F488248

General Info

Members Datasets Scaffolds Average Seq Length
1015 320 1015 402

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0081414|Ga0501077_0081414_331_1632
Length 433
Sequence MSNTSDLKVGAAGSVRTHSTRMPIAEISDKVRGGERLERAEALELYLTAPTPLLGRLADEVRALKHPLGIVTYIIDRNVNYTNVCVARCNFCAFYRPVGSDEGYVLAFDEIFRKIDETIAVGGGQLLLQGGHNPDLPLEWYEDLFRAVKQRYPAFRLHALSPPEVIHLSRLSRLPVPQVIERLVAVGLDSIPGGGAEILVDRVRKLLNCYGKATADEWLDVMRHAHLAGLRTTATMMYGTVETMEERLEHLFRLREVQDETGGFTAFIAWSYQPEHTELGGGEATGIDYLRTLAMARLVLDNFDNLQSSWVTQGGKVGQLSLGFGANDMGSVMIEENVVRAAGASYCMDEIEIVRNIENAGFVPKRRNMHYEILGDPIFRERDVPRMLELAVARADGDASRSPEINRYPAKSAAEKRARQAGPPSPELRRTPH

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
180 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
206 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
207 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
208 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
209 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
210 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
211 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
212 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
291 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
292 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
310 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
311 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
317 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
318 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 0
Rhizoplane 2.96
Rhizosphere 92.81
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000226 3300001977 Bacteria 7749
2 JGI25406J46586_10003400 3300003203 Bacteria 7487
3 rootH2_10032907 3300003320 Bacteria 16130
4 Ga0065704_10079193 3300005289 Bacteria 4227
5 Ga0065704_10083391 3300005289 Bacteria 3454
6 Ga0065712_10007258 3300005290 Bacteria 3310
7 Ga0065712_10011325 3300005290 Bacteria 2658
8 Ga0065712_10068725 3300005290 Bacteria 9225
9 Ga0065712_10077341 3300005290 Bacteria 3511
10 Ga0065712_10080235 3300005290 Bacteria 3121
11 Ga0065712_10135542 3300005290 Bacteria 1501
12 Ga0065715_10090819 3300005293 Bacteria 6413
13 Ga0065715_10102890 3300005293 Bacteria 3077
14 Ga0065715_10110296 3300005293 Bacteria 2627
15 Ga0065715_10132562 3300005293 Bacteria 1984
16 Ga0065715_10150068 3300005293 Bacteria 1740
17 Ga0065715_10192023 3300005293 Bacteria 1409
18 Ga0065707_10000725 3300005295 Bacteria 18952
19 Ga0065707_10008899 3300005295 Bacteria 3502
20 Ga0065707_10011370 3300005295 Bacteria 3916
21 Ga0065707_10094284 3300005295 Bacteria 3516
22 Ga0065707_10099266 3300005295 Bacteria 3015
23 Ga0070658_10025668 3300005327 Bacteria 4722
24 Ga0070676_10001466 3300005328 Bacteria 11939
25 Ga0070676_10041319 3300005328 Bacteria 2674
26 Ga0070676_10065562 3300005328 Bacteria 2168
27 Ga0070683_100009233 3300005329 Bacteria 8424
28 Ga0070683_100040413 3300005329 Bacteria 4289
29 Ga0070690_100025084 3300005330 Bacteria 3670
30 Ga0070690_100120191 3300005330 Bacteria 1762
31 Ga0070670_100006839 3300005331 Bacteria 9662
32 Ga0070670_100008844 3300005331 Bacteria 8597
33 Ga0070670_100037970 3300005331 Bacteria 4142
34 Ga0070670_100099279 3300005331 Bacteria 2505
35 Ga0070670_100123603 3300005331 Bacteria 2233
36 Ga0070677_10001126 3300005333 Bacteria 8600
37 Ga0068869_100002498 3300005334 Bacteria 11086
38 Ga0068869_100009274 3300005334 Bacteria 6381
39 Ga0068869_100013680 3300005334 Bacteria 5405
40 Ga0068869_100022727 3300005334 Bacteria 4325
41 Ga0070666_10008944 3300005335 Bacteria 6236
42 Ga0070666_10029308 3300005335 Bacteria 3617
43 Ga0070666_10029797 3300005335 Bacteria 3590
44 Ga0070666_10112000 3300005335 Bacteria 1888
45 Ga0070666_10139271 3300005335 Bacteria 1690
46 Ga0070666_10178262 3300005335 Bacteria 1490
47 Ga0068868_100194480 3300005338 Bacteria 1688
48 Ga0070689_100035932 3300005340 Bacteria 3788
49 Ga0070689_100060359 3300005340 Bacteria 2948
50 Ga0070689_100075253 3300005340 Bacteria 2643
51 Ga0070689_100090596 3300005340 Bacteria 2410
52 Ga0070689_100162245 3300005340 Bacteria 1807
53 Ga0070691_10000205 3300005341 Bacteria 19816
54 Ga0070687_100018084 3300005343 Bacteria 3252
55 Ga0070692_10008777 3300005345 Bacteria 4522
56 Ga0070668_100116014 3300005347 Bacteria 2135
57 Ga0070668_100125037 3300005347 Bacteria 2059
58 Ga0070668_100193341 3300005347 Bacteria 1667
59 Ga0070669_100000448 3300005353 Bacteria 31480
60 Ga0070669_100006945 3300005353 Bacteria 8135
61 Ga0070669_100013978 3300005353 Bacteria 5708
62 Ga0070669_100030385 3300005353 Bacteria 3898
63 Ga0070669_100031848 3300005353 Bacteria 3808
64 Ga0070669_100080683 3300005353 Bacteria 2422
65 Ga0070669_100147150 3300005353 Bacteria 1821
66 Ga0070669_100156427 3300005353 Bacteria 1768
67 Ga0070675_100000079 3300005354 Bacteria 56265
68 Ga0070675_100001092 3300005354 Bacteria 19569
69 Ga0070675_100004445 3300005354 Bacteria 10689
70 Ga0070675_100030474 3300005354 Bacteria 4355
71 Ga0070675_100041404 3300005354 Bacteria 3763
72 Ga0070675_100090370 3300005354 Bacteria 2565
73 Ga0070675_100150010 3300005354 Bacteria 1998
74 Ga0070671_100009064 3300005355 Bacteria 7987
75 Ga0070671_100037811 3300005355 Bacteria 4005
76 Ga0070671_100129684 3300005355 Bacteria 2123
77 Ga0070671_100135395 3300005355 Bacteria 2077
78 Ga0070671_100142785 3300005355 Bacteria 2020
79 Ga0070671_100347063 3300005355 Bacteria 1267
80 Ga0070674_100000386 3300005356 Bacteria 22108
81 Ga0070674_100005303 3300005356 Bacteria 7427
82 Ga0070674_100008928 3300005356 Bacteria 5987
83 Ga0070674_100191155 3300005356 Bacteria 1575
84 Ga0070673_100004167 3300005364 Bacteria 9112
85 Ga0070673_100024924 3300005364 Bacteria 4394
86 Ga0070673_100025921 3300005364 Bacteria 4323
87 Ga0070673_100061982 3300005364 Bacteria 2969
88 Ga0070673_100097137 3300005364 Bacteria 2419
89 Ga0070673_100126424 3300005364 Bacteria 2140
90 Ga0070673_100155285 3300005364 Bacteria 1942
91 Ga0070673_100158533 3300005364 Bacteria 1923
92 Ga0070688_100077951 3300005365 Bacteria 2137
93 Ga0070688_100093483 3300005365 Bacteria 1969
94 Ga0070659_100207275 3300005366 Bacteria 1615
95 Ga0070659_100277527 3300005366 Bacteria 1394
96 Ga0070667_100031743 3300005367 Bacteria 4403
97 Ga0070703_10034019 3300005406 Bacteria 1554
98 Ga0070709_10004714 3300005434 Bacteria 7368
99 Ga0070714_100111001 3300005435 Bacteria 2428
100 Ga0070713_100099511 3300005436 Bacteria 2516
101 Ga0070701_10031960 3300005438 Bacteria 2617
102 Ga0070701_10058005 3300005438 Bacteria 2031
103 Ga0070701_10078031 3300005438 Bacteria 1786
104 Ga0070705_100003620 3300005440 Bacteria 7565
105 Ga0070705_100006536 3300005440 Bacteria 5720
106 Ga0070705_100016983 3300005440 Bacteria 3792
107 Ga0070700_100002568 3300005441 Bacteria 9280
108 Ga0070700_100017254 3300005441 Bacteria 4124
109 Ga0070700_100148097 3300005441 Bacteria 1602
110 Ga0070694_100001458 3300005444 Bacteria 13864
111 Ga0070694_100142600 3300005444 Bacteria 1742
112 Ga0070708_100056855 3300005445 Bacteria 3481
113 Ga0070678_100002634 3300005456 Bacteria 9876
114 Ga0070678_100046333 3300005456 Bacteria 3117
115 Ga0070678_100109597 3300005456 Bacteria 2157
116 Ga0070662_100003754 3300005457 Bacteria 9506
117 Ga0070681_10058453 3300005458 Bacteria 3836
118 Ga0070681_10227774 3300005458 Bacteria 1778
119 Ga0068867_100000717 3300005459 Bacteria 22125
120 Ga0068867_100021865 3300005459 Bacteria 4567
121 Ga0068867_100206901 3300005459 Bacteria 1574
122 Ga0070685_10003826 3300005466 Bacteria 7615
123 Ga0070685_10041476 3300005466 Bacteria 2622
124 Ga0070707_100287150 3300005468 Bacteria 1599
125 Ga0070698_100058674 3300005471 Bacteria 3890
126 Ga0070698_100144729 3300005471 Bacteria 2327
127 Ga0070698_100209682 3300005471 Bacteria 1883
128 Ga0070698_100233180 3300005471 Bacteria 1774
129 Ga0070699_100001760 3300005518 Bacteria 19739
130 Ga0070699_100005713 3300005518 Bacteria 10893
131 Ga0070699_100017167 3300005518 Bacteria 6216
132 Ga0070699_100030946 3300005518 Bacteria 4620
133 Ga0070699_100047938 3300005518 Bacteria 3697
134 Ga0070679_100169943 3300005530 Bacteria 2153
135 Ga0070684_100001529 3300005535 Bacteria 16721
136 Ga0070684_100020841 3300005535 Bacteria 5440
137 Ga0070684_100021042 3300005535 Bacteria 5420
138 Ga0070697_100079448 3300005536 Bacteria 2700
139 Ga0070697_100120214 3300005536 Bacteria 2197
140 Ga0070672_100006035 3300005543 Bacteria 8093
141 Ga0070672_100046395 3300005543 Bacteria 3366
142 Ga0070672_100055481 3300005543 Bacteria 3104
143 Ga0070672_100061481 3300005543 Bacteria 2961
144 Ga0070672_100086262 3300005543 Bacteria 2524
145 Ga0070672_100125233 3300005543 Bacteria 2107
146 Ga0070672_100295807 3300005543 Bacteria 1371
147 Ga0070686_100015636 3300005544 Bacteria 4401
148 Ga0070686_100023538 3300005544 Bacteria 3682
149 Ga0070686_100026138 3300005544 Bacteria 3520
150 Ga0070695_100000171 3300005545 Bacteria 30974
151 Ga0070695_100002328 3300005545 Bacteria 10903
152 Ga0070696_100000124 3300005546 Bacteria 40765
153 Ga0070696_100020430 3300005546 Bacteria 4489
154 Ga0070665_100000030 3300005548 Bacteria 335245
155 Ga0070665_100001511 3300005548 Bacteria 27024
156 Ga0070665_100003106 3300005548 Bacteria 17884
157 Ga0070665_100045245 3300005548 Bacteria 4420
158 Ga0070665_100047420 3300005548 Bacteria 4312
159 Ga0070665_100172675 3300005548 Bacteria 2162
160 Ga0070704_100000145 3300005549 Bacteria 26912
161 Ga0070704_100013345 3300005549 Bacteria 5097
162 Ga0070704_100013519 3300005549 Bacteria 5067
163 Ga0070704_100030556 3300005549 Bacteria 3611
164 Ga0070704_100040574 3300005549 Bacteria 3205
165 Ga0070704_100040593 3300005549 Bacteria 3205
166 Ga0070704_100045242 3300005549 Bacteria 3062
167 Ga0070704_100058374 3300005549 Bacteria 2748
168 Ga0068855_100023926 3300005563 Bacteria 7315
169 Ga0068855_100238144 3300005563 Bacteria 2034
170 Ga0070664_100002901 3300005564 Bacteria 13874
171 Ga0070664_100014926 3300005564 Bacteria 6338
172 Ga0070664_100032600 3300005564 Bacteria 4358
173 Ga0070664_100094327 3300005564 Bacteria 2595
174 Ga0070664_100094406 3300005564 Bacteria 2594
175 Ga0070664_100163921 3300005564 Bacteria 1968
176 Ga0068854_100134749 3300005578 Bacteria 1890
177 Ga0070702_100008169 3300005615 Bacteria 5056
178 Ga0070702_100013036 3300005615 Bacteria 4187
179 Ga0070702_100078660 3300005615 Bacteria 1969
180 Ga0068859_100002171 3300005617 Bacteria 19940
181 Ga0068859_100016970 3300005617 Bacteria 7308
182 Ga0068859_100020062 3300005617 Bacteria 6711
183 Ga0068859_100029009 3300005617 Bacteria 5551
184 Ga0068859_100080713 3300005617 Bacteria 3294
185 Ga0068859_100141712 3300005617 Bacteria 2477
186 Ga0068859_100152747 3300005617 Bacteria 2384
187 Ga0068859_100225870 3300005617 Bacteria 1960
188 Ga0068864_100010029 3300005618 Bacteria 7821
189 Ga0068864_100019648 3300005618 Bacteria 5650
190 Ga0068864_100051184 3300005618 Bacteria 3557
191 Ga0068864_100125007 3300005618 Bacteria 2304
192 Ga0068866_10003215 3300005718 Bacteria 6738
193 Ga0068861_100004810 3300005719 Bacteria 9079
194 Ga0068861_100007457 3300005719 Bacteria 7497
195 Ga0068861_100009126 3300005719 Bacteria 6837
196 Ga0068861_100024227 3300005719 Bacteria 4387
197 Ga0068861_100088181 3300005719 Bacteria 2443
198 Ga0068861_100136399 3300005719 Bacteria 1997
199 Ga0068870_10008434 3300005840 Bacteria 4636
200 Ga0068870_10037466 3300005840 Bacteria 2500
201 Ga0068870_10066607 3300005840 Bacteria 1951
202 Ga0068863_100001409 3300005841 Bacteria 23845
203 Ga0068863_100009990 3300005841 Bacteria 9240
204 Ga0068863_100027693 3300005841 Bacteria 5407
205 Ga0068863_100122832 3300005841 Bacteria 2477
206 Ga0068863_100156929 3300005841 Bacteria 2179
207 Ga0068863_100279305 3300005841 Bacteria 1618
208 Ga0068858_100002245 3300005842 Bacteria 19525
209 Ga0068858_100002257 3300005842 Bacteria 19485
210 Ga0068858_100006285 3300005842 Bacteria 11570
211 Ga0068858_100006973 3300005842 Bacteria 10975
212 Ga0068858_100018755 3300005842 Bacteria 6472
213 Ga0068858_100020921 3300005842 Bacteria 6113
214 Ga0068858_100191854 3300005842 Bacteria 1931
215 Ga0068858_100222249 3300005842 Bacteria 1789
216 Ga0068858_100232534 3300005842 Bacteria 1748
217 Ga0068860_100014536 3300005843 Bacteria 7702
218 Ga0068862_100004218 3300005844 Bacteria 12175
219 Ga0068862_100022724 3300005844 Bacteria 5248
220 Ga0068862_100034614 3300005844 Bacteria 4275
221 Ga0068862_100291939 3300005844 Bacteria 1497
222 Ga0081538_10083325 3300005981 Bacteria 1690
223 Ga0081539_10000122 3300005985 Bacteria 183393
224 Ga0081539_10000251 3300005985 Bacteria 125220
225 Ga0081539_10001218 3300005985 Bacteria 45966
226 Ga0081539_10014209 3300005985 Bacteria 5911
227 Ga0081539_10023830 3300005985 Bacteria 3993
228 Ga0075365_10011187 3300006038 Bacteria 5267
229 Ga0075365_10091209 3300006038 Bacteria 2076
230 Ga0075368_10002646 3300006042 Bacteria 5889
231 Ga0075368_10010743 3300006042 Bacteria 3317
232 Ga0075368_10011178 3300006042 Bacteria 3262
233 Ga0075364_10005997 3300006051 Bacteria 7102
234 Ga0075364_10024627 3300006051 Bacteria 3823
235 Ga0075364_10038767 3300006051 Bacteria 3088
236 Ga0075432_10012783 3300006058 Bacteria 2852
237 Ga0075362_10001506 3300006177 Bacteria 7493
238 Ga0075367_10036553 3300006178 Bacteria 2849
239 Ga0075367_10044818 3300006178 Bacteria 2594
240 Ga0075366_10019632 3300006195 Bacteria 3915
241 Ga0075366_10026713 3300006195 Bacteria 3382
242 Ga0075366_10099884 3300006195 Bacteria 1741
243 Ga0075366_10111235 3300006195 Bacteria 1647
244 Ga0097621_100014408 3300006237 Bacteria 5916
245 Ga0097621_100025908 3300006237 Bacteria 4594
246 Ga0097621_100031186 3300006237 Bacteria 4228
247 Ga0097621_100041097 3300006237 Bacteria 3720
248 Ga0097621_100090819 3300006237 Bacteria 2556
249 Ga0097621_100134430 3300006237 Bacteria 2108
250 Ga0075370_10016777 3300006353 Bacteria 3945
251 Ga0075370_10024577 3300006353 Bacteria 3329
252 Ga0068871_100006379 3300006358 Bacteria 8339
253 Ga0068871_100006536 3300006358 Bacteria 8258
254 Ga0068871_100013495 3300006358 Bacteria 6065
255 Ga0068871_100015641 3300006358 Bacteria 5686
256 Ga0068871_100029695 3300006358 Bacteria 4297
257 Ga0068871_100038339 3300006358 Bacteria 3826
258 Ga0075428_100000607 3300006844 Bacteria 36552
259 Ga0075428_100004905 3300006844 Bacteria 14858
260 Ga0075428_100005950 3300006844 Bacteria 13556
261 Ga0075428_100006210 3300006844 Bacteria 13292
262 Ga0075428_100008246 3300006844 Bacteria 11550
263 Ga0075428_100012598 3300006844 Bacteria 9402
264 Ga0075428_100016111 3300006844 Bacteria 8264
265 Ga0075428_100016407 3300006844 Bacteria 8184
266 Ga0075428_100023613 3300006844 Bacteria 6807
267 Ga0075428_100099420 3300006844 Bacteria 3172
268 Ga0075428_100113085 3300006844 Bacteria 2957
269 Ga0075428_100167471 3300006844 Bacteria 2383
270 Ga0075430_100000792 3300006846 Bacteria 24519
271 Ga0075430_100002319 3300006846 Bacteria 15813
272 Ga0075430_100024767 3300006846 Bacteria 5104
273 Ga0075430_100038845 3300006846 Bacteria 4031
274 Ga0075430_100106553 3300006846 Bacteria 2338
275 Ga0075431_100003925 3300006847 Bacteria 14484
276 Ga0075431_100004102 3300006847 Bacteria 14228
277 Ga0075431_100011761 3300006847 Bacteria 8830
278 Ga0075431_100017152 3300006847 Bacteria 7360
279 Ga0075431_100018285 3300006847 Bacteria 7131
280 Ga0075431_100029812 3300006847 Bacteria 5618
281 Ga0075431_100040075 3300006847 Bacteria 4827
282 Ga0075431_100097966 3300006847 Bacteria 3028
283 Ga0075431_100128295 3300006847 Bacteria 2617
284 Ga0075431_100154780 3300006847 Bacteria 2359
285 Ga0075431_100305073 3300006847 Bacteria 1608
286 Ga0075431_100412836 3300006847 Bacteria 1350
287 Ga0075433_10000117 3300006852 Bacteria 39826
288 Ga0075433_10001282 3300006852 Bacteria 18351
289 Ga0075433_10003276 3300006852 Bacteria 12499
290 Ga0075433_10032388 3300006852 Bacteria 4478
291 Ga0075433_10058992 3300006852 Bacteria 3357
292 Ga0075433_10070161 3300006852 Bacteria 3079
293 Ga0075433_10197389 3300006852 Bacteria 1790
294 Ga0075434_100001049 3300006871 Bacteria 22542
295 Ga0075434_100001628 3300006871 Bacteria 19107
296 Ga0075434_100002292 3300006871 Bacteria 16732
297 Ga0075434_100006547 3300006871 Bacteria 10682
298 Ga0075434_100007494 3300006871 Bacteria 10099
299 Ga0075434_100008566 3300006871 Bacteria 9514
300 Ga0075434_100011037 3300006871 Bacteria 8499
301 Ga0075434_100133283 3300006871 Bacteria 2504
302 Ga0075434_100167579 3300006871 Bacteria 2216
303 Ga0075434_100227357 3300006871 Bacteria 1885
304 Ga0075429_100002617 3300006880 Bacteria 15180
305 Ga0075429_100004049 3300006880 Bacteria 12552
306 Ga0075429_100006146 3300006880 Bacteria 10381
307 Ga0075429_100012495 3300006880 Bacteria 7365
308 Ga0075429_100046796 3300006880 Bacteria 3764
309 Ga0068865_100005679 3300006881 Bacteria 7578
310 Ga0068865_100025355 3300006881 Bacteria 3900
311 Ga0068865_100051045 3300006881 Bacteria 2861
312 Ga0068865_100217855 3300006881 Bacteria 1491
313 Ga0075436_100008464 3300006914 Bacteria 7033
314 Ga0075436_100098257 3300006914 Bacteria 2037
315 Ga0097620_100002171 3300006931 Bacteria 19940
316 Ga0097620_100016971 3300006931 Bacteria 7308
317 Ga0097620_100020062 3300006931 Bacteria 6711
318 Ga0097620_100029008 3300006931 Bacteria 5551
319 Ga0097620_100080712 3300006931 Bacteria 3294
320 Ga0097620_100141713 3300006931 Bacteria 2477
321 Ga0097620_100152754 3300006931 Bacteria 2384
322 Ga0097620_100225864 3300006931 Bacteria 1960
323 Ga0075435_100000213 3300007076 Bacteria 35518
324 Ga0075435_100000297 3300007076 Bacteria 30737
325 Ga0075435_100005321 3300007076 Bacteria 8965
326 Ga0075435_100017325 3300007076 Bacteria 5451
327 Ga0075435_100032983 3300007076 Bacteria 4092
328 Ga0075435_100040177 3300007076 Bacteria 3735
329 Ga0075435_100040619 3300007076 Bacteria 3716
330 Ga0075435_100055651 3300007076 Bacteria 3196
331 Ga0105240_10028537 3300009093 Bacteria 7288
332 Ga0105240_10063655 3300009093 Bacteria 4586
333 Ga0105240_10091463 3300009093 Bacteria 3717
334 Ga0111539_10000058 3300009094 Bacteria 114638
335 Ga0111539_10000325 3300009094 Bacteria 58382
336 Ga0111539_10001074 3300009094 Bacteria 36076
337 Ga0111539_10001176 3300009094 Bacteria 34725
338 Ga0111539_10001197 3300009094 Bacteria 34523
339 Ga0111539_10001475 3300009094 Bacteria 31424
340 Ga0111539_10003731 3300009094 Bacteria 20043
341 Ga0111539_10006888 3300009094 Bacteria 14599
342 Ga0111539_10008450 3300009094 Bacteria 13096
343 Ga0111539_10036302 3300009094 Bacteria 5961
344 Ga0111539_10041490 3300009094 Bacteria 5533
345 Ga0111539_10044979 3300009094 Bacteria 5286
346 Ga0111539_10045572 3300009094 Bacteria 5249
347 Ga0111539_10097285 3300009094 Bacteria 3457
348 Ga0111539_10098985 3300009094 Bacteria 3425
349 Ga0105245_10238498 3300009098 Bacteria 1762
350 Ga0105247_10031583 3300009101 Bacteria 3215
351 Ga0105247_10044693 3300009101 Bacteria 2717
352 Ga0114129_10000006 3300009147 Bacteria 157531
353 Ga0114129_10000086 3300009147 Bacteria 86772
354 Ga0114129_10000535 3300009147 Bacteria 46578
355 Ga0114129_10002028 3300009147 Bacteria 27757
356 Ga0114129_10002137 3300009147 Bacteria 27257
357 Ga0114129_10002788 3300009147 Bacteria 24360
358 Ga0114129_10010075 3300009147 Bacteria 13472
359 Ga0114129_10015682 3300009147 Bacteria 10775
360 Ga0114129_10016405 3300009147 Bacteria 10541
361 Ga0114129_10023419 3300009147 Bacteria 8755
362 Ga0114129_10027315 3300009147 Bacteria 8081
363 Ga0114129_10029872 3300009147 Bacteria 7718
364 Ga0114129_10031981 3300009147 Bacteria 7438
365 Ga0114129_10038255 3300009147 Bacteria 6769
366 Ga0114129_10039441 3300009147 Bacteria 6658
367 Ga0114129_10044612 3300009147 Bacteria 6236
368 Ga0114129_10049856 3300009147 Bacteria 5882
369 Ga0114129_10062231 3300009147 Bacteria 5214
370 Ga0114129_10080265 3300009147 Bacteria 4534
371 Ga0114129_10123072 3300009147 Bacteria 3568
372 Ga0114129_10188309 3300009147 Bacteria 2804
373 Ga0114129_10245184 3300009147 Bacteria 2407
374 Ga0105243_10017800 3300009148 Bacteria 5376
375 Ga0105243_10066362 3300009148 Bacteria 2902
376 Ga0105243_10073547 3300009148 Bacteria 2770
377 Ga0105242_10011789 3300009176 Bacteria 6728
378 Ga0105242_10027442 3300009176 Bacteria 4520
379 Ga0105242_10069128 3300009176 Bacteria 2924
380 Ga0105248_10003314 3300009177 Bacteria 17875
381 Ga0105248_10016498 3300009177 Bacteria 8131
382 Ga0105248_10044075 3300009177 Bacteria 5003
383 Ga0105248_10064422 3300009177 Bacteria 4115
384 Ga0105248_10080302 3300009177 Bacteria 3665
385 Ga0105248_10142313 3300009177 Bacteria 2705
386 Ga0105248_10227608 3300009177 Bacteria 2099
387 Ga0105248_10228539 3300009177 Bacteria 2094
388 Ga0105248_10329833 3300009177 Bacteria 1719
389 Ga0105248_10372020 3300009177 Bacteria 1609
390 Ga0105237_10003664 3300009545 Bacteria 18113
391 Ga0105238_10318333 3300009551 Bacteria 1541
392 Ga0105249_10001652 3300009553 Bacteria 19532
393 Ga0105249_10001775 3300009553 Bacteria 18798
394 Ga0105249_10111431 3300009553 Bacteria 2588
395 Ga0157374_10015227 3300013296 Bacteria 6744
396 Ga0157378_10316880 3300013297 Bacteria 1514
397 Ga0163162_10047460 3300013306 Bacteria 4304
398 Ga0163162_10257726 3300013306 Bacteria 1876
399 Ga0157375_10068832 3300013308 Bacteria 3543
400 Ga0157375_10162813 3300013308 Bacteria 2374
401 Ga0157375_10230677 3300013308 Bacteria 2010
402 Ga0163163_10000022 3300014325 Bacteria 187289
403 Ga0163163_10014117 3300014325 Bacteria 7336
404 Ga0163163_10016032 3300014325 Bacteria 6949
405 Ga0163163_10019551 3300014325 Bacteria 6362
406 Ga0163163_10053198 3300014325 Bacteria 3996
407 Ga0157380_10007449 3300014326 Bacteria 7771
408 Ga0157377_10016113 3300014745 Bacteria 3839
409 Ga0157377_10055948 3300014745 Bacteria 2238
410 Ga0157377_10074316 3300014745 Bacteria 1972
411 Ga0157377_10081070 3300014745 Bacteria 1897
412 Ga0157379_10005030 3300014968 Bacteria 11340
413 Ga0157379_10009001 3300014968 Bacteria 8702
414 Ga0157379_10058462 3300014968 Bacteria 3447
415 Ga0157379_10075345 3300014968 Bacteria 3021
416 Ga0157379_10083810 3300014968 Bacteria 2857
417 Ga0157376_10003567 3300014969 Bacteria 10724
418 Ga0157376_10019672 3300014969 Bacteria 5208
419 Ga0157376_10027906 3300014969 Bacteria 4481
420 Ga0157376_10089394 3300014969 Bacteria 2663
421 Ga0157376_10160799 3300014969 Bacteria 2036
422 Ga0157376_10172235 3300014969 Bacteria 1972
423 Ga0163161_10005036 3300017792 Bacteria 9191
424 Ga0163161_10110299 3300017792 Bacteria 2056
425 Ga0207697_10000205 3300025315 Bacteria 31703
426 Ga0207682_10000463 3300025893 Bacteria 18777
427 Ga0207642_10008305 3300025899 Bacteria 3554
428 Ga0207710_10031496 3300025900 Bacteria 2319
429 Ga0207710_10036444 3300025900 Bacteria 2168
430 Ga0207688_10007917 3300025901 Bacteria 5784
431 Ga0207680_10009146 3300025903 Bacteria 4899
432 Ga0207680_10056339 3300025903 Bacteria 2373
433 Ga0207680_10154961 3300025903 Bacteria 1531
434 Ga0207645_10000604 3300025907 Bacteria 29721
435 Ga0207645_10032096 3300025907 Bacteria 3377
436 Ga0207645_10058829 3300025907 Bacteria 2454
437 Ga0207643_10000388 3300025908 Bacteria 29338
438 Ga0207643_10006413 3300025908 Bacteria 6300
439 Ga0207643_10033820 3300025908 Bacteria 2861
440 Ga0207643_10049928 3300025908 Bacteria 2371
441 Ga0207705_10031800 3300025909 Bacteria 3769
442 Ga0207707_10039997 3300025912 Bacteria 4097
443 Ga0207707_10070430 3300025912 Bacteria 3047
444 Ga0207695_10008487 3300025913 Bacteria 12846
445 Ga0207663_10048110 3300025916 Bacteria 2637
446 Ga0207662_10000796 3300025918 Bacteria 14521
447 Ga0207662_10007461 3300025918 Bacteria 5956
448 Ga0207662_10007991 3300025918 Bacteria 5768
449 Ga0207662_10115908 3300025918 Bacteria 1675
450 Ga0207652_10032531 3300025921 Bacteria 4386
451 Ga0207652_10165214 3300025921 Bacteria 1985
452 Ga0207646_10196321 3300025922 Bacteria 1822
453 Ga0207681_10003972 3300025923 Bacteria 9170
454 Ga0207681_10004122 3300025923 Bacteria 9008
455 Ga0207681_10017019 3300025923 Bacteria 4560
456 Ga0207681_10044318 3300025923 Bacteria 2981
457 Ga0207681_10060744 3300025923 Bacteria 2596
458 Ga0207681_10138819 3300025923 Bacteria 1808
459 Ga0207681_10139520 3300025923 Bacteria 1804
460 Ga0207681_10201374 3300025923 Bacteria 1529
461 Ga0207650_10014068 3300025925 Bacteria 5556
462 Ga0207650_10035626 3300025925 Bacteria 3616
463 Ga0207650_10044468 3300025925 Bacteria 3264
464 Ga0207650_10046750 3300025925 Bacteria 3188
465 Ga0207650_10125624 3300025925 Bacteria 2002
466 Ga0207659_10000293 3300025926 Bacteria 30396
467 Ga0207659_10000326 3300025926 Bacteria 28731
468 Ga0207659_10004827 3300025926 Bacteria 8171
469 Ga0207659_10035608 3300025926 Bacteria 3442
470 Ga0207659_10060834 3300025926 Bacteria 2720
471 Ga0207659_10064840 3300025926 Bacteria 2645
472 Ga0207659_10119343 3300025926 Bacteria 2019
473 Ga0207659_10130139 3300025926 Bacteria 1941
474 Ga0207659_10148296 3300025926 Bacteria 1829
475 Ga0207700_10006706 3300025928 Bacteria 6987
476 Ga0207700_10022777 3300025928 Bacteria 4303
477 Ga0207700_10089903 3300025928 Bacteria 2422
478 Ga0207644_10075050 3300025931 Bacteria 2484
479 Ga0207644_10083047 3300025931 Bacteria 2371
480 Ga0207644_10114181 3300025931 Bacteria 2046
481 Ga0207644_10197862 3300025931 Bacteria 1584
482 Ga0207644_10264263 3300025931 Bacteria 1377
483 Ga0207690_10091180 3300025932 Bacteria 2154
484 Ga0207690_10108396 3300025932 Bacteria 1996
485 Ga0207706_10005654 3300025933 Bacteria 11652
486 Ga0207706_10014400 3300025933 Bacteria 7167
487 Ga0207706_10027132 3300025933 Bacteria 5122
488 Ga0207706_10127196 3300025933 Bacteria 2240
489 Ga0207686_10010314 3300025934 Bacteria 5084
490 Ga0207709_10032830 3300025935 Bacteria 3043
491 Ga0207670_10021563 3300025936 Bacteria 3977
492 Ga0207670_10130450 3300025936 Bacteria 1841
493 Ga0207669_10000485 3300025937 Bacteria 17276
494 Ga0207669_10010988 3300025937 Bacteria 4384
495 Ga0207669_10061983 3300025937 Bacteria 2301
496 Ga0207669_10098565 3300025937 Bacteria 1925
497 Ga0207669_10121022 3300025937 Bacteria 1777
498 Ga0207669_10158235 3300025937 Bacteria 1596
499 Ga0207669_10165286 3300025937 Bacteria 1568
500 Ga0207704_10039040 3300025938 Bacteria 2760
501 Ga0207691_10003596 3300025940 Bacteria 15063
502 Ga0207691_10009207 3300025940 Bacteria 9476
503 Ga0207691_10016772 3300025940 Bacteria 6950
504 Ga0207691_10019770 3300025940 Bacteria 6369
505 Ga0207691_10048878 3300025940 Bacteria 3876
506 Ga0207691_10049213 3300025940 Bacteria 3862
507 Ga0207691_10055638 3300025940 Bacteria 3605
508 Ga0207691_10084610 3300025940 Bacteria 2847
509 Ga0207711_10019521 3300025941 Bacteria 5642
510 Ga0207711_10029567 3300025941 Bacteria 4624
511 Ga0207711_10033432 3300025941 Bacteria 4351
512 Ga0207711_10052644 3300025941 Bacteria 3489
513 Ga0207711_10088702 3300025941 Bacteria 2716
514 Ga0207711_10153768 3300025941 Bacteria 2078
515 Ga0207689_10000493 3300025942 Bacteria 37382
516 Ga0207689_10053565 3300025942 Bacteria 3324
517 Ga0207689_10075018 3300025942 Bacteria 2780
518 Ga0207689_10088221 3300025942 Bacteria 2548
519 Ga0207661_10065095 3300025944 Bacteria 2958
520 Ga0207661_10065705 3300025944 Bacteria 2945
521 Ga0207679_10001534 3300025945 Bacteria 14424
522 Ga0207679_10072946 3300025945 Bacteria 2595
523 Ga0207679_10086401 3300025945 Bacteria 2412
524 Ga0207679_10122742 3300025945 Bacteria 2071
525 Ga0207679_10268517 3300025945 Bacteria 1458
526 Ga0207667_10229884 3300025949 Bacteria 1899
527 Ga0207651_10021752 3300025960 Bacteria 3905
528 Ga0207651_10029444 3300025960 Bacteria 3479
529 Ga0207651_10034073 3300025960 Bacteria 3293
530 Ga0207651_10054222 3300025960 Bacteria 2746
531 Ga0207651_10068391 3300025960 Bacteria 2504
532 Ga0207651_10116925 3300025960 Bacteria 2014
533 Ga0207651_10132945 3300025960 Bacteria 1908
534 Ga0207712_10011403 3300025961 Bacteria 5663
535 Ga0207712_10058936 3300025961 Bacteria 2715
536 Ga0207712_10077446 3300025961 Bacteria 2410
537 Ga0207712_10136502 3300025961 Bacteria 1877
538 Ga0207668_10110065 3300025972 Bacteria 2065
539 Ga0207668_10120930 3300025972 Bacteria 1983
540 Ga0207658_10022741 3300025986 Bacteria 4367
541 Ga0207677_10046499 3300026023 Bacteria 2906
542 Ga0207677_10194243 3300026023 Bacteria 1608
543 Ga0207703_10011640 3300026035 Bacteria 6841
544 Ga0207703_10018232 3300026035 Bacteria 5482
545 Ga0207703_10026021 3300026035 Bacteria 4605
546 Ga0207703_10033634 3300026035 Bacteria 4065
547 Ga0207703_10058550 3300026035 Bacteria 3145
548 Ga0207703_10157326 3300026035 Bacteria 1987
549 Ga0207703_10234319 3300026035 Bacteria 1647
550 Ga0207708_10002632 3300026075 Bacteria 13204
551 Ga0207708_10005513 3300026075 Bacteria 9340
552 Ga0207708_10023061 3300026075 Bacteria 4702
553 Ga0207708_10110670 3300026075 Bacteria 2131
554 Ga0207641_10005008 3300026088 Bacteria 11359
555 Ga0207641_10014455 3300026088 Bacteria 6466
556 Ga0207641_10024274 3300026088 Bacteria 4997
557 Ga0207648_10000066 3300026089 Bacteria 98414
558 Ga0207648_10001196 3300026089 Bacteria 29074
559 Ga0207648_10003352 3300026089 Bacteria 16838
560 Ga0207648_10083107 3300026089 Bacteria 2793
561 Ga0207676_10026424 3300026095 Bacteria 4319
562 Ga0207676_10347253 3300026095 Bacteria 1371
563 Ga0207674_10008960 3300026116 Bacteria 11499
564 Ga0207674_10054035 3300026116 Bacteria 4091
565 Ga0207674_10172504 3300026116 Bacteria 2116
566 Ga0207675_100002221 3300026118 Bacteria 19290
567 Ga0207675_100003750 3300026118 Bacteria 14800
568 Ga0207675_100006154 3300026118 Bacteria 11400
569 Ga0207675_100013041 3300026118 Bacteria 7760
570 Ga0207675_100052306 3300026118 Bacteria 3811
571 Ga0207675_100059970 3300026118 Bacteria 3551
572 Ga0207675_100349512 3300026118 Bacteria 1449
573 Ga0207683_10017391 3300026121 Bacteria 6128
574 Ga0207683_10062123 3300026121 Bacteria 3289
575 Ga0207683_10063363 3300026121 Bacteria 3257
576 Ga0207683_10110074 3300026121 Bacteria 2466
577 Ga0207698_10032059 3300026142 Bacteria 3802
578 Ga0207698_10050680 3300026142 Bacteria 3169
579 Ga0209971_1025470 3300027682 Bacteria 1413
580 Ga0209998_10004994 3300027717 Bacteria 2788
581 Ga0207428_10000384 3300027907 Bacteria 55472
582 Ga0207428_10001147 3300027907 Bacteria 28680
583 Ga0207428_10002004 3300027907 Bacteria 20617
584 Ga0207428_10002555 3300027907 Bacteria 18177
585 Ga0207428_10003877 3300027907 Bacteria 14336
586 Ga0207428_10004178 3300027907 Bacteria 13837
587 Ga0207428_10008715 3300027907 Bacteria 9153
588 Ga0207428_10014166 3300027907 Bacteria 6941
589 Ga0207428_10034723 3300027907 Bacteria 4128
590 Ga0207428_10039463 3300027907 Bacteria 3834
591 Ga0207428_10056760 3300027907 Bacteria 3110
592 Ga0207428_10128770 3300027907 Bacteria 1938
593 Ga0207428_10136632 3300027907 Bacteria 1874
594 Ga0207428_10148612 3300027907 Bacteria 1785
595 Ga0268266_10000031 3300028379 Bacteria 406292
596 Ga0268266_10011481 3300028379 Bacteria 7694
597 Ga0268266_10015827 3300028379 Bacteria 6458
598 Ga0268266_10154655 3300028379 Bacteria 2070
599 Ga0268265_10000073 3300028380 Bacteria 128856
600 Ga0268265_10004027 3300028380 Bacteria 10350
601 Ga0268265_10035978 3300028380 Bacteria 3623
602 Ga0268265_10175603 3300028380 Bacteria 1835
603 Ga0268265_10240934 3300028380 Bacteria 1596
604 Ga0268264_10080119 3300028381 Bacteria 2788
605 Ga0268264_10146810 3300028381 Bacteria 2110
606 Ga0307511_10000356 3300030521 Bacteria 48468
607 Ga0265320_10083966 3300031240 Bacteria 1484
608 Ga0307408_100155550 3300031548 Bacteria 1810
609 Ga0307413_10008660 3300031824 Bacteria 4820
610 Ga0307413_10235736 3300031824 Bacteria 1347
611 Ga0307410_10023586 3300031852 Bacteria 3829
612 Ga0307410_10063133 3300031852 Bacteria 2540
613 Ga0307410_10087645 3300031852 Bacteria 2202
614 Ga0307406_10009340 3300031901 Bacteria 5497
615 Ga0307406_10095715 3300031901 Bacteria 2010
616 Ga0307406_10159921 3300031901 Bacteria 1618
617 Ga0307407_10042645 3300031903 Bacteria 2545
618 Ga0307407_10132996 3300031903 Bacteria 1594
619 Ga0307412_10018353 3300031911 Bacteria 4208
620 Ga0307412_10020109 3300031911 Bacteria 4057
621 Ga0307409_100045742 3300031995 Bacteria 3307
622 Ga0307409_100100724 3300031995 Bacteria 2395
623 Ga0307409_100104797 3300031995 Bacteria 2356
624 Ga0307409_100179873 3300031995 Bacteria 1871
625 Ga0307416_100003153 3300032002 Bacteria 9661
626 Ga0307416_100013387 3300032002 Bacteria 5573
627 Ga0307411_10008606 3300032005 Bacteria 5300
628 Ga0307411_10067754 3300032005 Bacteria 2403
629 Ga0307415_100024184 3300032126 Bacteria 3788
630 Ga0307415_100044876 3300032126 Bacteria 2959
631 Ga0307415_100045924 3300032126 Bacteria 2932
632 Ga0307415_100049048 3300032126 Bacteria 2852
633 Ga0307415_100137416 3300032126 Bacteria 1861
634 Ga0373958_0000875 3300034819 Bacteria 3876
635 Ga0373959_0009532 3300034820 Bacteria 1677
636 Ga0373929_0000673 3300035085 Bacteria 6586
637 Ga0373940_0001778 3300035088 Bacteria 4011
638 Ga0373949_0001556 3300035090 Bacteria 6478
639 Ga0373951_0000250 3300035091 Bacteria 17855
640 Ga0373952_0011873 3300035092 Bacteria 1705
641 Ga0373932_0001839 3300035112 Bacteria 5677
642 Ga0373939_0000330 3300035114 Bacteria 12172
643 Ga0373941_0001944 3300035115 Bacteria 4476
644 Ga0373945_0082277 3300035116 Bacteria 1235
645 Ga0373960_0000553 3300035121 Bacteria 7559
646 Ga0373943_0027502 3300035170 Bacteria 2673
647 Ga0373946_0007807 3300035171 Bacteria 3928
648 Ga0373955_0024945 3300035172 Bacteria 3064
649 Ga0373942_0000461 3300035207 Bacteria 11493
650 Ga0373961_0001789 3300035241 Bacteria 5922
651 Ga0373961_0022355 3300035241 Bacteria 1691
652 Ga0373924_0005767 3300035410 Bacteria 4403
653 Ga0373931_0027480 3300035691 Bacteria 2905
654 Ga0373931_0054408 3300035691 Bacteria 2139
655 Ga0373931_0058237 3300035691 Bacteria 2074
656 Ga0373935_0073940 3300035692 Bacteria 2202
657 Ga0373933_0130828 3300035724 Bacteria 1578
658 Ga0373947_0007636 3300035725 Bacteria 6257
659 Ga0373937_0025695 3300036401 Bacteria 5319
660 Ga0373937_0028403 3300036401 Bacteria 5062
661 Ga0373925_0059964 3300037068 Bacteria 2856
662 Ga0395905_0297288 3300037471 Bacteria 1502
663 Ga0436365_1516765 3300039437 Bacteria 2870
664 Ga0439439_0012265 3300041406 Bacteria 2071
665 Ga0451853_0579045 3300041512 Bacteria 1634
666 Ga0439431_0010431 3300041997 Bacteria 2109
667 Ga0439433_0016331 3300041999 Bacteria 1644
668 Ga0439449_0033891 3300042007 Bacteria 1902
669 Ga0439462_0025858 3300042015 Bacteria 1546
670 Ga0450920_008379 3300042122 Bacteria 1889
671 Ga0450923_000426 3300042125 Bacteria 4544
672 Ga0450923_012758 3300042125 Bacteria 1534
673 Ga0450894_000617 3300042131 Bacteria 5992
674 Ga0450896_001948 3300042133 Bacteria 2623
675 Ga0439446_0013425 3300042156 Bacteria 2248
676 Ga0439435_0009846 3300042436 Bacteria 2253
677 Ga0439435_0025433 3300042436 Bacteria 1569
678 Ga0451577_0039555 3300042876 Bacteria 4238
679 Ga0453684_0007700 3300044712 Bacteria 19687
680 Ga0451576_0003199 3300045051 Bacteria 22846
681 Ga0451576_0047452 3300045051 Bacteria 4515
682 Ga0451576_0160287 3300045051 Bacteria 2347
683 Ga0451576_0196080 3300045051 Bacteria 2109
684 Ga0451576_0274922 3300045051 Bacteria 1761
685 Ga0451576_0340825 3300045051 Bacteria 1569
686 Ga0451576_0458422 3300045051 Bacteria 1339
687 Ga0466967_0121536 3300045976 Bacteria 2414
688 Ga0495592_0056422 3300046454 Bacteria 2903
689 Ga0495603_0099276 3300046455 Bacteria 1700
690 Ga0495638_0002045 3300046460 Bacteria 17161
691 Ga0495608_0004305 3300046511 Bacteria 10197
692 Ga0495630_0004210 3300046517 Bacteria 10077
693 Ga0495643_0029339 3300046522 Bacteria 3078
694 Ga0495642_0001939 3300046528 Bacteria 8746
695 Ga0495640_0238116 3300046533 Bacteria 1143
696 Ga0495586_0019109 3300046535 Bacteria 3646
697 Ga0495587_0023896 3300046536 Bacteria 3752
698 Ga0495621_0000274 3300046539 Bacteria 12339
699 Ga0495645_0003638 3300046543 Bacteria 10467
700 Ga0495645_0048688 3300046543 Bacteria 3086
701 Ga0495633_0041241 3300046558 Bacteria 2196
702 Ga0495656_0004734 3300046615 Bacteria 4677
703 Ga0495634_0071486 3300046642 Bacteria 2284
704 Ga0495659_0045274 3300046664 Bacteria 1585
705 Ga0495588_0093176 3300046674 Bacteria 1579
706 Ga0495658_0083994 3300046683 Bacteria 1874
707 Ga0495658_0145241 3300046683 Bacteria 1453
708 Ga0495669_0007861 3300046684 Bacteria 4474
709 Ga0495613_0005107 3300046689 Bacteria 9843
710 Ga0495604_0059614 3300047317 Bacteria 2925
711 Ga0495636_0002541 3300047318 Bacteria 7008
712 Ga0495636_0055183 3300047318 Bacteria 1670
713 Ga0495674_0022038 3300047319 Bacteria 5879
714 Ga0495680_0077287 3300047322 Bacteria 2522
715 Ga0495677_0038898 3300047445 Bacteria 1738
716 Ga0495684_0001265 3300047471 Bacteria 20345
717 Ga0495684_0182541 3300047471 Bacteria 1555
718 Ga0496101_0000804 3300048904 Bacteria 18549
719 Ga0496104_0002606 3300048907 Bacteria 15527
720 Ga0496104_0003935 3300048907 Bacteria 12850
721 Ga0496104_0019706 3300048907 Bacteria 6176
722 Ga0496104_0056354 3300048907 Bacteria 3716
723 Ga0496104_0136351 3300048907 Bacteria 2358
724 Ga0496106_0145960 3300048909 Bacteria 1864
725 Ga0496106_0210716 3300048909 Bacteria 1548
726 Ga0496107_0106101 3300048910 Bacteria 2063
727 Ga0496108_0018262 3300048911 Bacteria 5742
728 Ga0496108_0018917 3300048911 Bacteria 5649
729 Ga0496108_0108005 3300048911 Bacteria 2377
730 Ga0496109_0008025 3300048912 Bacteria 8949
731 Ga0496109_0011886 3300048912 Bacteria 7494
732 Ga0496109_0232526 3300048912 Bacteria 1734
733 Ga0496110_0102985 3300048913 Bacteria 2560
734 Ga0496110_0132986 3300048913 Bacteria 2247
735 Ga0496110_0167139 3300048913 Bacteria 1995
736 Ga0496110_0180220 3300048913 Bacteria 1918
737 Ga0496112_0001309 3300048915 Bacteria 18920
738 Ga0496112_0013809 3300048915 Bacteria 7470
739 Ga0496112_0029041 3300048915 Bacteria 5346
740 Ga0496112_0064938 3300048915 Bacteria 3602
741 Ga0496112_0066934 3300048915 Bacteria 3545
742 Ga0496112_0139931 3300048915 Bacteria 2390
743 Ga0496113_0024136 3300048916 Bacteria 4318
744 Ga0496114_0001096 3300048917 Bacteria 20425
745 Ga0496114_0002165 3300048917 Bacteria 14953
746 Ga0496114_0133546 3300048917 Bacteria 2145
747 Ga0496115_0032156 3300048918 Bacteria 4139
748 Ga0496125_0000110 3300048928 Bacteria 192693
749 Ga0501032_0010564 3300049569 Bacteria 6657
750 Ga0501032_0040621 3300049569 Bacteria 3161
751 Ga0501033_0004582 3300049570 Bacteria 11071
752 Ga0501033_0013428 3300049570 Bacteria 6239
753 Ga0501033_0065267 3300049570 Bacteria 2678
754 Ga0501034_0002089 3300049571 Bacteria 24951
755 Ga0501034_0012882 3300049571 Bacteria 8624
756 Ga0501034_0015356 3300049571 Bacteria 7870
757 Ga0501034_0017979 3300049571 Bacteria 7252
758 Ga0501034_0217803 3300049571 Bacteria 1862
759 Ga0501036_0007369 3300049572 Bacteria 8963
760 Ga0501036_0028381 3300049572 Bacteria 4729
761 Ga0501036_0050145 3300049572 Bacteria 3535
762 Ga0501036_0057218 3300049572 Bacteria 3303
763 Ga0501036_0136125 3300049572 Bacteria 2073
764 Ga0501036_0195179 3300049572 Bacteria 1703
765 Ga0501036_0268280 3300049572 Bacteria 1429
766 Ga0501037_0018423 3300049573 Bacteria 5146
767 Ga0501038_0008228 3300049574 Bacteria 9599
768 Ga0501038_0016707 3300049574 Bacteria 6648
769 Ga0501038_0020934 3300049574 Bacteria 5877
770 Ga0501038_0058964 3300049574 Bacteria 3289
771 Ga0501038_0086775 3300049574 Bacteria 2629
772 Ga0501039_0010716 3300049575 Bacteria 6985
773 Ga0501039_0024023 3300049575 Bacteria 4681
774 Ga0501039_0050259 3300049575 Bacteria 3225
775 Ga0501039_0053740 3300049575 Bacteria 3117
776 Ga0501039_0060535 3300049575 Bacteria 2933
777 Ga0501040_0001382 3300049576 Bacteria 15327
778 Ga0501040_0025001 3300049576 Bacteria 4013
779 Ga0501040_0051305 3300049576 Bacteria 2822
780 Ga0501041_0000597 3300049577 Bacteria 18872
781 Ga0501041_0025281 3300049577 Bacteria 3569
782 Ga0501041_0039024 3300049577 Bacteria 2881
783 Ga0501041_0074349 3300049577 Bacteria 2088
784 Ga0501042_0041720 3300049578 Bacteria 3264
785 Ga0501042_0067683 3300049578 Bacteria 2553
786 Ga0501043_0001140 3300049579 Bacteria 23357
787 Ga0501043_0071783 3300049579 Bacteria 2719
788 Ga0501043_0091148 3300049579 Bacteria 2396
789 Ga0501046_0003486 3300049580 Bacteria 14423
790 Ga0501046_0015129 3300049580 Bacteria 6487
791 Ga0501046_0017976 3300049580 Bacteria 5892
792 Ga0501046_0021113 3300049580 Bacteria 5376
793 Ga0501046_0026442 3300049580 Bacteria 4740
794 Ga0501047_0000908 3300049581 Bacteria 30253
795 Ga0501047_0006823 3300049581 Bacteria 10727
796 Ga0501047_0043918 3300049581 Bacteria 4317
797 Ga0501048_0002446 3300049582 Bacteria 14175
798 Ga0501048_0045755 3300049582 Bacteria 3125
799 Ga0501048_0063065 3300049582 Bacteria 2622
800 Ga0501048_0068820 3300049582 Bacteria 2500
801 Ga0501067_0065120 3300049583 Bacteria 2017
802 Ga0501068_0008404 3300049584 Bacteria 5743
803 Ga0501068_0016295 3300049584 Bacteria 4283
804 Ga0501068_0031077 3300049584 Bacteria 3171
805 Ga0501069_0013156 3300049585 Bacteria 4409
806 Ga0501070_0115182 3300049586 Bacteria 2220
807 Ga0501071_0005906 3300049587 Bacteria 7919
808 Ga0501071_0028537 3300049587 Bacteria 3934
809 Ga0501071_0044245 3300049587 Bacteria 3193
810 Ga0501071_0122660 3300049587 Bacteria 1927
811 Ga0501072_0018177 3300049588 Bacteria 5408
812 Ga0501072_0032031 3300049588 Bacteria 4116
813 Ga0501072_0033988 3300049588 Bacteria 3994
814 Ga0501072_0086541 3300049588 Bacteria 2487
815 Ga0501072_0113304 3300049588 Bacteria 2159
816 Ga0501073_0007926 3300049589 Bacteria 7880
817 Ga0501073_0008361 3300049589 Bacteria 7675
818 Ga0501073_0070812 3300049589 Bacteria 2429
819 Ga0501074_0218254 3300049590 Bacteria 1358
820 Ga0501075_0000178 3300049591 Bacteria 33062
821 Ga0501075_0010672 3300049591 Bacteria 6464
822 Ga0501075_0013657 3300049591 Bacteria 5801
823 Ga0501075_0093693 3300049591 Bacteria 2280
824 Ga0501076_0004723 3300049592 Bacteria 9721
825 Ga0501076_0010886 3300049592 Bacteria 6766
826 Ga0501076_0027892 3300049592 Bacteria 4380
827 Ga0501076_0166821 3300049592 Bacteria 1795
828 Ga0501076_0260076 3300049592 Bacteria 1421
829 Ga0501077_0017103 3300049593 Bacteria 4574
830 Ga0501077_0037886 3300049593 Bacteria 3070
831 Ga0501077_0040049 3300049593 Bacteria 2985
832 Ga0501077_0081414 3300049593 Bacteria 2051
833 Ga0501217_003704 3300049661 Bacteria 3105
834 Ga0501079_0000603 3300049741 Bacteria 23834
835 Ga0501079_0015632 3300049741 Bacteria 5796
836 Ga0501079_0037822 3300049741 Bacteria 3721
837 Ga0501080_0001055 3300049742 Bacteria 22666
838 Ga0501080_0017108 3300049742 Bacteria 6697
839 Ga0501080_0024517 3300049742 Bacteria 5592
840 Ga0501080_0089859 3300049742 Bacteria 2853
841 Ga0501080_0093465 3300049742 Bacteria 2793
842 Ga0501080_0157811 3300049742 Bacteria 2095
843 Ga0501081_0000629 3300049743 Bacteria 20130
844 Ga0501081_0037707 3300049743 Bacteria 3299
845 Ga0501081_0132638 3300049743 Bacteria 1781
846 Ga0501081_0263013 3300049743 Bacteria 1261
847 Ga0501083_0008276 3300049744 Bacteria 7353
848 Ga0501083_0041397 3300049744 Bacteria 3124
849 Ga0501083_0087921 3300049744 Bacteria 2054
850 Ga0501035_0123944 3300049822 Bacteria 2257
851 Ga0501035_0363038 3300049822 Bacteria 1210
852 Ga0501044_0018916 3300049823 Bacteria 7373
853 Ga0501044_0062774 3300049823 Bacteria 3796
854 Ga0501044_0087804 3300049823 Bacteria 3140
855 Ga0501045_0002740 3300049824 Bacteria 12039
856 Ga0501045_0006810 3300049824 Bacteria 7918
857 Ga0501045_0013268 3300049824 Bacteria 5816
858 Ga0501045_0015836 3300049824 Bacteria 5348
859 Ga0501045_0048673 3300049824 Bacteria 3090
860 Ga0501045_0055704 3300049824 Bacteria 2891
861 nmdc:mga03683_6376_c1 3300050489 Bacteria 4035
862 nmdc:mga03n38_52542_c1 3300050490 Bacteria 1824
863 nmdc:mga00v17_2777_c1 3300050491 Bacteria 8987
864 nmdc:mga00v17_50774_c1 3300050491 Bacteria 2521
865 nmdc:mga0yw44_165056_c1 3300050492 Bacteria 1451
866 nmdc:mga0yw44_51969_c1 3300050492 Bacteria 2483
867 nmdc:mga0yw44_55252_c1 3300050492 Bacteria 1912
868 nmdc:mga0yw44_8972_c1 3300050492 Bacteria 5019
869 nmdc:mga0k408_14528_c1 3300050493 Bacteria 4341
870 nmdc:mga0k408_36239_c1 3300050493 Bacteria 2831
871 nmdc:mga0k408_4972_c1 3300050493 Bacteria 7044
872 nmdc:mga0k408_49885_c1 3300050493 Bacteria 2423
873 nmdc:mga0k408_54998_c1 3300050493 Bacteria 2307
874 nmdc:mga06z11_25980_c1 3300050494 Bacteria 2782
875 nmdc:mga06z11_29142_c1 3300050494 Bacteria 2656
876 nmdc:mga07m45_25398_c2 3300050496 Bacteria 2866
877 nmdc:mga05p37_11403_c1 3300050507 Bacteria 10579
878 nmdc:mga05p37_12306_c1 3300050507 Bacteria 10218
879 nmdc:mga05p37_128098_c1 3300050507 Bacteria 3116
880 nmdc:mga05p37_1358_c1 3300050507 Bacteria 28465
881 nmdc:mga05p37_15661_c1 3300050507 Bacteria 9114
882 nmdc:mga05p37_2308_c1 3300050507 Bacteria 22237
883 nmdc:mga05p37_26622_c1 3300050507 Bacteria 7032
884 nmdc:mga05p37_28047_c1 3300050507 Bacteria 6861
885 nmdc:mga05p37_282934_c1 3300050507 Bacteria 1977
886 nmdc:mga05p37_33001_c1 3300050507 Bacteria 6339
887 nmdc:mga05p37_3422_c1 3300050507 Bacteria 18519
888 nmdc:mga05p37_3819_c1 3300050507 Bacteria 17617
889 nmdc:mga05p37_42401_c1 3300050507 Bacteria 5591
890 nmdc:mga05p37_43448_c1 3300050507 Bacteria 5529
891 nmdc:mga05p37_495_c1 3300050507 Bacteria 43222
892 nmdc:mga05p37_5252_c1 3300050507 Bacteria 15201
893 nmdc:mga05p37_55203_c1 3300050507 Bacteria 4887
894 nmdc:mga05p37_58213_c1 3300050507 Bacteria 4759
895 nmdc:mga05p37_6503_c2 3300050507 Bacteria 11287
896 nmdc:mga05p37_68083_c1 3300050507 Bacteria 4378
897 nmdc:mga05p37_68337_c1 3300050507 Bacteria 4369
898 nmdc:mga05p37_961_c1 3300050507 Bacteria 32612
899 nmdc:mga09592_108188_c1 3300050508 Bacteria 2384
900 nmdc:mga09592_10896_c1 3300050508 Bacteria 7400
901 nmdc:mga09592_17183_c1 3300050508 Bacteria 5924
902 nmdc:mga09592_2031_c1 3300050508 Bacteria 16324
903 nmdc:mga09592_4707_c1 3300050508 Bacteria 11050
904 nmdc:mga09592_62675_c1 3300050508 Bacteria 3146
905 nmdc:mga09592_86250_c1 3300050508 Bacteria 2678
906 nmdc:mga0qj67_1190_c1 3300050509 Bacteria 18039
907 nmdc:mga0qj67_2135_c1 3300050509 Bacteria 14068
908 nmdc:mga0qj67_22084_c1 3300050509 Bacteria 4884
909 nmdc:mga0qj67_32516_c1 3300050509 Bacteria 4069
910 nmdc:mga0qj67_35929_c1 3300050509 Bacteria 3875
911 nmdc:mga0qj67_40919_c1 3300050509 Bacteria 3643
912 nmdc:mga0qj67_47324_c1 3300050509 Bacteria 3398
913 nmdc:mga0qj67_58411_c1 3300050509 Bacteria 3059
914 nmdc:mga0qj67_60442_c1 3300050509 Bacteria 3007
915 nmdc:mga0qj67_82034_c1 3300050509 Bacteria 2586
916 nmdc:mga06r32_129893_c1 3300050510 Bacteria 2491
917 nmdc:mga06r32_14863_c1 3300050510 Bacteria 7063
918 nmdc:mga06r32_160070_c1 3300050510 Bacteria 2233
919 nmdc:mga06r32_16856_c1 3300050510 Bacteria 6663
920 nmdc:mga06r32_25092_c1 3300050510 Bacteria 5540
921 nmdc:mga06r32_2825_c1 3300050510 Bacteria 15577
922 nmdc:mga06r32_393907_c1 3300050510 Bacteria 1367
923 nmdc:mga06r32_496934_c1 3300050510 Bacteria 1197
924 nmdc:mga06r32_78935_c1 3300050510 Bacteria 3201
925 nmdc:mga08y16_11370_c1 3300050511 Bacteria 9353
926 nmdc:mga08y16_11518_c1 3300050511 Bacteria 9292
927 nmdc:mga08y16_12_c1 3300050511 Bacteria 438455
928 nmdc:mga08y16_150876_c1 3300050511 Bacteria 2416
929 nmdc:mga08y16_154644_c1 3300050511 Bacteria 2384
930 nmdc:mga08y16_17225_c1 3300050511 Bacteria 7606
931 nmdc:mga08y16_187138_c1 3300050511 Bacteria 2148
932 nmdc:mga08y16_20431_c1 3300050511 Bacteria 6990
933 nmdc:mga08y16_255175_c1 3300050511 Bacteria 1812
934 nmdc:mga08y16_259322_c1 3300050511 Bacteria 1795
935 nmdc:mga08y16_275149_c1 3300050511 Bacteria 1738
936 nmdc:mga08y16_323468_c1 3300050511 Bacteria 1587
937 nmdc:mga08y16_33699_c1 3300050511 Bacteria 5378
938 nmdc:mga08y16_4298_c1 3300050511 Bacteria 14875
939 nmdc:mga08y16_62425_c1 3300050511 Bacteria 3891
940 nmdc:mga08y16_632_c1 3300050511 Bacteria 33000
941 nmdc:mga08y16_635_c1 3300050511 Bacteria 32952
942 nmdc:mga08y16_6404_c1 3300050511 Bacteria 12342
943 nmdc:mga08y16_66344_c1 3300050511 Bacteria 3766
944 nmdc:mga08y16_6914_c1 3300050511 Bacteria 11895
945 nmdc:mga08y16_73474_c1 3300050511 Bacteria 3564
946 nmdc:mga08y16_78768_c1 3300050511 Bacteria 3435
947 nmdc:mga08y16_9169_c1 3300050511 Bacteria 10387
948 nmdc:mga0n895_107863_c1 3300050512 Bacteria 2799
949 nmdc:mga0n895_136750_c1 3300050512 Bacteria 2477
950 nmdc:mga0n895_1444_c1 3300050512 Bacteria 17764
951 nmdc:mga0n895_14801_c1 3300050512 Bacteria 7098
952 nmdc:mga0n895_148625_c1 3300050512 Bacteria 2372
953 nmdc:mga0n895_1608_c1 3300050512 Bacteria 17009
954 nmdc:mga0n895_173_c1 3300050512 Bacteria 39986
955 nmdc:mga0n895_279438_c1 3300050512 Bacteria 1693
956 nmdc:mga0n895_3741_c1 3300050512 Bacteria 12312
957 nmdc:mga0n895_46140_c1 3300050512 Bacteria 4255
958 nmdc:mga0n895_5460_c1 3300050512 Bacteria 10633
959 nmdc:mga0n895_87701_c1 3300050512 Bacteria 3110
960 nmdc:mga0rr50_1088_c1 3300050513 Bacteria 14763
961 nmdc:mga0rr50_126967_c1 3300050513 Bacteria 2038
962 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
963 nmdc:mga0rr50_3496_c1 3300050513 Bacteria 9050
964 nmdc:mga0rr50_61366_c1 3300050513 Bacteria 2832
965 nmdc:mga0rr50_69588_c1 3300050513 Bacteria 2679
966 nmdc:mga0rr50_89446_c1 3300050513 Bacteria 2394
967 nmdc:mga08x19_13689_c1 3300050514 Bacteria 4909
968 nmdc:mga08x19_24019_c1 3300050514 Bacteria 3785
969 nmdc:mga08x19_452_c1 3300050514 Bacteria 27982
970 nmdc:mga08x19_46854_c1 3300050514 Bacteria 2766
971 nmdc:mga0a205_144881_c2 3300050515 Bacteria 1672
972 nmdc:mga0a205_145467_c1 3300050515 Bacteria 2270
973 nmdc:mga0a205_170541_c1 3300050515 Bacteria 2072
974 nmdc:mga0a205_171984_c1 3300050515 Bacteria 2062
975 nmdc:mga0a205_196634_c1 3300050515 Bacteria 1907
976 nmdc:mga0a205_2224_c1 3300050515 Bacteria 17074
977 nmdc:mga0a205_25961_c1 3300050515 Bacteria 5581
978 nmdc:mga0a205_47152_c1 3300050515 Bacteria 4157
979 nmdc:mga0a205_47_c1 3300050515 Bacteria 65667
980 nmdc:mga0a205_57182_c1 3300050515 Bacteria 3766
981 nmdc:mga0a205_82073_c1 3300050515 Bacteria 3114
982 Ga0495601_0003629 3300053077 Bacteria 8872
983 Ga0495601_0005785 3300053077 Bacteria 7211
984 Ga0495595_0076467 3300053084 Bacteria 1589
985 Ga0495619_0001690 3300053085 Bacteria 14594
986 Ga0495619_0021667 3300053085 Bacteria 4105
987 Ga0495619_0147271 3300053085 Bacteria 1624
988 Ga0500641_0003189 3300053096 Bacteria 5797
989 Ga0500555_000789 3300053103 Bacteria 11496
990 Ga0500593_098259 3300053117 Bacteria 1225
991 Ga0500616_0000358 3300053153 Bacteria 64893
992 Ga0500645_001085 3300053730 Bacteria 14965
993 Ga0501084_0007641 3300054114 Bacteria 8913
994 Ga0501084_0011303 3300054114 Bacteria 7391
995 Ga0501084_0021751 3300054114 Bacteria 5349
996 Ga0501084_0022378 3300054114 Bacteria 5273
997 Ga0501084_0029602 3300054114 Bacteria 4581
998 Ga0501084_0161265 3300054114 Bacteria 1892
999 Ga0590071_000222 3300059421 Bacteria 16802
1000 Ga0590071_000785 3300059421 Bacteria 8886
1001 Ga0590074_000479 3300059423 Bacteria 5882
1002 Ga0590074_003564 3300059423 Bacteria 2577
1003 Ga0590075_000259 3300059424 Bacteria 14841
1004 Ga0590075_002259 3300059424 Bacteria 4629
1005 Ga0590075_002665 3300059424 Bacteria 4264
1006 Ga0590077_000168 3300059426 Bacteria 18409
1007 Ga0590077_000434 3300059426 Bacteria 11752
1008 Ga0590077_000839 3300059426 Bacteria 7922
1009 Ga0501082_0003739 3300060353 Bacteria 13297
1010 Ga0501082_0055328 3300060353 Bacteria 3418
1011 Ga0501082_0083506 3300060353 Bacteria 2756
1012 Ga0501082_0282336 3300060353 Bacteria 1445
1013 Ga0530510_0003933 3300061734 Bacteria 10244
1014 Ga0530510_0121296 3300061734 Bacteria 1919
1015 Ga0530510_0167794 3300061734 Bacteria 1626

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0363038 Ga0501035_0363038_137_1198 337
2 3300049824 Ga0501045_0006810 Ga0501045_0006810_6820_7881 337
3 3300061734 Ga0530510_0167794 Ga0530510_0167794_55_1107 347
4 3300003320 rootH2_10032907 rootH2_1003290710 350
5 3300005289 Ga0065704_10083391 Ga0065704_100833912 351
6 3300005548 Ga0070665_100000030 Ga0070665_100000030116 351
7 3300005841 Ga0068863_100001409 Ga0068863_10000140924 351
8 3300005842 Ga0068858_100002257 Ga0068858_1000022575 351
9 3300006852 Ga0075433_10058992 Ga0075433_100589925 351
10 3300009545 Ga0105237_10003664 Ga0105237_100036647 351
11 3300025913 Ga0207695_10008487 Ga0207695_100084872 351
12 3300026088 Ga0207641_10005008 Ga0207641_100050085 351
13 3300028379 Ga0268266_10000031 Ga0268266_10000031116 351
14 3300030521 Ga0307511_10000356 Ga0307511_1000035631 351
15 3300048928 Ga0496125_0000110 Ga0496125_0000110_160119_161204 351
16 3300049574 Ga0501038_0008228 Ga0501038_0008228_8512_9567 351
17 3300050515 nmdc:mga0a205_82073_c1 nmdc:mga0a205_82073_c1_1716_2795 351
18 3300049743 Ga0501081_0263013 Ga0501081_0263013_24_1085 353
19 3300046533 Ga0495640_0238116 Ga0495640_0238116_38_1132 364
20 3300050508 nmdc:mga09592_108188_c1 nmdc:mga09592_108188_c1_1205_2344 364
21 3300050510 nmdc:mga06r32_393907_c1 nmdc:mga06r32_393907_c1_194_1312 366
22 3300053117 Ga0500593_098259 Ga0500593_098259_12_1142 366
23 3300049592 Ga0501076_0260076 Ga0501076_0260076_10_1173 367
24 3300050510 nmdc:mga06r32_496934_c1 nmdc:mga06r32_496934_c1_11_1126 370
25 3300049569 Ga0501032_0010564 Ga0501032_0010564_1963_3171 381
26 3300049571 Ga0501034_0002089 Ga0501034_0002089_10299_11507 381
27 3300049572 Ga0501036_0028381 Ga0501036_0028381_892_2100 381
28 3300049574 Ga0501038_0016707 Ga0501038_0016707_2673_3881 381
29 3300049574 Ga0501038_0020934 Ga0501038_0020934_587_1795 381
30 3300049575 Ga0501039_0024023 Ga0501039_0024023_1553_2761 381
31 3300049580 Ga0501046_0015129 Ga0501046_0015129_4422_5630 381
32 3300049581 Ga0501047_0006823 Ga0501047_0006823_9364_10572 381
33 3300049583 Ga0501067_0065120 Ga0501067_0065120_721_1929 381
34 3300049584 Ga0501068_0016295 Ga0501068_0016295_856_2064 381
35 3300049585 Ga0501069_0013156 Ga0501069_0013156_3043_4251 381
36 3300049588 Ga0501072_0018177 Ga0501072_0018177_2481_3689 381
37 3300049589 Ga0501073_0070812 Ga0501073_0070812_1049_2257 381
38 3300049742 Ga0501080_0001055 Ga0501080_0001055_10598_11806 381
39 3300049742 Ga0501080_0017108 Ga0501080_0017108_621_1829 381
40 3300049744 Ga0501083_0041397 Ga0501083_0041397_592_1800 381
41 3300049823 Ga0501044_0018916 Ga0501044_0018916_1459_2667 381
42 3300060353 Ga0501082_0055328 Ga0501082_0055328_2044_3252 381
43 3300042156 Ga0439446_0013425 Ga0439446_0013425_577_1806 384
44 3300049571 Ga0501034_0217803 Ga0501034_0217803_30_1190 385
45 3300005617 Ga0068859_100225870 Ga0068859_1002258702 386
46 3300006931 Ga0097620_100225864 Ga0097620_1002258642 386
47 3300025960 Ga0207651_10034073 Ga0207651_100340733 386
48 3300026121 Ga0207683_10110074 Ga0207683_101100743 386
49 3300035116 Ga0373945_0082277 Ga0373945_0082277_25_1215 386
50 3300049588 Ga0501072_0113304 Ga0501072_0113304_966_2126 386
51 3300009177 Ga0105248_10064422 Ga0105248_100644223 388
52 3300014325 Ga0163163_10000022 Ga0163163_10000022155 388
53 3300025941 Ga0207711_10019521 Ga0207711_100195213 388
54 3300035691 Ga0373931_0054408 Ga0373931_0054408_272_1447 388
55 3300048913 Ga0496110_0132986 Ga0496110_0132986_942_2153 388
56 3300005333 Ga0070677_10001126 Ga0070677_100011261 389
57 3300025893 Ga0207682_10000463 Ga0207682_1000046312 389
58 3300025928 Ga0207700_10022777 Ga0207700_100227775 389
59 3300031240 Ga0265320_10083966 Ga0265320_100839662 389
60 3300005549 Ga0070704_100040593 Ga0070704_1000405933 390
61 3300005840 Ga0068870_10066607 Ga0068870_100666072 390
62 3300006852 Ga0075433_10003276 Ga0075433_100032761 390
63 3300007076 Ga0075435_100040619 Ga0075435_1000406192 390
64 3300049742 Ga0501080_0093465 Ga0501080_0093465_292_1524 390
65 3300049743 Ga0501081_0037707 Ga0501081_0037707_1202_2434 390
66 3300049824 Ga0501045_0013268 Ga0501045_0013268_2031_3263 390
67 3300050513 nmdc:mga0rr50_61366_c1 nmdc:mga0rr50_61366_c1_1567_2775 390
68 3300050515 nmdc:mga0a205_47152_c1 nmdc:mga0a205_47152_c1_1388_2596 390
69 3300009094 Ga0111539_10001475 Ga0111539_1000147518 392
70 3300027907 Ga0207428_10008715 Ga0207428_100087156 392
71 3300050511 nmdc:mga08y16_6404_c1 nmdc:mga08y16_6404_c1_1127_2326 392
72 3300005356 Ga0070674_100005303 Ga0070674_1000053036 393
73 3300025937 Ga0207669_10061983 Ga0207669_100619832 393
74 3300048909 Ga0496106_0145960 Ga0496106_0145960_117_1325 393
75 3300005341 Ga0070691_10000205 Ga0070691_100002055 395
76 3300005440 Ga0070705_100016983 Ga0070705_1000169833 395
77 3300005441 Ga0070700_100017254 Ga0070700_1000172542 395
78 3300005459 Ga0068867_100021865 Ga0068867_1000218653 395
79 3300005549 Ga0070704_100030556 Ga0070704_1000305563 395
80 3300005719 Ga0068861_100004810 Ga0068861_1000048109 395
81 3300009094 Ga0111539_10098985 Ga0111539_100989852 395
82 3300025960 Ga0207651_10054222 Ga0207651_100542223 395
83 3300026075 Ga0207708_10002632 Ga0207708_1000263214 395
84 3300026089 Ga0207648_10003352 Ga0207648_100033524 395
85 3300026118 Ga0207675_100002221 Ga0207675_10000222113 395
86 3300027907 Ga0207428_10014166 Ga0207428_100141663 395
87 3300050511 nmdc:mga08y16_9169_c1 nmdc:mga08y16_9169_c1_355_1557 395
88 3300005347 Ga0070668_100125037 Ga0070668_1001250372 396
89 3300005353 Ga0070669_100031848 Ga0070669_1000318482 396
90 3300005354 Ga0070675_100041404 Ga0070675_1000414041 396
91 3300005366 Ga0070659_100277527 Ga0070659_1002775271 396
92 3300005436 Ga0070713_100099511 Ga0070713_1000995113 396
93 3300025926 Ga0207659_10148296 Ga0207659_101482961 396
94 3300025928 Ga0207700_10089903 Ga0207700_100899033 396
95 3300036401 Ga0373937_0028403 Ga0373937_0028403_2556_3764 396
96 3300005290 Ga0065712_10135542 Ga0065712_101355421 397
97 3300005293 Ga0065715_10150068 Ga0065715_101500682 397
98 3300005340 Ga0070689_100075253 Ga0070689_1000752531 397
99 3300005355 Ga0070671_100142785 Ga0070671_1001427852 397
100 3300005406 Ga0070703_10034019 Ga0070703_100340191 397
101 3300005434 Ga0070709_10004714 Ga0070709_100047143 397
102 3300005543 Ga0070672_100046395 Ga0070672_1000463953 397
103 3300005543 Ga0070672_100125233 Ga0070672_1001252332 397
104 3300005544 Ga0070686_100026138 Ga0070686_1000261383 397
105 3300005563 Ga0068855_100238144 Ga0068855_1002381442 397
106 3300005617 Ga0068859_100080713 Ga0068859_1000807133 397
107 3300005618 Ga0068864_100010029 Ga0068864_1000100293 397
108 3300005841 Ga0068863_100279305 Ga0068863_1002793051 397
109 3300006038 Ga0075365_10011187 Ga0075365_100111874 397
110 3300006038 Ga0075365_10091209 Ga0075365_100912092 397
111 3300006042 Ga0075368_10011178 Ga0075368_100111783 397
112 3300006051 Ga0075364_10005997 Ga0075364_100059972 397
113 3300006051 Ga0075364_10024627 Ga0075364_100246273 397
114 3300006051 Ga0075364_10038767 Ga0075364_100387672 397
115 3300006177 Ga0075362_10001506 Ga0075362_100015067 397
116 3300006178 Ga0075367_10036553 Ga0075367_100365532 397
117 3300006195 Ga0075366_10019632 Ga0075366_100196322 397
118 3300006195 Ga0075366_10099884 Ga0075366_100998842 397
119 3300006237 Ga0097621_100134430 Ga0097621_1001344302 397
120 3300006353 Ga0075370_10024577 Ga0075370_100245772 397
121 3300006931 Ga0097620_100080712 Ga0097620_1000807123 397
122 3300009093 Ga0105240_10091463 Ga0105240_100914633 397
123 3300009177 Ga0105248_10044075 Ga0105248_100440754 397
124 3300025903 Ga0207680_10056339 Ga0207680_100563392 397
125 3300025925 Ga0207650_10035626 Ga0207650_100356264 397
126 3300025928 Ga0207700_10006706 Ga0207700_100067064 397
127 3300025932 Ga0207690_10091180 Ga0207690_100911802 397
128 3300025933 Ga0207706_10127196 Ga0207706_101271962 397
129 3300025940 Ga0207691_10016772 Ga0207691_100167726 397
130 3300025940 Ga0207691_10019770 Ga0207691_100197703 397
131 3300025949 Ga0207667_10229884 Ga0207667_102298842 397
132 3300027682 Ga0209971_1025470 Ga0209971_10254701 397
133 3300027717 Ga0209998_10004994 Ga0209998_100049943 397
134 3300028379 Ga0268266_10154655 Ga0268266_101546552 397
135 3300037471 Ga0395905_0297288 Ga0395905_0297288_213_1415 397
136 3300048907 Ga0496104_0056354 Ga0496104_0056354_1225_2439 397
137 3300048909 Ga0496106_0210716 Ga0496106_0210716_114_1334 397
138 3300048911 Ga0496108_0018917 Ga0496108_0018917_1226_2446 397
139 3300048912 Ga0496109_0011886 Ga0496109_0011886_466_1686 397
140 3300048913 Ga0496110_0102985 Ga0496110_0102985_1214_2434 397
141 3300048915 Ga0496112_0064938 Ga0496112_0064938_1048_2268 397
142 3300048917 Ga0496114_0002165 Ga0496114_0002165_8487_9701 397
143 3300049571 Ga0501034_0017979 Ga0501034_0017979_1288_2499 397
144 3300050489 nmdc:mga03683_6376_c1 nmdc:mga03683_6376_c1_853_2061 397
145 3300050490 nmdc:mga03n38_52542_c1 nmdc:mga03n38_52542_c1_222_1430 397
146 3300050491 nmdc:mga00v17_2777_c1 nmdc:mga00v17_2777_c1_5685_6893 397
147 3300050492 nmdc:mga0yw44_51969_c1 nmdc:mga0yw44_51969_c1_229_1437 397
148 3300050492 nmdc:mga0yw44_55252_c1 nmdc:mga0yw44_55252_c1_213_1421 397
149 3300050492 nmdc:mga0yw44_8972_c1 nmdc:mga0yw44_8972_c1_2757_3965 397
150 3300050493 nmdc:mga0k408_14528_c1 nmdc:mga0k408_14528_c1_2633_3841 397
151 3300050493 nmdc:mga0k408_49885_c1 nmdc:mga0k408_49885_c1_367_1575 397
152 3300050494 nmdc:mga06z11_25980_c1 nmdc:mga06z11_25980_c1_1422_2630 397
153 3300050494 nmdc:mga06z11_29142_c1 nmdc:mga06z11_29142_c1_1348_2556 397
154 3300050507 nmdc:mga05p37_58213_c1 nmdc:mga05p37_58213_c1_1816_3024 397
155 3300060353 Ga0501082_0282336 Ga0501082_0282336_145_1356 397
156 3300005295 Ga0065707_10011370 Ga0065707_100113701 398
157 3300005334 Ga0068869_100013680 Ga0068869_1000136804 398
158 3300005335 Ga0070666_10029308 Ga0070666_100293083 398
159 3300005347 Ga0070668_100116014 Ga0070668_1001160142 398
160 3300005356 Ga0070674_100191155 Ga0070674_1001911551 398
161 3300005366 Ga0070659_100207275 Ga0070659_1002072751 398
162 3300005435 Ga0070714_100111001 Ga0070714_1001110012 398
163 3300005471 Ga0070698_100209682 Ga0070698_1002096822 398
164 3300005518 Ga0070699_100017167 Ga0070699_1000171676 398
165 3300005543 Ga0070672_100295807 Ga0070672_1002958071 398
166 3300005544 Ga0070686_100023538 Ga0070686_1000235383 398
167 3300005546 Ga0070696_100020430 Ga0070696_1000204301 398
168 3300005548 Ga0070665_100001511 Ga0070665_10000151118 398
169 3300006195 Ga0075366_10026713 Ga0075366_100267133 398
170 3300006237 Ga0097621_100014408 Ga0097621_1000144085 398
171 3300006237 Ga0097621_100025908 Ga0097621_1000259085 398
172 3300006358 Ga0068871_100006379 Ga0068871_1000063796 398
173 3300006358 Ga0068871_100038339 Ga0068871_1000383393 398
174 3300006844 Ga0075428_100113085 Ga0075428_1001130852 398
175 3300006847 Ga0075431_100305073 Ga0075431_1003050732 398
176 3300006871 Ga0075434_100011037 Ga0075434_1000110376 398
177 3300006881 Ga0068865_100025355 Ga0068865_1000253552 398
178 3300007076 Ga0075435_100000297 Ga0075435_10000029711 398
179 3300007076 Ga0075435_100017325 Ga0075435_1000173256 398
180 3300009093 Ga0105240_10028537 Ga0105240_100285376 398
181 3300009094 Ga0111539_10006888 Ga0111539_100068884 398
182 3300009147 Ga0114129_10000006 Ga0114129_100000066 398
183 3300009147 Ga0114129_10015682 Ga0114129_100156822 398
184 3300009147 Ga0114129_10029872 Ga0114129_100298722 398
185 3300009176 Ga0105242_10027442 Ga0105242_100274423 398
186 3300009176 Ga0105242_10069128 Ga0105242_100691282 398
187 3300009177 Ga0105248_10227608 Ga0105248_102276082 398
188 3300009177 Ga0105248_10329833 Ga0105248_103298331 398
189 3300009551 Ga0105238_10318333 Ga0105238_103183332 398
190 3300014969 Ga0157376_10003567 Ga0157376_1000356710 398
191 3300025918 Ga0207662_10007991 Ga0207662_100079913 398
192 3300025932 Ga0207690_10108396 Ga0207690_101083962 398
193 3300025937 Ga0207669_10158235 Ga0207669_101582352 398
194 3300025938 Ga0207704_10039040 Ga0207704_100390402 398
195 3300025941 Ga0207711_10033432 Ga0207711_100334323 398
196 3300025941 Ga0207711_10052644 Ga0207711_100526442 398
197 3300025941 Ga0207711_10153768 Ga0207711_101537682 398
198 3300025942 Ga0207689_10075018 Ga0207689_100750183 398
199 3300025945 Ga0207679_10122742 Ga0207679_101227422 398
200 3300025972 Ga0207668_10120930 Ga0207668_101209301 398
201 3300026023 Ga0207677_10046499 Ga0207677_100464992 398
202 3300027907 Ga0207428_10128770 Ga0207428_101287701 398
203 3300031824 Ga0307413_10235736 Ga0307413_102357361 398
204 3300031852 Ga0307410_10023586 Ga0307410_100235862 398
205 3300031901 Ga0307406_10095715 Ga0307406_100957152 398
206 3300031995 Ga0307409_100179873 Ga0307409_1001798732 398
207 3300032002 Ga0307416_100003153 Ga0307416_10000315311 398
208 3300035724 Ga0373933_0130828 Ga0373933_0130828_82_1296 398
209 3300037068 Ga0373925_0059964 Ga0373925_0059964_1409_2635 398
210 3300041406 Ga0439439_0012265 Ga0439439_0012265_172_1443 398
211 3300041997 Ga0439431_0010431 Ga0439431_0010431_33_1253 398
212 3300042015 Ga0439462_0025858 Ga0439462_0025858_102_1373 398
213 3300046460 Ga0495638_0002045 Ga0495638_0002045_12441_13664 398
214 3300046664 Ga0495659_0045274 Ga0495659_0045274_97_1296 398
215 3300048904 Ga0496101_0000804 Ga0496101_0000804_4157_5371 398
216 3300048907 Ga0496104_0019706 Ga0496104_0019706_201_1406 398
217 3300048907 Ga0496104_0136351 Ga0496104_0136351_697_1902 398
218 3300048915 Ga0496112_0139931 Ga0496112_0139931_128_1333 398
219 3300048917 Ga0496114_0001096 Ga0496114_0001096_13494_14708 398
220 3300049569 Ga0501032_0040621 Ga0501032_0040621_1616_2836 398
221 3300049570 Ga0501033_0004582 Ga0501033_0004582_7605_8825 398
222 3300049570 Ga0501033_0013428 Ga0501033_0013428_2304_3512 398
223 3300049570 Ga0501033_0065267 Ga0501033_0065267_1093_2307 398
224 3300049571 Ga0501034_0012882 Ga0501034_0012882_800_2008 398
225 3300049572 Ga0501036_0007369 Ga0501036_0007369_5275_6495 398
226 3300049572 Ga0501036_0136125 Ga0501036_0136125_361_1569 398
227 3300049573 Ga0501037_0018423 Ga0501037_0018423_648_1868 398
228 3300049574 Ga0501038_0058964 Ga0501038_0058964_1255_2475 398
229 3300049575 Ga0501039_0050259 Ga0501039_0050259_1518_2726 398
230 3300049575 Ga0501039_0053740 Ga0501039_0053740_1678_2898 398
231 3300049575 Ga0501039_0060535 Ga0501039_0060535_963_2177 398
232 3300049576 Ga0501040_0001382 Ga0501040_0001382_9555_10769 398
233 3300049577 Ga0501041_0000597 Ga0501041_0000597_16697_17911 398
234 3300049579 Ga0501043_0001140 Ga0501043_0001140_7084_8292 398
235 3300049579 Ga0501043_0071783 Ga0501043_0071783_710_1924 398
236 3300049579 Ga0501043_0091148 Ga0501043_0091148_398_1618 398
237 3300049580 Ga0501046_0003486 Ga0501046_0003486_10136_11350 398
238 3300049580 Ga0501046_0017976 Ga0501046_0017976_1375_2583 398
239 3300049580 Ga0501046_0021113 Ga0501046_0021113_2747_3967 398
240 3300049580 Ga0501046_0026442 Ga0501046_0026442_2885_4093 398
241 3300049581 Ga0501047_0000908 Ga0501047_0000908_14831_16039 398
242 3300049582 Ga0501048_0002446 Ga0501048_0002446_10046_11266 398
243 3300049582 Ga0501048_0068820 Ga0501048_0068820_908_2122 398
244 3300049584 Ga0501068_0008404 Ga0501068_0008404_4222_5442 398
245 3300049584 Ga0501068_0031077 Ga0501068_0031077_1329_2543 398
246 3300049586 Ga0501070_0115182 Ga0501070_0115182_576_1796 398
247 3300049587 Ga0501071_0028537 Ga0501071_0028537_366_1580 398
248 3300049588 Ga0501072_0086541 Ga0501072_0086541_1002_2222 398
249 3300049589 Ga0501073_0007926 Ga0501073_0007926_1858_3066 398
250 3300049591 Ga0501075_0000178 Ga0501075_0000178_17825_19039 398
251 3300049593 Ga0501077_0040049 Ga0501077_0040049_956_2170 398
252 3300049741 Ga0501079_0000603 Ga0501079_0000603_12069_13283 398
253 3300049741 Ga0501079_0037822 Ga0501079_0037822_2204_3424 398
254 3300049742 Ga0501080_0024517 Ga0501080_0024517_2870_4084 398
255 3300049742 Ga0501080_0089859 Ga0501080_0089859_1259_2467 398
256 3300049742 Ga0501080_0157811 Ga0501080_0157811_451_1671 398
257 3300049743 Ga0501081_0000629 Ga0501081_0000629_16371_17585 398
258 3300049744 Ga0501083_0008276 Ga0501083_0008276_4370_5590 398
259 3300049744 Ga0501083_0087921 Ga0501083_0087921_579_1787 398
260 3300049822 Ga0501035_0123944 Ga0501035_0123944_727_1941 398
261 3300049823 Ga0501044_0062774 Ga0501044_0062774_2179_3387 398
262 3300049824 Ga0501045_0002740 Ga0501045_0002740_919_2133 398
263 3300050507 nmdc:mga05p37_3819_c1 nmdc:mga05p37_3819_c1_935_2149 398
264 3300050507 nmdc:mga05p37_495_c1 nmdc:mga05p37_495_c1_35438_36679 398
265 3300050507 nmdc:mga05p37_68337_c1 nmdc:mga05p37_68337_c1_1740_2936 398
266 3300050511 nmdc:mga08y16_150876_c1 nmdc:mga08y16_150876_c1_512_1759 398
267 3300050511 nmdc:mga08y16_259322_c1 nmdc:mga08y16_259322_c1_446_1669 398
268 3300050511 nmdc:mga08y16_4298_c1 nmdc:mga08y16_4298_c1_11354_12553 398
269 3300050512 nmdc:mga0n895_14801_c1 nmdc:mga0n895_14801_c1_3612_4823 398
270 3300050513 nmdc:mga0rr50_1088_c1 nmdc:mga0rr50_1088_c1_11291_12487 398
271 3300050514 nmdc:mga08x19_46854_c1 nmdc:mga08x19_46854_c1_1137_2348 398
272 3300053153 Ga0500616_0000358 Ga0500616_0000358_22045_23316 398
273 3300053730 Ga0500645_001085 Ga0500645_001085_1743_2963 398
274 3300054114 Ga0501084_0011303 Ga0501084_0011303_5199_6413 398
275 3300054114 Ga0501084_0022378 Ga0501084_0022378_2061_3269 398
276 3300059423 Ga0590074_003564 Ga0590074_003564_487_1701 398
277 3300059424 Ga0590075_002259 Ga0590075_002259_1856_3070 398
278 3300059426 Ga0590077_000434 Ga0590077_000434_8273_9487 398
279 3300060353 Ga0501082_0003739 Ga0501082_0003739_1095_2309 398
280 3300005295 Ga0065707_10000725 Ga0065707_1000072519 399
281 3300005331 Ga0070670_100099279 Ga0070670_1000992791 399
282 3300005335 Ga0070666_10008944 Ga0070666_100089442 399
283 3300005335 Ga0070666_10139271 Ga0070666_101392712 399
284 3300005354 Ga0070675_100090370 Ga0070675_1000903702 399
285 3300005364 Ga0070673_100126424 Ga0070673_1001264242 399
286 3300005364 Ga0070673_100155285 Ga0070673_1001552852 399
287 3300005438 Ga0070701_10078031 Ga0070701_100780312 399
288 3300005441 Ga0070700_100148097 Ga0070700_1001480972 399
289 3300005459 Ga0068867_100206901 Ga0068867_1002069012 399
290 3300005468 Ga0070707_100287150 Ga0070707_1002871502 399
291 3300005518 Ga0070699_100001760 Ga0070699_1000017602 399
292 3300005536 Ga0070697_100120214 Ga0070697_1001202142 399
293 3300005545 Ga0070695_100002328 Ga0070695_1000023284 399
294 3300005548 Ga0070665_100003106 Ga0070665_10000310618 399
295 3300005548 Ga0070665_100047420 Ga0070665_1000474205 399
296 3300005548 Ga0070665_100172675 Ga0070665_1001726751 399
297 3300005549 Ga0070704_100013345 Ga0070704_1000133451 399
298 3300005563 Ga0068855_100023926 Ga0068855_1000239264 399
299 3300005564 Ga0070664_100163921 Ga0070664_1001639212 399
300 3300005615 Ga0070702_100013036 Ga0070702_1000130364 399
301 3300005617 Ga0068859_100020062 Ga0068859_1000200625 399
302 3300005618 Ga0068864_100125007 Ga0068864_1001250072 399
303 3300005719 Ga0068861_100007457 Ga0068861_1000074572 399
304 3300005841 Ga0068863_100122832 Ga0068863_1001228321 399
305 3300005841 Ga0068863_100156929 Ga0068863_1001569292 399
306 3300005842 Ga0068858_100020921 Ga0068858_1000209217 399
307 3300005844 Ga0068862_100022724 Ga0068862_1000227242 399
308 3300006042 Ga0075368_10002646 Ga0075368_100026463 399
309 3300006042 Ga0075368_10010743 Ga0075368_100107432 399
310 3300006195 Ga0075366_10111235 Ga0075366_101112352 399
311 3300006353 Ga0075370_10016777 Ga0075370_100167772 399
312 3300006846 Ga0075430_100024767 Ga0075430_1000247674 399
313 3300006871 Ga0075434_100001049 Ga0075434_10000104918 399
314 3300006871 Ga0075434_100006547 Ga0075434_10000654710 399
315 3300006914 Ga0075436_100008464 Ga0075436_1000084643 399
316 3300006931 Ga0097620_100020062 Ga0097620_1000200625 399
317 3300007076 Ga0075435_100000213 Ga0075435_10000021318 399
318 3300009098 Ga0105245_10238498 Ga0105245_102384982 399
319 3300009147 Ga0114129_10044612 Ga0114129_100446123 399
320 3300009176 Ga0105242_10011789 Ga0105242_100117895 399
321 3300013296 Ga0157374_10015227 Ga0157374_100152276 399
322 3300013308 Ga0157375_10230677 Ga0157375_102306772 399
323 3300014745 Ga0157377_10074316 Ga0157377_100743161 399
324 3300014968 Ga0157379_10075345 Ga0157379_100753453 399
325 3300014969 Ga0157376_10019672 Ga0157376_100196725 399
326 3300014969 Ga0157376_10089394 Ga0157376_100893942 399
327 3300017792 Ga0163161_10005036 Ga0163161_100050365 399
328 3300025903 Ga0207680_10009146 Ga0207680_100091462 399
329 3300025909 Ga0207705_10031800 Ga0207705_100318003 399
330 3300025921 Ga0207652_10032531 Ga0207652_100325312 399
331 3300025940 Ga0207691_10048878 Ga0207691_100488784 399
332 3300025960 Ga0207651_10029444 Ga0207651_100294442 399
333 3300025961 Ga0207712_10058936 Ga0207712_100589363 399
334 3300026035 Ga0207703_10033634 Ga0207703_100336342 399
335 3300026095 Ga0207676_10347253 Ga0207676_103472531 399
336 3300026118 Ga0207675_100013041 Ga0207675_1000130412 399
337 3300026121 Ga0207683_10062123 Ga0207683_100621232 399
338 3300026142 Ga0207698_10050680 Ga0207698_100506802 399
339 3300028379 Ga0268266_10011481 Ga0268266_100114816 399
340 3300028380 Ga0268265_10035978 Ga0268265_100359783 399
341 3300028381 Ga0268264_10080119 Ga0268264_100801192 399
342 3300031852 Ga0307410_10063133 Ga0307410_100631332 399
343 3300031911 Ga0307412_10018353 Ga0307412_100183534 399
344 3300032126 Ga0307415_100045924 Ga0307415_1000459242 399
345 3300034819 Ga0373958_0000875 Ga0373958_0000875_2449_3648 399
346 3300034820 Ga0373959_0009532 Ga0373959_0009532_143_1342 399
347 3300035085 Ga0373929_0000673 Ga0373929_0000673_657_1856 399
348 3300035088 Ga0373940_0001778 Ga0373940_0001778_2566_3765 399
349 3300035090 Ga0373949_0001556 Ga0373949_0001556_4779_5978 399
350 3300035091 Ga0373951_0000250 Ga0373951_0000250_5749_6948 399
351 3300035092 Ga0373952_0011873 Ga0373952_0011873_38_1237 399
352 3300035112 Ga0373932_0001839 Ga0373932_0001839_469_1668 399
353 3300035114 Ga0373939_0000330 Ga0373939_0000330_9118_10317 399
354 3300035115 Ga0373941_0001944 Ga0373941_0001944_2779_3978 399
355 3300035121 Ga0373960_0000553 Ga0373960_0000553_3362_4561 399
356 3300035207 Ga0373942_0000461 Ga0373942_0000461_6083_7282 399
357 3300035241 Ga0373961_0001789 Ga0373961_0001789_3223_4422 399
358 3300035691 Ga0373931_0058237 Ga0373931_0058237_362_1561 399
359 3300041999 Ga0439433_0016331 Ga0439433_0016331_30_1274 399
360 3300042122 Ga0450920_008379 Ga0450920_008379_314_1552 399
361 3300042125 Ga0450923_012758 Ga0450923_012758_111_1349 399
362 3300045051 Ga0451576_0003199 Ga0451576_0003199_1681_2880 399
363 3300046522 Ga0495643_0029339 Ga0495643_0029339_49_1263 399
364 3300048910 Ga0496107_0106101 Ga0496107_0106101_136_1356 399
365 3300048913 Ga0496110_0167139 Ga0496110_0167139_623_1843 399
366 3300048918 Ga0496115_0032156 Ga0496115_0032156_121_1326 399
367 3300049572 Ga0501036_0195179 Ga0501036_0195179_452_1657 399
368 3300049582 Ga0501048_0045755 Ga0501048_0045755_555_1760 399
369 3300049587 Ga0501071_0044245 Ga0501071_0044245_556_1761 399
370 3300049588 Ga0501072_0033988 Ga0501072_0033988_2192_3397 399
371 3300049591 Ga0501075_0013657 Ga0501075_0013657_2638_3843 399
372 3300049592 Ga0501076_0027892 Ga0501076_0027892_1584_2789 399
373 3300049592 Ga0501076_0166821 Ga0501076_0166821_322_1539 399
374 3300050491 nmdc:mga00v17_50774_c1 nmdc:mga00v17_50774_c1_1110_2348 399
375 3300050492 nmdc:mga0yw44_165056_c1 nmdc:mga0yw44_165056_c1_94_1335 399
376 3300050493 nmdc:mga0k408_36239_c1 nmdc:mga0k408_36239_c1_152_1387 399
377 3300050493 nmdc:mga0k408_54998_c1 nmdc:mga0k408_54998_c1_1027_2259 399
378 3300050496 nmdc:mga07m45_25398_c2 nmdc:mga07m45_25398_c2_894_2129 399
379 3300050507 nmdc:mga05p37_42401_c1 nmdc:mga05p37_42401_c1_1314_2522 399
380 3300050509 nmdc:mga0qj67_22084_c1 nmdc:mga0qj67_22084_c1_953_2161 399
381 3300050509 nmdc:mga0qj67_60442_c1 nmdc:mga0qj67_60442_c1_1436_2659 399
382 3300050512 nmdc:mga0n895_173_c1 nmdc:mga0n895_173_c1_21292_22500 399
383 3300050512 nmdc:mga0n895_5460_c1 nmdc:mga0n895_5460_c1_9258_10466 399
384 3300050513 nmdc:mga0rr50_126967_c1 nmdc:mga0rr50_126967_c1_682_1887 399
385 3300050513 nmdc:mga0rr50_2_c1 nmdc:mga0rr50_2_c1_327136_328344 399
386 3300050513 nmdc:mga0rr50_89446_c1 nmdc:mga0rr50_89446_c1_327_1565 399
387 3300050514 nmdc:mga08x19_24019_c1 nmdc:mga08x19_24019_c1_1155_2363 399
388 3300050514 nmdc:mga08x19_452_c1 nmdc:mga08x19_452_c1_7394_8602 399
389 3300053077 Ga0495601_0003629 Ga0495601_0003629_2055_3275 399
390 3300053085 Ga0495619_0021667 Ga0495619_0021667_2832_4052 399
391 3300060353 Ga0501082_0083506 Ga0501082_0083506_208_1410 399
392 3300001977 JGI24746J21847_1000226 JGI24746J21847_10002262 400
393 3300003203 JGI25406J46586_10003400 JGI25406J46586_100034002 400
394 3300005289 Ga0065704_10079193 Ga0065704_100791934 400
395 3300005290 Ga0065712_10007258 Ga0065712_100072582 400
396 3300005290 Ga0065712_10011325 Ga0065712_100113253 400
397 3300005290 Ga0065712_10068725 Ga0065712_1006872510 400
398 3300005290 Ga0065712_10077341 Ga0065712_100773413 400
399 3300005290 Ga0065712_10080235 Ga0065712_100802352 400
400 3300005293 Ga0065715_10090819 Ga0065715_100908191 400
401 3300005293 Ga0065715_10102890 Ga0065715_101028901 400
402 3300005293 Ga0065715_10110296 Ga0065715_101102963 400
403 3300005293 Ga0065715_10132562 Ga0065715_101325622 400
404 3300005293 Ga0065715_10192023 Ga0065715_101920231 400
405 3300005295 Ga0065707_10008899 Ga0065707_100088992 400
406 3300005295 Ga0065707_10094284 Ga0065707_100942843 400
407 3300005295 Ga0065707_10099266 Ga0065707_100992662 400
408 3300005327 Ga0070658_10025668 Ga0070658_100256682 400
409 3300005328 Ga0070676_10001466 Ga0070676_100014669 400
410 3300005328 Ga0070676_10041319 Ga0070676_100413192 400
411 3300005328 Ga0070676_10065562 Ga0070676_100655622 400
412 3300005329 Ga0070683_100009233 Ga0070683_1000092336 400
413 3300005329 Ga0070683_100040413 Ga0070683_1000404132 400
414 3300005330 Ga0070690_100025084 Ga0070690_1000250842 400
415 3300005330 Ga0070690_100120191 Ga0070690_1001201911 400
416 3300005331 Ga0070670_100006839 Ga0070670_1000068397 400
417 3300005331 Ga0070670_100008844 Ga0070670_1000088449 400
418 3300005331 Ga0070670_100037970 Ga0070670_1000379703 400
419 3300005331 Ga0070670_100123603 Ga0070670_1001236032 400
420 3300005334 Ga0068869_100002498 Ga0068869_1000024982 400
421 3300005334 Ga0068869_100009274 Ga0068869_1000092746 400
422 3300005334 Ga0068869_100022727 Ga0068869_1000227274 400
423 3300005335 Ga0070666_10029797 Ga0070666_100297974 400
424 3300005335 Ga0070666_10112000 Ga0070666_101120002 400
425 3300005335 Ga0070666_10178262 Ga0070666_101782621 400
426 3300005338 Ga0068868_100194480 Ga0068868_1001944802 400
427 3300005340 Ga0070689_100035932 Ga0070689_1000359322 400
428 3300005340 Ga0070689_100060359 Ga0070689_1000603593 400
429 3300005340 Ga0070689_100090596 Ga0070689_1000905962 400
430 3300005340 Ga0070689_100162245 Ga0070689_1001622452 400
431 3300005343 Ga0070687_100018084 Ga0070687_1000180843 400
432 3300005345 Ga0070692_10008777 Ga0070692_100087772 400
433 3300005347 Ga0070668_100193341 Ga0070668_1001933411 400
434 3300005353 Ga0070669_100000448 Ga0070669_1000004488 400
435 3300005353 Ga0070669_100006945 Ga0070669_1000069452 400
436 3300005353 Ga0070669_100013978 Ga0070669_1000139784 400
437 3300005353 Ga0070669_100030385 Ga0070669_1000303853 400
438 3300005353 Ga0070669_100080683 Ga0070669_1000806832 400
439 3300005353 Ga0070669_100147150 Ga0070669_1001471502 400
440 3300005353 Ga0070669_100156427 Ga0070669_1001564272 400
441 3300005354 Ga0070675_100000079 Ga0070675_10000007947 400
442 3300005354 Ga0070675_100001092 Ga0070675_1000010928 400
443 3300005354 Ga0070675_100004445 Ga0070675_1000044455 400
444 3300005354 Ga0070675_100030474 Ga0070675_1000304742 400
445 3300005354 Ga0070675_100150010 Ga0070675_1001500102 400
446 3300005355 Ga0070671_100009064 Ga0070671_1000090646 400
447 3300005355 Ga0070671_100037811 Ga0070671_1000378113 400
448 3300005355 Ga0070671_100129684 Ga0070671_1001296842 400
449 3300005355 Ga0070671_100135395 Ga0070671_1001353952 400
450 3300005355 Ga0070671_100347063 Ga0070671_1003470631 400
451 3300005356 Ga0070674_100000386 Ga0070674_10000038620 400
452 3300005356 Ga0070674_100008928 Ga0070674_1000089282 400
453 3300005364 Ga0070673_100004167 Ga0070673_1000041674 400
454 3300005364 Ga0070673_100024924 Ga0070673_1000249244 400
455 3300005364 Ga0070673_100025921 Ga0070673_1000259213 400
456 3300005364 Ga0070673_100061982 Ga0070673_1000619822 400
457 3300005364 Ga0070673_100097137 Ga0070673_1000971372 400
458 3300005364 Ga0070673_100158533 Ga0070673_1001585332 400
459 3300005365 Ga0070688_100077951 Ga0070688_1000779511 400
460 3300005365 Ga0070688_100093483 Ga0070688_1000934832 400
461 3300005367 Ga0070667_100031743 Ga0070667_1000317434 400
462 3300005438 Ga0070701_10031960 Ga0070701_100319603 400
463 3300005438 Ga0070701_10058005 Ga0070701_100580052 400
464 3300005440 Ga0070705_100003620 Ga0070705_1000036203 400
465 3300005440 Ga0070705_100006536 Ga0070705_1000065362 400
466 3300005441 Ga0070700_100002568 Ga0070700_1000025685 400
467 3300005444 Ga0070694_100001458 Ga0070694_1000014587 400
468 3300005444 Ga0070694_100142600 Ga0070694_1001426002 400
469 3300005445 Ga0070708_100056855 Ga0070708_1000568552 400
470 3300005456 Ga0070678_100002634 Ga0070678_1000026349 400
471 3300005456 Ga0070678_100046333 Ga0070678_1000463333 400
472 3300005456 Ga0070678_100109597 Ga0070678_1001095972 400
473 3300005457 Ga0070662_100003754 Ga0070662_1000037542 400
474 3300005458 Ga0070681_10058453 Ga0070681_100584532 400
475 3300005458 Ga0070681_10227774 Ga0070681_102277741 400
476 3300005459 Ga0068867_100000717 Ga0068867_1000007174 400
477 3300005466 Ga0070685_10003826 Ga0070685_100038261 400
478 3300005466 Ga0070685_10041476 Ga0070685_100414763 400
479 3300005471 Ga0070698_100058674 Ga0070698_1000586743 400
480 3300005471 Ga0070698_100144729 Ga0070698_1001447292 400
481 3300005471 Ga0070698_100233180 Ga0070698_1002331802 400
482 3300005518 Ga0070699_100005713 Ga0070699_1000057139 400
483 3300005518 Ga0070699_100030946 Ga0070699_1000309464 400
484 3300005518 Ga0070699_100047938 Ga0070699_1000479383 400
485 3300005530 Ga0070679_100169943 Ga0070679_1001699432 400
486 3300005535 Ga0070684_100001529 Ga0070684_1000015293 400
487 3300005535 Ga0070684_100020841 Ga0070684_1000208415 400
488 3300005535 Ga0070684_100021042 Ga0070684_1000210422 400
489 3300005536 Ga0070697_100079448 Ga0070697_1000794482 400
490 3300005543 Ga0070672_100006035 Ga0070672_1000060356 400
491 3300005543 Ga0070672_100055481 Ga0070672_1000554813 400
492 3300005543 Ga0070672_100061481 Ga0070672_1000614812 400
493 3300005543 Ga0070672_100086262 Ga0070672_1000862622 400
494 3300005544 Ga0070686_100015636 Ga0070686_1000156364 400
495 3300005545 Ga0070695_100000171 Ga0070695_10000017110 400
496 3300005546 Ga0070696_100000124 Ga0070696_1000001246 400
497 3300005548 Ga0070665_100045245 Ga0070665_1000452455 400
498 3300005549 Ga0070704_100000145 Ga0070704_1000001459 400
499 3300005549 Ga0070704_100013519 Ga0070704_1000135193 400
500 3300005549 Ga0070704_100040574 Ga0070704_1000405743 400
501 3300005549 Ga0070704_100045242 Ga0070704_1000452422 400
502 3300005549 Ga0070704_100058374 Ga0070704_1000583742 400
503 3300005564 Ga0070664_100002901 Ga0070664_10000290110 400
504 3300005564 Ga0070664_100014926 Ga0070664_1000149262 400
505 3300005564 Ga0070664_100032600 Ga0070664_1000326003 400
506 3300005564 Ga0070664_100094327 Ga0070664_1000943273 400
507 3300005564 Ga0070664_100094406 Ga0070664_1000944062 400
508 3300005578 Ga0068854_100134749 Ga0068854_1001347492 400
509 3300005615 Ga0070702_100008169 Ga0070702_1000081693 400
510 3300005615 Ga0070702_100078660 Ga0070702_1000786602 400
511 3300005617 Ga0068859_100002171 Ga0068859_1000021717 400
512 3300005617 Ga0068859_100016970 Ga0068859_1000169708 400
513 3300005617 Ga0068859_100029009 Ga0068859_1000290093 400
514 3300005617 Ga0068859_100141712 Ga0068859_1001417122 400
515 3300005617 Ga0068859_100152747 Ga0068859_1001527472 400
516 3300005618 Ga0068864_100019648 Ga0068864_1000196485 400
517 3300005618 Ga0068864_100051184 Ga0068864_1000511843 400
518 3300005718 Ga0068866_10003215 Ga0068866_100032154 400
519 3300005719 Ga0068861_100009126 Ga0068861_1000091263 400
520 3300005719 Ga0068861_100024227 Ga0068861_1000242273 400
521 3300005719 Ga0068861_100088181 Ga0068861_1000881812 400
522 3300005719 Ga0068861_100136399 Ga0068861_1001363992 400
523 3300005840 Ga0068870_10008434 Ga0068870_100084344 400
524 3300005840 Ga0068870_10037466 Ga0068870_100374663 400
525 3300005841 Ga0068863_100009990 Ga0068863_1000099907 400
526 3300005841 Ga0068863_100027693 Ga0068863_1000276933 400
527 3300005842 Ga0068858_100002245 Ga0068858_1000022458 400
528 3300005842 Ga0068858_100006285 Ga0068858_10000628513 400
529 3300005842 Ga0068858_100006973 Ga0068858_10000697311 400
530 3300005842 Ga0068858_100018755 Ga0068858_1000187554 400
531 3300005842 Ga0068858_100191854 Ga0068858_1001918542 400
532 3300005842 Ga0068858_100222249 Ga0068858_1002222492 400
533 3300005842 Ga0068858_100232534 Ga0068858_1002325342 400
534 3300005843 Ga0068860_100014536 Ga0068860_1000145363 400
535 3300005844 Ga0068862_100004218 Ga0068862_1000042189 400
536 3300005844 Ga0068862_100034614 Ga0068862_1000346143 400
537 3300005844 Ga0068862_100291939 Ga0068862_1002919391 400
538 3300005981 Ga0081538_10083325 Ga0081538_100833251 400
539 3300005985 Ga0081539_10000122 Ga0081539_1000012264 400
540 3300005985 Ga0081539_10000251 Ga0081539_1000025148 400
541 3300005985 Ga0081539_10001218 Ga0081539_100012187 400
542 3300005985 Ga0081539_10014209 Ga0081539_100142096 400
543 3300005985 Ga0081539_10023830 Ga0081539_100238302 400
544 3300006058 Ga0075432_10012783 Ga0075432_100127833 400
545 3300006178 Ga0075367_10044818 Ga0075367_100448183 400
546 3300006237 Ga0097621_100031186 Ga0097621_1000311864 400
547 3300006237 Ga0097621_100041097 Ga0097621_1000410972 400
548 3300006237 Ga0097621_100090819 Ga0097621_1000908192 400
549 3300006358 Ga0068871_100006536 Ga0068871_10000653610 400
550 3300006358 Ga0068871_100013495 Ga0068871_1000134956 400
551 3300006358 Ga0068871_100015641 Ga0068871_1000156416 400
552 3300006358 Ga0068871_100029695 Ga0068871_1000296953 400
553 3300006844 Ga0075428_100000607 Ga0075428_10000060728 400
554 3300006844 Ga0075428_100004905 Ga0075428_10000490510 400
555 3300006844 Ga0075428_100005950 Ga0075428_1000059507 400
556 3300006844 Ga0075428_100006210 Ga0075428_1000062109 400
557 3300006844 Ga0075428_100008246 Ga0075428_1000082464 400
558 3300006844 Ga0075428_100012598 Ga0075428_1000125982 400
559 3300006844 Ga0075428_100016111 Ga0075428_1000161116 400
560 3300006844 Ga0075428_100016407 Ga0075428_1000164078 400
561 3300006844 Ga0075428_100023613 Ga0075428_1000236137 400
562 3300006844 Ga0075428_100099420 Ga0075428_1000994202 400
563 3300006844 Ga0075428_100167471 Ga0075428_1001674712 400
564 3300006846 Ga0075430_100000792 Ga0075430_1000007929 400
565 3300006846 Ga0075430_100002319 Ga0075430_10000231911 400
566 3300006846 Ga0075430_100038845 Ga0075430_1000388453 400
567 3300006846 Ga0075430_100106553 Ga0075430_1001065532 400
568 3300006847 Ga0075431_100003925 Ga0075431_10000392510 400
569 3300006847 Ga0075431_100004102 Ga0075431_1000041028 400
570 3300006847 Ga0075431_100011761 Ga0075431_1000117613 400
571 3300006847 Ga0075431_100017152 Ga0075431_1000171523 400
572 3300006847 Ga0075431_100018285 Ga0075431_1000182855 400
573 3300006847 Ga0075431_100029812 Ga0075431_1000298125 400
574 3300006847 Ga0075431_100040075 Ga0075431_1000400755 400
575 3300006847 Ga0075431_100097966 Ga0075431_1000979662 400
576 3300006847 Ga0075431_100128295 Ga0075431_1001282953 400
577 3300006847 Ga0075431_100154780 Ga0075431_1001547802 400
578 3300006847 Ga0075431_100412836 Ga0075431_1004128362 400
579 3300006852 Ga0075433_10000117 Ga0075433_100001179 400
580 3300006852 Ga0075433_10001282 Ga0075433_1000128217 400
581 3300006852 Ga0075433_10032388 Ga0075433_100323885 400
582 3300006852 Ga0075433_10070161 Ga0075433_100701612 400
583 3300006852 Ga0075433_10197389 Ga0075433_101973892 400
584 3300006871 Ga0075434_100001628 Ga0075434_10000162813 400
585 3300006871 Ga0075434_100002292 Ga0075434_10000229214 400
586 3300006871 Ga0075434_100007494 Ga0075434_1000074947 400
587 3300006871 Ga0075434_100008566 Ga0075434_1000085663 400
588 3300006871 Ga0075434_100133283 Ga0075434_1001332832 400
589 3300006871 Ga0075434_100167579 Ga0075434_1001675792 400
590 3300006871 Ga0075434_100227357 Ga0075434_1002273571 400
591 3300006880 Ga0075429_100002617 Ga0075429_1000026178 400
592 3300006880 Ga0075429_100004049 Ga0075429_10000404910 400
593 3300006880 Ga0075429_100006146 Ga0075429_1000061469 400
594 3300006880 Ga0075429_100012495 Ga0075429_1000124952 400
595 3300006880 Ga0075429_100046796 Ga0075429_1000467964 400
596 3300006881 Ga0068865_100005679 Ga0068865_1000056798 400
597 3300006881 Ga0068865_100051045 Ga0068865_1000510453 400
598 3300006881 Ga0068865_100217855 Ga0068865_1002178551 400
599 3300006914 Ga0075436_100098257 Ga0075436_1000982572 400
600 3300006931 Ga0097620_100002171 Ga0097620_10000217114 400
601 3300006931 Ga0097620_100016971 Ga0097620_1000169718 400
602 3300006931 Ga0097620_100029008 Ga0097620_1000290083 400
603 3300006931 Ga0097620_100141713 Ga0097620_1001417132 400
604 3300006931 Ga0097620_100152754 Ga0097620_1001527542 400
605 3300007076 Ga0075435_100005321 Ga0075435_1000053215 400
606 3300007076 Ga0075435_100032983 Ga0075435_1000329832 400
607 3300007076 Ga0075435_100040177 Ga0075435_1000401775 400
608 3300007076 Ga0075435_100055651 Ga0075435_1000556512 400
609 3300009093 Ga0105240_10063655 Ga0105240_100636553 400
610 3300009094 Ga0111539_10000058 Ga0111539_1000005892 400
611 3300009094 Ga0111539_10000325 Ga0111539_1000032523 400
612 3300009094 Ga0111539_10001074 Ga0111539_1000107422 400
613 3300009094 Ga0111539_10001176 Ga0111539_1000117631 400
614 3300009094 Ga0111539_10001197 Ga0111539_1000119727 400
615 3300009094 Ga0111539_10003731 Ga0111539_100037312 400
616 3300009094 Ga0111539_10008450 Ga0111539_1000845010 400
617 3300009094 Ga0111539_10036302 Ga0111539_100363023 400
618 3300009094 Ga0111539_10041490 Ga0111539_100414902 400
619 3300009094 Ga0111539_10044979 Ga0111539_100449792 400
620 3300009094 Ga0111539_10045572 Ga0111539_100455724 400
621 3300009094 Ga0111539_10097285 Ga0111539_100972852 400
622 3300009101 Ga0105247_10031583 Ga0105247_100315833 400
623 3300009101 Ga0105247_10044693 Ga0105247_100446932 400
624 3300009147 Ga0114129_10000086 Ga0114129_1000008628 400
625 3300009147 Ga0114129_10000535 Ga0114129_1000053510 400
626 3300009147 Ga0114129_10002028 Ga0114129_1000202826 400
627 3300009147 Ga0114129_10002137 Ga0114129_1000213710 400
628 3300009147 Ga0114129_10002788 Ga0114129_1000278813 400
629 3300009147 Ga0114129_10010075 Ga0114129_1001007511 400
630 3300009147 Ga0114129_10016405 Ga0114129_100164053 400
631 3300009147 Ga0114129_10023419 Ga0114129_100234196 400
632 3300009147 Ga0114129_10027315 Ga0114129_100273154 400
633 3300009147 Ga0114129_10031981 Ga0114129_100319816 400
634 3300009147 Ga0114129_10038255 Ga0114129_100382556 400
635 3300009147 Ga0114129_10039441 Ga0114129_100394415 400
636 3300009147 Ga0114129_10049856 Ga0114129_100498563 400
637 3300009147 Ga0114129_10062231 Ga0114129_100622313 400
638 3300009147 Ga0114129_10080265 Ga0114129_100802652 400
639 3300009147 Ga0114129_10123072 Ga0114129_101230723 400
640 3300009147 Ga0114129_10188309 Ga0114129_101883092 400
641 3300009147 Ga0114129_10245184 Ga0114129_102451842 400
642 3300009148 Ga0105243_10017800 Ga0105243_100178004 400
643 3300009148 Ga0105243_10066362 Ga0105243_100663623 400
644 3300009148 Ga0105243_10073547 Ga0105243_100735472 400
645 3300009177 Ga0105248_10003314 Ga0105248_100033148 400
646 3300009177 Ga0105248_10016498 Ga0105248_1001649810 400
647 3300009177 Ga0105248_10080302 Ga0105248_100803023 400
648 3300009177 Ga0105248_10142313 Ga0105248_101423132 400
649 3300009177 Ga0105248_10228539 Ga0105248_102285392 400
650 3300009177 Ga0105248_10372020 Ga0105248_103720201 400
651 3300009553 Ga0105249_10001652 Ga0105249_1000165210 400
652 3300009553 Ga0105249_10001775 Ga0105249_1000177511 400
653 3300009553 Ga0105249_10111431 Ga0105249_101114312 400
654 3300013297 Ga0157378_10316880 Ga0157378_103168802 400
655 3300013306 Ga0163162_10047460 Ga0163162_100474603 400
656 3300013306 Ga0163162_10257726 Ga0163162_102577261 400
657 3300013308 Ga0157375_10068832 Ga0157375_100688322 400
658 3300013308 Ga0157375_10162813 Ga0157375_101628133 400
659 3300014325 Ga0163163_10014117 Ga0163163_100141173 400
660 3300014325 Ga0163163_10016032 Ga0163163_100160322 400
661 3300014325 Ga0163163_10019551 Ga0163163_100195514 400
662 3300014325 Ga0163163_10053198 Ga0163163_100531983 400
663 3300014326 Ga0157380_10007449 Ga0157380_100074494 400
664 3300014745 Ga0157377_10016113 Ga0157377_100161134 400
665 3300014745 Ga0157377_10055948 Ga0157377_100559482 400
666 3300014745 Ga0157377_10081070 Ga0157377_100810702 400
667 3300014968 Ga0157379_10005030 Ga0157379_100050307 400
668 3300014968 Ga0157379_10009001 Ga0157379_100090017 400
669 3300014968 Ga0157379_10058462 Ga0157379_100584622 400
670 3300014968 Ga0157379_10083810 Ga0157379_100838102 400
671 3300014969 Ga0157376_10027906 Ga0157376_100279062 400
672 3300014969 Ga0157376_10160799 Ga0157376_101607992 400
673 3300014969 Ga0157376_10172235 Ga0157376_101722352 400
674 3300017792 Ga0163161_10110299 Ga0163161_101102992 400
675 3300025315 Ga0207697_10000205 Ga0207697_1000020513 400
676 3300025899 Ga0207642_10008305 Ga0207642_100083052 400
677 3300025900 Ga0207710_10031496 Ga0207710_100314962 400
678 3300025900 Ga0207710_10036444 Ga0207710_100364442 400
679 3300025901 Ga0207688_10007917 Ga0207688_100079176 400
680 3300025903 Ga0207680_10154961 Ga0207680_101549611 400
681 3300025907 Ga0207645_10000604 Ga0207645_1000060413 400
682 3300025907 Ga0207645_10032096 Ga0207645_100320962 400
683 3300025907 Ga0207645_10058829 Ga0207645_100588292 400
684 3300025908 Ga0207643_10000388 Ga0207643_100003885 400
685 3300025908 Ga0207643_10006413 Ga0207643_100064135 400
686 3300025908 Ga0207643_10033820 Ga0207643_100338202 400
687 3300025908 Ga0207643_10049928 Ga0207643_100499282 400
688 3300025912 Ga0207707_10039997 Ga0207707_100399974 400
689 3300025912 Ga0207707_10070430 Ga0207707_100704302 400
690 3300025916 Ga0207663_10048110 Ga0207663_100481102 400
691 3300025918 Ga0207662_10000796 Ga0207662_100007969 400
692 3300025918 Ga0207662_10007461 Ga0207662_100074613 400
693 3300025918 Ga0207662_10115908 Ga0207662_101159082 400
694 3300025921 Ga0207652_10165214 Ga0207652_101652141 400
695 3300025922 Ga0207646_10196321 Ga0207646_101963212 400
696 3300025923 Ga0207681_10003972 Ga0207681_100039726 400
697 3300025923 Ga0207681_10004122 Ga0207681_100041226 400
698 3300025923 Ga0207681_10017019 Ga0207681_100170193 400
699 3300025923 Ga0207681_10044318 Ga0207681_100443182 400
700 3300025923 Ga0207681_10060744 Ga0207681_100607442 400
701 3300025923 Ga0207681_10138819 Ga0207681_101388192 400
702 3300025923 Ga0207681_10139520 Ga0207681_101395202 400
703 3300025923 Ga0207681_10201374 Ga0207681_102013742 400
704 3300025925 Ga0207650_10014068 Ga0207650_100140684 400
705 3300025925 Ga0207650_10044468 Ga0207650_100444682 400
706 3300025925 Ga0207650_10046750 Ga0207650_100467502 400
707 3300025925 Ga0207650_10125624 Ga0207650_101256242 400
708 3300025926 Ga0207659_10000293 Ga0207659_1000029329 400
709 3300025926 Ga0207659_10000326 Ga0207659_1000032621 400
710 3300025926 Ga0207659_10004827 Ga0207659_100048276 400
711 3300025926 Ga0207659_10035608 Ga0207659_100356082 400
712 3300025926 Ga0207659_10060834 Ga0207659_100608343 400
713 3300025926 Ga0207659_10064840 Ga0207659_100648402 400
714 3300025926 Ga0207659_10119343 Ga0207659_101193432 400
715 3300025926 Ga0207659_10130139 Ga0207659_101301392 400
716 3300025931 Ga0207644_10075050 Ga0207644_100750502 400
717 3300025931 Ga0207644_10083047 Ga0207644_100830473 400
718 3300025931 Ga0207644_10114181 Ga0207644_101141812 400
719 3300025931 Ga0207644_10197862 Ga0207644_101978622 400
720 3300025931 Ga0207644_10264263 Ga0207644_102642632 400
721 3300025933 Ga0207706_10005654 Ga0207706_100056546 400
722 3300025933 Ga0207706_10014400 Ga0207706_100144004 400
723 3300025933 Ga0207706_10027132 Ga0207706_100271322 400
724 3300025934 Ga0207686_10010314 Ga0207686_100103142 400
725 3300025935 Ga0207709_10032830 Ga0207709_100328303 400
726 3300025936 Ga0207670_10021563 Ga0207670_100215632 400
727 3300025936 Ga0207670_10130450 Ga0207670_101304502 400
728 3300025937 Ga0207669_10000485 Ga0207669_100004852 400
729 3300025937 Ga0207669_10010988 Ga0207669_100109884 400
730 3300025937 Ga0207669_10098565 Ga0207669_100985652 400
731 3300025937 Ga0207669_10121022 Ga0207669_101210222 400
732 3300025937 Ga0207669_10165286 Ga0207669_101652862 400
733 3300025940 Ga0207691_10003596 Ga0207691_1000359612 400
734 3300025940 Ga0207691_10009207 Ga0207691_100092078 400
735 3300025940 Ga0207691_10049213 Ga0207691_100492132 400
736 3300025940 Ga0207691_10055638 Ga0207691_100556382 400
737 3300025940 Ga0207691_10084610 Ga0207691_100846102 400
738 3300025941 Ga0207711_10029567 Ga0207711_100295674 400
739 3300025941 Ga0207711_10088702 Ga0207711_100887022 400
740 3300025942 Ga0207689_10000493 Ga0207689_1000049326 400
741 3300025942 Ga0207689_10053565 Ga0207689_100535651 400
742 3300025942 Ga0207689_10088221 Ga0207689_100882212 400
743 3300025944 Ga0207661_10065095 Ga0207661_100650953 400
744 3300025944 Ga0207661_10065705 Ga0207661_100657053 400
745 3300025945 Ga0207679_10001534 Ga0207679_100015343 400
746 3300025945 Ga0207679_10072946 Ga0207679_100729462 400
747 3300025945 Ga0207679_10086401 Ga0207679_100864012 400
748 3300025945 Ga0207679_10268517 Ga0207679_102685172 400
749 3300025960 Ga0207651_10021752 Ga0207651_100217522 400
750 3300025960 Ga0207651_10068391 Ga0207651_100683912 400
751 3300025960 Ga0207651_10116925 Ga0207651_101169252 400
752 3300025960 Ga0207651_10132945 Ga0207651_101329452 400
753 3300025961 Ga0207712_10011403 Ga0207712_100114032 400
754 3300025961 Ga0207712_10077446 Ga0207712_100774463 400
755 3300025961 Ga0207712_10136502 Ga0207712_101365022 400
756 3300025972 Ga0207668_10110065 Ga0207668_101100652 400
757 3300025986 Ga0207658_10022741 Ga0207658_100227415 400
758 3300026023 Ga0207677_10194243 Ga0207677_101942432 400
759 3300026035 Ga0207703_10011640 Ga0207703_100116402 400
760 3300026035 Ga0207703_10018232 Ga0207703_100182325 400
761 3300026035 Ga0207703_10026021 Ga0207703_100260214 400
762 3300026035 Ga0207703_10058550 Ga0207703_100585502 400
763 3300026035 Ga0207703_10157326 Ga0207703_101573262 400
764 3300026035 Ga0207703_10234319 Ga0207703_102343192 400
765 3300026075 Ga0207708_10005513 Ga0207708_100055139 400
766 3300026075 Ga0207708_10023061 Ga0207708_100230614 400
767 3300026075 Ga0207708_10110670 Ga0207708_101106701 400
768 3300026088 Ga0207641_10014455 Ga0207641_100144553 400
769 3300026088 Ga0207641_10024274 Ga0207641_100242743 400
770 3300026089 Ga0207648_10000066 Ga0207648_1000006652 400
771 3300026089 Ga0207648_10001196 Ga0207648_1000119615 400
772 3300026089 Ga0207648_10083107 Ga0207648_100831072 400
773 3300026095 Ga0207676_10026424 Ga0207676_100264244 400
774 3300026116 Ga0207674_10008960 Ga0207674_100089604 400
775 3300026116 Ga0207674_10054035 Ga0207674_100540353 400
776 3300026116 Ga0207674_10172504 Ga0207674_101725043 400
777 3300026118 Ga0207675_100003750 Ga0207675_1000037509 400
778 3300026118 Ga0207675_100006154 Ga0207675_1000061547 400
779 3300026118 Ga0207675_100052306 Ga0207675_1000523063 400
780 3300026118 Ga0207675_100059970 Ga0207675_1000599703 400
781 3300026118 Ga0207675_100349512 Ga0207675_1003495122 400
782 3300026121 Ga0207683_10017391 Ga0207683_100173916 400
783 3300026121 Ga0207683_10063363 Ga0207683_100633632 400
784 3300026142 Ga0207698_10032059 Ga0207698_100320593 400
785 3300027907 Ga0207428_10000384 Ga0207428_1000038442 400
786 3300027907 Ga0207428_10001147 Ga0207428_100011474 400
787 3300027907 Ga0207428_10002004 Ga0207428_1000200415 400
788 3300027907 Ga0207428_10002555 Ga0207428_1000255513 400
789 3300027907 Ga0207428_10003877 Ga0207428_1000387710 400
790 3300027907 Ga0207428_10004178 Ga0207428_100041787 400
791 3300027907 Ga0207428_10034723 Ga0207428_100347232 400
792 3300027907 Ga0207428_10039463 Ga0207428_100394632 400
793 3300027907 Ga0207428_10056760 Ga0207428_100567602 400
794 3300027907 Ga0207428_10136632 Ga0207428_101366322 400
795 3300027907 Ga0207428_10148612 Ga0207428_101486122 400
796 3300028379 Ga0268266_10015827 Ga0268266_100158272 400
797 3300028380 Ga0268265_10000073 Ga0268265_1000007350 400
798 3300028380 Ga0268265_10004027 Ga0268265_100040275 400
799 3300028380 Ga0268265_10175603 Ga0268265_101756032 400
800 3300028380 Ga0268265_10240934 Ga0268265_102409342 400
801 3300028381 Ga0268264_10146810 Ga0268264_101468102 400
802 3300031548 Ga0307408_100155550 Ga0307408_1001555501 400
803 3300031824 Ga0307413_10008660 Ga0307413_100086604 400
804 3300031852 Ga0307410_10087645 Ga0307410_100876452 400
805 3300031901 Ga0307406_10009340 Ga0307406_100093405 400
806 3300031901 Ga0307406_10159921 Ga0307406_101599212 400
807 3300031903 Ga0307407_10042645 Ga0307407_100426452 400
808 3300031903 Ga0307407_10132996 Ga0307407_101329961 400
809 3300031911 Ga0307412_10020109 Ga0307412_100201094 400
810 3300031995 Ga0307409_100045742 Ga0307409_1000457423 400
811 3300031995 Ga0307409_100100724 Ga0307409_1001007242 400
812 3300031995 Ga0307409_100104797 Ga0307409_1001047972 400
813 3300032002 Ga0307416_100013387 Ga0307416_1000133876 400
814 3300032005 Ga0307411_10008606 Ga0307411_100086062 400
815 3300032005 Ga0307411_10067754 Ga0307411_100677542 400
816 3300032126 Ga0307415_100024184 Ga0307415_1000241842 400
817 3300032126 Ga0307415_100044876 Ga0307415_1000448763 400
818 3300032126 Ga0307415_100049048 Ga0307415_1000490482 400
819 3300032126 Ga0307415_100137416 Ga0307415_1001374162 400
820 3300035170 Ga0373943_0027502 Ga0373943_0027502_919_2157 400
821 3300035171 Ga0373946_0007807 Ga0373946_0007807_1445_2683 400
822 3300035172 Ga0373955_0024945 Ga0373955_0024945_392_1630 400
823 3300035241 Ga0373961_0022355 Ga0373961_0022355_102_1313 400
824 3300035410 Ga0373924_0005767 Ga0373924_0005767_1998_3236 400
825 3300035691 Ga0373931_0027480 Ga0373931_0027480_441_1652 400
826 3300035692 Ga0373935_0073940 Ga0373935_0073940_796_2034 400
827 3300035725 Ga0373947_0007636 Ga0373947_0007636_311_1549 400
828 3300036401 Ga0373937_0025695 Ga0373937_0025695_3652_4854 400
829 3300039437 Ga0436365_1516765 Ga0436365_1516765_1489_2724 400
830 3300041512 Ga0451853_0579045 Ga0451853_0579045_374_1579 400
831 3300042007 Ga0439449_0033891 Ga0439449_0033891_36_1244 400
832 3300042125 Ga0450923_000426 Ga0450923_000426_1061_2287 400
833 3300042131 Ga0450894_000617 Ga0450894_000617_3513_4739 400
834 3300042133 Ga0450896_001948 Ga0450896_001948_1386_2612 400
835 3300042436 Ga0439435_0009846 Ga0439435_0009846_518_1720 400
836 3300042436 Ga0439435_0025433 Ga0439435_0025433_99_1310 400
837 3300042876 Ga0451577_0039555 Ga0451577_0039555_2390_3604 400
838 3300044712 Ga0453684_0007700 Ga0453684_0007700_14069_15283 400
839 3300045051 Ga0451576_0047452 Ga0451576_0047452_1243_2451 400
840 3300045051 Ga0451576_0160287 Ga0451576_0160287_902_2104 400
841 3300045051 Ga0451576_0196080 Ga0451576_0196080_311_1513 400
842 3300045051 Ga0451576_0274922 Ga0451576_0274922_463_1665 400
843 3300045051 Ga0451576_0340825 Ga0451576_0340825_33_1241 400
844 3300045051 Ga0451576_0458422 Ga0451576_0458422_84_1292 400
845 3300045976 Ga0466967_0121536 Ga0466967_0121536_1070_2281 400
846 3300046454 Ga0495592_0056422 Ga0495592_0056422_47_1297 400
847 3300046455 Ga0495603_0099276 Ga0495603_0099276_423_1631 400
848 3300046511 Ga0495608_0004305 Ga0495608_0004305_8216_9466 400
849 3300046517 Ga0495630_0004210 Ga0495630_0004210_6109_7359 400
850 3300046528 Ga0495642_0001939 Ga0495642_0001939_1020_2225 400
851 3300046535 Ga0495586_0019109 Ga0495586_0019109_341_1543 400
852 3300046536 Ga0495587_0023896 Ga0495587_0023896_1767_3017 400
853 3300046539 Ga0495621_0000274 Ga0495621_0000274_6461_7663 400
854 3300046543 Ga0495645_0003638 Ga0495645_0003638_7103_8305 400
855 3300046543 Ga0495645_0048688 Ga0495645_0048688_982_2232 400
856 3300046558 Ga0495633_0041241 Ga0495633_0041241_214_1416 400
857 3300046615 Ga0495656_0004734 Ga0495656_0004734_2631_3833 400
858 3300046642 Ga0495634_0071486 Ga0495634_0071486_583_1797 400
859 3300046674 Ga0495588_0093176 Ga0495588_0093176_181_1383 400
860 3300046683 Ga0495658_0083994 Ga0495658_0083994_52_1257 400
861 3300046683 Ga0495658_0145241 Ga0495658_0145241_151_1386 400
862 3300046684 Ga0495669_0007861 Ga0495669_0007861_3019_4257 400
863 3300046689 Ga0495613_0005107 Ga0495613_0005107_4582_5832 400
864 3300047317 Ga0495604_0059614 Ga0495604_0059614_1264_2472 400
865 3300047318 Ga0495636_0002541 Ga0495636_0002541_315_1526 400
866 3300047318 Ga0495636_0055183 Ga0495636_0055183_103_1314 400
867 3300047319 Ga0495674_0022038 Ga0495674_0022038_4537_5787 400
868 3300047322 Ga0495680_0077287 Ga0495680_0077287_97_1299 400
869 3300047445 Ga0495677_0038898 Ga0495677_0038898_86_1291 400
870 3300047471 Ga0495684_0001265 Ga0495684_0001265_10761_12011 400
871 3300047471 Ga0495684_0182541 Ga0495684_0182541_145_1353 400
872 3300048907 Ga0496104_0002606 Ga0496104_0002606_11858_13060 400
873 3300048907 Ga0496104_0003935 Ga0496104_0003935_8372_9580 400
874 3300048911 Ga0496108_0018262 Ga0496108_0018262_1798_3000 400
875 3300048911 Ga0496108_0108005 Ga0496108_0108005_13_1239 400
876 3300048912 Ga0496109_0008025 Ga0496109_0008025_6242_7450 400
877 3300048912 Ga0496109_0232526 Ga0496109_0232526_218_1420 400
878 3300048913 Ga0496110_0180220 Ga0496110_0180220_535_1743 400
879 3300048915 Ga0496112_0001309 Ga0496112_0001309_13614_14822 400
880 3300048915 Ga0496112_0013809 Ga0496112_0013809_1184_2386 400
881 3300048915 Ga0496112_0029041 Ga0496112_0029041_1756_2964 400
882 3300048915 Ga0496112_0066934 Ga0496112_0066934_1011_2237 400
883 3300048916 Ga0496113_0024136 Ga0496113_0024136_2703_3905 400
884 3300048917 Ga0496114_0133546 Ga0496114_0133546_430_1665 400
885 3300049571 Ga0501034_0015356 Ga0501034_0015356_1338_2546 400
886 3300049572 Ga0501036_0050145 Ga0501036_0050145_534_1787 400
887 3300049572 Ga0501036_0057218 Ga0501036_0057218_1191_2417 400
888 3300049572 Ga0501036_0268280 Ga0501036_0268280_35_1258 400
889 3300049574 Ga0501038_0086775 Ga0501038_0086775_102_1328 400
890 3300049575 Ga0501039_0010716 Ga0501039_0010716_5448_6650 400
891 3300049576 Ga0501040_0025001 Ga0501040_0025001_2234_3436 400
892 3300049576 Ga0501040_0051305 Ga0501040_0051305_1106_2332 400
893 3300049577 Ga0501041_0025281 Ga0501041_0025281_711_1913 400
894 3300049577 Ga0501041_0039024 Ga0501041_0039024_668_1921 400
895 3300049577 Ga0501041_0074349 Ga0501041_0074349_715_1917 400
896 3300049578 Ga0501042_0041720 Ga0501042_0041720_1410_2612 400
897 3300049578 Ga0501042_0067683 Ga0501042_0067683_1152_2354 400
898 3300049581 Ga0501047_0043918 Ga0501047_0043918_787_1995 400
899 3300049582 Ga0501048_0063065 Ga0501048_0063065_1073_2299 400
900 3300049587 Ga0501071_0005906 Ga0501071_0005906_3229_4482 400
901 3300049587 Ga0501071_0122660 Ga0501071_0122660_672_1880 400
902 3300049588 Ga0501072_0032031 Ga0501072_0032031_1263_2465 400
903 3300049589 Ga0501073_0008361 Ga0501073_0008361_6135_7370 400
904 3300049590 Ga0501074_0218254 Ga0501074_0218254_32_1234 400
905 3300049591 Ga0501075_0010672 Ga0501075_0010672_2912_4165 400
906 3300049591 Ga0501075_0093693 Ga0501075_0093693_72_1280 400
907 3300049592 Ga0501076_0004723 Ga0501076_0004723_6585_7838 400
908 3300049592 Ga0501076_0010886 Ga0501076_0010886_958_2184 400
909 3300049593 Ga0501077_0017103 Ga0501077_0017103_675_1928 400
910 3300049593 Ga0501077_0037886 Ga0501077_0037886_504_1712 400
911 3300049593 Ga0501077_0081414 Ga0501077_0081414_331_1632 400
912 3300049661 Ga0501217_003704 Ga0501217_003704_904_2145 400
913 3300049741 Ga0501079_0015632 Ga0501079_0015632_1281_2507 400
914 3300049743 Ga0501081_0132638 Ga0501081_0132638_497_1711 400
915 3300049823 Ga0501044_0087804 Ga0501044_0087804_387_1595 400
916 3300049824 Ga0501045_0015836 Ga0501045_0015836_2826_4052 400
917 3300049824 Ga0501045_0048673 Ga0501045_0048673_25_1233 400
918 3300049824 Ga0501045_0055704 Ga0501045_0055704_874_2076 400
919 3300050493 nmdc:mga0k408_4972_c1 nmdc:mga0k408_4972_c1_5120_6328 400
920 3300050507 nmdc:mga05p37_11403_c1 nmdc:mga05p37_11403_c1_3712_4920 400
921 3300050507 nmdc:mga05p37_12306_c1 nmdc:mga05p37_12306_c1_7209_8411 400
922 3300050507 nmdc:mga05p37_128098_c1 nmdc:mga05p37_128098_c1_16_1218 400
923 3300050507 nmdc:mga05p37_1358_c1 nmdc:mga05p37_1358_c1_19923_21131 400
924 3300050507 nmdc:mga05p37_15661_c1 nmdc:mga05p37_15661_c1_1345_2574 400
925 3300050507 nmdc:mga05p37_2308_c1 nmdc:mga05p37_2308_c1_18756_19988 400
926 3300050507 nmdc:mga05p37_26622_c1 nmdc:mga05p37_26622_c1_4070_5275 400
927 3300050507 nmdc:mga05p37_28047_c1 nmdc:mga05p37_28047_c1_3673_4881 400
928 3300050507 nmdc:mga05p37_282934_c1 nmdc:mga05p37_282934_c1_623_1825 400
929 3300050507 nmdc:mga05p37_33001_c1 nmdc:mga05p37_33001_c1_3954_5165 400
930 3300050507 nmdc:mga05p37_3422_c1 nmdc:mga05p37_3422_c1_5126_6334 400
931 3300050507 nmdc:mga05p37_43448_c1 nmdc:mga05p37_43448_c1_2364_3572 400
932 3300050507 nmdc:mga05p37_5252_c1 nmdc:mga05p37_5252_c1_10038_11297 400
933 3300050507 nmdc:mga05p37_55203_c1 nmdc:mga05p37_55203_c1_874_2079 400
934 3300050507 nmdc:mga05p37_6503_c2 nmdc:mga05p37_6503_c2_6777_8003 400
935 3300050507 nmdc:mga05p37_68083_c1 nmdc:mga05p37_68083_c1_2185_3393 400
936 3300050507 nmdc:mga05p37_961_c1 nmdc:mga05p37_961_c1_7260_8501 400
937 3300050508 nmdc:mga09592_10896_c1 nmdc:mga09592_10896_c1_2256_3497 400
938 3300050508 nmdc:mga09592_17183_c1 nmdc:mga09592_17183_c1_1392_2597 400
939 3300050508 nmdc:mga09592_2031_c1 nmdc:mga09592_2031_c1_1972_3180 400
940 3300050508 nmdc:mga09592_4707_c1 nmdc:mga09592_4707_c1_4590_5792 400
941 3300050508 nmdc:mga09592_62675_c1 nmdc:mga09592_62675_c1_484_1686 400
942 3300050508 nmdc:mga09592_86250_c1 nmdc:mga09592_86250_c1_520_1725 400
943 3300050509 nmdc:mga0qj67_1190_c1 nmdc:mga0qj67_1190_c1_1206_2408 400
944 3300050509 nmdc:mga0qj67_2135_c1 nmdc:mga0qj67_2135_c1_7929_9170 400
945 3300050509 nmdc:mga0qj67_32516_c1 nmdc:mga0qj67_32516_c1_644_1849 400
946 3300050509 nmdc:mga0qj67_35929_c1 nmdc:mga0qj67_35929_c1_2534_3775 400
947 3300050509 nmdc:mga0qj67_40919_c1 nmdc:mga0qj67_40919_c1_1706_2914 400
948 3300050509 nmdc:mga0qj67_47324_c1 nmdc:mga0qj67_47324_c1_317_1543 400
949 3300050509 nmdc:mga0qj67_58411_c1 nmdc:mga0qj67_58411_c1_168_1370 400
950 3300050509 nmdc:mga0qj67_82034_c1 nmdc:mga0qj67_82034_c1_1183_2385 400
951 3300050510 nmdc:mga06r32_129893_c1 nmdc:mga06r32_129893_c1_224_1426 400
952 3300050510 nmdc:mga06r32_14863_c1 nmdc:mga06r32_14863_c1_1117_2325 400
953 3300050510 nmdc:mga06r32_160070_c1 nmdc:mga06r32_160070_c1_478_1683 400
954 3300050510 nmdc:mga06r32_16856_c1 nmdc:mga06r32_16856_c1_793_2034 400
955 3300050510 nmdc:mga06r32_25092_c1 nmdc:mga06r32_25092_c1_3762_4970 400
956 3300050510 nmdc:mga06r32_2825_c1 nmdc:mga06r32_2825_c1_9090_10292 400
957 3300050510 nmdc:mga06r32_78935_c1 nmdc:mga06r32_78935_c1_110_1315 400
958 3300050511 nmdc:mga08y16_11370_c1 nmdc:mga08y16_11370_c1_4192_5394 400
959 3300050511 nmdc:mga08y16_11518_c1 nmdc:mga08y16_11518_c1_6539_7780 400
960 3300050511 nmdc:mga08y16_12_c1 nmdc:mga08y16_12_c1_410308_411513 400
961 3300050511 nmdc:mga08y16_154644_c1 nmdc:mga08y16_154644_c1_722_1930 400
962 3300050511 nmdc:mga08y16_17225_c1 nmdc:mga08y16_17225_c1_4898_6100 400
963 3300050511 nmdc:mga08y16_187138_c1 nmdc:mga08y16_187138_c1_357_1565 400
964 3300050511 nmdc:mga08y16_20431_c1 nmdc:mga08y16_20431_c1_2058_3266 400
965 3300050511 nmdc:mga08y16_255175_c1 nmdc:mga08y16_255175_c1_479_1699 400
966 3300050511 nmdc:mga08y16_275149_c1 nmdc:mga08y16_275149_c1_292_1515 400
967 3300050511 nmdc:mga08y16_323468_c1 nmdc:mga08y16_323468_c1_331_1533 400
968 3300050511 nmdc:mga08y16_33699_c1 nmdc:mga08y16_33699_c1_2994_4196 400
969 3300050511 nmdc:mga08y16_62425_c1 nmdc:mga08y16_62425_c1_2562_3764 400
970 3300050511 nmdc:mga08y16_632_c1 nmdc:mga08y16_632_c1_22854_24065 400
971 3300050511 nmdc:mga08y16_635_c1 nmdc:mga08y16_635_c1_9629_10831 400
972 3300050511 nmdc:mga08y16_66344_c1 nmdc:mga08y16_66344_c1_1362_2570 400
973 3300050511 nmdc:mga08y16_6914_c1 nmdc:mga08y16_6914_c1_6582_7784 400
974 3300050511 nmdc:mga08y16_73474_c1 nmdc:mga08y16_73474_c1_2283_3491 400
975 3300050511 nmdc:mga08y16_78768_c1 nmdc:mga08y16_78768_c1_1637_2845 400
976 3300050512 nmdc:mga0n895_107863_c1 nmdc:mga0n895_107863_c1_134_1336 400
977 3300050512 nmdc:mga0n895_136750_c1 nmdc:mga0n895_136750_c1_691_1923 400
978 3300050512 nmdc:mga0n895_1444_c1 nmdc:mga0n895_1444_c1_5128_6330 400
979 3300050512 nmdc:mga0n895_148625_c1 nmdc:mga0n895_148625_c1_999_2207 400
980 3300050512 nmdc:mga0n895_1608_c1 nmdc:mga0n895_1608_c1_762_1964 400
981 3300050512 nmdc:mga0n895_279438_c1 nmdc:mga0n895_279438_c1_61_1269 400
982 3300050512 nmdc:mga0n895_3741_c1 nmdc:mga0n895_3741_c1_5057_6259 400
983 3300050512 nmdc:mga0n895_46140_c1 nmdc:mga0n895_46140_c1_2220_3428 400
984 3300050512 nmdc:mga0n895_87701_c1 nmdc:mga0n895_87701_c1_1365_2567 400
985 3300050513 nmdc:mga0rr50_3496_c1 nmdc:mga0rr50_3496_c1_5042_6244 400
986 3300050513 nmdc:mga0rr50_69588_c1 nmdc:mga0rr50_69588_c1_127_1332 400
987 3300050514 nmdc:mga08x19_13689_c1 nmdc:mga08x19_13689_c1_2976_4184 400
988 3300050515 nmdc:mga0a205_144881_c2 nmdc:mga0a205_144881_c2_385_1590 400
989 3300050515 nmdc:mga0a205_145467_c1 nmdc:mga0a205_145467_c1_44_1276 400
990 3300050515 nmdc:mga0a205_170541_c1 nmdc:mga0a205_170541_c1_302_1507 400
991 3300050515 nmdc:mga0a205_171984_c1 nmdc:mga0a205_171984_c1_333_1541 400
992 3300050515 nmdc:mga0a205_196634_c1 nmdc:mga0a205_196634_c1_101_1303 400
993 3300050515 nmdc:mga0a205_2224_c1 nmdc:mga0a205_2224_c1_5515_6717 400
994 3300050515 nmdc:mga0a205_25961_c1 nmdc:mga0a205_25961_c1_4091_5293 400
995 3300050515 nmdc:mga0a205_47_c1 nmdc:mga0a205_47_c1_39709_40911 400
996 3300050515 nmdc:mga0a205_57182_c1 nmdc:mga0a205_57182_c1_1406_2614 400
997 3300053077 Ga0495601_0005785 Ga0495601_0005785_5550_6800 400
998 3300053084 Ga0495595_0076467 Ga0495595_0076467_269_1519 400
999 3300053085 Ga0495619_0001690 Ga0495619_0001690_9979_11229 400
1000 3300053085 Ga0495619_0147271 Ga0495619_0147271_343_1551 400
1001 3300053096 Ga0500641_0003189 Ga0500641_0003189_1404_2648 400
1002 3300053103 Ga0500555_000789 Ga0500555_000789_4979_6247 400
1003 3300054114 Ga0501084_0007641 Ga0501084_0007641_3456_4682 400
1004 3300054114 Ga0501084_0021751 Ga0501084_0021751_2917_4119 400
1005 3300054114 Ga0501084_0029602 Ga0501084_0029602_973_2181 400
1006 3300054114 Ga0501084_0161265 Ga0501084_0161265_663_1865 400
1007 3300059421 Ga0590071_000222 Ga0590071_000222_14038_15240 400
1008 3300059421 Ga0590071_000785 Ga0590071_000785_3877_5079 400
1009 3300059423 Ga0590074_000479 Ga0590074_000479_1097_2299 400
1010 3300059424 Ga0590075_000259 Ga0590075_000259_3713_4915 400
1011 3300059424 Ga0590075_002665 Ga0590075_002665_1814_3016 400
1012 3300059426 Ga0590077_000168 Ga0590077_000168_15875_17077 400
1013 3300059426 Ga0590077_000839 Ga0590077_000839_6428_7630 400
1014 3300061734 Ga0530510_0003933 Ga0530510_0003933_1503_2756 400
1015 3300061734 Ga0530510_0121296 Ga0530510_0121296_533_1759 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19288

CofH_C

CofH/MqnC C-terminal region

261

378

0.96

PF04055

Radical_SAM

Radical SAM superfamily

79

254

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xig-assembly1.cif.gz_B x-ray crystal structure of mqne from pedobacter heparinus 0.9222 2 352
6xi9-assembly1.cif.gz_A x-ray crystal structure of mqne from pedobacter heparinus in complex with aminofutalosine and methionine 0.92 2 354
6xi9-assembly2.cif.gz_B x-ray crystal structure of mqne from pedobacter heparinus in complex with aminofutalosine and methionine 0.9196 2 354
6xig-assembly1.cif.gz_A x-ray crystal structure of mqne from pedobacter heparinus 0.9178 2 359
6xig-assembly1.cif.gz_A x-ray crystal structure of mqne from pedobacter heparinus 0.8436 2 359
ID Description Score Start End Superfamily
af_Q58826_3_356_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9559 10 350 3.20.20.70
af_P9WP77_498_849_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9374 1 347 3.20.20.70
af_P9WP77_498_849_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9219 1 347 3.20.20.70
af_Q58826_3_356_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9191 10 350 3.20.20.70
af_P9WP77_16_335_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8278 2 287 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1Q7QNR6-F1-model_v4 Cyclic dehypoxanthine futalosine synthase (Cyclic DHFL synthase) (EC 1.21.98.1) (Dehypoxanthine futalosine cyclase) (DHFL cyclase) (Menaquinone biosynthetic enzyme MqnC) 0.995 2 398 GO:0005506
GO:0009234
GO:0016765
GO:0044689
GO:0046992
GO:0051539
AF-A0A3N5NG97-F1-model_v4 Dehypoxanthine futalosine cyclase 0.9945 1 323 GO:0009234
GO:0016765
GO:0044689
GO:0046872
GO:0051539
AF-A0A381NKD4-F1-model_v4 Radical SAM core domain-containing protein 0.9938 39 400 GO:0009234
GO:0016765
GO:0044689
GO:0046872
GO:0051539
AF-A0A7C7VMF2-F1-model_v4 Cyclic dehypoxanthine futalosine synthase (Cyclic DHFL synthase) (EC 1.21.98.1) (Dehypoxanthine futalosine cyclase) (DHFL cyclase) (Menaquinone biosynthetic enzyme MqnC) 0.9892 2 352 GO:0005506
GO:0009234
GO:0016765
GO:0044689
GO:0046992
GO:0051539
AF-A0A3N5NG97-F1-model_v4 Dehypoxanthine futalosine cyclase 0.9884 1 323 GO:0009234
GO:0016765
GO:0044689
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
92.76 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map