_10197389 | 3300006852 | Bacteria | 1790 |
| 294 | Ga0075434_100001049 | 3300006871 | Bacteria | 22542 |
| 295 | Ga0075434_100001628 | 3300006871 | Bacteria | 19107 |
| 296 | Ga0075434_100002292 | 3300006871 | Bacteria | 16732 |
| 297 | Ga0075434_100006547 | 3300006871 | Bacteria | 10682 |
| 298 | Ga0075434_100007494 | 3300006871 | Bacteria | 10099 |
| 299 | Ga0075434_100008566 | 3300006871 | Bacteria | 9514 |
| 300 | Ga0075434_100011037 | 3300006871 | Bacteria | 8499 |
| 301 | Ga0075434_100133283 | 3300006871 | Bacteria | 2504 |
| 302 | Ga0075434_100167579 | 3300006871 | Bacteria | 2216 |
| 303 | Ga0075434_100227357 | 3300006871 | Bacteria | 1885 |
| 304 | Ga0075429_100002617 | 3300006880 | Bacteria | 15180 |
| 305 | Ga0075429_100004049 | 3300006880 | Bacteria | 12552 |
| 306 | Ga0075429_100006146 | 3300006880 | Bacteria | 10381 |
| 307 | Ga0075429_100012495 | 3300006880 | Bacteria | 7365 |
| 308 | Ga0075429_100046796 | 3300006880 | Bacteria | 3764 |
| 309 | Ga0068865_100005679 | 3300006881 | Bacteria | 7578 |
| 310 | Ga0068865_100025355 | 3300006881 | Bacteria | 3900 |
| 311 | Ga0068865_100051045 | 3300006881 | Bacteria | 2861 |
| 312 | Ga0068865_100217855 | 3300006881 | Bacteria | 1491 |
| 313 | Ga0075436_100008464 | 3300006914 | Bacteria | 7033 |
| 314 | Ga0075436_100098257 | 3300006914 | Bacteria | 2037 |
| 315 | Ga0097620_100002171 | 3300006931 | Bacteria | 19940 |
| 316 | Ga0097620_100016971 | 3300006931 | Bacteria | 7308 |
| 317 | Ga0097620_100020062 | 3300006931 | Bacteria | 6711 |
| 318 | Ga0097620_100029008 | 3300006931 | Bacteria | 5551 |
| 319 | Ga0097620_100080712 | 3300006931 | Bacteria | 3294 |
| 320 | Ga0097620_100141713 | 3300006931 | Bacteria | 2477 |
| 321 | Ga0097620_100152754 | 3300006931 | Bacteria | 2384 |
| 322 | Ga0097620_100225864 | 3300006931 | Bacteria | 1960 |
| 323 | Ga0075435_100000213 | 3300007076 | Bacteria | 35518 |
| 324 | Ga0075435_100000297 | 3300007076 | Bacteria | 30737 |
| 325 | Ga0075435_100005321 | 3300007076 | Bacteria | 8965 |
| 326 | Ga0075435_100017325 | 3300007076 | Bacteria | 5451 |
| 327 | Ga0075435_100032983 | 3300007076 | Bacteria | 4092 |
| 328 | Ga0075435_100040177 | 3300007076 | Bacteria | 3735 |
| 329 | Ga0075435_100040619 | 3300007076 | Bacteria | 3716 |
| 330 | Ga0075435_100055651 | 3300007076 | Bacteria | 3196 |
| 331 | Ga0105240_10028537 | 3300009093 | Bacteria | 7288 |
| 332 | Ga0105240_10063655 | 3300009093 | Bacteria | 4586 |
| 333 | Ga0105240_10091463 | 3300009093 | Bacteria | 3717 |
| 334 | Ga0111539_10000058 | 3300009094 | Bacteria | 114638 |
| 335 | Ga0111539_10000325 | 3300009094 | Bacteria | 58382 |
| 336 | Ga0111539_10001074 | 3300009094 | Bacteria | 36076 |
| 337 | Ga0111539_10001176 | 3300009094 | Bacteria | 34725 |
| 338 | Ga0111539_10001197 | 3300009094 | Bacteria | 34523 |
| 339 | Ga0111539_10001475 | 3300009094 | Bacteria | 31424 |
| 340 | Ga0111539_10003731 | 3300009094 | Bacteria | 20043 |
| 341 | Ga0111539_10006888 | 3300009094 | Bacteria | 14599 |
| 342 | Ga0111539_10008450 | 3300009094 | Bacteria | 13096 |
| 343 | Ga0111539_10036302 | 3300009094 | Bacteria | 5961 |
| 344 | Ga0111539_10041490 | 3300009094 | Bacteria | 5533 |
| 345 | Ga0111539_10044979 | 3300009094 | Bacteria | 5286 |
| 346 | Ga0111539_10045572 | 3300009094 | Bacteria | 5249 |
| 347 | Ga0111539_10097285 | 3300009094 | Bacteria | 3457 |
| 348 | Ga0111539_10098985 | 3300009094 | Bacteria | 3425 |
| 349 | Ga0105245_10238498 | 3300009098 | Bacteria | 1762 |
| 350 | Ga0105247_10031583 | 3300009101 | Bacteria | 3215 |
| 351 | Ga0105247_10044693 | 3300009101 | Bacteria | 2717 |
| 352 | Ga0114129_10000006 | 3300009147 | Bacteria | 157531 |
| 353 | Ga0114129_10000086 | 3300009147 | Bacteria | 86772 |
| 354 | Ga0114129_10000535 | 3300009147 | Bacteria | 46578 |
| 355 | Ga0114129_10002028 | 3300009147 | Bacteria | 27757 |
| 356 | Ga0114129_10002137 | 3300009147 | Bacteria | 27257 |
| 357 | Ga0114129_10002788 | 3300009147 | Bacteria | 24360 |
| 358 | Ga0114129_10010075 | 3300009147 | Bacteria | 13472 |
| 359 | Ga0114129_10015682 | 3300009147 | Bacteria | 10775 |
| 360 | Ga0114129_10016405 | 3300009147 | Bacteria | 10541 |
| 361 | Ga0114129_10023419 | 3300009147 | Bacteria | 8755 |
| 362 | Ga0114129_10027315 | 3300009147 | Bacteria | 8081 |
| 363 | Ga0114129_10029872 | 3300009147 | Bacteria | 7718 |
| 364 | Ga0114129_10031981 | 3300009147 | Bacteria | 7438 |
| 365 | Ga0114129_10038255 | 3300009147 | Bacteria | 6769 |
| 366 | Ga0114129_10039441 | 3300009147 | Bacteria | 6658 |
| 367 | Ga0114129_10044612 | 3300009147 | Bacteria | 6236 |
| 368 | Ga0114129_10049856 | 3300009147 | Bacteria | 5882 |
| 369 | Ga0114129_10062231 | 3300009147 | Bacteria | 5214 |
| 370 | Ga0114129_10080265 | 3300009147 | Bacteria | 4534 |
| 371 | Ga0114129_10123072 | 3300009147 | Bacteria | 3568 |
| 372 | Ga0114129_10188309 | 3300009147 | Bacteria | 2804 |
| 373 | Ga0114129_10245184 | 3300009147 | Bacteria | 2407 |
| 374 | Ga0105243_10017800 | 3300009148 | Bacteria | 5376 |
| 375 | Ga0105243_10066362 | 3300009148 | Bacteria | 2902 |
| 376 | Ga0105243_10073547 | 3300009148 | Bacteria | 2770 |
| 377 | Ga0105242_10011789 | 3300009176 | Bacteria | 6728 |
| 378 | Ga0105242_10027442 | 3300009176 | Bacteria | 4520 |
| 379 | Ga0105242_10069128 | 3300009176 | Bacteria | 2924 |
| 380 | Ga0105248_10003314 | 3300009177 | Bacteria | 17875 |
| 381 | Ga0105248_10016498 | 3300009177 | Bacteria | 8131 |
| 382 | Ga0105248_10044075 | 3300009177 | Bacteria | 5003 |
| 383 | Ga0105248_10064422 | 3300009177 | Bacteria | 4115 |
| 384 | Ga0105248_10080302 | 3300009177 | Bacteria | 3665 |
| 385 | Ga0105248_10142313 | 3300009177 | Bacteria | 2705 |
| 386 | Ga0105248_10227608 | 3300009177 | Bacteria | 2099 |
| 387 | Ga0105248_10228539 | 3300009177 | Bacteria | 2094 |
| 388 | Ga0105248_10329833 | 3300009177 | Bacteria | 1719 |
| 389 | Ga0105248_10372020 | 3300009177 | Bacteria | 1609 |
| 390 | Ga0105237_10003664 | 3300009545 | Bacteria | 18113 |
| 391 | Ga0105238_10318333 | 3300009551 | Bacteria | 1541 |
| 392 | Ga0105249_10001652 | 3300009553 | Bacteria | 19532 |
| 393 | Ga0105249_10001775 | 3300009553 | Bacteria | 18798 |
| 394 | Ga0105249_10111431 | 3300009553 | Bacteria | 2588 |
| 395 | Ga0157374_10015227 | 3300013296 | Bacteria | 6744 |
| 396 | Ga0157378_10316880 | 3300013297 | Bacteria | 1514 |
| 397 | Ga0163162_10047460 | 3300013306 | Bacteria | 4304 |
| 398 | Ga0163162_10257726 | 3300013306 | Bacteria | 1876 |
| 399 | Ga0157375_10068832 | 3300013308 | Bacteria | 3543 |
| 400 | Ga0157375_10162813 | 3300013308 | Bacteria | 2374 |
| 401 | Ga0157375_10230677 | 3300013308 | Bacteria | 2010 |
| 402 | Ga0163163_10000022 | 3300014325 | Bacteria | 187289 |
| 403 | Ga0163163_10014117 | 3300014325 | Bacteria | 7336 |
| 404 | Ga0163163_10016032 | 3300014325 | Bacteria | 6949 |
| 405 | Ga0163163_10019551 | 3300014325 | Bacteria | 6362 |
| 406 | Ga0163163_10053198 | 3300014325 | Bacteria | 3996 |
| 407 | Ga0157380_10007449 | 3300014326 | Bacteria | 7771 |
| 408 | Ga0157377_10016113 | 3300014745 | Bacteria | 3839 |
| 409 | Ga0157377_10055948 | 3300014745 | Bacteria | 2238 |
| 410 | Ga0157377_10074316 | 3300014745 | Bacteria | 1972 |
| 411 | Ga0157377_10081070 | 3300014745 | Bacteria | 1897 |
| 412 | Ga0157379_10005030 | 3300014968 | Bacteria | 11340 |
| 413 | Ga0157379_10009001 | 3300014968 | Bacteria | 8702 |
| 414 | Ga0157379_10058462 | 3300014968 | Bacteria | 3447 |
| 415 | Ga0157379_10075345 | 3300014968 | Bacteria | 3021 |
| 416 | Ga0157379_10083810 | 3300014968 | Bacteria | 2857 |
| 417 | Ga0157376_10003567 | 3300014969 | Bacteria | 10724 |
| 418 | Ga0157376_10019672 | 3300014969 | Bacteria | 5208 |
| 419 | Ga0157376_10027906 | 3300014969 | Bacteria | 4481 |
| 420 | Ga0157376_10089394 | 3300014969 | Bacteria | 2663 |
| 421 | Ga0157376_10160799 | 3300014969 | Bacteria | 2036 |
| 422 | Ga0157376_10172235 | 3300014969 | Bacteria | 1972 |
| 423 | Ga0163161_10005036 | 3300017792 | Bacteria | 9191 |
| 424 | Ga0163161_10110299 | 3300017792 | Bacteria | 2056 |
| 425 | Ga0207697_10000205 | 3300025315 | Bacteria | 31703 |
| 426 | Ga0207682_10000463 | 3300025893 | Bacteria | 18777 |
| 427 | Ga0207642_10008305 | 3300025899 | Bacteria | 3554 |
| 428 | Ga0207710_10031496 | 3300025900 | Bacteria | 2319 |
| 429 | Ga0207710_10036444 | 3300025900 | Bacteria | 2168 |
| 430 | Ga0207688_10007917 | 3300025901 | Bacteria | 5784 |
| 431 | Ga0207680_10009146 | 3300025903 | Bacteria | 4899 |
| 432 | Ga0207680_10056339 | 3300025903 | Bacteria | 2373 |
| 433 | Ga0207680_10154961 | 3300025903 | Bacteria | 1531 |
| 434 | Ga0207645_10000604 | 3300025907 | Bacteria | 29721 |
| 435 | Ga0207645_10032096 | 3300025907 | Bacteria | 3377 |
| 436 | Ga0207645_10058829 | 3300025907 | Bacteria | 2454 |
| 437 | Ga0207643_10000388 | 3300025908 | Bacteria | 29338 |
| 438 | Ga0207643_10006413 | 3300025908 | Bacteria | 6300 |
| 439 | Ga0207643_10033820 | 3300025908 | Bacteria | 2861 |
| 440 | Ga0207643_10049928 | 3300025908 | Bacteria | 2371 |
| 441 | Ga0207705_10031800 | 3300025909 | Bacteria | 3769 |
| 442 | Ga0207707_10039997 | 3300025912 | Bacteria | 4097 |
| 443 | Ga0207707_10070430 | 3300025912 | Bacteria | 3047 |
| 444 | Ga0207695_10008487 | 3300025913 | Bacteria | 12846 |
| 445 | Ga0207663_10048110 | 3300025916 | Bacteria | 2637 |
| 446 | Ga0207662_10000796 | 3300025918 | Bacteria | 14521 |
| 447 | Ga0207662_10007461 | 3300025918 | Bacteria | 5956 |
| 448 | Ga0207662_10007991 | 3300025918 | Bacteria | 5768 |
| 449 | Ga0207662_10115908 | 3300025918 | Bacteria | 1675 |
| 450 | Ga0207652_10032531 | 3300025921 | Bacteria | 4386 |
| 451 | Ga0207652_10165214 | 3300025921 | Bacteria | 1985 |
| 452 | Ga0207646_10196321 | 3300025922 | Bacteria | 1822 |
| 453 | Ga0207681_10003972 | 3300025923 | Bacteria | 9170 |
| 454 | Ga0207681_10004122 | 3300025923 | Bacteria | 9008 |
| 455 | Ga0207681_10017019 | 3300025923 | Bacteria | 4560 |
| 456 | Ga0207681_10044318 | 3300025923 | Bacteria | 2981 |
| 457 | Ga0207681_10060744 | 3300025923 | Bacteria | 2596 |
| 458 | Ga0207681_10138819 | 3300025923 | Bacteria | 1808 |
| 459 | Ga0207681_10139520 | 3300025923 | Bacteria | 1804 |
| 460 | Ga0207681_10201374 | 3300025923 | Bacteria | 1529 |
| 461 | Ga0207650_10014068 | 3300025925 | Bacteria | 5556 |
| 462 | Ga0207650_10035626 | 3300025925 | Bacteria | 3616 |
| 463 | Ga0207650_10044468 | 3300025925 | Bacteria | 3264 |
| 464 | Ga0207650_10046750 | 3300025925 | Bacteria | 3188 |
| 465 | Ga0207650_10125624 | 3300025925 | Bacteria | 2002 |
| 466 | Ga0207659_10000293 | 3300025926 | Bacteria | 30396 |
| 467 | Ga0207659_10000326 | 3300025926 | Bacteria | 28731 |
| 468 | Ga0207659_10004827 | 3300025926 | Bacteria | 8171 |
| 469 | Ga0207659_10035608 | 3300025926 | Bacteria | 3442 |
| 470 | Ga0207659_10060834 | 3300025926 | Bacteria | 2720 |
| 471 | Ga0207659_10064840 | 3300025926 | Bacteria | 2645 |
| 472 | Ga0207659_10119343 | 3300025926 | Bacteria | 2019 |
| 473 | Ga0207659_10130139 | 3300025926 | Bacteria | 1941 |
| 474 | Ga0207659_10148296 | 3300025926 | Bacteria | 1829 |
| 475 | Ga0207700_10006706 | 3300025928 | Bacteria | 6987 |
| 476 | Ga0207700_10022777 | 3300025928 | Bacteria | 4303 |
| 477 | Ga0207700_10089903 | 3300025928 | Bacteria | 2422 |
| 478 | Ga0207644_10075050 | 3300025931 | Bacteria | 2484 |
| 479 | Ga0207644_10083047 | 3300025931 | Bacteria | 2371 |
| 480 | Ga0207644_10114181 | 3300025931 | Bacteria | 2046 |
| 481 | Ga0207644_10197862 | 3300025931 | Bacteria | 1584 |
| 482 | Ga0207644_10264263 | 3300025931 | Bacteria | 1377 |
| 483 | Ga0207690_10091180 | 3300025932 | Bacteria | 2154 |
| 484 | Ga0207690_10108396 | 3300025932 | Bacteria | 1996 |
| 485 | Ga0207706_10005654 | 3300025933 | Bacteria | 11652 |
| 486 | Ga0207706_10014400 | 3300025933 | Bacteria | 7167 |
| 487 | Ga0207706_10027132 | 3300025933 | Bacteria | 5122 |
| 488 | Ga0207706_10127196 | 3300025933 | Bacteria | 2240 |
| 489 | Ga0207686_10010314 | 3300025934 | Bacteria | 5084 |
| 490 | Ga0207709_10032830 | 3300025935 | Bacteria | 3043 |
| 491 | Ga0207670_10021563 | 3300025936 | Bacteria | 3977 |
| 492 | Ga0207670_10130450 | 3300025936 | Bacteria | 1841 |
| 493 | Ga0207669_10000485 | 3300025937 | Bacteria | 17276 |
| 494 | Ga0207669_10010988 | 3300025937 | Bacteria | 4384 |
| 495 | Ga0207669_10061983 | 3300025937 | Bacteria | 2301 |
| 496 | Ga0207669_10098565 | 3300025937 | Bacteria | 1925 |
| 497 | Ga0207669_10121022 | 3300025937 | Bacteria | 1777 |
| 498 | Ga0207669_10158235 | 3300025937 | Bacteria | 1596 |
| 499 | Ga0207669_10165286 | 3300025937 | Bacteria | 1568 |
| 500 | Ga0207704_10039040 | 3300025938 | Bacteria | 2760 |
| 501 | Ga0207691_10003596 | 3300025940 | Bacteria | 15063 |
| 502 | Ga0207691_10009207 | 3300025940 | Bacteria | 9476 |
| 503 | Ga0207691_10016772 | 3300025940 | Bacteria | 6950 |
| 504 | Ga0207691_10019770 | 3300025940 | Bacteria | 6369 |
| 505 | Ga0207691_10048878 | 3300025940 | Bacteria | 3876 |
| 506 | Ga0207691_10049213 | 3300025940 | Bacteria | 3862 |
| 507 | Ga0207691_10055638 | 3300025940 | Bacteria | 3605 |
| 508 | Ga0207691_10084610 | 3300025940 | Bacteria | 2847 |
| 509 | Ga0207711_10019521 | 3300025941 | Bacteria | 5642 |
| 510 | Ga0207711_10029567 | 3300025941 | Bacteria | 4624 |
| 511 | Ga0207711_10033432 | 3300025941 | Bacteria | 4351 |
| 512 | Ga0207711_10052644 | 3300025941 | Bacteria | 3489 |
| 513 | Ga0207711_10088702 | 3300025941 | Bacteria | 2716 |
| 514 | Ga0207711_10153768 | 3300025941 | Bacteria | 2078 |
| 515 | Ga0207689_10000493 | 3300025942 | Bacteria | 37382 |
| 516 | Ga0207689_10053565 | 3300025942 | Bacteria | 3324 |
| 517 | Ga0207689_10075018 | 3300025942 | Bacteria | 2780 |
| 518 | Ga0207689_10088221 | 3300025942 | Bacteria | 2548 |
| 519 | Ga0207661_10065095 | 3300025944 | Bacteria | 2958 |
| 520 | Ga0207661_10065705 | 3300025944 | Bacteria | 2945 |
| 521 | Ga0207679_10001534 | 3300025945 | Bacteria | 14424 |
| 522 | Ga0207679_10072946 | 3300025945 | Bacteria | 2595 |
| 523 | Ga0207679_10086401 | 3300025945 | Bacteria | 2412 |
| 524 | Ga0207679_10122742 | 3300025945 | Bacteria | 2071 |
| 525 | Ga0207679_10268517 | 3300025945 | Bacteria | 1458 |
| 526 | Ga0207667_10229884 | 3300025949 | Bacteria | 1899 |
| 527 | Ga0207651_10021752 | 3300025960 | Bacteria | 3905 |
| 528 | Ga0207651_10029444 | 3300025960 | Bacteria | 3479 |
| 529 | Ga0207651_10034073 | 3300025960 | Bacteria | 3293 |
| 530 | Ga0207651_10054222 | 3300025960 | Bacteria | 2746 |
| 531 | Ga0207651_10068391 | 3300025960 | Bacteria | 2504 |
| 532 | Ga0207651_10116925 | 3300025960 | Bacteria | 2014 |
| 533 | Ga0207651_10132945 | 3300025960 | Bacteria | 1908 |
| 534 | Ga0207712_10011403 | 3300025961 | Bacteria | 5663 |
| 535 | Ga0207712_10058936 | 3300025961 | Bacteria | 2715 |
| 536 | Ga0207712_10077446 | 3300025961 | Bacteria | 2410 |
| 537 | Ga0207712_10136502 | 3300025961 | Bacteria | 1877 |
| 538 | Ga0207668_10110065 | 3300025972 | Bacteria | 2065 |
| 539 | Ga0207668_10120930 | 3300025972 | Bacteria | 1983 |
| 540 | Ga0207658_10022741 | 3300025986 | Bacteria | 4367 |
| 541 | Ga0207677_10046499 | 3300026023 | Bacteria | 2906 |
| 542 | Ga0207677_10194243 | 3300026023 | Bacteria | 1608 |
| 543 | Ga0207703_10011640 | 3300026035 | Bacteria | 6841 |
| 544 | Ga0207703_10018232 | 3300026035 | Bacteria | 5482 |
| 545 | Ga0207703_10026021 | 3300026035 | Bacteria | 4605 |
| 546 | Ga0207703_10033634 | 3300026035 | Bacteria | 4065 |
| 547 | Ga0207703_10058550 | 3300026035 | Bacteria | 3145 |
| 548 | Ga0207703_10157326 | 3300026035 | Bacteria | 1987 |
| 549 | Ga0207703_10234319 | 3300026035 | Bacteria | 1647 |
| 550 | Ga0207708_10002632 | 3300026075 | Bacteria | 13204 |
| 551 | Ga0207708_10005513 | 3300026075 | Bacteria | 9340 |
| 552 | Ga0207708_10023061 | 3300026075 | Bacteria | 4702 |
| 553 | Ga0207708_10110670 | 3300026075 | Bacteria | 2131 |
| 554 | Ga0207641_10005008 | 3300026088 | Bacteria | 11359 |
| 555 | Ga0207641_10014455 | 3300026088 | Bacteria | 6466 |
| 556 | Ga0207641_10024274 | 3300026088 | Bacteria | 4997 |
| 557 | Ga0207648_10000066 | 3300026089 | Bacteria | 98414 |
| 558 | Ga0207648_10001196 | 3300026089 | Bacteria | 29074 |
| 559 | Ga0207648_10003352 | 3300026089 | Bacteria | 16838 |
| 560 | Ga0207648_10083107 | 3300026089 | Bacteria | 2793 |
| 561 | Ga0207676_10026424 | 3300026095 | Bacteria | 4319 |
| 562 | Ga0207676_10347253 | 3300026095 | Bacteria | 1371 |
| 563 | Ga0207674_10008960 | 3300026116 | Bacteria | 11499 |
| 564 | Ga0207674_10054035 | 3300026116 | Bacteria | 4091 |
| 565 | Ga0207674_10172504 | 3300026116 | Bacteria | 2116 |
| 566 | Ga0207675_100002221 | 3300026118 | Bacteria | 19290 |
| 567 | Ga0207675_100003750 | 3300026118 | Bacteria | 14800 |
| 568 | Ga0207675_100006154 | 3300026118 | Bacteria | 11400 |
| 569 | Ga0207675_100013041 | 3300026118 | Bacteria | 7760 |
| 570 | Ga0207675_100052306 | 3300026118 | Bacteria | 3811 |
| 571 | Ga0207675_100059970 | 3300026118 | Bacteria | 3551 |
| 572 | Ga0207675_100349512 | 3300026118 | Bacteria | 1449 |
| 573 | Ga0207683_10017391 | 3300026121 | Bacteria | 6128 |
| 574 | Ga0207683_10062123 | 3300026121 | Bacteria | 3289 |
| 575 | Ga0207683_10063363 | 3300026121 | Bacteria | 3257 |
| 576 | Ga0207683_10110074 | 3300026121 | Bacteria | 2466 |
| 577 | Ga0207698_10032059 | 3300026142 | Bacteria | 3802 |
| 578 | Ga0207698_10050680 | 3300026142 | Bacteria | 3169 |
| 579 | Ga0209971_1025470 | 3300027682 | Bacteria | 1413 |
| 580 | Ga0209998_10004994 | 3300027717 | Bacteria | 2788 |
| 581 | Ga0207428_10000384 | 3300027907 | Bacteria | 55472 |
| 582 | Ga0207428_10001147 | 3300027907 | Bacteria | 28680 |
| 583 | Ga0207428_10002004 | 3300027907 | Bacteria | 20617 |
| 584 | Ga0207428_10002555 | 3300027907 | Bacteria | 18177 |
| 585 | Ga0207428_10003877 | 3300027907 | Bacteria | 14336 |
| 586 | Ga0207428_10004178 | 3300027907 | Bacteria | 13837 |
| 587 | Ga0207428_10008715 | 3300027907 | Bacteria | 9153 |
| 588 | Ga0207428_10014166 | 3300027907 | Bacteria | 6941 |
| 589 | Ga0207428_10034723 | 3300027907 | Bacteria | 4128 |
| 590 | Ga0207428_10039463 | 3300027907 | Bacteria | 3834 |
| 591 | Ga0207428_10056760 | 3300027907 | Bacteria | 3110 |
| 592 | Ga0207428_10128770 | 3300027907 | Bacteria | 1938 |
| 593 | Ga0207428_10136632 | 3300027907 | Bacteria | 1874 |
| 594 | Ga0207428_10148612 | 3300027907 | Bacteria | 1785 |
| 595 | Ga0268266_10000031 | 3300028379 | Bacteria | 406292 |
| 596 | Ga0268266_10011481 | 3300028379 | Bacteria | 7694 |
| 597 | Ga0268266_10015827 | 3300028379 | Bacteria | 6458 |
| 598 | Ga0268266_10154655 | 3300028379 | Bacteria | 2070 |
| 599 | Ga0268265_10000073 | 3300028380 | Bacteria | 128856 |
| 600 | Ga0268265_10004027 | 3300028380 | Bacteria | 10350 |
| 601 | Ga0268265_10035978 | 3300028380 | Bacteria | 3623 |
| 602 | Ga0268265_10175603 | 3300028380 | Bacteria | 1835 |
| 603 | Ga0268265_10240934 | 3300028380 | Bacteria | 1596 |
| 604 | Ga0268264_10080119 | 3300028381 | Bacteria | 2788 |
| 605 | Ga0268264_10146810 | 3300028381 | Bacteria | 2110 |
| 606 | Ga0307511_10000356 | 3300030521 | Bacteria | 48468 |
| 607 | Ga0265320_10083966 | 3300031240 | Bacteria | 1484 |
| 608 | Ga0307408_100155550 | 3300031548 | Bacteria | 1810 |
| 609 | Ga0307413_10008660 | 3300031824 | Bacteria | 4820 |
| 610 | Ga0307413_10235736 | 3300031824 | Bacteria | 1347 |
| 611 | Ga0307410_10023586 | 3300031852 | Bacteria | 3829 |
| 612 | Ga0307410_10063133 | 3300031852 | Bacteria | 2540 |
| 613 | Ga0307410_10087645 | 3300031852 | Bacteria | 2202 |
| 614 | Ga0307406_10009340 | 3300031901 | Bacteria | 5497 |
| 615 | Ga0307406_10095715 | 3300031901 | Bacteria | 2010 |
| 616 | Ga0307406_10159921 | 3300031901 | Bacteria | 1618 |
| 617 | Ga0307407_10042645 | 3300031903 | Bacteria | 2545 |
| 618 | Ga0307407_10132996 | 3300031903 | Bacteria | 1594 |
| 619 | Ga0307412_10018353 | 3300031911 | Bacteria | 4208 |
| 620 | Ga0307412_10020109 | 3300031911 | Bacteria | 4057 |
| 621 | Ga0307409_100045742 | 3300031995 | Bacteria | 3307 |
| 622 | Ga0307409_100100724 | 3300031995 | Bacteria | 2395 |
| 623 | Ga0307409_100104797 | 3300031995 | Bacteria | 2356 |
| 624 | Ga0307409_100179873 | 3300031995 | Bacteria | 1871 |
| 625 | Ga0307416_100003153 | 3300032002 | Bacteria | 9661 |
| 626 | Ga0307416_100013387 | 3300032002 | Bacteria | 5573 |
| 627 | Ga0307411_10008606 | 3300032005 | Bacteria | 5300 |
| 628 | Ga0307411_10067754 | 3300032005 | Bacteria | 2403 |
| 629 | Ga0307415_100024184 | 3300032126 | Bacteria | 3788 |
| 630 | Ga0307415_100044876 | 3300032126 | Bacteria | 2959 |
| 631 | Ga0307415_100045924 | 3300032126 | Bacteria | 2932 |
| 632 | Ga0307415_100049048 | 3300032126 | Bacteria | 2852 |
| 633 | Ga0307415_100137416 | 3300032126 | Bacteria | 1861 |
| 634 | Ga0373958_0000875 | 3300034819 | Bacteria | 3876 |
| 635 | Ga0373959_0009532 | 3300034820 | Bacteria | 1677 |
| 636 | Ga0373929_0000673 | 3300035085 | Bacteria | 6586 |
| 637 | Ga0373940_0001778 | 3300035088 | Bacteria | 4011 |
| 638 | Ga0373949_0001556 | 3300035090 | Bacteria | 6478 |
| 639 | Ga0373951_0000250 | 3300035091 | Bacteria | 17855 |
| 640 | Ga0373952_0011873 | 3300035092 | Bacteria | 1705 |
| 641 | Ga0373932_0001839 | 3300035112 | Bacteria | 5677 |
| 642 | Ga0373939_0000330 | 3300035114 | Bacteria | 12172 |
| 643 | Ga0373941_0001944 | 3300035115 | Bacteria | 4476 |
| 644 | Ga0373945_0082277 | 3300035116 | Bacteria | 1235 |
| 645 | Ga0373960_0000553 | 3300035121 | Bacteria | 7559 |
| 646 | Ga0373943_0027502 | 3300035170 | Bacteria | 2673 |
| 647 | Ga0373946_0007807 | 3300035171 | Bacteria | 3928 |
| 648 | Ga0373955_0024945 | 3300035172 | Bacteria | 3064 |
| 649 | Ga0373942_0000461 | 3300035207 | Bacteria | 11493 |
| 650 | Ga0373961_0001789 | 3300035241 | Bacteria | 5922 |
| 651 | Ga0373961_0022355 | 3300035241 | Bacteria | 1691 |
| 652 | Ga0373924_0005767 | 3300035410 | Bacteria | 4403 |
| 653 | Ga0373931_0027480 | 3300035691 | Bacteria | 2905 |
| 654 | Ga0373931_0054408 | 3300035691 | Bacteria | 2139 |
| 655 | Ga0373931_0058237 | 3300035691 | Bacteria | 2074 |
| 656 | Ga0373935_0073940 | 3300035692 | Bacteria | 2202 |
| 657 | Ga0373933_0130828 | 3300035724 | Bacteria | 1578 |
| 658 | Ga0373947_0007636 | 3300035725 | Bacteria | 6257 |
| 659 | Ga0373937_0025695 | 3300036401 | Bacteria | 5319 |
| 660 | Ga0373937_0028403 | 3300036401 | Bacteria | 5062 |
| 661 | Ga0373925_0059964 | 3300037068 | Bacteria | 2856 |
| 662 | Ga0395905_0297288 | 3300037471 | Bacteria | 1502 |
| 663 | Ga0436365_1516765 | 3300039437 | Bacteria | 2870 |
| 664 | Ga0439439_0012265 | 3300041406 | Bacteria | 2071 |
| 665 | Ga0451853_0579045 | 3300041512 | Bacteria | 1634 |
| 666 | Ga0439431_0010431 | 3300041997 | Bacteria | 2109 |
| 667 | Ga0439433_0016331 | 3300041999 | Bacteria | 1644 |
| 668 | Ga0439449_0033891 | 3300042007 | Bacteria | 1902 |
| 669 | Ga0439462_0025858 | 3300042015 | Bacteria | 1546 |
| 670 | Ga0450920_008379 | 3300042122 | Bacteria | 1889 |
| 671 | Ga0450923_000426 | 3300042125 | Bacteria | 4544 |
| 672 | Ga0450923_012758 | 3300042125 | Bacteria | 1534 |
| 673 | Ga0450894_000617 | 3300042131 | Bacteria | 5992 |
| 674 | Ga0450896_001948 | 3300042133 | Bacteria | 2623 |
| 675 | Ga0439446_0013425 | 3300042156 | Bacteria | 2248 |
| 676 | Ga0439435_0009846 | 3300042436 | Bacteria | 2253 |
| 677 | Ga0439435_0025433 | 3300042436 | Bacteria | 1569 |
| 678 | Ga0451577_0039555 | 3300042876 | Bacteria | 4238 |
| 679 | Ga0453684_0007700 | 3300044712 | Bacteria | 19687 |
| 680 | Ga0451576_0003199 | 3300045051 | Bacteria | 22846 |
| 681 | Ga0451576_0047452 | 3300045051 | Bacteria | 4515 |
| 682 | Ga0451576_0160287 | 3300045051 | Bacteria | 2347 |
| 683 | Ga0451576_0196080 | 3300045051 | Bacteria | 2109 |
| 684 | Ga0451576_0274922 | 3300045051 | Bacteria | 1761 |
| 685 | Ga0451576_0340825 | 3300045051 | Bacteria | 1569 |
| 686 | Ga0451576_0458422 | 3300045051 | Bacteria | 1339 |
| 687 | Ga0466967_0121536 | 3300045976 | Bacteria | 2414 |
| 688 | Ga0495592_0056422 | 3300046454 | Bacteria | 2903 |
| 689 | Ga0495603_0099276 | 3300046455 | Bacteria | 1700 |
| 690 | Ga0495638_0002045 | 3300046460 | Bacteria | 17161 |
| 691 | Ga0495608_0004305 | 3300046511 | Bacteria | 10197 |
| 692 | Ga0495630_0004210 | 3300046517 | Bacteria | 10077 |
| 693 | Ga0495643_0029339 | 3300046522 | Bacteria | 3078 |
| 694 | Ga0495642_0001939 | 3300046528 | Bacteria | 8746 |
| 695 | Ga0495640_0238116 | 3300046533 | Bacteria | 1143 |
| 696 | Ga0495586_0019109 | 3300046535 | Bacteria | 3646 |
| 697 | Ga0495587_0023896 | 3300046536 | Bacteria | 3752 |
| 698 | Ga0495621_0000274 | 3300046539 | Bacteria | 12339 |
| 699 | Ga0495645_0003638 | 3300046543 | Bacteria | 10467 |
| 700 | Ga0495645_0048688 | 3300046543 | Bacteria | 3086 |
| 701 | Ga0495633_0041241 | 3300046558 | Bacteria | 2196 |
| 702 | Ga0495656_0004734 | 3300046615 | Bacteria | 4677 |
| 703 | Ga0495634_0071486 | 3300046642 | Bacteria | 2284 |
| 704 | Ga0495659_0045274 | 3300046664 | Bacteria | 1585 |
| 705 | Ga0495588_0093176 | 3300046674 | Bacteria | 1579 |
| 706 | Ga0495658_0083994 | 3300046683 | Bacteria | 1874 |
| 707 | Ga0495658_0145241 | 3300046683 | Bacteria | 1453 |
| 708 | Ga0495669_0007861 | 3300046684 | Bacteria | 4474 |
| 709 | Ga0495613_0005107 | 3300046689 | Bacteria | 9843 |
| 710 | Ga0495604_0059614 | 3300047317 | Bacteria | 2925 |
| 711 | Ga0495636_0002541 | 3300047318 | Bacteria | 7008 |
| 712 | Ga0495636_0055183 | 3300047318 | Bacteria | 1670 |
| 713 | Ga0495674_0022038 | 3300047319 | Bacteria | 5879 |
| 714 | Ga0495680_0077287 | 3300047322 | Bacteria | 2522 |
| 715 | Ga0495677_0038898 | 3300047445 | Bacteria | 1738 |
| 716 | Ga0495684_0001265 | 3300047471 | Bacteria | 20345 |
| 717 | Ga0495684_0182541 | 3300047471 | Bacteria | 1555 |
| 718 | Ga0496101_0000804 | 3300048904 | Bacteria | 18549 |
| 719 | Ga0496104_0002606 | 3300048907 | Bacteria | 15527 |
| 720 | Ga0496104_0003935 | 3300048907 | Bacteria | 12850 |
| 721 | Ga0496104_0019706 | 3300048907 | Bacteria | 6176 |
| 722 | Ga0496104_0056354 | 3300048907 | Bacteria | 3716 |
| 723 | Ga0496104_0136351 | 3300048907 | Bacteria | 2358 |
| 724 | Ga0496106_0145960 | 3300048909 | Bacteria | 1864 |
| 725 | Ga0496106_0210716 | 3300048909 | Bacteria | 1548 |
| 726 | Ga0496107_0106101 | 3300048910 | Bacteria | 2063 |
| 727 | Ga0496108_0018262 | 3300048911 | Bacteria | 5742 |
| 728 | Ga0496108_0018917 | 3300048911 | Bacteria | 5649 |
| 729 | Ga0496108_0108005 | 3300048911 | Bacteria | 2377 |
| 730 | Ga0496109_0008025 | 3300048912 | Bacteria | 8949 |
| 731 | Ga0496109_0011886 | 3300048912 | Bacteria | 7494 |
| 732 | Ga0496109_0232526 | 3300048912 | Bacteria | 1734 |
| 733 | Ga0496110_0102985 | 3300048913 | Bacteria | 2560 |
| 734 | Ga0496110_0132986 | 3300048913 | Bacteria | 2247 |
| 735 | Ga0496110_0167139 | 3300048913 | Bacteria | 1995 |
| 736 | Ga0496110_0180220 | 3300048913 | Bacteria | 1918 |
| 737 | Ga0496112_0001309 | 3300048915 | Bacteria | 18920 |
| 738 | Ga0496112_0013809 | 3300048915 | Bacteria | 7470 |
| 739 | Ga0496112_0029041 | 3300048915 | Bacteria | 5346 |
| 740 | Ga0496112_0064938 | 3300048915 | Bacteria | 3602 |
| 741 | Ga0496112_0066934 | 3300048915 | Bacteria | 3545 |
| 742 | Ga0496112_0139931 | 3300048915 | Bacteria | 2390 |
| 743 | Ga0496113_0024136 | 3300048916 | Bacteria | 4318 |
| 744 | Ga0496114_0001096 | 3300048917 | Bacteria | 20425 |
| 745 | Ga0496114_0002165 | 3300048917 | Bacteria | 14953 |
| 746 | Ga0496114_0133546 | 3300048917 | Bacteria | 2145 |
| 747 | Ga0496115_0032156 | 3300048918 | Bacteria | 4139 |
| 748 | Ga0496125_0000110 | 3300048928 | Bacteria | 192693 |
| 749 | Ga0501032_0010564 | 3300049569 | Bacteria | 6657 |
| 750 | Ga0501032_0040621 | 3300049569 | Bacteria | 3161 |
| 751 | Ga0501033_0004582 | 3300049570 | Bacteria | 11071 |
| 752 | Ga0501033_0013428 | 3300049570 | Bacteria | 6239 |
| 753 | Ga0501033_0065267 | 3300049570 | Bacteria | 2678 |
| 754 | Ga0501034_0002089 | 3300049571 | Bacteria | 24951 |
| 755 | Ga0501034_0012882 | 3300049571 | Bacteria | 8624 |
| 756 | Ga0501034_0015356 | 3300049571 | Bacteria | 7870 |
| 757 | Ga0501034_0017979 | 3300049571 | Bacteria | 7252 |
| 758 | Ga0501034_0217803 | 3300049571 | Bacteria | 1862 |
| 759 | Ga0501036_0007369 | 3300049572 | Bacteria | 8963 |
| 760 | Ga0501036_0028381 | 3300049572 | Bacteria | 4729 |
| 761 | Ga0501036_0050145 | 3300049572 | Bacteria | 3535 |
| 762 | Ga0501036_0057218 | 3300049572 | Bacteria | 3303 |
| 763 | Ga0501036_0136125 | 3300049572 | Bacteria | 2073 |
| 764 | Ga0501036_0195179 | 3300049572 | Bacteria | 1703 |
| 765 | Ga0501036_0268280 | 3300049572 | Bacteria | 1429 |
| 766 | Ga0501037_0018423 | 3300049573 | Bacteria | 5146 |
| 767 | Ga0501038_0008228 | 3300049574 | Bacteria | 9599 |
| 768 | Ga0501038_0016707 | 3300049574 | Bacteria | 6648 |
| 769 | Ga0501038_0020934 | 3300049574 | Bacteria | 5877 |
| 770 | Ga0501038_0058964 | 3300049574 | Bacteria | 3289 |
| 771 | Ga0501038_0086775 | 3300049574 | Bacteria | 2629 |
| 772 | Ga0501039_0010716 | 3300049575 | Bacteria | 6985 |
| 773 | Ga0501039_0024023 | 3300049575 | Bacteria | 4681 |
| 774 | Ga0501039_0050259 | 3300049575 | Bacteria | 3225 |
| 775 | Ga0501039_0053740 | 3300049575 | Bacteria | 3117 |
| 776 | Ga0501039_0060535 | 3300049575 | Bacteria | 2933 |
| 777 | Ga0501040_0001382 | 3300049576 | Bacteria | 15327 |
| 778 | Ga0501040_0025001 | 3300049576 | Bacteria | 4013 |
| 779 | Ga0501040_0051305 | 3300049576 | Bacteria | 2822 |
| 780 | Ga0501041_0000597 | 3300049577 | Bacteria | 18872 |
| 781 | Ga0501041_0025281 | 3300049577 | Bacteria | 3569 |
| 782 | Ga0501041_0039024 | 3300049577 | Bacteria | 2881 |
| 783 | Ga0501041_0074349 | 3300049577 | Bacteria | 2088 |
| 784 | Ga0501042_0041720 | 3300049578 | Bacteria | 3264 |
| 785 | Ga0501042_0067683 | 3300049578 | Bacteria | 2553 |
| 786 | Ga0501043_0001140 | 3300049579 | Bacteria | 23357 |
| 787 | Ga0501043_0071783 | 3300049579 | Bacteria | 2719 |
| 788 | Ga0501043_0091148 | 3300049579 | Bacteria | 2396 |
| 789 | Ga0501046_0003486 | 3300049580 | Bacteria | 14423 |
| 790 | Ga0501046_0015129 | 3300049580 | Bacteria | 6487 |
| 791 | Ga0501046_0017976 | 3300049580 | Bacteria | 5892 |
| 792 | Ga0501046_0021113 | 3300049580 | Bacteria | 5376 |
| 793 | Ga0501046_0026442 | 3300049580 | Bacteria | 4740 |
| 794 | Ga0501047_0000908 | 3300049581 | Bacteria | 30253 |
| 795 | Ga0501047_0006823 | 3300049581 | Bacteria | 10727 |
| 796 | Ga0501047_0043918 | 3300049581 | Bacteria | 4317 |
| 797 | Ga0501048_0002446 | 3300049582 | Bacteria | 14175 |
| 798 | Ga0501048_0045755 | 3300049582 | Bacteria | 3125 |
| 799 | Ga0501048_0063065 | 3300049582 | Bacteria | 2622 |
| 800 | Ga0501048_0068820 | 3300049582 | Bacteria | 2500 |
| 801 | Ga0501067_0065120 | 3300049583 | Bacteria | 2017 |
| 802 | Ga0501068_0008404 | 3300049584 | Bacteria | 5743 |
| 803 | Ga0501068_0016295 | 3300049584 | Bacteria | 4283 |
| 804 | Ga0501068_0031077 | 3300049584 | Bacteria | 3171 |
| 805 | Ga0501069_0013156 | 3300049585 | Bacteria | 4409 |
| 806 | Ga0501070_0115182 | 3300049586 | Bacteria | 2220 |
| 807 | Ga0501071_0005906 | 3300049587 | Bacteria | 7919 |
| 808 | Ga0501071_0028537 | 3300049587 | Bacteria | 3934 |
| 809 | Ga0501071_0044245 | 3300049587 | Bacteria | 3193 |
| 810 | Ga0501071_0122660 | 3300049587 | Bacteria | 1927 |
| 811 | Ga0501072_0018177 | 3300049588 | Bacteria | 5408 |
| 812 | Ga0501072_0032031 | 3300049588 | Bacteria | 4116 |
| 813 | Ga0501072_0033988 | 3300049588 | Bacteria | 3994 |
| 814 | Ga0501072_0086541 | 3300049588 | Bacteria | 2487 |
| 815 | Ga0501072_0113304 | 3300049588 | Bacteria | 2159 |
| 816 | Ga0501073_0007926 | 3300049589 | Bacteria | 7880 |
| 817 | Ga0501073_0008361 | 3300049589 | Bacteria | 7675 |
| 818 | Ga0501073_0070812 | 3300049589 | Bacteria | 2429 |
| 819 | Ga0501074_0218254 | 3300049590 | Bacteria | 1358 |
| 820 | Ga0501075_0000178 | 3300049591 | Bacteria | 33062 |
| 821 | Ga0501075_0010672 | 3300049591 | Bacteria | 6464 |
| 822 | Ga0501075_0013657 | 3300049591 | Bacteria | 5801 |
| 823 | Ga0501075_0093693 | 3300049591 | Bacteria | 2280 |
| 824 | Ga0501076_0004723 | 3300049592 | Bacteria | 9721 |
| 825 | Ga0501076_0010886 | 3300049592 | Bacteria | 6766 |
| 826 | Ga0501076_0027892 | 3300049592 | Bacteria | 4380 |
| 827 | Ga0501076_0166821 | 3300049592 | Bacteria | 1795 |
| 828 | Ga0501076_0260076 | 3300049592 | Bacteria | 1421 |
| 829 | Ga0501077_0017103 | 3300049593 | Bacteria | 4574 |
| 830 | Ga0501077_0037886 | 3300049593 | Bacteria | 3070 |
| 831 | Ga0501077_0040049 | 3300049593 | Bacteria | 2985 |
| 832 | Ga0501077_0081414 | 3300049593 | Bacteria | 2051 |
| 833 | Ga0501217_003704 | 3300049661 | Bacteria | 3105 |
| 834 | Ga0501079_0000603 | 3300049741 | Bacteria | 23834 |
| 835 | Ga0501079_0015632 | 3300049741 | Bacteria | 5796 |
| 836 | Ga0501079_0037822 | 3300049741 | Bacteria | 3721 |
| 837 | Ga0501080_0001055 | 3300049742 | Bacteria | 22666 |
| 838 | Ga0501080_0017108 | 3300049742 | Bacteria | 6697 |
| 839 | Ga0501080_0024517 | 3300049742 | Bacteria | 5592 |
| 840 | Ga0501080_0089859 | 3300049742 | Bacteria | 2853 |
| 841 | Ga0501080_0093465 | 3300049742 | Bacteria | 2793 |
| 842 | Ga0501080_0157811 | 3300049742 | Bacteria | 2095 |
| 843 | Ga0501081_0000629 | 3300049743 | Bacteria | 20130 |
| 844 | Ga0501081_0037707 | 3300049743 | Bacteria | 3299 |
| 845 | Ga0501081_0132638 | 3300049743 | Bacteria | 1781 |
| 846 | Ga0501081_0263013 | 3300049743 | Bacteria | 1261 |
| 847 | Ga0501083_0008276 | 3300049744 | Bacteria | 7353 |
| 848 | Ga0501083_0041397 | 3300049744 | Bacteria | 3124 |
| 849 | Ga0501083_0087921 | 3300049744 | Bacteria | 2054 |
| 850 | Ga0501035_0123944 | 3300049822 | Bacteria | 2257 |
| 851 | Ga0501035_0363038 | 3300049822 | Bacteria | 1210 |
| 852 | Ga0501044_0018916 | 3300049823 | Bacteria | 7373 |
| 853 | Ga0501044_0062774 | 3300049823 | Bacteria | 3796 |
| 854 | Ga0501044_0087804 | 3300049823 | Bacteria | 3140 |
| 855 | Ga0501045_0002740 | 3300049824 | Bacteria | 12039 |
| 856 | Ga0501045_0006810 | 3300049824 | Bacteria | 7918 |
| 857 | Ga0501045_0013268 | 3300049824 | Bacteria | 5816 |
| 858 | Ga0501045_0015836 | 3300049824 | Bacteria | 5348 |
| 859 | Ga0501045_0048673 | 3300049824 | Bacteria | 3090 |
| 860 | Ga0501045_0055704 | 3300049824 | Bacteria | 2891 |
| 861 | nmdc:mga03683_6376_c1 | 3300050489 | Bacteria | 4035 |
| 862 | nmdc:mga03n38_52542_c1 | 3300050490 | Bacteria | 1824 |
| 863 | nmdc:mga00v17_2777_c1 | 3300050491 | Bacteria | 8987 |
| 864 | nmdc:mga00v17_50774_c1 | 3300050491 | Bacteria | 2521 |
| 865 | nmdc:mga0yw44_165056_c1 | 3300050492 | Bacteria | 1451 |
| 866 | nmdc:mga0yw44_51969_c1 | 3300050492 | Bacteria | 2483 |
| 867 | nmdc:mga0yw44_55252_c1 | 3300050492 | Bacteria | 1912 |
| 868 | nmdc:mga0yw44_8972_c1 | 3300050492 | Bacteria | 5019 |
| 869 | nmdc:mga0k408_14528_c1 | 3300050493 | Bacteria | 4341 |
| 870 | nmdc:mga0k408_36239_c1 | 3300050493 | Bacteria | 2831 |
| 871 | nmdc:mga0k408_4972_c1 | 3300050493 | Bacteria | 7044 |
| 872 | nmdc:mga0k408_49885_c1 | 3300050493 | Bacteria | 2423 |
| 873 | nmdc:mga0k408_54998_c1 | 3300050493 | Bacteria | 2307 |
| 874 | nmdc:mga06z11_25980_c1 | 3300050494 | Bacteria | 2782 |
| 875 | nmdc:mga06z11_29142_c1 | 3300050494 | Bacteria | 2656 |
| 876 | nmdc:mga07m45_25398_c2 | 3300050496 | Bacteria | 2866 |
| 877 | nmdc:mga05p37_11403_c1 | 3300050507 | Bacteria | 10579 |
| 878 | nmdc:mga05p37_12306_c1 | 3300050507 | Bacteria | 10218 |
| 879 | nmdc:mga05p37_128098_c1 | 3300050507 | Bacteria | 3116 |
| 880 | nmdc:mga05p37_1358_c1 | 3300050507 | Bacteria | 28465 |
| 881 | nmdc:mga05p37_15661_c1 | 3300050507 | Bacteria | 9114 |
| 882 | nmdc:mga05p37_2308_c1 | 3300050507 | Bacteria | 22237 |
| 883 | nmdc:mga05p37_26622_c1 | 3300050507 | Bacteria | 7032 |
| 884 | nmdc:mga05p37_28047_c1 | 3300050507 | Bacteria | 6861 |
| 885 | nmdc:mga05p37_282934_c1 | 3300050507 | Bacteria | 1977 |
| 886 | nmdc:mga05p37_33001_c1 | 3300050507 | Bacteria | 6339 |
| 887 | nmdc:mga05p37_3422_c1 | 3300050507 | Bacteria | 18519 |
| 888 | nmdc:mga05p37_3819_c1 | 3300050507 | Bacteria | 17617 |
| 889 | nmdc:mga05p37_42401_c1 | 3300050507 | Bacteria | 5591 |
| 890 | nmdc:mga05p37_43448_c1 | 3300050507 | Bacteria | 5529 |
| 891 | nmdc:mga05p37_495_c1 | 3300050507 | Bacteria | 43222 |
| 892 | nmdc:mga05p37_5252_c1 | 3300050507 | Bacteria | 15201 |
| 893 | nmdc:mga05p37_55203_c1 | 3300050507 | Bacteria | 4887 |
| 894 | nmdc:mga05p37_58213_c1 | 3300050507 | Bacteria | 4759 |
| 895 | nmdc:mga05p37_6503_c2 | 3300050507 | Bacteria | 11287 |
| 896 | nmdc:mga05p37_68083_c1 | 3300050507 | Bacteria | 4378 |
| 897 | nmdc:mga05p37_68337_c1 | 3300050507 | Bacteria | 4369 |
| 898 | nmdc:mga05p37_961_c1 | 3300050507 | Bacteria | 32612 |
| 899 | nmdc:mga09592_108188_c1 | 3300050508 | Bacteria | 2384 |
| 900 | nmdc:mga09592_10896_c1 | 3300050508 | Bacteria | 7400 |
| 901 | nmdc:mga09592_17183_c1 | 3300050508 | Bacteria | 5924 |
| 902 | nmdc:mga09592_2031_c1 | 3300050508 | Bacteria | 16324 |
| 903 | nmdc:mga09592_4707_c1 | 3300050508 | Bacteria | 11050 |
| 904 | nmdc:mga09592_62675_c1 | 3300050508 | Bacteria | 3146 |
| 905 | nmdc:mga09592_86250_c1 | 3300050508 | Bacteria | 2678 |
| 906 | nmdc:mga0qj67_1190_c1 | 3300050509 | Bacteria | 18039 |
| 907 | nmdc:mga0qj67_2135_c1 | 3300050509 | Bacteria | 14068 |
| 908 | nmdc:mga0qj67_22084_c1 | 3300050509 | Bacteria | 4884 |
| 909 | nmdc:mga0qj67_32516_c1 | 3300050509 | Bacteria | 4069 |
| 910 | nmdc:mga0qj67_35929_c1 | 3300050509 | Bacteria | 3875 |
| 911 | nmdc:mga0qj67_40919_c1 | 3300050509 | Bacteria | 3643 |
| 912 | nmdc:mga0qj67_47324_c1 | 3300050509 | Bacteria | 3398 |
| 913 | nmdc:mga0qj67_58411_c1 | 3300050509 | Bacteria | 3059 |
| 914 | nmdc:mga0qj67_60442_c1 | 3300050509 | Bacteria | 3007 |
| 915 | nmdc:mga0qj67_82034_c1 | 3300050509 | Bacteria | 2586 |
| 916 | nmdc:mga06r32_129893_c1 | 3300050510 | Bacteria | 2491 |
| 917 | nmdc:mga06r32_14863_c1 | 3300050510 | Bacteria | 7063 |
| 918 | nmdc:mga06r32_160070_c1 | 3300050510 | Bacteria | 2233 |
| 919 | nmdc:mga06r32_16856_c1 | 3300050510 | Bacteria | 6663 |
| 920 | nmdc:mga06r32_25092_c1 | 3300050510 | Bacteria | 5540 |
| 921 | nmdc:mga06r32_2825_c1 | 3300050510 | Bacteria | 15577 |
| 922 | nmdc:mga06r32_393907_c1 | 3300050510 | Bacteria | 1367 |
| 923 | nmdc:mga06r32_496934_c1 | 3300050510 | Bacteria | 1197 |
| 924 | nmdc:mga06r32_78935_c1 | 3300050510 | Bacteria | 3201 |
| 925 | nmdc:mga08y16_11370_c1 | 3300050511 | Bacteria | 9353 |
| 926 | nmdc:mga08y16_11518_c1 | 3300050511 | Bacteria | 9292 |
| 927 | nmdc:mga08y16_12_c1 | 3300050511 | Bacteria | 438455 |
| 928 | nmdc:mga08y16_150876_c1 | 3300050511 | Bacteria | 2416 |
| 929 | nmdc:mga08y16_154644_c1 | 3300050511 | Bacteria | 2384 |
| 930 | nmdc:mga08y16_17225_c1 | 3300050511 | Bacteria | 7606 |
| 931 | nmdc:mga08y16_187138_c1 | 3300050511 | Bacteria | 2148 |
| 932 | nmdc:mga08y16_20431_c1 | 3300050511 | Bacteria | 6990 |
| 933 | nmdc:mga08y16_255175_c1 | 3300050511 | Bacteria | 1812 |
| 934 | nmdc:mga08y16_259322_c1 | 3300050511 | Bacteria | 1795 |
| 935 | nmdc:mga08y16_275149_c1 | 3300050511 | Bacteria | 1738 |
| 936 | nmdc:mga08y16_323468_c1 | 3300050511 | Bacteria | 1587 |
| 937 | nmdc:mga08y16_33699_c1 | 3300050511 | Bacteria | 5378 |
| 938 | nmdc:mga08y16_4298_c1 | 3300050511 | Bacteria | 14875 |
| 939 | nmdc:mga08y16_62425_c1 | 3300050511 | Bacteria | 3891 |
| 940 | nmdc:mga08y16_632_c1 | 3300050511 | Bacteria | 33000 |
| 941 | nmdc:mga08y16_635_c1 | 3300050511 | Bacteria | 32952 |
| 942 | nmdc:mga08y16_6404_c1 | 3300050511 | Bacteria | 12342 |
| 943 | nmdc:mga08y16_66344_c1 | 3300050511 | Bacteria | 3766 |
| 944 | nmdc:mga08y16_6914_c1 | 3300050511 | Bacteria | 11895 |
| 945 | nmdc:mga08y16_73474_c1 | 3300050511 | Bacteria | 3564 |
| 946 | nmdc:mga08y16_78768_c1 | 3300050511 | Bacteria | 3435 |
| 947 | nmdc:mga08y16_9169_c1 | 3300050511 | Bacteria | 10387 |
| 948 | nmdc:mga0n895_107863_c1 | 3300050512 | Bacteria | 2799 |
| 949 | nmdc:mga0n895_136750_c1 | 3300050512 | Bacteria | 2477 |
| 950 | nmdc:mga0n895_1444_c1 | 3300050512 | Bacteria | 17764 |
| 951 | nmdc:mga0n895_14801_c1 | 3300050512 | Bacteria | 7098 |
| 952 | nmdc:mga0n895_148625_c1 | 3300050512 | Bacteria | 2372 |
| 953 | nmdc:mga0n895_1608_c1 | 3300050512 | Bacteria | 17009 |
| 954 | nmdc:mga0n895_173_c1 | 3300050512 | Bacteria | 39986 |
| 955 | nmdc:mga0n895_279438_c1 | 3300050512 | Bacteria | 1693 |
| 956 | nmdc:mga0n895_3741_c1 | 3300050512 | Bacteria | 12312 |
| 957 | nmdc:mga0n895_46140_c1 | 3300050512 | Bacteria | 4255 |
| 958 | nmdc:mga0n895_5460_c1 | 3300050512 | Bacteria | 10633 |
| 959 | nmdc:mga0n895_87701_c1 | 3300050512 | Bacteria | 3110 |
| 960 | nmdc:mga0rr50_1088_c1 | 3300050513 | Bacteria | 14763 |
| 961 | nmdc:mga0rr50_126967_c1 | 3300050513 | Bacteria | 2038 |
| 962 | nmdc:mga0rr50_2_c1 | 3300050513 | Bacteria | 373938 |
| 963 | nmdc:mga0rr50_3496_c1 | 3300050513 | Bacteria | 9050 |
| 964 | nmdc:mga0rr50_61366_c1 | 3300050513 | Bacteria | 2832 |
| 965 | nmdc:mga0rr50_69588_c1 | 3300050513 | Bacteria | 2679 |
| 966 | nmdc:mga0rr50_89446_c1 | 3300050513 | Bacteria | 2394 |
| 967 | nmdc:mga08x19_13689_c1 | 3300050514 | Bacteria | 4909 |
| 968 | nmdc:mga08x19_24019_c1 | 3300050514 | Bacteria | 3785 |
| 969 | nmdc:mga08x19_452_c1 | 3300050514 | Bacteria | 27982 |
| 970 | nmdc:mga08x19_46854_c1 | 3300050514 | Bacteria | 2766 |
| 971 | nmdc:mga0a205_144881_c2 | 3300050515 | Bacteria | 1672 |
| 972 | nmdc:mga0a205_145467_c1 | 3300050515 | Bacteria | 2270 |
| 973 | nmdc:mga0a205_170541_c1 | 3300050515 | Bacteria | 2072 |
| 974 | nmdc:mga0a205_171984_c1 | 3300050515 | Bacteria | 2062 |
| 975 | nmdc:mga0a205_196634_c1 | 3300050515 | Bacteria | 1907 |
| 976 | nmdc:mga0a205_2224_c1 | 3300050515 | Bacteria | 17074 |
| 977 | nmdc:mga0a205_25961_c1 | 3300050515 | Bacteria | 5581 |
| 978 | nmdc:mga0a205_47152_c1 | 3300050515 | Bacteria | 4157 |
| 979 | nmdc:mga0a205_47_c1 | 3300050515 | Bacteria | 65667 |
| 980 | nmdc:mga0a205_57182_c1 | 3300050515 | Bacteria | 3766 |
| 981 | nmdc:mga0a205_82073_c1 | 3300050515 | Bacteria | 3114 |
| 982 | Ga0495601_0003629 | 3300053077 | Bacteria | 8872 |
| 983 | Ga0495601_0005785 | 3300053077 | Bacteria | 7211 |
| 984 | Ga0495595_0076467 | 3300053084 | Bacteria | 1589 |
| 985 | Ga0495619_0001690 | 3300053085 | Bacteria | 14594 |
| 986 | Ga0495619_0021667 | 3300053085 | Bacteria | 4105 |
| 987 | Ga0495619_0147271 | 3300053085 | Bacteria | 1624 |
| 988 | Ga0500641_0003189 | 3300053096 | Bacteria | 5797 |
| 989 | Ga0500555_000789 | 3300053103 | Bacteria | 11496 |
| 990 | Ga0500593_098259 | 3300053117 | Bacteria | 1225 |
| 991 | Ga0500616_0000358 | 3300053153 | Bacteria | 64893 |
| 992 | Ga0500645_001085 | 3300053730 | Bacteria | 14965 |
| 993 | Ga0501084_0007641 | 3300054114 | Bacteria | 8913 |
| 994 | Ga0501084_0011303 | 3300054114 | Bacteria | 7391 |
| 995 | Ga0501084_0021751 | 3300054114 | Bacteria | 5349 |
| 996 | Ga0501084_0022378 | 3300054114 | Bacteria | 5273 |
| 997 | Ga0501084_0029602 | 3300054114 | Bacteria | 4581 |
| 998 | Ga0501084_0161265 | 3300054114 | Bacteria | 1892 |
| 999 | Ga0590071_000222 | 3300059421 | Bacteria | 16802 |
| 1000 | Ga0590071_000785 | 3300059421 | Bacteria | 8886 |
| 1001 | Ga0590074_000479 | 3300059423 | Bacteria | 5882 |
| 1002 | Ga0590074_003564 | 3300059423 | Bacteria | 2577 |
| 1003 | Ga0590075_000259 | 3300059424 | Bacteria | 14841 |
| 1004 | Ga0590075_002259 | 3300059424 | Bacteria | 4629 |
| 1005 | Ga0590075_002665 | 3300059424 | Bacteria | 4264 |
| 1006 | Ga0590077_000168 | 3300059426 | Bacteria | 18409 |
| 1007 | Ga0590077_000434 | 3300059426 | Bacteria | 11752 |
| 1008 | Ga0590077_000839 | 3300059426 | Bacteria | 7922 |
| 1009 | Ga0501082_0003739 | 3300060353 | Bacteria | 13297 |
| 1010 | Ga0501082_0055328 | 3300060353 | Bacteria | 3418 |
| 1011 | Ga0501082_0083506 | 3300060353 | Bacteria | 2756 |
| 1012 | Ga0501082_0282336 | 3300060353 | Bacteria | 1445 |
| 1013 | Ga0530510_0003933 | 3300061734 | Bacteria | 10244 |
| 1014 | Ga0530510_0121296 | 3300061734 | Bacteria | 1919 |
| 1015 | Ga0530510_0167794 | 3300061734 | Bacteria | 1626 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_0363038 | Ga0501035_0363038_137_1198 | 337 |
| 2 | 3300049824 | Ga0501045_0006810 | Ga0501045_0006810_6820_7881 | 337 |
| 3 | 3300061734 | Ga0530510_0167794 | Ga0530510_0167794_55_1107 | 347 |
| 4 | 3300003320 | rootH2_10032907 | rootH2_1003290710 | 350 |
| 5 | 3300005289 | Ga0065704_10083391 | Ga0065704_100833912 | 351 |
| 6 | 3300005548 | Ga0070665_100000030 | Ga0070665_100000030116 | 351 |
| 7 | 3300005841 | Ga0068863_100001409 | Ga0068863_10000140924 | 351 |
| 8 | 3300005842 | Ga0068858_100002257 | Ga0068858_1000022575 | 351 |
| 9 | 3300006852 | Ga0075433_10058992 | Ga0075433_100589925 | 351 |
| 10 | 3300009545 | Ga0105237_10003664 | Ga0105237_100036647 | 351 |
| 11 | 3300025913 | Ga0207695_10008487 | Ga0207695_100084872 | 351 |
| 12 | 3300026088 | Ga0207641_10005008 | Ga0207641_100050085 | 351 |
| 13 | 3300028379 | Ga0268266_10000031 | Ga0268266_10000031116 | 351 |
| 14 | 3300030521 | Ga0307511_10000356 | Ga0307511_1000035631 | 351 |
| 15 | 3300048928 | Ga0496125_0000110 | Ga0496125_0000110_160119_161204 | 351 |
| 16 | 3300049574 | Ga0501038_0008228 | Ga0501038_0008228_8512_9567 | 351 |
| 17 | 3300050515 | nmdc:mga0a205_82073_c1 | nmdc:mga0a205_82073_c1_1716_2795 | 351 |
| 18 | 3300049743 | Ga0501081_0263013 | Ga0501081_0263013_24_1085 | 353 |
| 19 | 3300046533 | Ga0495640_0238116 | Ga0495640_0238116_38_1132 | 364 |
| 20 | 3300050508 | nmdc:mga09592_108188_c1 | nmdc:mga09592_108188_c1_1205_2344 | 364 |
| 21 | 3300050510 | nmdc:mga06r32_393907_c1 | nmdc:mga06r32_393907_c1_194_1312 | 366 |
| 22 | 3300053117 | Ga0500593_098259 | Ga0500593_098259_12_1142 | 366 |
| 23 | 3300049592 | Ga0501076_0260076 | Ga0501076_0260076_10_1173 | 367 |
| 24 | 3300050510 | nmdc:mga06r32_496934_c1 | nmdc:mga06r32_496934_c1_11_1126 | 370 |
| 25 | 3300049569 | Ga0501032_0010564 | Ga0501032_0010564_1963_3171 | 381 |
| 26 | 3300049571 | Ga0501034_0002089 | Ga0501034_0002089_10299_11507 | 381 |
| 27 | 3300049572 | Ga0501036_0028381 | Ga0501036_0028381_892_2100 | 381 |
| 28 | 3300049574 | Ga0501038_0016707 | Ga0501038_0016707_2673_3881 | 381 |
| 29 | 3300049574 | Ga0501038_0020934 | Ga0501038_0020934_587_1795 | 381 |
| 30 | 3300049575 | Ga0501039_0024023 | Ga0501039_0024023_1553_2761 | 381 |
| 31 | 3300049580 | Ga0501046_0015129 | Ga0501046_0015129_4422_5630 | 381 |
| 32 | 3300049581 | Ga0501047_0006823 | Ga0501047_0006823_9364_10572 | 381 |
| 33 | 3300049583 | Ga0501067_0065120 | Ga0501067_0065120_721_1929 | 381 |
| 34 | 3300049584 | Ga0501068_0016295 | Ga0501068_0016295_856_2064 | 381 |
| 35 | 3300049585 | Ga0501069_0013156 | Ga0501069_0013156_3043_4251 | 381 |
| 36 | 3300049588 | Ga0501072_0018177 | Ga0501072_0018177_2481_3689 | 381 |
| 37 | 3300049589 | Ga0501073_0070812 | Ga0501073_0070812_1049_2257 | 381 |
| 38 | 3300049742 | Ga0501080_0001055 | Ga0501080_0001055_10598_11806 | 381 |
| 39 | 3300049742 | Ga0501080_0017108 | Ga0501080_0017108_621_1829 | 381 |
| 40 | 3300049744 | Ga0501083_0041397 | Ga0501083_0041397_592_1800 | 381 |
| 41 | 3300049823 | Ga0501044_0018916 | Ga0501044_0018916_1459_2667 | 381 |
| 42 | 3300060353 | Ga0501082_0055328 | Ga0501082_0055328_2044_3252 | 381 |
| 43 | 3300042156 | Ga0439446_0013425 | Ga0439446_0013425_577_1806 | 384 |
| 44 | 3300049571 | Ga0501034_0217803 | Ga0501034_0217803_30_1190 | 385 |
| 45 | 3300005617 | Ga0068859_100225870 | Ga0068859_1002258702 | 386 |
| 46 | 3300006931 | Ga0097620_100225864 | Ga0097620_1002258642 | 386 |
| 47 | 3300025960 | Ga0207651_10034073 | Ga0207651_100340733 | 386 |
| 48 | 3300026121 | Ga0207683_10110074 | Ga0207683_101100743 | 386 |
| 49 | 3300035116 | Ga0373945_0082277 | Ga0373945_0082277_25_1215 | 386 |
| 50 | 3300049588 | Ga0501072_0113304 | Ga0501072_0113304_966_2126 | 386 |
| 51 | 3300009177 | Ga0105248_10064422 | Ga0105248_100644223 | 388 |
| 52 | 3300014325 | Ga0163163_10000022 | Ga0163163_10000022155 | 388 |
| 53 | 3300025941 | Ga0207711_10019521 | Ga0207711_100195213 | 388 |
| 54 | 3300035691 | Ga0373931_0054408 | Ga0373931_0054408_272_1447 | 388 |
| 55 | 3300048913 | Ga0496110_0132986 | Ga0496110_0132986_942_2153 | 388 |
| 56 | 3300005333 | Ga0070677_10001126 | Ga0070677_100011261 | 389 |
| 57 | 3300025893 | Ga0207682_10000463 | Ga0207682_1000046312 | 389 |
| 58 | 3300025928 | Ga0207700_10022777 | Ga0207700_100227775 | 389 |
| 59 | 3300031240 | Ga0265320_10083966 | Ga0265320_100839662 | 389 |
| 60 | 3300005549 | Ga0070704_100040593 | Ga0070704_1000405933 | 390 |
| 61 | 3300005840 | Ga0068870_10066607 | Ga0068870_100666072 | 390 |
| 62 | 3300006852 | Ga0075433_10003276 | Ga0075433_100032761 | 390 |
| 63 | 3300007076 | Ga0075435_100040619 | Ga0075435_1000406192 | 390 |
| 64 | 3300049742 | Ga0501080_0093465 | Ga0501080_0093465_292_1524 | 390 |
| 65 | 3300049743 | Ga0501081_0037707 | Ga0501081_0037707_1202_2434 | 390 |
| 66 | 3300049824 | Ga0501045_0013268 | Ga0501045_0013268_2031_3263 | 390 |
| 67 | 3300050513 | nmdc:mga0rr50_61366_c1 | nmdc:mga0rr50_61366_c1_1567_2775 | 390 |
| 68 | 3300050515 | nmdc:mga0a205_47152_c1 | nmdc:mga0a205_47152_c1_1388_2596 | 390 |
| 69 | 3300009094 | Ga0111539_10001475 | Ga0111539_1000147518 | 392 |
| 70 | 3300027907 | Ga0207428_10008715 | Ga0207428_100087156 | 392 |
| 71 | 3300050511 | nmdc:mga08y16_6404_c1 | nmdc:mga08y16_6404_c1_1127_2326 | 392 |
| 72 | 3300005356 | Ga0070674_100005303 | Ga0070674_1000053036 | 393 |
| 73 | 3300025937 | Ga0207669_10061983 | Ga0207669_100619832 | 393 |
| 74 | 3300048909 | Ga0496106_0145960 | Ga0496106_0145960_117_1325 | 393 |
| 75 | 3300005341 | Ga0070691_10000205 | Ga0070691_100002055 | 395 |
| 76 | 3300005440 | Ga0070705_100016983 | Ga0070705_1000169833 | 395 |
| 77 | 3300005441 | Ga0070700_100017254 | Ga0070700_1000172542 | 395 |
| 78 | 3300005459 | Ga0068867_100021865 | Ga0068867_1000218653 | 395 |
| 79 | 3300005549 | Ga0070704_100030556 | Ga0070704_1000305563 | 395 |
| 80 | 3300005719 | Ga0068861_100004810 | Ga0068861_1000048109 | 395 |
| 81 | 3300009094 | Ga0111539_10098985 | Ga0111539_100989852 | 395 |
| 82 | 3300025960 | Ga0207651_10054222 | Ga0207651_100542223 | 395 |
| 83 | 3300026075 | Ga0207708_10002632 | Ga0207708_1000263214 | 395 |
| 84 | 3300026089 | Ga0207648_10003352 | Ga0207648_100033524 | 395 |
| 85 | 3300026118 | Ga0207675_100002221 | Ga0207675_10000222113 | 395 |
| 86 | 3300027907 | Ga0207428_10014166 | Ga0207428_100141663 | 395 |
| 87 | 3300050511 | nmdc:mga08y16_9169_c1 | nmdc:mga08y16_9169_c1_355_1557 | 395 |
| 88 | 3300005347 | Ga0070668_100125037 | Ga0070668_1001250372 | 396 |
| 89 | 3300005353 | Ga0070669_100031848 | Ga0070669_1000318482 | 396 |
| 90 | 3300005354 | Ga0070675_100041404 | Ga0070675_1000414041 | 396 |
| 91 | 3300005366 | Ga0070659_100277527 | Ga0070659_1002775271 | 396 |
| 92 | 3300005436 | Ga0070713_100099511 | Ga0070713_1000995113 | 396 |
| 93 | 3300025926 | Ga0207659_10148296 | Ga0207659_101482961 | 396 |
| 94 | 3300025928 | Ga0207700_10089903 | Ga0207700_100899033 | 396 |
| 95 | 3300036401 | Ga0373937_0028403 | Ga0373937_0028403_2556_3764 | 396 |
| 96 | 3300005290 | Ga0065712_10135542 | Ga0065712_101355421 | 397 |
| 97 | 3300005293 | Ga0065715_10150068 | Ga0065715_101500682 | 397 |
| 98 | 3300005340 | Ga0070689_100075253 | Ga0070689_1000752531 | 397 |
| 99 | 3300005355 | Ga0070671_100142785 | Ga0070671_1001427852 | 397 |
| 100 | 3300005406 | Ga0070703_10034019 | Ga0070703_100340191 | 397 |
| 101 | 3300005434 | Ga0070709_10004714 | Ga0070709_100047143 | 397 |
| 102 | 3300005543 | Ga0070672_100046395 | Ga0070672_1000463953 | 397 |
| 103 | 3300005543 | Ga0070672_100125233 | Ga0070672_1001252332 | 397 |
| 104 | 3300005544 | Ga0070686_100026138 | Ga0070686_1000261383 | 397 |
| 105 | 3300005563 | Ga0068855_100238144 | Ga0068855_1002381442 | 397 |
| 106 | 3300005617 | Ga0068859_100080713 | Ga0068859_1000807133 | 397 |
| 107 | 3300005618 | Ga0068864_100010029 | Ga0068864_1000100293 | 397 |
| 108 | 3300005841 | Ga0068863_100279305 | Ga0068863_1002793051 | 397 |
| 109 | 3300006038 | Ga0075365_10011187 | Ga0075365_100111874 | 397 |
| 110 | 3300006038 | Ga0075365_10091209 | Ga0075365_100912092 | 397 |
| 111 | 3300006042 | Ga0075368_10011178 | Ga0075368_100111783 | 397 |
| 112 | 3300006051 | Ga0075364_10005997 | Ga0075364_100059972 | 397 |
| 113 | 3300006051 | Ga0075364_10024627 | Ga0075364_100246273 | 397 |
| 114 | 3300006051 | Ga0075364_10038767 | Ga0075364_100387672 | 397 |
| 115 | 3300006177 | Ga0075362_10001506 | Ga0075362_100015067 | 397 |
| 116 | 3300006178 | Ga0075367_10036553 | Ga0075367_100365532 | 397 |
| 117 | 3300006195 | Ga0075366_10019632 | Ga0075366_100196322 | 397 |
| 118 | 3300006195 | Ga0075366_10099884 | Ga0075366_100998842 | 397 |
| 119 | 3300006237 | Ga0097621_100134430 | Ga0097621_1001344302 | 397 |
| 120 | 3300006353 | Ga0075370_10024577 | Ga0075370_100245772 | 397 |
| 121 | 3300006931 | Ga0097620_100080712 | Ga0097620_1000807123 | 397 |
| 122 | 3300009093 | Ga0105240_10091463 | Ga0105240_100914633 | 397 |
| 123 | 3300009177 | Ga0105248_10044075 | Ga0105248_100440754 | 397 |
| 124 | 3300025903 | Ga0207680_10056339 | Ga0207680_100563392 | 397 |
| 125 | 3300025925 | Ga0207650_10035626 | Ga0207650_100356264 | 397 |
| 126 | 3300025928 | Ga0207700_10006706 | Ga0207700_100067064 | 397 |
| 127 | 3300025932 | Ga0207690_10091180 | Ga0207690_100911802 | 397 |
| 128 | 3300025933 | Ga0207706_10127196 | Ga0207706_101271962 | 397 |
| 129 | 3300025940 | Ga0207691_10016772 | Ga0207691_100167726 | 397 |
| 130 | 3300025940 | Ga0207691_10019770 | Ga0207691_100197703 | 397 |
| 131 | 3300025949 | Ga0207667_10229884 | Ga0207667_102298842 | 397 |
| 132 | 3300027682 | Ga0209971_1025470 | Ga0209971_10254701 | 397 |
| 133 | 3300027717 | Ga0209998_10004994 | Ga0209998_100049943 | 397 |
| 134 | 3300028379 | Ga0268266_10154655 | Ga0268266_101546552 | 397 |
| 135 | 3300037471 | Ga0395905_0297288 | Ga0395905_0297288_213_1415 | 397 |
| 136 | 3300048907 | Ga0496104_0056354 | Ga0496104_0056354_1225_2439 | 397 |
| 137 | 3300048909 | Ga0496106_0210716 | Ga0496106_0210716_114_1334 | 397 |
| 138 | 3300048911 | Ga0496108_0018917 | Ga0496108_0018917_1226_2446 | 397 |
| 139 | 3300048912 | Ga0496109_0011886 | Ga0496109_0011886_466_1686 | 397 |
| 140 | 3300048913 | Ga0496110_0102985 | Ga0496110_0102985_1214_2434 | 397 |
| 141 | 3300048915 | Ga0496112_0064938 | Ga0496112_0064938_1048_2268 | 397 |
| 142 | 3300048917 | Ga0496114_0002165 | Ga0496114_0002165_8487_9701 | 397 |
| 143 | 3300049571 | Ga0501034_0017979 | Ga0501034_0017979_1288_2499 | 397 |
| 144 | 3300050489 | nmdc:mga03683_6376_c1 | nmdc:mga03683_6376_c1_853_2061 | 397 |
| 145 | 3300050490 | nmdc:mga03n38_52542_c1 | nmdc:mga03n38_52542_c1_222_1430 | 397 |
| 146 | 3300050491 | nmdc:mga00v17_2777_c1 | nmdc:mga00v17_2777_c1_5685_6893 | 397 |
| 147 | 3300050492 | nmdc:mga0yw44_51969_c1 | nmdc:mga0yw44_51969_c1_229_1437 | 397 |
| 148 | 3300050492 | nmdc:mga0yw44_55252_c1 | nmdc:mga0yw44_55252_c1_213_1421 | 397 |
| 149 | 3300050492 | nmdc:mga0yw44_8972_c1 | nmdc:mga0yw44_8972_c1_2757_3965 | 397 |
| 150 | 3300050493 | nmdc:mga0k408_14528_c1 | nmdc:mga0k408_14528_c1_2633_3841 | 397 |
| 151 | 3300050493 | nmdc:mga0k408_49885_c1 | nmdc:mga0k408_49885_c1_367_1575 | 397 |
| 152 | 3300050494 | nmdc:mga06z11_25980_c1 | nmdc:mga06z11_25980_c1_1422_2630 | 397 |
| 153 | 3300050494 | nmdc:mga06z11_29142_c1 | nmdc:mga06z11_29142_c1_1348_2556 | 397 |
| 154 | 3300050507 | nmdc:mga05p37_58213_c1 | nmdc:mga05p37_58213_c1_1816_3024 | 397 |
| 155 | 3300060353 | Ga0501082_0282336 | Ga0501082_0282336_145_1356 | 397 |
| 156 | 3300005295 | Ga0065707_10011370 | Ga0065707_100113701 | 398 |
| 157 | 3300005334 | Ga0068869_100013680 | Ga0068869_1000136804 | 398 |
| 158 | 3300005335 | Ga0070666_10029308 | Ga0070666_100293083 | 398 |
| 159 | 3300005347 | Ga0070668_100116014 | Ga0070668_1001160142 | 398 |
| 160 | 3300005356 | Ga0070674_100191155 | Ga0070674_1001911551 | 398 |
| 161 | 3300005366 | Ga0070659_100207275 | Ga0070659_1002072751 | 398 |
| 162 | 3300005435 | Ga0070714_100111001 | Ga0070714_1001110012 | 398 |
| 163 | 3300005471 | Ga0070698_100209682 | Ga0070698_1002096822 | 398 |
| 164 | 3300005518 | Ga0070699_100017167 | Ga0070699_1000171676 | 398 |
| 165 | 3300005543 | Ga0070672_100295807 | Ga0070672_1002958071 | 398 |
| 166 | 3300005544 | Ga0070686_100023538 | Ga0070686_1000235383 | 398 |
| 167 | 3300005546 | Ga0070696_100020430 | Ga0070696_1000204301 | 398 |
| 168 | 3300005548 | Ga0070665_100001511 | Ga0070665_10000151118 | 398 |
| 169 | 3300006195 | Ga0075366_10026713 | Ga0075366_100267133 | 398 |
| 170 | 3300006237 | Ga0097621_100014408 | Ga0097621_1000144085 | 398 |
| 171 | 3300006237 | Ga0097621_100025908 | Ga0097621_1000259085 | 398 |
| 172 | 3300006358 | Ga0068871_100006379 | Ga0068871_1000063796 | 398 |
| 173 | 3300006358 | Ga0068871_100038339 | Ga0068871_1000383393 | 398 |
| 174 | 3300006844 | Ga0075428_100113085 | Ga0075428_1001130852 | 398 |
| 175 | 3300006847 | Ga0075431_100305073 | Ga0075431_1003050732 | 398 |
| 176 | 3300006871 | Ga0075434_100011037 | Ga0075434_1000110376 | 398 |
| 177 | 3300006881 | Ga0068865_100025355 | Ga0068865_1000253552 | 398 |
| 178 | 3300007076 | Ga0075435_100000297 | Ga0075435_10000029711 | 398 |
| 179 | 3300007076 | Ga0075435_100017325 | Ga0075435_1000173256 | 398 |
| 180 | 3300009093 | Ga0105240_10028537 | Ga0105240_100285376 | 398 |
| 181 | 3300009094 | Ga0111539_10006888 | Ga0111539_100068884 | 398 |
| 182 | 3300009147 | Ga0114129_10000006 | Ga0114129_100000066 | 398 |
| 183 | 3300009147 | Ga0114129_10015682 | Ga0114129_100156822 | 398 |
| 184 | 3300009147 | Ga0114129_10029872 | Ga0114129_100298722 | 398 |
| 185 | 3300009176 | Ga0105242_10027442 | Ga0105242_100274423 | 398 |
| 186 | 3300009176 | Ga0105242_10069128 | Ga0105242_100691282 | 398 |
| 187 | 3300009177 | Ga0105248_10227608 | Ga0105248_102276082 | 398 |
| 188 | 3300009177 | Ga0105248_10329833 | Ga0105248_103298331 | 398 |
| 189 | 3300009551 | Ga0105238_10318333 | Ga0105238_103183332 | 398 |
| 190 | 3300014969 | Ga0157376_10003567 | Ga0157376_1000356710 | 398 |
| 191 | 3300025918 | Ga0207662_10007991 | Ga0207662_100079913 | 398 |
| 192 | 3300025932 | Ga0207690_10108396 | Ga0207690_101083962 | 398 |
| 193 | 3300025937 | Ga0207669_10158235 | Ga0207669_101582352 | 398 |
| 194 | 3300025938 | Ga0207704_10039040 | Ga0207704_100390402 | 398 |
| 195 | 3300025941 | Ga0207711_10033432 | Ga0207711_100334323 | 398 |
| 196 | 3300025941 | Ga0207711_10052644 | Ga0207711_100526442 | 398 |
| 197 | 3300025941 | Ga0207711_10153768 | Ga0207711_101537682 | 398 |
| 198 | 3300025942 | Ga0207689_10075018 | Ga0207689_100750183 | 398 |
| 199 | 3300025945 | Ga0207679_10122742 | Ga0207679_101227422 | 398 |
| 200 | 3300025972 | Ga0207668_10120930 | Ga0207668_101209301 | 398 |
| 201 | 3300026023 | Ga0207677_10046499 | Ga0207677_100464992 | 398 |
| 202 | 3300027907 | Ga0207428_10128770 | Ga0207428_101287701 | 398 |
| 203 | 3300031824 | Ga0307413_10235736 | Ga0307413_102357361 | 398 |
| 204 | 3300031852 | Ga0307410_10023586 | Ga0307410_100235862 | 398 |
| 205 | 3300031901 | Ga0307406_10095715 | Ga0307406_100957152 | 398 |
| 206 | 3300031995 | Ga0307409_100179873 | Ga0307409_1001798732 | 398 |
| 207 | 3300032002 | Ga0307416_100003153 | Ga0307416_10000315311 | 398 |
| 208 | 3300035724 | Ga0373933_0130828 | Ga0373933_0130828_82_1296 | 398 |
| 209 | 3300037068 | Ga0373925_0059964 | Ga0373925_0059964_1409_2635 | 398 |
| 210 | 3300041406 | Ga0439439_0012265 | Ga0439439_0012265_172_1443 | 398 |
| 211 | 3300041997 | Ga0439431_0010431 | Ga0439431_0010431_33_1253 | 398 |
| 212 | 3300042015 | Ga0439462_0025858 | Ga0439462_0025858_102_1373 | 398 |
| 213 | 3300046460 | Ga0495638_0002045 | Ga0495638_0002045_12441_13664 | 398 |
| 214 | 3300046664 | Ga0495659_0045274 | Ga0495659_0045274_97_1296 | 398 |
| 215 | 3300048904 | Ga0496101_0000804 | Ga0496101_0000804_4157_5371 | 398 |
| 216 | 3300048907 | Ga0496104_0019706 | Ga0496104_0019706_201_1406 | 398 |
| 217 | 3300048907 | Ga0496104_0136351 | Ga0496104_0136351_697_1902 | 398 |
| 218 | 3300048915 | Ga0496112_0139931 | Ga0496112_0139931_128_1333 | 398 |
| 219 | 3300048917 | Ga0496114_0001096 | Ga0496114_0001096_13494_14708 | 398 |
| 220 | 3300049569 | Ga0501032_0040621 | Ga0501032_0040621_1616_2836 | 398 |
| 221 | 3300049570 | Ga0501033_0004582 | Ga0501033_0004582_7605_8825 | 398 |
| 222 | 3300049570 | Ga0501033_0013428 | Ga0501033_0013428_2304_3512 | 398 |
| 223 | 3300049570 | Ga0501033_0065267 | Ga0501033_0065267_1093_2307 | 398 |
| 224 | 3300049571 | Ga0501034_0012882 | Ga0501034_0012882_800_2008 | 398 |
| 225 | 3300049572 | Ga0501036_0007369 | Ga0501036_0007369_5275_6495 | 398 |
| 226 | 3300049572 | Ga0501036_0136125 | Ga0501036_0136125_361_1569 | 398 |
| 227 | 3300049573 | Ga0501037_0018423 | Ga0501037_0018423_648_1868 | 398 |
| 228 | 3300049574 | Ga0501038_0058964 | Ga0501038_0058964_1255_2475 | 398 |
| 229 | 3300049575 | Ga0501039_0050259 | Ga0501039_0050259_1518_2726 | 398 |
| 230 | 3300049575 | Ga0501039_0053740 | Ga0501039_0053740_1678_2898 | 398 |
| 231 | 3300049575 | Ga0501039_0060535 | Ga0501039_0060535_963_2177 | 398 |
| 232 | 3300049576 | Ga0501040_0001382 | Ga0501040_0001382_9555_10769 | 398 |
| 233 | 3300049577 | Ga0501041_0000597 | Ga0501041_0000597_16697_17911 | 398 |
| 234 | 3300049579 | Ga0501043_0001140 | Ga0501043_0001140_7084_8292 | 398 |
| 235 | 3300049579 | Ga0501043_0071783 | Ga0501043_0071783_710_1924 | 398 |
| 236 | 3300049579 | Ga0501043_0091148 | Ga0501043_0091148_398_1618 | 398 |
| 237 | 3300049580 | Ga0501046_0003486 | Ga0501046_0003486_10136_11350 | 398 |
| 238 | 3300049580 | Ga0501046_0017976 | Ga0501046_0017976_1375_2583 | 398 |
| 239 | 3300049580 | Ga0501046_0021113 | Ga0501046_0021113_2747_3967 | 398 |
| 240 | 3300049580 | Ga0501046_0026442 | Ga0501046_0026442_2885_4093 | 398 |
| 241 | 3300049581 | Ga0501047_0000908 | Ga0501047_0000908_14831_16039 | 398 |
| 242 | 3300049582 | Ga0501048_0002446 | Ga0501048_0002446_10046_11266 | 398 |
| 243 | 3300049582 | Ga0501048_0068820 | Ga0501048_0068820_908_2122 | 398 |
| 244 | 3300049584 | Ga0501068_0008404 | Ga0501068_0008404_4222_5442 | 398 |
| 245 | 3300049584 | Ga0501068_0031077 | Ga0501068_0031077_1329_2543 | 398 |
| 246 | 3300049586 | Ga0501070_0115182 | Ga0501070_0115182_576_1796 | 398 |
| 247 | 3300049587 | Ga0501071_0028537 | Ga0501071_0028537_366_1580 | 398 |
| 248 | 3300049588 | Ga0501072_0086541 | Ga0501072_0086541_1002_2222 | 398 |
| 249 | 3300049589 | Ga0501073_0007926 | Ga0501073_0007926_1858_3066 | 398 |
| 250 | 3300049591 | Ga0501075_0000178 | Ga0501075_0000178_17825_19039 | 398 |
| 251 | 3300049593 | Ga0501077_0040049 | Ga0501077_0040049_956_2170 | 398 |
| 252 | 3300049741 | Ga0501079_0000603 | Ga0501079_0000603_12069_13283 | 398 |
| 253 | 3300049741 | Ga0501079_0037822 | Ga0501079_0037822_2204_3424 | 398 |
| 254 | 3300049742 | Ga0501080_0024517 | Ga0501080_0024517_2870_4084 | 398 |
| 255 | 3300049742 | Ga0501080_0089859 | Ga0501080_0089859_1259_2467 | 398 |
| 256 | 3300049742 | Ga0501080_0157811 | Ga0501080_0157811_451_1671 | 398 |
| 257 | 3300049743 | Ga0501081_0000629 | Ga0501081_0000629_16371_17585 | 398 |
| 258 | 3300049744 | Ga0501083_0008276 | Ga0501083_0008276_4370_5590 | 398 |
| 259 | 3300049744 | Ga0501083_0087921 | Ga0501083_0087921_579_1787 | 398 |
| 260 | 3300049822 | Ga0501035_0123944 | Ga0501035_0123944_727_1941 | 398 |
| 261 | 3300049823 | Ga0501044_0062774 | Ga0501044_0062774_2179_3387 | 398 |
| 262 | 3300049824 | Ga0501045_0002740 | Ga0501045_0002740_919_2133 | 398 |
| 263 | 3300050507 | nmdc:mga05p37_3819_c1 | nmdc:mga05p37_3819_c1_935_2149 | 398 |
| 264 | 3300050507 | nmdc:mga05p37_495_c1 | nmdc:mga05p37_495_c1_35438_36679 | 398 |
| 265 | 3300050507 | nmdc:mga05p37_68337_c1 | nmdc:mga05p37_68337_c1_1740_2936 | 398 |
| 266 | 3300050511 | nmdc:mga08y16_150876_c1 | nmdc:mga08y16_150876_c1_512_1759 | 398 |
| 267 | 3300050511 | nmdc:mga08y16_259322_c1 | nmdc:mga08y16_259322_c1_446_1669 | 398 |
| 268 | 3300050511 | nmdc:mga08y16_4298_c1 | nmdc:mga08y16_4298_c1_11354_12553 | 398 |
| 269 | 3300050512 | nmdc:mga0n895_14801_c1 | nmdc:mga0n895_14801_c1_3612_4823 | 398 |
| 270 | 3300050513 | nmdc:mga0rr50_1088_c1 | nmdc:mga0rr50_1088_c1_11291_12487 | 398 |
| 271 | 3300050514 | nmdc:mga08x19_46854_c1 | nmdc:mga08x19_46854_c1_1137_2348 | 398 |
| 272 | 3300053153 | Ga0500616_0000358 | Ga0500616_0000358_22045_23316 | 398 |
| 273 | 3300053730 | Ga0500645_001085 | Ga0500645_001085_1743_2963 | 398 |
| 274 | 3300054114 | Ga0501084_0011303 | Ga0501084_0011303_5199_6413 | 398 |
| 275 | 3300054114 | Ga0501084_0022378 | Ga0501084_0022378_2061_3269 | 398 |
| 276 | 3300059423 | Ga0590074_003564 | Ga0590074_003564_487_1701 | 398 |
| 277 | 3300059424 | Ga0590075_002259 | Ga0590075_002259_1856_3070 | 398 |
| 278 | 3300059426 | Ga0590077_000434 | Ga0590077_000434_8273_9487 | 398 |
| 279 | 3300060353 | Ga0501082_0003739 | Ga0501082_0003739_1095_2309 | 398 |
| 280 | 3300005295 | Ga0065707_10000725 | Ga0065707_1000072519 | 399 |
| 281 | 3300005331 | Ga0070670_100099279 | Ga0070670_1000992791 | 399 |
| 282 | 3300005335 | Ga0070666_10008944 | Ga0070666_100089442 | 399 |
| 283 | 3300005335 | Ga0070666_10139271 | Ga0070666_101392712 | 399 |
| 284 | 3300005354 | Ga0070675_100090370 | Ga0070675_1000903702 | 399 |
| 285 | 3300005364 | Ga0070673_100126424 | Ga0070673_1001264242 | 399 |
| 286 | 3300005364 | Ga0070673_100155285 | Ga0070673_1001552852 | 399 |
| 287 | 3300005438 | Ga0070701_10078031 | Ga0070701_100780312 | 399 |
| 288 | 3300005441 | Ga0070700_100148097 | Ga0070700_1001480972 | 399 |
| 289 | 3300005459 | Ga0068867_100206901 | Ga0068867_1002069012 | 399 |
| 290 | 3300005468 | Ga0070707_100287150 | Ga0070707_1002871502 | 399 |
| 291 | 3300005518 | Ga0070699_100001760 | Ga0070699_1000017602 | 399 |
| 292 | 3300005536 | Ga0070697_100120214 | Ga0070697_1001202142 | 399 |
| 293 | 3300005545 | Ga0070695_100002328 | Ga0070695_1000023284 | 399 |
| 294 | 3300005548 | Ga0070665_100003106 | Ga0070665_10000310618 | 399 |
| 295 | 3300005548 | Ga0070665_100047420 | Ga0070665_1000474205 | 399 |
| 296 | 3300005548 | Ga0070665_100172675 | Ga0070665_1001726751 | 399 |
| 297 | 3300005549 | Ga0070704_100013345 | Ga0070704_1000133451 | 399 |
| 298 | 3300005563 | Ga0068855_100023926 | Ga0068855_1000239264 | 399 |
| 299 | 3300005564 | Ga0070664_100163921 | Ga0070664_1001639212 | 399 |
| 300 | 3300005615 | Ga0070702_100013036 | Ga0070702_1000130364 | 399 |
| 301 | 3300005617 | Ga0068859_100020062 | Ga0068859_1000200625 | 399 |
| 302 | 3300005618 | Ga0068864_100125007 | Ga0068864_1001250072 | 399 |
| 303 | 3300005719 | Ga0068861_100007457 | Ga0068861_1000074572 | 399 |
| 304 | 3300005841 | Ga0068863_100122832 | Ga0068863_1001228321 | 399 |
| 305 | 3300005841 | Ga0068863_100156929 | Ga0068863_1001569292 | 399 |
| 306 | 3300005842 | Ga0068858_100020921 | Ga0068858_1000209217 | 399 |
| 307 | 3300005844 | Ga0068862_100022724 | Ga0068862_1000227242 | 399 |
| 308 | 3300006042 | Ga0075368_10002646 | Ga0075368_100026463 | 399 |
| 309 | 3300006042 | Ga0075368_10010743 | Ga0075368_100107432 | 399 |
| 310 | 3300006195 | Ga0075366_10111235 | Ga0075366_101112352 | 399 |
| 311 | 3300006353 | Ga0075370_10016777 | Ga0075370_100167772 | 399 |
| 312 | 3300006846 | Ga0075430_100024767 | Ga0075430_1000247674 | 399 |
| 313 | 3300006871 | Ga0075434_100001049 | Ga0075434_10000104918 | 399 |
| 314 | 3300006871 | Ga0075434_100006547 | Ga0075434_10000654710 | 399 |
| 315 | 3300006914 | Ga0075436_100008464 | Ga0075436_1000084643 | 399 |
| 316 | 3300006931 | Ga0097620_100020062 | Ga0097620_1000200625 | 399 |
| 317 | 3300007076 | Ga0075435_100000213 | Ga0075435_10000021318 | 399 |
| 318 | 3300009098 | Ga0105245_10238498 | Ga0105245_102384982 | 399 |
| 319 | 3300009147 | Ga0114129_10044612 | Ga0114129_100446123 | 399 |
| 320 | 3300009176 | Ga0105242_10011789 | Ga0105242_100117895 | 399 |
| 321 | 3300013296 | Ga0157374_10015227 | Ga0157374_100152276 | 399 |
| 322 | 3300013308 | Ga0157375_10230677 | Ga0157375_102306772 | 399 |
| 323 | 3300014745 | Ga0157377_10074316 | Ga0157377_100743161 | 399 |
| 324 | 3300014968 | Ga0157379_10075345 | Ga0157379_100753453 | 399 |
| 325 | 3300014969 | Ga0157376_10019672 | Ga0157376_100196725 | 399 |
| 326 | 3300014969 | Ga0157376_10089394 | Ga0157376_100893942 | 399 |
| 327 | 3300017792 | Ga0163161_10005036 | Ga0163161_100050365 | 399 |
| 328 | 3300025903 | Ga0207680_10009146 | Ga0207680_100091462 | 399 |
| 329 | 3300025909 | Ga0207705_10031800 | Ga0207705_100318003 | 399 |
| 330 | 3300025921 | Ga0207652_10032531 | Ga0207652_100325312 | 399 |
| 331 | 3300025940 | Ga0207691_10048878 | Ga0207691_100488784 | 399 |
| 332 | 3300025960 | Ga0207651_10029444 | Ga0207651_100294442 | 399 |
| 333 | 3300025961 | Ga0207712_10058936 | Ga0207712_100589363 | 399 |
| 334 | 3300026035 | Ga0207703_10033634 | Ga0207703_100336342 | 399 |
| 335 | 3300026095 | Ga0207676_10347253 | Ga0207676_103472531 | 399 |
| 336 | 3300026118 | Ga0207675_100013041 | Ga0207675_1000130412 | 399 |
| 337 | 3300026121 | Ga0207683_10062123 | Ga0207683_100621232 | 399 |
| 338 | 3300026142 | Ga0207698_10050680 | Ga0207698_100506802 | 399 |
| 339 | 3300028379 | Ga0268266_10011481 | Ga0268266_100114816 | 399 |
| 340 | 3300028380 | Ga0268265_10035978 | Ga0268265_100359783 | 399 |
| 341 | 3300028381 | Ga0268264_10080119 | Ga0268264_100801192 | 399 |
| 342 | 3300031852 | Ga0307410_10063133 | Ga0307410_100631332 | 399 |
| 343 | 3300031911 | Ga0307412_10018353 | Ga0307412_100183534 | 399 |
| 344 | 3300032126 | Ga0307415_100045924 | Ga0307415_1000459242 | 399 |
| 345 | 3300034819 | Ga0373958_0000875 | Ga0373958_0000875_2449_3648 | 399 |
| 346 | 3300034820 | Ga0373959_0009532 | Ga0373959_0009532_143_1342 | 399 |
| 347 | 3300035085 | Ga0373929_0000673 | Ga0373929_0000673_657_1856 | 399 |
| 348 | 3300035088 | Ga0373940_0001778 | Ga0373940_0001778_2566_3765 | 399 |
| 349 | 3300035090 | Ga0373949_0001556 | Ga0373949_0001556_4779_5978 | 399 |
| 350 | 3300035091 | Ga0373951_0000250 | Ga0373951_0000250_5749_6948 | 399 |
| 351 | 3300035092 | Ga0373952_0011873 | Ga0373952_0011873_38_1237 | 399 |
| 352 | 3300035112 | Ga0373932_0001839 | Ga0373932_0001839_469_1668 | 399 |
| 353 | 3300035114 | Ga0373939_0000330 | Ga0373939_0000330_9118_10317 | 399 |
| 354 | 3300035115 | Ga0373941_0001944 | Ga0373941_0001944_2779_3978 | 399 |
| 355 | 3300035121 | Ga0373960_0000553 | Ga0373960_0000553_3362_4561 | 399 |
| 356 | 3300035207 | Ga0373942_0000461 | Ga0373942_0000461_6083_7282 | 399 |
| 357 | 3300035241 | Ga0373961_0001789 | Ga0373961_0001789_3223_4422 | 399 |
| 358 | 3300035691 | Ga0373931_0058237 | Ga0373931_0058237_362_1561 | 399 |
| 359 | 3300041999 | Ga0439433_0016331 | Ga0439433_0016331_30_1274 | 399 |
| 360 | 3300042122 | Ga0450920_008379 | Ga0450920_008379_314_1552 | 399 |
| 361 | 3300042125 | Ga0450923_012758 | Ga0450923_012758_111_1349 | 399 |
| 362 | 3300045051 | Ga0451576_0003199 | Ga0451576_0003199_1681_2880 | 399 |
| 363 | 3300046522 | Ga0495643_0029339 | Ga0495643_0029339_49_1263 | 399 |
| 364 | 3300048910 | Ga0496107_0106101 | Ga0496107_0106101_136_1356 | 399 |
| 365 | 3300048913 | Ga0496110_0167139 | Ga0496110_0167139_623_1843 | 399 |
| 366 | 3300048918 | Ga0496115_0032156 | Ga0496115_0032156_121_1326 | 399 |
| 367 | 3300049572 | Ga0501036_0195179 | Ga0501036_0195179_452_1657 | 399 |
| 368 | 3300049582 | Ga0501048_0045755 | Ga0501048_0045755_555_1760 | 399 |
| 369 | 3300049587 | Ga0501071_0044245 | Ga0501071_0044245_556_1761 | 399 |
| 370 | 3300049588 | Ga0501072_0033988 | Ga0501072_0033988_2192_3397 | 399 |
| 371 | 3300049591 | Ga0501075_0013657 | Ga0501075_0013657_2638_3843 | 399 |
| 372 | 3300049592 | Ga0501076_0027892 | Ga0501076_0027892_1584_2789 | 399 |
| 373 | 3300049592 | Ga0501076_0166821 | Ga0501076_0166821_322_1539 | 399 |
| 374 | 3300050491 | nmdc:mga00v17_50774_c1 | nmdc:mga00v17_50774_c1_1110_2348 | 399 |
| 375 | 3300050492 | nmdc:mga0yw44_165056_c1 | nmdc:mga0yw44_165056_c1_94_1335 | 399 |
| 376 | 3300050493 | nmdc:mga0k408_36239_c1 | nmdc:mga0k408_36239_c1_152_1387 | 399 |
| 377 | 3300050493 | nmdc:mga0k408_54998_c1 | nmdc:mga0k408_54998_c1_1027_2259 | 399 |
| 378 | 3300050496 | nmdc:mga07m45_25398_c2 | nmdc:mga07m45_25398_c2_894_2129 | 399 |
| 379 | 3300050507 | nmdc:mga05p37_42401_c1 | nmdc:mga05p37_42401_c1_1314_2522 | 399 |
| 380 | 3300050509 | nmdc:mga0qj67_22084_c1 | nmdc:mga0qj67_22084_c1_953_2161 | 399 |
| 381 | 3300050509 | nmdc:mga0qj67_60442_c1 | nmdc:mga0qj67_60442_c1_1436_2659 | 399 |
| 382 | 3300050512 | nmdc:mga0n895_173_c1 | nmdc:mga0n895_173_c1_21292_22500 | 399 |
| 383 | 3300050512 | nmdc:mga0n895_5460_c1 | nmdc:mga0n895_5460_c1_9258_10466 | 399 |
| 384 | 3300050513 | nmdc:mga0rr50_126967_c1 | nmdc:mga0rr50_126967_c1_682_1887 | 399 |
| 385 | 3300050513 | nmdc:mga0rr50_2_c1 | nmdc:mga0rr50_2_c1_327136_328344 | 399 |
| 386 | 3300050513 | nmdc:mga0rr50_89446_c1 | nmdc:mga0rr50_89446_c1_327_1565 | 399 |
| 387 | 3300050514 | nmdc:mga08x19_24019_c1 | nmdc:mga08x19_24019_c1_1155_2363 | 399 |
| 388 | 3300050514 | nmdc:mga08x19_452_c1 | nmdc:mga08x19_452_c1_7394_8602 | 399 |
| 389 | 3300053077 | Ga0495601_0003629 | Ga0495601_0003629_2055_3275 | 399 |
| 390 | 3300053085 | Ga0495619_0021667 | Ga0495619_0021667_2832_4052 | 399 |
| 391 | 3300060353 | Ga0501082_0083506 | Ga0501082_0083506_208_1410 | 399 |
| 392 | 3300001977 | JGI24746J21847_1000226 | JGI24746J21847_10002262 | 400 |
| 393 | 3300003203 | JGI25406J46586_10003400 | JGI25406J46586_100034002 | 400 |
| 394 | 3300005289 | Ga0065704_10079193 | Ga0065704_100791934 | 400 |
| 395 | 3300005290 | Ga0065712_10007258 | Ga0065712_100072582 | 400 |
| 396 | 3300005290 | Ga0065712_10011325 | Ga0065712_100113253 | 400 |
| 397 | 3300005290 | Ga0065712_10068725 | Ga0065712_1006872510 | 400 |
| 398 | 3300005290 | Ga0065712_10077341 | Ga0065712_100773413 | 400 |
| 399 | 3300005290 | Ga0065712_10080235 | Ga0065712_100802352 | 400 |
| 400 | 3300005293 | Ga0065715_10090819 | Ga0065715_100908191 | 400 |
| 401 | 3300005293 | Ga0065715_10102890 | Ga0065715_101028901 | 400 |
| 402 | 3300005293 | Ga0065715_10110296 | Ga0065715_101102963 | 400 |
| 403 | 3300005293 | Ga0065715_10132562 | Ga0065715_101325622 | 400 |
| 404 | 3300005293 | Ga0065715_10192023 | Ga0065715_101920231 | 400 |
| 405 | 3300005295 | Ga0065707_10008899 | Ga0065707_100088992 | 400 |
| 406 | 3300005295 | Ga0065707_10094284 | Ga0065707_100942843 | 400 |
| 407 | 3300005295 | Ga0065707_10099266 | Ga0065707_100992662 | 400 |
| 408 | 3300005327 | Ga0070658_10025668 | Ga0070658_100256682 | 400 |
| 409 | 3300005328 | Ga0070676_10001466 | Ga0070676_100014669 | 400 |
| 410 | 3300005328 | Ga0070676_10041319 | Ga0070676_100413192 | 400 |
| 411 | 3300005328 | Ga0070676_10065562 | Ga0070676_100655622 | 400 |
| 412 | 3300005329 | Ga0070683_100009233 | Ga0070683_1000092336 | 400 |
| 413 | 3300005329 | Ga0070683_100040413 | Ga0070683_1000404132 | 400 |
| 414 | 3300005330 | Ga0070690_100025084 | Ga0070690_1000250842 | 400 |
| 415 | 3300005330 | Ga0070690_100120191 | Ga0070690_1001201911 | 400 |
| 416 | 3300005331 | Ga0070670_100006839 | Ga0070670_1000068397 | 400 |
| 417 | 3300005331 | Ga0070670_100008844 | Ga0070670_1000088449 | 400 |
| 418 | 3300005331 | Ga0070670_100037970 | Ga0070670_1000379703 | 400 |
| 419 | 3300005331 | Ga0070670_100123603 | Ga0070670_1001236032 | 400 |
| 420 | 3300005334 | Ga0068869_100002498 | Ga0068869_1000024982 | 400 |
| 421 | 3300005334 | Ga0068869_100009274 | Ga0068869_1000092746 | 400 |
| 422 | 3300005334 | Ga0068869_100022727 | Ga0068869_1000227274 | 400 |
| 423 | 3300005335 | Ga0070666_10029797 | Ga0070666_100297974 | 400 |
| 424 | 3300005335 | Ga0070666_10112000 | Ga0070666_101120002 | 400 |
| 425 | 3300005335 | Ga0070666_10178262 | Ga0070666_101782621 | 400 |
| 426 | 3300005338 | Ga0068868_100194480 | Ga0068868_1001944802 | 400 |
| 427 | 3300005340 | Ga0070689_100035932 | Ga0070689_1000359322 | 400 |
| 428 | 3300005340 | Ga0070689_100060359 | Ga0070689_1000603593 | 400 |
| 429 | 3300005340 | Ga0070689_100090596 | Ga0070689_1000905962 | 400 |
| 430 | 3300005340 | Ga0070689_100162245 | Ga0070689_1001622452 | 400 |
| 431 | 3300005343 | Ga0070687_100018084 | Ga0070687_1000180843 | 400 |
| 432 | 3300005345 | Ga0070692_10008777 | Ga0070692_100087772 | 400 |
| 433 | 3300005347 | Ga0070668_100193341 | Ga0070668_1001933411 | 400 |
| 434 | 3300005353 | Ga0070669_100000448 | Ga0070669_1000004488 | 400 |
| 435 | 3300005353 | Ga0070669_100006945 | Ga0070669_1000069452 | 400 |
| 436 | 3300005353 | Ga0070669_100013978 | Ga0070669_1000139784 | 400 |
| 437 | 3300005353 | Ga0070669_100030385 | Ga0070669_1000303853 | 400 |
| 438 | 3300005353 | Ga0070669_100080683 | Ga0070669_1000806832 | 400 |
| 439 | 3300005353 | Ga0070669_100147150 | Ga0070669_1001471502 | 400 |
| 440 | 3300005353 | Ga0070669_100156427 | Ga0070669_1001564272 | 400 |
| 441 | 3300005354 | Ga0070675_100000079 | Ga0070675_10000007947 | 400 |
| 442 | 3300005354 | Ga0070675_100001092 | Ga0070675_1000010928 | 400 |
| 443 | 3300005354 | Ga0070675_100004445 | Ga0070675_1000044455 | 400 |
| 444 | 3300005354 | Ga0070675_100030474 | Ga0070675_1000304742 | 400 |
| 445 | 3300005354 | Ga0070675_100150010 | Ga0070675_1001500102 | 400 |
| 446 | 3300005355 | Ga0070671_100009064 | Ga0070671_1000090646 | 400 |
| 447 | 3300005355 | Ga0070671_100037811 | Ga0070671_1000378113 | 400 |
| 448 | 3300005355 | Ga0070671_100129684 | Ga0070671_1001296842 | 400 |
| 449 | 3300005355 | Ga0070671_100135395 | Ga0070671_1001353952 | 400 |
| 450 | 3300005355 | Ga0070671_100347063 | Ga0070671_1003470631 | 400 |
| 451 | 3300005356 | Ga0070674_100000386 | Ga0070674_10000038620 | 400 |
| 452 | 3300005356 | Ga0070674_100008928 | Ga0070674_1000089282 | 400 |
| 453 | 3300005364 | Ga0070673_100004167 | Ga0070673_1000041674 | 400 |
| 454 | 3300005364 | Ga0070673_100024924 | Ga0070673_1000249244 | 400 |
| 455 | 3300005364 | Ga0070673_100025921 | Ga0070673_1000259213 | 400 |
| 456 | 3300005364 | Ga0070673_100061982 | Ga0070673_1000619822 | 400 |
| 457 | 3300005364 | Ga0070673_100097137 | Ga0070673_1000971372 | 400 |
| 458 | 3300005364 | Ga0070673_100158533 | Ga0070673_1001585332 | 400 |
| 459 | 3300005365 | Ga0070688_100077951 | Ga0070688_1000779511 | 400 |
| 460 | 3300005365 | Ga0070688_100093483 | Ga0070688_1000934832 | 400 |
| 461 | 3300005367 | Ga0070667_100031743 | Ga0070667_1000317434 | 400 |
| 462 | 3300005438 | Ga0070701_10031960 | Ga0070701_100319603 | 400 |
| 463 | 3300005438 | Ga0070701_10058005 | Ga0070701_100580052 | 400 |
| 464 | 3300005440 | Ga0070705_100003620 | Ga0070705_1000036203 | 400 |
| 465 | 3300005440 | Ga0070705_100006536 | Ga0070705_1000065362 | 400 |
| 466 | 3300005441 | Ga0070700_100002568 | Ga0070700_1000025685 | 400 |
| 467 | 3300005444 | Ga0070694_100001458 | Ga0070694_1000014587 | 400 |
| 468 | 3300005444 | Ga0070694_100142600 | Ga0070694_1001426002 | 400 |
| 469 | 3300005445 | Ga0070708_100056855 | Ga0070708_1000568552 | 400 |
| 470 | 3300005456 | Ga0070678_100002634 | Ga0070678_1000026349 | 400 |
| 471 | 3300005456 | Ga0070678_100046333 | Ga0070678_1000463333 | 400 |
| 472 | 3300005456 | Ga0070678_100109597 | Ga0070678_1001095972 | 400 |
| 473 | 3300005457 | Ga0070662_100003754 | Ga0070662_1000037542 | 400 |
| 474 | 3300005458 | Ga0070681_10058453 | Ga0070681_100584532 | 400 |
| 475 | 3300005458 | Ga0070681_10227774 | Ga0070681_102277741 | 400 |
| 476 | 3300005459 | Ga0068867_100000717 | Ga0068867_1000007174 | 400 |
| 477 | 3300005466 | Ga0070685_10003826 | Ga0070685_100038261 | 400 |
| 478 | 3300005466 | Ga0070685_10041476 | Ga0070685_100414763 | 400 |
| 479 | 3300005471 | Ga0070698_100058674 | Ga0070698_1000586743 | 400 |
| 480 | 3300005471 | Ga0070698_100144729 | Ga0070698_1001447292 | 400 |
| 481 | 3300005471 | Ga0070698_100233180 | Ga0070698_1002331802 | 400 |
| 482 | 3300005518 | Ga0070699_100005713 | Ga0070699_1000057139 | 400 |
| 483 | 3300005518 | Ga0070699_100030946 | Ga0070699_1000309464 | 400 |
| 484 | 3300005518 | Ga0070699_100047938 | Ga0070699_1000479383 | 400 |
| 485 | 3300005530 | Ga0070679_100169943 | Ga0070679_1001699432 | 400 |
| 486 | 3300005535 | Ga0070684_100001529 | Ga0070684_1000015293 | 400 |
| 487 | 3300005535 | Ga0070684_100020841 | Ga0070684_1000208415 | 400 |
| 488 | 3300005535 | Ga0070684_100021042 | Ga0070684_1000210422 | 400 |
| 489 | 3300005536 | Ga0070697_100079448 | Ga0070697_1000794482 | 400 |
| 490 | 3300005543 | Ga0070672_100006035 | Ga0070672_1000060356 | 400 |
| 491 | 3300005543 | Ga0070672_100055481 | Ga0070672_1000554813 | 400 |
| 492 | 3300005543 | Ga0070672_100061481 | Ga0070672_1000614812 | 400 |
| 493 | 3300005543 | Ga0070672_100086262 | Ga0070672_1000862622 | 400 |
| 494 | 3300005544 | Ga0070686_100015636 | Ga0070686_1000156364 | 400 |
| 495 | 3300005545 | Ga0070695_100000171 | Ga0070695_10000017110 | 400 |
| 496 | 3300005546 | Ga0070696_100000124 | Ga0070696_1000001246 | 400 |
| 497 | 3300005548 | Ga0070665_100045245 | Ga0070665_1000452455 | 400 |
| 498 | 3300005549 | Ga0070704_100000145 | Ga0070704_1000001459 | 400 |
| 499 | 3300005549 | Ga0070704_100013519 | Ga0070704_1000135193 | 400 |
| 500 | 3300005549 | Ga0070704_100040574 | Ga0070704_1000405743 | 400 |
| 501 | 3300005549 | Ga0070704_100045242 | Ga0070704_1000452422 | 400 |
| 502 | 3300005549 | Ga0070704_100058374 | Ga0070704_1000583742 | 400 |
| 503 | 3300005564 | Ga0070664_100002901 | Ga0070664_10000290110 | 400 |
| 504 | 3300005564 | Ga0070664_100014926 | Ga0070664_1000149262 | 400 |
| 505 | 3300005564 | Ga0070664_100032600 | Ga0070664_1000326003 | 400 |
| 506 | 3300005564 | Ga0070664_100094327 | Ga0070664_1000943273 | 400 |
| 507 | 3300005564 | Ga0070664_100094406 | Ga0070664_1000944062 | 400 |
| 508 | 3300005578 | Ga0068854_100134749 | Ga0068854_1001347492 | 400 |
| 509 | 3300005615 | Ga0070702_100008169 | Ga0070702_1000081693 | 400 |
| 510 | 3300005615 | Ga0070702_100078660 | Ga0070702_1000786602 | 400 |
| 511 | 3300005617 | Ga0068859_100002171 | Ga0068859_1000021717 | 400 |
| 512 | 3300005617 | Ga0068859_100016970 | Ga0068859_1000169708 | 400 |
| 513 | 3300005617 | Ga0068859_100029009 | Ga0068859_1000290093 | 400 |
| 514 | 3300005617 | Ga0068859_100141712 | Ga0068859_1001417122 | 400 |
| 515 | 3300005617 | Ga0068859_100152747 | Ga0068859_1001527472 | 400 |
| 516 | 3300005618 | Ga0068864_100019648 | Ga0068864_1000196485 | 400 |
| 517 | 3300005618 | Ga0068864_100051184 | Ga0068864_1000511843 | 400 |
| 518 | 3300005718 | Ga0068866_10003215 | Ga0068866_100032154 | 400 |
| 519 | 3300005719 | Ga0068861_100009126 | Ga0068861_1000091263 | 400 |
| 520 | 3300005719 | Ga0068861_100024227 | Ga0068861_1000242273 | 400 |
| 521 | 3300005719 | Ga0068861_100088181 | Ga0068861_1000881812 | 400 |
| 522 | 3300005719 | Ga0068861_100136399 | Ga0068861_1001363992 | 400 |
| 523 | 3300005840 | Ga0068870_10008434 | Ga0068870_100084344 | 400 |
| 524 | 3300005840 | Ga0068870_10037466 | Ga0068870_100374663 | 400 |
| 525 | 3300005841 | Ga0068863_100009990 | Ga0068863_1000099907 | 400 |
| 526 | 3300005841 | Ga0068863_100027693 | Ga0068863_1000276933 | 400 |
| 527 | 3300005842 | Ga0068858_100002245 | Ga0068858_1000022458 | 400 |
| 528 | 3300005842 | Ga0068858_100006285 | Ga0068858_10000628513 | 400 |
| 529 | 3300005842 | Ga0068858_100006973 | Ga0068858_10000697311 | 400 |
| 530 | 3300005842 | Ga0068858_100018755 | Ga0068858_1000187554 | 400 |
| 531 | 3300005842 | Ga0068858_100191854 | Ga0068858_1001918542 | 400 |
| 532 | 3300005842 | Ga0068858_100222249 | Ga0068858_1002222492 | 400 |
| 533 | 3300005842 | Ga0068858_100232534 | Ga0068858_1002325342 | 400 |
| 534 | 3300005843 | Ga0068860_100014536 | Ga0068860_1000145363 | 400 |
| 535 | 3300005844 | Ga0068862_100004218 | Ga0068862_1000042189 | 400 |
| 536 | 3300005844 | Ga0068862_100034614 | Ga0068862_1000346143 | 400 |
| 537 | 3300005844 | Ga0068862_100291939 | Ga0068862_1002919391 | 400 |
| 538 | 3300005981 | Ga0081538_10083325 | Ga0081538_100833251 | 400 |
| 539 | 3300005985 | Ga0081539_10000122 | Ga0081539_1000012264 | 400 |
| 540 | 3300005985 | Ga0081539_10000251 | Ga0081539_1000025148 | 400 |
| 541 | 3300005985 | Ga0081539_10001218 | Ga0081539_100012187 | 400 |
| 542 | 3300005985 | Ga0081539_10014209 | Ga0081539_100142096 | 400 |
| 543 | 3300005985 | Ga0081539_10023830 | Ga0081539_100238302 | 400 |
| 544 | 3300006058 | Ga0075432_10012783 | Ga0075432_100127833 | 400 |
| 545 | 3300006178 | Ga0075367_10044818 | Ga0075367_100448183 | 400 |
| 546 | 3300006237 | Ga0097621_100031186 | Ga0097621_1000311864 | 400 |
| 547 | 3300006237 | Ga0097621_100041097 | Ga0097621_1000410972 | 400 |
| 548 | 3300006237 | Ga0097621_100090819 | Ga0097621_1000908192 | 400 |
| 549 | 3300006358 | Ga0068871_100006536 | Ga0068871_10000653610 | 400 |
| 550 | 3300006358 | Ga0068871_100013495 | Ga0068871_1000134956 | 400 |
| 551 | 3300006358 | Ga0068871_100015641 | Ga0068871_1000156416 | 400 |
| 552 | 3300006358 | Ga0068871_100029695 | Ga0068871_1000296953 | 400 |
| 553 | 3300006844 | Ga0075428_100000607 | Ga0075428_10000060728 | 400 |
| 554 | 3300006844 | Ga0075428_100004905 | Ga0075428_10000490510 | 400 |
| 555 | 3300006844 | Ga0075428_100005950 | Ga0075428_1000059507 | 400 |
| 556 | 3300006844 | Ga0075428_100006210 | Ga0075428_1000062109 | 400 |
| 557 | 3300006844 | Ga0075428_100008246 | Ga0075428_1000082464 | 400 |
| 558 | 3300006844 | Ga0075428_100012598 | Ga0075428_1000125982 | 400 |
| 559 | 3300006844 | Ga0075428_100016111 | Ga0075428_1000161116 | 400 |
| 560 | 3300006844 | Ga0075428_100016407 | Ga0075428_1000164078 | 400 |
| 561 | 3300006844 | Ga0075428_100023613 | Ga0075428_1000236137 | 400 |
| 562 | 3300006844 | Ga0075428_100099420 | Ga0075428_1000994202 | 400 |
| 563 | 3300006844 | Ga0075428_100167471 | Ga0075428_1001674712 | 400 |
| 564 | 3300006846 | Ga0075430_100000792 | Ga0075430_1000007929 | 400 |
| 565 | 3300006846 | Ga0075430_100002319 | Ga0075430_10000231911 | 400 |
| 566 | 3300006846 | Ga0075430_100038845 | Ga0075430_1000388453 | 400 |
| 567 | 3300006846 | Ga0075430_100106553 | Ga0075430_1001065532 | 400 |
| 568 | 3300006847 | Ga0075431_100003925 | Ga0075431_10000392510 | 400 |
| 569 | 3300006847 | Ga0075431_100004102 | Ga0075431_1000041028 | 400 |
| 570 | 3300006847 | Ga0075431_100011761 | Ga0075431_1000117613 | 400 |
| 571 | 3300006847 | Ga0075431_100017152 | Ga0075431_1000171523 | 400 |
| 572 | 3300006847 | Ga0075431_100018285 | Ga0075431_1000182855 | 400 |
| 573 | 3300006847 | Ga0075431_100029812 | Ga0075431_1000298125 | 400 |
| 574 | 3300006847 | Ga0075431_100040075 | Ga0075431_1000400755 | 400 |
| 575 | 3300006847 | Ga0075431_100097966 | Ga0075431_1000979662 | 400 |
| 576 | 3300006847 | Ga0075431_100128295 | Ga0075431_1001282953 | 400 |
| 577 | 3300006847 | Ga0075431_100154780 | Ga0075431_1001547802 | 400 |
| 578 | 3300006847 | Ga0075431_100412836 | Ga0075431_1004128362 | 400 |
| 579 | 3300006852 | Ga0075433_10000117 | Ga0075433_100001179 | 400 |
| 580 | 3300006852 | Ga0075433_10001282 | Ga0075433_1000128217 | 400 |
| 581 | 3300006852 | Ga0075433_10032388 | Ga0075433_100323885 | 400 |
| 582 | 3300006852 | Ga0075433_10070161 | Ga0075433_100701612 | 400 |
| 583 | 3300006852 | Ga0075433_10197389 | Ga0075433_101973892 | 400 |
| 584 | 3300006871 | Ga0075434_100001628 | Ga0075434_10000162813 | 400 |
| 585 | 3300006871 | Ga0075434_100002292 | Ga0075434_10000229214 | 400 |
| 586 | 3300006871 | Ga0075434_100007494 | Ga0075434_1000074947 | 400 |
| 587 | 3300006871 | Ga0075434_100008566 | Ga0075434_1000085663 | 400 |
| 588 | 3300006871 | Ga0075434_100133283 | Ga0075434_1001332832 | 400 |
| 589 | 3300006871 | Ga0075434_100167579 | Ga0075434_1001675792 | 400 |
| 590 | 3300006871 | Ga0075434_100227357 | Ga0075434_1002273571 | 400 |
| 591 | 3300006880 | Ga0075429_100002617 | Ga0075429_1000026178 | 400 |
| 592 | 3300006880 | Ga0075429_100004049 | Ga0075429_10000404910 | 400 |
| 593 | 3300006880 | Ga0075429_100006146 | Ga0075429_1000061469 | 400 |
| 594 | 3300006880 | Ga0075429_100012495 | Ga0075429_1000124952 | 400 |
| 595 | 3300006880 | Ga0075429_100046796 | Ga0075429_1000467964 | 400 |
| 596 | 3300006881 | Ga0068865_100005679 | Ga0068865_1000056798 | 400 |
| 597 | 3300006881 | Ga0068865_100051045 | Ga0068865_1000510453 | 400 |
| 598 | 3300006881 | Ga0068865_100217855 | Ga0068865_1002178551 | 400 |
| 599 | 3300006914 | Ga0075436_100098257 | Ga0075436_1000982572 | 400 |
| 600 | 3300006931 | Ga0097620_100002171 | Ga0097620_10000217114 | 400 |
| 601 | 3300006931 | Ga0097620_100016971 | Ga0097620_1000169718 | 400 |
| 602 | 3300006931 | Ga0097620_100029008 | Ga0097620_1000290083 | 400 |
| 603 | 3300006931 | Ga0097620_100141713 | Ga0097620_1001417132 | 400 |
| 604 | 3300006931 | Ga0097620_100152754 | Ga0097620_1001527542 | 400 |
| 605 | 3300007076 | Ga0075435_100005321 | Ga0075435_1000053215 | 400 |
| 606 | 3300007076 | Ga0075435_100032983 | Ga0075435_1000329832 | 400 |
| 607 | 3300007076 | Ga0075435_100040177 | Ga0075435_1000401775 | 400 |
| 608 | 3300007076 | Ga0075435_100055651 | Ga0075435_1000556512 | 400 |
| 609 | 3300009093 | Ga0105240_10063655 | Ga0105240_100636553 | 400 |
| 610 | 3300009094 | Ga0111539_10000058 | Ga0111539_1000005892 | 400 |
| 611 | 3300009094 | Ga0111539_10000325 | Ga0111539_1000032523 | 400 |
| 612 | 3300009094 | Ga0111539_10001074 | Ga0111539_1000107422 | 400 |
| 613 | 3300009094 | Ga0111539_10001176 | Ga0111539_1000117631 | 400 |
| 614 | 3300009094 | Ga0111539_10001197 | Ga0111539_1000119727 | 400 |
| 615 | 3300009094 | Ga0111539_10003731 | Ga0111539_100037312 | 400 |
| 616 | 3300009094 | Ga0111539_10008450 | Ga0111539_1000845010 | 400 |
| 617 | 3300009094 | Ga0111539_10036302 | Ga0111539_100363023 | 400 |
| 618 | 3300009094 | Ga0111539_10041490 | Ga0111539_100414902 | 400 |
| 619 | 3300009094 | Ga0111539_10044979 | Ga0111539_100449792 | 400 |
| 620 | 3300009094 | Ga0111539_10045572 | Ga0111539_100455724 | 400 |
| 621 | 3300009094 | Ga0111539_10097285 | Ga0111539_100972852 | 400 |
| 622 | 3300009101 | Ga0105247_10031583 | Ga0105247_100315833 | 400 |
| 623 | 3300009101 | Ga0105247_10044693 | Ga0105247_100446932 | 400 |
| 624 | 3300009147 | Ga0114129_10000086 | Ga0114129_1000008628 | 400 |
| 625 | 3300009147 | Ga0114129_10000535 | Ga0114129_1000053510 | 400 |
| 626 | 3300009147 | Ga0114129_10002028 | Ga0114129_1000202826 | 400 |
| 627 | 3300009147 | Ga0114129_10002137 | Ga0114129_1000213710 | 400 |
| 628 | 3300009147 | Ga0114129_10002788 | Ga0114129_1000278813 | 400 |
| 629 | 3300009147 | Ga0114129_10010075 | Ga0114129_1001007511 | 400 |
| 630 | 3300009147 | Ga0114129_10016405 | Ga0114129_100164053 | 400 |
| 631 | 3300009147 | Ga0114129_10023419 | Ga0114129_100234196 | 400 |
| 632 | 3300009147 | Ga0114129_10027315 | Ga0114129_100273154 | 400 |
| 633 | 3300009147 | Ga0114129_10031981 | Ga0114129_100319816 | 400 |
| 634 | 3300009147 | Ga0114129_10038255 | Ga0114129_100382556 | 400 |
| 635 | 3300009147 | Ga0114129_10039441 | Ga0114129_100394415 | 400 |
| 636 | 3300009147 | Ga0114129_10049856 | Ga0114129_100498563 | 400 |
| 637 | 3300009147 | Ga0114129_10062231 | Ga0114129_100622313 | 400 |
| 638 | 3300009147 | Ga0114129_10080265 | Ga0114129_100802652 | 400 |
| 639 | 3300009147 | Ga0114129_10123072 | Ga0114129_101230723 | 400 |
| 640 | 3300009147 | Ga0114129_10188309 | Ga0114129_101883092 | 400 |
| 641 | 3300009147 | Ga0114129_10245184 | Ga0114129_102451842 | 400 |
| 642 | 3300009148 | Ga0105243_10017800 | Ga0105243_100178004 | 400 |
| 643 | 3300009148 | Ga0105243_10066362 | Ga0105243_100663623 | 400 |
| 644 | 3300009148 | Ga0105243_10073547 | Ga0105243_100735472 | 400 |
| 645 | 3300009177 | Ga0105248_10003314 | Ga0105248_100033148 | 400 |
| 646 | 3300009177 | Ga0105248_10016498 | Ga0105248_1001649810 | 400 |
| 647 | 3300009177 | Ga0105248_10080302 | Ga0105248_100803023 | 400 |
| 648 | 3300009177 | Ga0105248_10142313 | Ga0105248_101423132 | 400 |
| 649 | 3300009177 | Ga0105248_10228539 | Ga0105248_102285392 | 400 |
| 650 | 3300009177 | Ga0105248_10372020 | Ga0105248_103720201 | 400 |
| 651 | 3300009553 | Ga0105249_10001652 | Ga0105249_1000165210 | 400 |
| 652 | 3300009553 | Ga0105249_10001775 | Ga0105249_1000177511 | 400 |
| 653 | 3300009553 | Ga0105249_10111431 | Ga0105249_101114312 | 400 |
| 654 | 3300013297 | Ga0157378_10316880 | Ga0157378_103168802 | 400 |
| 655 | 3300013306 | Ga0163162_10047460 | Ga0163162_100474603 | 400 |
| 656 | 3300013306 | Ga0163162_10257726 | Ga0163162_102577261 | 400 |
| 657 | 3300013308 | Ga0157375_10068832 | Ga0157375_100688322 | 400 |
| 658 | 3300013308 | Ga0157375_10162813 | Ga0157375_101628133 | 400 |
| 659 | 3300014325 | Ga0163163_10014117 | Ga0163163_100141173 | 400 |
| 660 | 3300014325 | Ga0163163_10016032 | Ga0163163_100160322 | 400 |
| 661 | 3300014325 | Ga0163163_10019551 | Ga0163163_100195514 | 400 |
| 662 | 3300014325 | Ga0163163_10053198 | Ga0163163_100531983 | 400 |
| 663 | 3300014326 | Ga0157380_10007449 | Ga0157380_100074494 | 400 |
| 664 | 3300014745 | Ga0157377_10016113 | Ga0157377_100161134 | 400 |
| 665 | 3300014745 | Ga0157377_10055948 | Ga0157377_100559482 | 400 |
| 666 | 3300014745 | Ga0157377_10081070 | Ga0157377_100810702 | 400 |
| 667 | 3300014968 | Ga0157379_10005030 | Ga0157379_100050307 | 400 |
| 668 | 3300014968 | Ga0157379_10009001 | Ga0157379_100090017 | 400 |
| 669 | 3300014968 | Ga0157379_10058462 | Ga0157379_100584622 | 400 |
| 670 | 3300014968 | Ga0157379_10083810 | Ga0157379_100838102 | 400 |
| 671 | 3300014969 | Ga0157376_10027906 | Ga0157376_100279062 | 400 |
| 672 | 3300014969 | Ga0157376_10160799 | Ga0157376_101607992 | 400 |
| 673 | 3300014969 | Ga0157376_10172235 | Ga0157376_101722352 | 400 |
| 674 | 3300017792 | Ga0163161_10110299 | Ga0163161_101102992 | 400 |
| 675 | 3300025315 | Ga0207697_10000205 | Ga0207697_1000020513 | 400 |
| 676 | 3300025899 | Ga0207642_10008305 | Ga0207642_100083052 | 400 |
| 677 | 3300025900 | Ga0207710_10031496 | Ga0207710_100314962 | 400 |
| 678 | 3300025900 | Ga0207710_10036444 | Ga0207710_100364442 | 400 |
| 679 | 3300025901 | Ga0207688_10007917 | Ga0207688_100079176 | 400 |
| 680 | 3300025903 | Ga0207680_10154961 | Ga0207680_101549611 | 400 |
| 681 | 3300025907 | Ga0207645_10000604 | Ga0207645_1000060413 | 400 |
| 682 | 3300025907 | Ga0207645_10032096 | Ga0207645_100320962 | 400 |
| 683 | 3300025907 | Ga0207645_10058829 | Ga0207645_100588292 | 400 |
| 684 | 3300025908 | Ga0207643_10000388 | Ga0207643_100003885 | 400 |
| 685 | 3300025908 | Ga0207643_10006413 | Ga0207643_100064135 | 400 |
| 686 | 3300025908 | Ga0207643_10033820 | Ga0207643_100338202 | 400 |
| 687 | 3300025908 | Ga0207643_10049928 | Ga0207643_100499282 | 400 |
| 688 | 3300025912 | Ga0207707_10039997 | Ga0207707_100399974 | 400 |
| 689 | 3300025912 | Ga0207707_10070430 | Ga0207707_100704302 | 400 |
| 690 | 3300025916 | Ga0207663_10048110 | Ga0207663_100481102 | 400 |
| 691 | 3300025918 | Ga0207662_10000796 | Ga0207662_100007969 | 400 |
| 692 | 3300025918 | Ga0207662_10007461 | Ga0207662_100074613 | 400 |
| 693 | 3300025918 | Ga0207662_10115908 | Ga0207662_101159082 | 400 |
| 694 | 3300025921 | Ga0207652_10165214 | Ga0207652_101652141 | 400 |
| 695 | 3300025922 | Ga0207646_10196321 | Ga0207646_101963212 | 400 |
| 696 | 3300025923 | Ga0207681_10003972 | Ga0207681_100039726 | 400 |
| 697 | 3300025923 | Ga0207681_10004122 | Ga0207681_100041226 | 400 |
| 698 | 3300025923 | Ga0207681_10017019 | Ga0207681_100170193 | 400 |
| 699 | 3300025923 | Ga0207681_10044318 | Ga0207681_100443182 | 400 |
| 700 | 3300025923 | Ga0207681_10060744 | Ga0207681_100607442 | 400 |
| 701 | 3300025923 | Ga0207681_10138819 | Ga0207681_101388192 | 400 |
| 702 | 3300025923 | Ga0207681_10139520 | Ga0207681_101395202 | 400 |
| 703 | 3300025923 | Ga0207681_10201374 | Ga0207681_102013742 | 400 |
| 704 | 3300025925 | Ga0207650_10014068 | Ga0207650_100140684 | 400 |
| 705 | 3300025925 | Ga0207650_10044468 | Ga0207650_100444682 | 400 |
| 706 | 3300025925 | Ga0207650_10046750 | Ga0207650_100467502 | 400 |
| 707 | 3300025925 | Ga0207650_10125624 | Ga0207650_101256242 | 400 |
| 708 | 3300025926 | Ga0207659_10000293 | Ga0207659_1000029329 | 400 |
| 709 | 3300025926 | Ga0207659_10000326 | Ga0207659_1000032621 | 400 |
| 710 | 3300025926 | Ga0207659_10004827 | Ga0207659_100048276 | 400 |
| 711 | 3300025926 | Ga0207659_10035608 | Ga0207659_100356082 | 400 |
| 712 | 3300025926 | Ga0207659_10060834 | Ga0207659_100608343 | 400 |
| 713 | 3300025926 | Ga0207659_10064840 | Ga0207659_100648402 | 400 |
| 714 | 3300025926 | Ga0207659_10119343 | Ga0207659_101193432 | 400 |
| 715 | 3300025926 | Ga0207659_10130139 | Ga0207659_101301392 | 400 |
| 716 | 3300025931 | Ga0207644_10075050 | Ga0207644_100750502 | 400 |
| 717 | 3300025931 | Ga0207644_10083047 | Ga0207644_100830473 | 400 |
| 718 | 3300025931 | Ga0207644_10114181 | Ga0207644_101141812 | 400 |
| 719 | 3300025931 | Ga0207644_10197862 | Ga0207644_101978622 | 400 |
| 720 | 3300025931 | Ga0207644_10264263 | Ga0207644_102642632 | 400 |
| 721 | 3300025933 | Ga0207706_10005654 | Ga0207706_100056546 | 400 |
| 722 | 3300025933 | Ga0207706_10014400 | Ga0207706_100144004 | 400 |
| 723 | 3300025933 | Ga0207706_10027132 | Ga0207706_100271322 | 400 |
| 724 | 3300025934 | Ga0207686_10010314 | Ga0207686_100103142 | 400 |
| 725 | 3300025935 | Ga0207709_10032830 | Ga0207709_100328303 | 400 |
| 726 | 3300025936 | Ga0207670_10021563 | Ga0207670_100215632 | 400 |
| 727 | 3300025936 | Ga0207670_10130450 | Ga0207670_101304502 | 400 |
| 728 | 3300025937 | Ga0207669_10000485 | Ga0207669_100004852 | 400 |
| 729 | 3300025937 | Ga0207669_10010988 | Ga0207669_100109884 | 400 |
| 730 | 3300025937 | Ga0207669_10098565 | Ga0207669_100985652 | 400 |
| 731 | 3300025937 | Ga0207669_10121022 | Ga0207669_101210222 | 400 |
| 732 | 3300025937 | Ga0207669_10165286 | Ga0207669_101652862 | 400 |
| 733 | 3300025940 | Ga0207691_10003596 | Ga0207691_1000359612 | 400 |
| 734 | 3300025940 | Ga0207691_10009207 | Ga0207691_100092078 | 400 |
| 735 | 3300025940 | Ga0207691_10049213 | Ga0207691_100492132 | 400 |
| 736 | 3300025940 | Ga0207691_10055638 | Ga0207691_100556382 | 400 |
| 737 | 3300025940 | Ga0207691_10084610 | Ga0207691_100846102 | 400 |
| 738 | 3300025941 | Ga0207711_10029567 | Ga0207711_100295674 | 400 |
| 739 | 3300025941 | Ga0207711_10088702 | Ga0207711_100887022 | 400 |
| 740 | 3300025942 | Ga0207689_10000493 | Ga0207689_1000049326 | 400 |
| 741 | 3300025942 | Ga0207689_10053565 | Ga0207689_100535651 | 400 |
| 742 | 3300025942 | Ga0207689_10088221 | Ga0207689_100882212 | 400 |
| 743 | 3300025944 | Ga0207661_10065095 | Ga0207661_100650953 | 400 |
| 744 | 3300025944 | Ga0207661_10065705 | Ga0207661_100657053 | 400 |
| 745 | 3300025945 | Ga0207679_10001534 | Ga0207679_100015343 | 400 |
| 746 | 3300025945 | Ga0207679_10072946 | Ga0207679_100729462 | 400 |
| 747 | 3300025945 | Ga0207679_10086401 | Ga0207679_100864012 | 400 |
| 748 | 3300025945 | Ga0207679_10268517 | Ga0207679_102685172 | 400 |
| 749 | 3300025960 | Ga0207651_10021752 | Ga0207651_100217522 | 400 |
| 750 | 3300025960 | Ga0207651_10068391 | Ga0207651_100683912 | 400 |
| 751 | 3300025960 | Ga0207651_10116925 | Ga0207651_101169252 | 400 |
| 752 | 3300025960 | Ga0207651_10132945 | Ga0207651_101329452 | 400 |
| 753 | 3300025961 | Ga0207712_10011403 | Ga0207712_100114032 | 400 |
| 754 | 3300025961 | Ga0207712_10077446 | Ga0207712_100774463 | 400 |
| 755 | 3300025961 | Ga0207712_10136502 | Ga0207712_101365022 | 400 |
| 756 | 3300025972 | Ga0207668_10110065 | Ga0207668_101100652 | 400 |
| 757 | 3300025986 | Ga0207658_10022741 | Ga0207658_100227415 | 400 |
| 758 | 3300026023 | Ga0207677_10194243 | Ga0207677_101942432 | 400 |
| 759 | 3300026035 | Ga0207703_10011640 | Ga0207703_100116402 | 400 |
| 760 | 3300026035 | Ga0207703_10018232 | Ga0207703_100182325 | 400 |
| 761 | 3300026035 | Ga0207703_10026021 | Ga0207703_100260214 | 400 |
| 762 | 3300026035 | Ga0207703_10058550 | Ga0207703_100585502 | 400 |
| 763 | 3300026035 | Ga0207703_10157326 | Ga0207703_101573262 | 400 |
| 764 | 3300026035 | Ga0207703_10234319 | Ga0207703_102343192 | 400 |
| 765 | 3300026075 | Ga0207708_10005513 | Ga0207708_100055139 | 400 |
| 766 | 3300026075 | Ga0207708_10023061 | Ga0207708_100230614 | 400 |
| 767 | 3300026075 | Ga0207708_10110670 | Ga0207708_101106701 | 400 |
| 768 | 3300026088 | Ga0207641_10014455 | Ga0207641_100144553 | 400 |
| 769 | 3300026088 | Ga0207641_10024274 | Ga0207641_100242743 | 400 |
| 770 | 3300026089 | Ga0207648_10000066 | Ga0207648_1000006652 | 400 |
| 771 | 3300026089 | Ga0207648_10001196 | Ga0207648_1000119615 | 400 |
| 772 | 3300026089 | Ga0207648_10083107 | Ga0207648_100831072 | 400 |
| 773 | 3300026095 | Ga0207676_10026424 | Ga0207676_100264244 | 400 |
| 774 | 3300026116 | Ga0207674_10008960 | Ga0207674_100089604 | 400 |
| 775 | 3300026116 | Ga0207674_10054035 | Ga0207674_100540353 | 400 |
| 776 | 3300026116 | Ga0207674_10172504 | Ga0207674_101725043 | 400 |
| 777 | 3300026118 | Ga0207675_100003750 | Ga0207675_1000037509 | 400 |
| 778 | 3300026118 | Ga0207675_100006154 | Ga0207675_1000061547 | 400 |
| 779 | 3300026118 | Ga0207675_100052306 | Ga0207675_1000523063 | 400 |
| 780 | 3300026118 | Ga0207675_100059970 | Ga0207675_1000599703 | 400 |
| 781 | 3300026118 | Ga0207675_100349512 | Ga0207675_1003495122 | 400 |
| 782 | 3300026121 | Ga0207683_10017391 | Ga0207683_100173916 | 400 |
| 783 | 3300026121 | Ga0207683_10063363 | Ga0207683_100633632 | 400 |
| 784 | 3300026142 | Ga0207698_10032059 | Ga0207698_100320593 | 400 |
| 785 | 3300027907 | Ga0207428_10000384 | Ga0207428_1000038442 | 400 |
| 786 | 3300027907 | Ga0207428_10001147 | Ga0207428_100011474 | 400 |
| 787 | 3300027907 | Ga0207428_10002004 | Ga0207428_1000200415 | 400 |
| 788 | 3300027907 | Ga0207428_10002555 | Ga0207428_1000255513 | 400 |
| 789 | 3300027907 | Ga0207428_10003877 | Ga0207428_1000387710 | 400 |
| 790 | 3300027907 | Ga0207428_10004178 | Ga0207428_100041787 | 400 |
| 791 | 3300027907 | Ga0207428_10034723 | Ga0207428_100347232 | 400 |
| 792 | 3300027907 | Ga0207428_10039463 | Ga0207428_100394632 | 400 |
| 793 | 3300027907 | Ga0207428_10056760 | Ga0207428_100567602 | 400 |
| 794 | 3300027907 | Ga0207428_10136632 | Ga0207428_101366322 | 400 |
| 795 | 3300027907 | Ga0207428_10148612 | Ga0207428_101486122 | 400 |
| 796 | 3300028379 | Ga0268266_10015827 | Ga0268266_100158272 | 400 |
| 797 | 3300028380 | Ga0268265_10000073 | Ga0268265_1000007350 | 400 |
| 798 | 3300028380 | Ga0268265_10004027 | Ga0268265_100040275 | 400 |
| 799 | 3300028380 | Ga0268265_10175603 | Ga0268265_101756032 | 400 |
| 800 | 3300028380 | Ga0268265_10240934 | Ga0268265_102409342 | 400 |
| 801 | 3300028381 | Ga0268264_10146810 | Ga0268264_101468102 | 400 |
| 802 | 3300031548 | Ga0307408_100155550 | Ga0307408_1001555501 | 400 |
| 803 | 3300031824 | Ga0307413_10008660 | Ga0307413_100086604 | 400 |
| 804 | 3300031852 | Ga0307410_10087645 | Ga0307410_100876452 | 400 |
| 805 | 3300031901 | Ga0307406_10009340 | Ga0307406_100093405 | 400 |
| 806 | 3300031901 | Ga0307406_10159921 | Ga0307406_101599212 | 400 |
| 807 | 3300031903 | Ga0307407_10042645 | Ga0307407_100426452 | 400 |
| 808 | 3300031903 | Ga0307407_10132996 | Ga0307407_101329961 | 400 |
| 809 | 3300031911 | Ga0307412_10020109 | Ga0307412_100201094 | 400 |
| 810 | 3300031995 | Ga0307409_100045742 | Ga0307409_1000457423 | 400 |
| 811 | 3300031995 | Ga0307409_100100724 | Ga0307409_1001007242 | 400 |
| 812 | 3300031995 | Ga0307409_100104797 | Ga0307409_1001047972 | 400 |
| 813 | 3300032002 | Ga0307416_100013387 | Ga0307416_1000133876 | 400 |
| 814 | 3300032005 | Ga0307411_10008606 | Ga0307411_100086062 | 400 |
| 815 | 3300032005 | Ga0307411_10067754 | Ga0307411_100677542 | 400 |
| 816 | 3300032126 | Ga0307415_100024184 | Ga0307415_1000241842 | 400 |
| 817 | 3300032126 | Ga0307415_100044876 | Ga0307415_1000448763 | 400 |
| 818 | 3300032126 | Ga0307415_100049048 | Ga0307415_1000490482 | 400 |
| 819 | 3300032126 | Ga0307415_100137416 | Ga0307415_1001374162 | 400 |
| 820 | 3300035170 | Ga0373943_0027502 | Ga0373943_0027502_919_2157 | 400 |
| 821 | 3300035171 | Ga0373946_0007807 | Ga0373946_0007807_1445_2683 | 400 |
| 822 | 3300035172 | Ga0373955_0024945 | Ga0373955_0024945_392_1630 | 400 |
| 823 | 3300035241 | Ga0373961_0022355 | Ga0373961_0022355_102_1313 | 400 |
| 824 | 3300035410 | Ga0373924_0005767 | Ga0373924_0005767_1998_3236 | 400 |
| 825 | 3300035691 | Ga0373931_0027480 | Ga0373931_0027480_441_1652 | 400 |
| 826 | 3300035692 | Ga0373935_0073940 | Ga0373935_0073940_796_2034 | 400 |
| 827 | 3300035725 | Ga0373947_0007636 | Ga0373947_0007636_311_1549 | 400 |
| 828 | 3300036401 | Ga0373937_0025695 | Ga0373937_0025695_3652_4854 | 400 |
| 829 | 3300039437 | Ga0436365_1516765 | Ga0436365_1516765_1489_2724 | 400 |
| 830 | 3300041512 | Ga0451853_0579045 | Ga0451853_0579045_374_1579 | 400 |
| 831 | 3300042007 | Ga0439449_0033891 | Ga0439449_0033891_36_1244 | 400 |
| 832 | 3300042125 | Ga0450923_000426 | Ga0450923_000426_1061_2287 | 400 |
| 833 | 3300042131 | Ga0450894_000617 | Ga0450894_000617_3513_4739 | 400 |
| 834 | 3300042133 | Ga0450896_001948 | Ga0450896_001948_1386_2612 | 400 |
| 835 | 3300042436 | Ga0439435_0009846 | Ga0439435_0009846_518_1720 | 400 |
| 836 | 3300042436 | Ga0439435_0025433 | Ga0439435_0025433_99_1310 | 400 |
| 837 | 3300042876 | Ga0451577_0039555 | Ga0451577_0039555_2390_3604 | 400 |
| 838 | 3300044712 | Ga0453684_0007700 | Ga0453684_0007700_14069_15283 | 400 |
| 839 | 3300045051 | Ga0451576_0047452 | Ga0451576_0047452_1243_2451 | 400 |
| 840 | 3300045051 | Ga0451576_0160287 | Ga0451576_0160287_902_2104 | 400 |
| 841 | 3300045051 | Ga0451576_0196080 | Ga0451576_0196080_311_1513 | 400 |
| 842 | 3300045051 | Ga0451576_0274922 | Ga0451576_0274922_463_1665 | 400 |
| 843 | 3300045051 | Ga0451576_0340825 | Ga0451576_0340825_33_1241 | 400 |
| 844 | 3300045051 | Ga0451576_0458422 | Ga0451576_0458422_84_1292 | 400 |
| 845 | 3300045976 | Ga0466967_0121536 | Ga0466967_0121536_1070_2281 | 400 |
| 846 | 3300046454 | Ga0495592_0056422 | Ga0495592_0056422_47_1297 | 400 |
| 847 | 3300046455 | Ga0495603_0099276 | Ga0495603_0099276_423_1631 | 400 |
| 848 | 3300046511 | Ga0495608_0004305 | Ga0495608_0004305_8216_9466 | 400 |
| 849 | 3300046517 | Ga0495630_0004210 | Ga0495630_0004210_6109_7359 | 400 |
| 850 | 3300046528 | Ga0495642_0001939 | Ga0495642_0001939_1020_2225 | 400 |
| 851 | 3300046535 | Ga0495586_0019109 | Ga0495586_0019109_341_1543 | 400 |
| 852 | 3300046536 | Ga0495587_0023896 | Ga0495587_0023896_1767_3017 | 400 |
| 853 | 3300046539 | Ga0495621_0000274 | Ga0495621_0000274_6461_7663 | 400 |
| 854 | 3300046543 | Ga0495645_0003638 | Ga0495645_0003638_7103_8305 | 400 |
| 855 | 3300046543 | Ga0495645_0048688 | Ga0495645_0048688_982_2232 | 400 |
| 856 | 3300046558 | Ga0495633_0041241 | Ga0495633_0041241_214_1416 | 400 |
| 857 | 3300046615 | Ga0495656_0004734 | Ga0495656_0004734_2631_3833 | 400 |
| 858 | 3300046642 | Ga0495634_0071486 | Ga0495634_0071486_583_1797 | 400 |
| 859 | 3300046674 | Ga0495588_0093176 | Ga0495588_0093176_181_1383 | 400 |
| 860 | 3300046683 | Ga0495658_0083994 | Ga0495658_0083994_52_1257 | 400 |
| 861 | 3300046683 | Ga0495658_0145241 | Ga0495658_0145241_151_1386 | 400 |
| 862 | 3300046684 | Ga0495669_0007861 | Ga0495669_0007861_3019_4257 | 400 |
| 863 | 3300046689 | Ga0495613_0005107 | Ga0495613_0005107_4582_5832 | 400 |
| 864 | 3300047317 | Ga0495604_0059614 | Ga0495604_0059614_1264_2472 | 400 |
| 865 | 3300047318 | Ga0495636_0002541 | Ga0495636_0002541_315_1526 | 400 |
| 866 | 3300047318 | Ga0495636_0055183 | Ga0495636_0055183_103_1314 | 400 |
| 867 | 3300047319 | Ga0495674_0022038 | Ga0495674_0022038_4537_5787 | 400 |
| 868 | 3300047322 | Ga0495680_0077287 | Ga0495680_0077287_97_1299 | 400 |
| 869 | 3300047445 | Ga0495677_0038898 | Ga0495677_0038898_86_1291 | 400 |
| 870 | 3300047471 | Ga0495684_0001265 | Ga0495684_0001265_10761_12011 | 400 |
| 871 | 3300047471 | Ga0495684_0182541 | Ga0495684_0182541_145_1353 | 400 |
| 872 | 3300048907 | Ga0496104_0002606 | Ga0496104_0002606_11858_13060 | 400 |
| 873 | 3300048907 | Ga0496104_0003935 | Ga0496104_0003935_8372_9580 | 400 |
| 874 | 3300048911 | Ga0496108_0018262 | Ga0496108_0018262_1798_3000 | 400 |
| 875 | 3300048911 | Ga0496108_0108005 | Ga0496108_0108005_13_1239 | 400 |
| 876 | 3300048912 | Ga0496109_0008025 | Ga0496109_0008025_6242_7450 | 400 |
| 877 | 3300048912 | Ga0496109_0232526 | Ga0496109_0232526_218_1420 | 400 |
| 878 | 3300048913 | Ga0496110_0180220 | Ga0496110_0180220_535_1743 | 400 |
| 879 | 3300048915 | Ga0496112_0001309 | Ga0496112_0001309_13614_14822 | 400 |
| 880 | 3300048915 | Ga0496112_0013809 | Ga0496112_0013809_1184_2386 | 400 |
| 881 | 3300048915 | Ga0496112_0029041 | Ga0496112_0029041_1756_2964 | 400 |
| 882 | 3300048915 | Ga0496112_0066934 | Ga0496112_0066934_1011_2237 | 400 |
| 883 | 3300048916 | Ga0496113_0024136 | Ga0496113_0024136_2703_3905 | 400 |
| 884 | 3300048917 | Ga0496114_0133546 | Ga0496114_0133546_430_1665 | 400 |
| 885 | 3300049571 | Ga0501034_0015356 | Ga0501034_0015356_1338_2546 | 400 |
| 886 | 3300049572 | Ga0501036_0050145 | Ga0501036_0050145_534_1787 | 400 |
| 887 | 3300049572 | Ga0501036_0057218 | Ga0501036_0057218_1191_2417 | 400 |
| 888 | 3300049572 | Ga0501036_0268280 | Ga0501036_0268280_35_1258 | 400 |
| 889 | 3300049574 | Ga0501038_0086775 | Ga0501038_0086775_102_1328 | 400 |
| 890 | 3300049575 | Ga0501039_0010716 | Ga0501039_0010716_5448_6650 | 400 |
| 891 | 3300049576 | Ga0501040_0025001 | Ga0501040_0025001_2234_3436 | 400 |
| 892 | 3300049576 | Ga0501040_0051305 | Ga0501040_0051305_1106_2332 | 400 |
| 893 | 3300049577 | Ga0501041_0025281 | Ga0501041_0025281_711_1913 | 400 |
| 894 | 3300049577 | Ga0501041_0039024 | Ga0501041_0039024_668_1921 | 400 |
| 895 | 3300049577 | Ga0501041_0074349 | Ga0501041_0074349_715_1917 | 400 |
| 896 | 3300049578 | Ga0501042_0041720 | Ga0501042_0041720_1410_2612 | 400 |
| 897 | 3300049578 | Ga0501042_0067683 | Ga0501042_0067683_1152_2354 | 400 |
| 898 | 3300049581 | Ga0501047_0043918 | Ga0501047_0043918_787_1995 | 400 |
| 899 | 3300049582 | Ga0501048_0063065 | Ga0501048_0063065_1073_2299 | 400 |
| 900 | 3300049587 | Ga0501071_0005906 | Ga0501071_0005906_3229_4482 | 400 |
| 901 | 3300049587 | Ga0501071_0122660 | Ga0501071_0122660_672_1880 | 400 |
| 902 | 3300049588 | Ga0501072_0032031 | Ga0501072_0032031_1263_2465 | 400 |
| 903 | 3300049589 | Ga0501073_0008361 | Ga0501073_0008361_6135_7370 | 400 |
| 904 | 3300049590 | Ga0501074_0218254 | Ga0501074_0218254_32_1234 | 400 |
| 905 | 3300049591 | Ga0501075_0010672 | Ga0501075_0010672_2912_4165 | 400 |
| 906 | 3300049591 | Ga0501075_0093693 | Ga0501075_0093693_72_1280 | 400 |
| 907 | 3300049592 | Ga0501076_0004723 | Ga0501076_0004723_6585_7838 | 400 |
| 908 | 3300049592 | Ga0501076_0010886 | Ga0501076_0010886_958_2184 | 400 |
| 909 | 3300049593 | Ga0501077_0017103 | Ga0501077_0017103_675_1928 | 400 |
| 910 | 3300049593 | Ga0501077_0037886 | Ga0501077_0037886_504_1712 | 400 |
| 911 | 3300049593 | Ga0501077_0081414 | Ga0501077_0081414_331_1632 | 400 |
| 912 | 3300049661 | Ga0501217_003704 | Ga0501217_003704_904_2145 | 400 |
| 913 | 3300049741 | Ga0501079_0015632 | Ga0501079_0015632_1281_2507 | 400 |
| 914 | 3300049743 | Ga0501081_0132638 | Ga0501081_0132638_497_1711 | 400 |
| 915 | 3300049823 | Ga0501044_0087804 | Ga0501044_0087804_387_1595 | 400 |
| 916 | 3300049824 | Ga0501045_0015836 | Ga0501045_0015836_2826_4052 | 400 |
| 917 | 3300049824 | Ga0501045_0048673 | Ga0501045_0048673_25_1233 | 400 |
| 918 | 3300049824 | Ga0501045_0055704 | Ga0501045_0055704_874_2076 | 400 |
| 919 | 3300050493 | nmdc:mga0k408_4972_c1 | nmdc:mga0k408_4972_c1_5120_6328 | 400 |
| 920 | 3300050507 | nmdc:mga05p37_11403_c1 | nmdc:mga05p37_11403_c1_3712_4920 | 400 |
| 921 | 3300050507 | nmdc:mga05p37_12306_c1 | nmdc:mga05p37_12306_c1_7209_8411 | 400 |
| 922 | 3300050507 | nmdc:mga05p37_128098_c1 | nmdc:mga05p37_128098_c1_16_1218 | 400 |
| 923 | 3300050507 | nmdc:mga05p37_1358_c1 | nmdc:mga05p37_1358_c1_19923_21131 | 400 |
| 924 | 3300050507 | nmdc:mga05p37_15661_c1 | nmdc:mga05p37_15661_c1_1345_2574 | 400 |
| 925 | 3300050507 | nmdc:mga05p37_2308_c1 | nmdc:mga05p37_2308_c1_18756_19988 | 400 |
| 926 | 3300050507 | nmdc:mga05p37_26622_c1 | nmdc:mga05p37_26622_c1_4070_5275 | 400 |
| 927 | 3300050507 | nmdc:mga05p37_28047_c1 | nmdc:mga05p37_28047_c1_3673_4881 | 400 |
| 928 | 3300050507 | nmdc:mga05p37_282934_c1 | nmdc:mga05p37_282934_c1_623_1825 | 400 |
| 929 | 3300050507 | nmdc:mga05p37_33001_c1 | nmdc:mga05p37_33001_c1_3954_5165 | 400 |
| 930 | 3300050507 | nmdc:mga05p37_3422_c1 | nmdc:mga05p37_3422_c1_5126_6334 | 400 |
| 931 | 3300050507 | nmdc:mga05p37_43448_c1 | nmdc:mga05p37_43448_c1_2364_3572 | 400 |
| 932 | 3300050507 | nmdc:mga05p37_5252_c1 | nmdc:mga05p37_5252_c1_10038_11297 | 400 |
| 933 | 3300050507 | nmdc:mga05p37_55203_c1 | nmdc:mga05p37_55203_c1_874_2079 | 400 |
| 934 | 3300050507 | nmdc:mga05p37_6503_c2 | nmdc:mga05p37_6503_c2_6777_8003 | 400 |
| 935 | 3300050507 | nmdc:mga05p37_68083_c1 | nmdc:mga05p37_68083_c1_2185_3393 | 400 |
| 936 | 3300050507 | nmdc:mga05p37_961_c1 | nmdc:mga05p37_961_c1_7260_8501 | 400 |
| 937 | 3300050508 | nmdc:mga09592_10896_c1 | nmdc:mga09592_10896_c1_2256_3497 | 400 |
| 938 | 3300050508 | nmdc:mga09592_17183_c1 | nmdc:mga09592_17183_c1_1392_2597 | 400 |
| 939 | 3300050508 | nmdc:mga09592_2031_c1 | nmdc:mga09592_2031_c1_1972_3180 | 400 |
| 940 | 3300050508 | nmdc:mga09592_4707_c1 | nmdc:mga09592_4707_c1_4590_5792 | 400 |
| 941 | 3300050508 | nmdc:mga09592_62675_c1 | nmdc:mga09592_62675_c1_484_1686 | 400 |
| 942 | 3300050508 | nmdc:mga09592_86250_c1 | nmdc:mga09592_86250_c1_520_1725 | 400 |
| 943 | 3300050509 | nmdc:mga0qj67_1190_c1 | nmdc:mga0qj67_1190_c1_1206_2408 | 400 |
| 944 | 3300050509 | nmdc:mga0qj67_2135_c1 | nmdc:mga0qj67_2135_c1_7929_9170 | 400 |
| 945 | 3300050509 | nmdc:mga0qj67_32516_c1 | nmdc:mga0qj67_32516_c1_644_1849 | 400 |
| 946 | 3300050509 | nmdc:mga0qj67_35929_c1 | nmdc:mga0qj67_35929_c1_2534_3775 | 400 |
| 947 | 3300050509 | nmdc:mga0qj67_40919_c1 | nmdc:mga0qj67_40919_c1_1706_2914 | 400 |
| 948 | 3300050509 | nmdc:mga0qj67_47324_c1 | nmdc:mga0qj67_47324_c1_317_1543 | 400 |
| 949 | 3300050509 | nmdc:mga0qj67_58411_c1 | nmdc:mga0qj67_58411_c1_168_1370 | 400 |
| 950 | 3300050509 | nmdc:mga0qj67_82034_c1 | nmdc:mga0qj67_82034_c1_1183_2385 | 400 |
| 951 | 3300050510 | nmdc:mga06r32_129893_c1 | nmdc:mga06r32_129893_c1_224_1426 | 400 |
| 952 | 3300050510 | nmdc:mga06r32_14863_c1 | nmdc:mga06r32_14863_c1_1117_2325 | 400 |
| 953 | 3300050510 | nmdc:mga06r32_160070_c1 | nmdc:mga06r32_160070_c1_478_1683 | 400 |
| 954 | 3300050510 | nmdc:mga06r32_16856_c1 | nmdc:mga06r32_16856_c1_793_2034 | 400 |
| 955 | 3300050510 | nmdc:mga06r32_25092_c1 | nmdc:mga06r32_25092_c1_3762_4970 | 400 |
| 956 | 3300050510 | nmdc:mga06r32_2825_c1 | nmdc:mga06r32_2825_c1_9090_10292 | 400 |
| 957 | 3300050510 | nmdc:mga06r32_78935_c1 | nmdc:mga06r32_78935_c1_110_1315 | 400 |
| 958 | 3300050511 | nmdc:mga08y16_11370_c1 | nmdc:mga08y16_11370_c1_4192_5394 | 400 |
| 959 | 3300050511 | nmdc:mga08y16_11518_c1 | nmdc:mga08y16_11518_c1_6539_7780 | 400 |
| 960 | 3300050511 | nmdc:mga08y16_12_c1 | nmdc:mga08y16_12_c1_410308_411513 | 400 |
| 961 | 3300050511 | nmdc:mga08y16_154644_c1 | nmdc:mga08y16_154644_c1_722_1930 | 400 |
| 962 | 3300050511 | nmdc:mga08y16_17225_c1 | nmdc:mga08y16_17225_c1_4898_6100 | 400 |
| 963 | 3300050511 | nmdc:mga08y16_187138_c1 | nmdc:mga08y16_187138_c1_357_1565 | 400 |
| 964 | 3300050511 | nmdc:mga08y16_20431_c1 | nmdc:mga08y16_20431_c1_2058_3266 | 400 |
| 965 | 3300050511 | nmdc:mga08y16_255175_c1 | nmdc:mga08y16_255175_c1_479_1699 | 400 |
| 966 | 3300050511 | nmdc:mga08y16_275149_c1 | nmdc:mga08y16_275149_c1_292_1515 | 400 |
| 967 | 3300050511 | nmdc:mga08y16_323468_c1 | nmdc:mga08y16_323468_c1_331_1533 | 400 |
| 968 | 3300050511 | nmdc:mga08y16_33699_c1 | nmdc:mga08y16_33699_c1_2994_4196 | 400 |
| 969 | 3300050511 | nmdc:mga08y16_62425_c1 | nmdc:mga08y16_62425_c1_2562_3764 | 400 |
| 970 | 3300050511 | nmdc:mga08y16_632_c1 | nmdc:mga08y16_632_c1_22854_24065 | 400 |
| 971 | 3300050511 | nmdc:mga08y16_635_c1 | nmdc:mga08y16_635_c1_9629_10831 | 400 |
| 972 | 3300050511 | nmdc:mga08y16_66344_c1 | nmdc:mga08y16_66344_c1_1362_2570 | 400 |
| 973 | 3300050511 | nmdc:mga08y16_6914_c1 | nmdc:mga08y16_6914_c1_6582_7784 | 400 |
| 974 | 3300050511 | nmdc:mga08y16_73474_c1 | nmdc:mga08y16_73474_c1_2283_3491 | 400 |
| 975 | 3300050511 | nmdc:mga08y16_78768_c1 | nmdc:mga08y16_78768_c1_1637_2845 | 400 |
| 976 | 3300050512 | nmdc:mga0n895_107863_c1 | nmdc:mga0n895_107863_c1_134_1336 | 400 |
| 977 | 3300050512 | nmdc:mga0n895_136750_c1 | nmdc:mga0n895_136750_c1_691_1923 | 400 |
| 978 | 3300050512 | nmdc:mga0n895_1444_c1 | nmdc:mga0n895_1444_c1_5128_6330 | 400 |
| 979 | 3300050512 | nmdc:mga0n895_148625_c1 | nmdc:mga0n895_148625_c1_999_2207 | 400 |
| 980 | 3300050512 | nmdc:mga0n895_1608_c1 | nmdc:mga0n895_1608_c1_762_1964 | 400 |
| 981 | 3300050512 | nmdc:mga0n895_279438_c1 | nmdc:mga0n895_279438_c1_61_1269 | 400 |
| 982 | 3300050512 | nmdc:mga0n895_3741_c1 | nmdc:mga0n895_3741_c1_5057_6259 | 400 |
| 983 | 3300050512 | nmdc:mga0n895_46140_c1 | nmdc:mga0n895_46140_c1_2220_3428 | 400 |
| 984 | 3300050512 | nmdc:mga0n895_87701_c1 | nmdc:mga0n895_87701_c1_1365_2567 | 400 |
| 985 | 3300050513 | nmdc:mga0rr50_3496_c1 | nmdc:mga0rr50_3496_c1_5042_6244 | 400 |
| 986 | 3300050513 | nmdc:mga0rr50_69588_c1 | nmdc:mga0rr50_69588_c1_127_1332 | 400 |
| 987 | 3300050514 | nmdc:mga08x19_13689_c1 | nmdc:mga08x19_13689_c1_2976_4184 | 400 |
| 988 | 3300050515 | nmdc:mga0a205_144881_c2 | nmdc:mga0a205_144881_c2_385_1590 | 400 |
| 989 | 3300050515 | nmdc:mga0a205_145467_c1 | nmdc:mga0a205_145467_c1_44_1276 | 400 |
| 990 | 3300050515 | nmdc:mga0a205_170541_c1 | nmdc:mga0a205_170541_c1_302_1507 | 400 |
| 991 | 3300050515 | nmdc:mga0a205_171984_c1 | nmdc:mga0a205_171984_c1_333_1541 | 400 |
| 992 | 3300050515 | nmdc:mga0a205_196634_c1 | nmdc:mga0a205_196634_c1_101_1303 | 400 |
| 993 | 3300050515 | nmdc:mga0a205_2224_c1 | nmdc:mga0a205_2224_c1_5515_6717 | 400 |
| 994 | 3300050515 | nmdc:mga0a205_25961_c1 | nmdc:mga0a205_25961_c1_4091_5293 | 400 |
| 995 | 3300050515 | nmdc:mga0a205_47_c1 | nmdc:mga0a205_47_c1_39709_40911 | 400 |
| 996 | 3300050515 | nmdc:mga0a205_57182_c1 | nmdc:mga0a205_57182_c1_1406_2614 | 400 |
| 997 | 3300053077 | Ga0495601_0005785 | Ga0495601_0005785_5550_6800 | 400 |
| 998 | 3300053084 | Ga0495595_0076467 | Ga0495595_0076467_269_1519 | 400 |
| 999 | 3300053085 | Ga0495619_0001690 | Ga0495619_0001690_9979_11229 | 400 |
| 1000 | 3300053085 | Ga0495619_0147271 | Ga0495619_0147271_343_1551 | 400 |
| 1001 | 3300053096 | Ga0500641_0003189 | Ga0500641_0003189_1404_2648 | 400 |
| 1002 | 3300053103 | Ga0500555_000789 | Ga0500555_000789_4979_6247 | 400 |
| 1003 | 3300054114 | Ga0501084_0007641 | Ga0501084_0007641_3456_4682 | 400 |
| 1004 | 3300054114 | Ga0501084_0021751 | Ga0501084_0021751_2917_4119 | 400 |
| 1005 | 3300054114 | Ga0501084_0029602 | Ga0501084_0029602_973_2181 | 400 |
| 1006 | 3300054114 | Ga0501084_0161265 | Ga0501084_0161265_663_1865 | 400 |
| 1007 | 3300059421 | Ga0590071_000222 | Ga0590071_000222_14038_15240 | 400 |
| 1008 | 3300059421 | Ga0590071_000785 | Ga0590071_000785_3877_5079 | 400 |
| 1009 | 3300059423 | Ga0590074_000479 | Ga0590074_000479_1097_2299 | 400 |
| 1010 | 3300059424 | Ga0590075_000259 | Ga0590075_000259_3713_4915 | 400 |
| 1011 | 3300059424 | Ga0590075_002665 | Ga0590075_002665_1814_3016 | 400 |
| 1012 | 3300059426 | Ga0590077_000168 | Ga0590077_000168_15875_17077 | 400 |
| 1013 | 3300059426 | Ga0590077_000839 | Ga0590077_000839_6428_7630 | 400 |
| 1014 | 3300061734 | Ga0530510_0003933 | Ga0530510_0003933_1503_2756 | 400 |
| 1015 | 3300061734 | Ga0530510_0121296 | Ga0530510_0121296_533_1759 | 400 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xig-assembly1.cif.gz_B | x-ray crystal structure of mqne from pedobacter heparinus | 0.9222 | 2 | 352 |
| 6xi9-assembly1.cif.gz_A | x-ray crystal structure of mqne from pedobacter heparinus in complex with aminofutalosine and methionine | 0.92 | 2 | 354 |
| 6xi9-assembly2.cif.gz_B | x-ray crystal structure of mqne from pedobacter heparinus in complex with aminofutalosine and methionine | 0.9196 | 2 | 354 |
| 6xig-assembly1.cif.gz_A | x-ray crystal structure of mqne from pedobacter heparinus | 0.9178 | 2 | 359 |
| 6xig-assembly1.cif.gz_A | x-ray crystal structure of mqne from pedobacter heparinus | 0.8436 | 2 | 359 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58826_3_356_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9559 | 10 | 350 | 3.20.20.70 |
| af_P9WP77_498_849_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9374 | 1 | 347 | 3.20.20.70 |
| af_P9WP77_498_849_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9219 | 1 | 347 | 3.20.20.70 |
| af_Q58826_3_356_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9191 | 10 | 350 | 3.20.20.70 |
| af_P9WP77_16_335_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8278 | 2 | 287 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7QNR6-F1-model_v4 | Cyclic dehypoxanthine futalosine synthase (Cyclic DHFL synthase) (EC 1.21.98.1) (Dehypoxanthine futalosine cyclase) (DHFL cyclase) (Menaquinone biosynthetic enzyme MqnC) | 0.995 | 2 | 398 |
GO:0005506
GO:0009234 GO:0016765 GO:0044689 GO:0046992 GO:0051539 |
| AF-A0A3N5NG97-F1-model_v4 | Dehypoxanthine futalosine cyclase | 0.9945 | 1 | 323 |
GO:0009234
GO:0016765 GO:0044689 GO:0046872 GO:0051539 |
| AF-A0A381NKD4-F1-model_v4 | Radical SAM core domain-containing protein | 0.9938 | 39 | 400 |
GO:0009234
GO:0016765 GO:0044689 GO:0046872 GO:0051539 |
| AF-A0A7C7VMF2-F1-model_v4 | Cyclic dehypoxanthine futalosine synthase (Cyclic DHFL synthase) (EC 1.21.98.1) (Dehypoxanthine futalosine cyclase) (DHFL cyclase) (Menaquinone biosynthetic enzyme MqnC) | 0.9892 | 2 | 352 |
GO:0005506
GO:0009234 GO:0016765 GO:0044689 GO:0046992 GO:0051539 |
| AF-A0A3N5NG97-F1-model_v4 | Dehypoxanthine futalosine cyclase | 0.9884 | 1 | 323 |
GO:0009234
GO:0016765 GO:0044689 GO:0046872 GO:0051539 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar