F488253
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1016 | 327 | 2032 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10516524|Ga0070717_105165242 |
| Length | 271 |
| Sequence | VPHPSFALLRKRVGNLTFCKPAASTLFPRDFSTFPHCCYHSCATRMAIDWQTFRLTLELAFTVSVMLLALGLPIAYWIAFSRWRWRFLVEAFVALPIVLPPTVLGFYVLVALGPRSPLGRWWISLTGHTLAFTFTGLVVGSILYSLPFAVQPFASAFLAVDRKLIAASATLGASPFRTFRTVTVPLSVSGIVTGIALSFAHTMGEFGVVLMVGGNIPGITRTVSIDIYDRVQSSDYAGANQTALILLFICFALLALVYGLNRRAALMDAWK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 131 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 132 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 133 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 134 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 213 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 214 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 223 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 224 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 225 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 226 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 240 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 247 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 248 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 252 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 253 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 317 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 326 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 327 | 646564506 | Arcobacter nitrofigilis DSM 7299 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.62 |
| Metatranscriptomes | 1.08 |
| Isolates | 0.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.3 |
| Nodule | 0 |
| Rhizoplane | 4.92 |
| Rhizosphere | 93.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070717_10516524 | 3300006028 | Bacteria | 1080 |
| 2 | MBSR1b_contig_201130 | 2162886012 | Bacteria | 5475 |
| 3 | MBSR1b_contig_3160416 | 2162886012 | Bacteria | 6945 |
| 4 | LJNas_1000129 | 3300000546 | Bacteria | 11792 |
| 5 | JGI24752J21851_1006373 | 3300001976 | Unclassified | 1542 |
| 6 | JGI24740J21852_10097993 | 3300001979 | Unclassified | 749 |
| 7 | JGI24737J22298_10034298 | 3300001990 | Unclassified | 1573 |
| 8 | JGI24743J22301_10007079 | 3300001991 | Bacteria | 1935 |
| 9 | JGI24034J26672_10000570 | 3300002239 | Bacteria | 4702 |
| 10 | JGI24742J22300_10036682 | 3300002244 | Unclassified | 866 |
| 11 | JGI24751J29686_10023255 | 3300002459 | Unclassified | 1285 |
| 12 | rootH1_10066128 | 3300003323 | Bacteria | 5407 |
| 13 | Ga0065712_10082264 | 3300005290 | Unclassified | 2931 |
| 14 | Ga0065715_10004441 | 3300005293 | Bacteria | 7976 |
| 15 | Ga0065715_10203251 | 3300005293 | Bacteria | 1350 |
| 16 | Ga0065707_10164984 | 3300005295 | Unclassified | 1530 |
| 17 | Ga0070658_10012517 | 3300005327 | Bacteria | 6806 |
| 18 | Ga0070658_10172599 | 3300005327 | Bacteria | 1817 |
| 19 | Ga0070676_10032029 | 3300005328 | Bacteria | 3009 |
| 20 | Ga0070676_10092810 | 3300005328 | Bacteria | 1852 |
| 21 | Ga0070683_100000180 | 3300005329 | Bacteria | 41854 |
| 22 | Ga0070683_100184739 | 3300005329 | Bacteria | 1979 |
| 23 | Ga0070683_100567660 | 3300005329 | Bacteria | 1085 |
| 24 | Ga0070690_100198034 | 3300005330 | Bacteria | 1396 |
| 25 | Ga0070670_100001706 | 3300005331 | Bacteria | 17892 |
| 26 | Ga0070670_100155017 | 3300005331 | Bacteria | 1983 |
| 27 | Ga0070670_100391214 | 3300005331 | Bacteria | 1226 |
| 28 | Ga0068869_100002390 | 3300005334 | Bacteria | 11306 |
| 29 | Ga0068869_100014353 | 3300005334 | Bacteria | 5289 |
| 30 | Ga0070666_10040208 | 3300005335 | Bacteria | 3120 |
| 31 | Ga0070666_10087335 | 3300005335 | Bacteria | 2137 |
| 32 | Ga0070680_100163322 | 3300005336 | Bacteria | 1872 |
| 33 | Ga0070680_100201821 | 3300005336 | Bacteria | 1677 |
| 34 | Ga0070680_100240366 | 3300005336 | Bacteria | 1531 |
| 35 | Ga0070682_100047195 | 3300005337 | Bacteria | 2677 |
| 36 | Ga0070682_100108040 | 3300005337 | Unclassified | 1849 |
| 37 | Ga0068868_100002943 | 3300005338 | Bacteria | 11818 |
| 38 | Ga0068868_100006066 | 3300005338 | Bacteria | 8533 |
| 39 | Ga0068868_100019802 | 3300005338 | Bacteria | 5048 |
| 40 | Ga0068868_100051856 | 3300005338 | Bacteria | 3229 |
| 41 | Ga0068868_100261589 | 3300005338 | Bacteria | 1459 |
| 42 | Ga0070660_100016682 | 3300005339 | Bacteria | 5338 |
| 43 | Ga0070660_100240181 | 3300005339 | Unclassified | 1475 |
| 44 | Ga0070660_100522864 | 3300005339 | Bacteria | 988 |
| 45 | Ga0070689_100016928 | 3300005340 | Bacteria | 5344 |
| 46 | Ga0070689_100170285 | 3300005340 | Bacteria | 1764 |
| 47 | Ga0070687_100023249 | 3300005343 | Bacteria | 2944 |
| 48 | Ga0070661_100000886 | 3300005344 | Bacteria | 21512 |
| 49 | Ga0070661_100226734 | 3300005344 | Bacteria | 1435 |
| 50 | Ga0070692_10463847 | 3300005345 | Unclassified | 813 |
| 51 | Ga0070668_100013446 | 3300005347 | Bacteria | 6110 |
| 52 | Ga0070669_100016274 | 3300005353 | Bacteria | 5305 |
| 53 | Ga0070669_100095707 | 3300005353 | Bacteria | 2233 |
| 54 | Ga0070675_100003414 | 3300005354 | Bacteria | 12028 |
| 55 | Ga0070675_100507415 | 3300005354 | Bacteria | 1087 |
| 56 | Ga0070671_100024798 | 3300005355 | Bacteria | 4913 |
| 57 | Ga0070671_100032659 | 3300005355 | Bacteria | 4301 |
| 58 | Ga0070671_100224112 | 3300005355 | Unclassified | 1595 |
| 59 | Ga0070674_100008141 | 3300005356 | Bacteria | 6219 |
| 60 | Ga0070674_100129520 | 3300005356 | Bacteria | 1879 |
| 61 | Ga0070673_100106371 | 3300005364 | Bacteria | 2319 |
| 62 | Ga0070673_100128982 | 3300005364 | Bacteria | 2119 |
| 63 | Ga0070688_100001337 | 3300005365 | Bacteria | 12230 |
| 64 | Ga0070659_100055418 | 3300005366 | Bacteria | 3124 |
| 65 | Ga0070659_100083237 | 3300005366 | Bacteria | 2557 |
| 66 | Ga0070659_100233724 | 3300005366 | Bacteria | 1519 |
| 67 | Ga0070667_100009483 | 3300005367 | Bacteria | 8075 |
| 68 | Ga0070667_100093961 | 3300005367 | Bacteria | 2583 |
| 69 | Ga0070709_10015131 | 3300005434 | Bacteria | 4383 |
| 70 | Ga0070709_10038441 | 3300005434 | Bacteria | 2930 |
| 71 | Ga0070709_10057013 | 3300005434 | Bacteria | 2473 |
| 72 | Ga0070709_10084591 | 3300005434 | Bacteria | 2078 |
| 73 | Ga0070709_10147207 | 3300005434 | Bacteria | 1624 |
| 74 | Ga0070709_10170516 | 3300005434 | Bacteria | 1520 |
| 75 | Ga0070709_10170725 | 3300005434 | Bacteria | 1519 |
| 76 | Ga0070709_10257488 | 3300005434 | Bacteria | 1259 |
| 77 | Ga0070709_10667144 | 3300005434 | Bacteria | 806 |
| 78 | Ga0070714_100001114 | 3300005435 | Bacteria | 19295 |
| 79 | Ga0070714_100016666 | 3300005435 | Bacteria | 5939 |
| 80 | Ga0070714_100224122 | 3300005435 | Bacteria | 1729 |
| 81 | Ga0070713_100000543 | 3300005436 | Bacteria | 23927 |
| 82 | Ga0070713_100002121 | 3300005436 | Bacteria | 12836 |
| 83 | Ga0070713_100029017 | 3300005436 | Bacteria | 4375 |
| 84 | Ga0070713_100037336 | 3300005436 | Bacteria | 3927 |
| 85 | Ga0070713_100040170 | 3300005436 | Unclassified | 3803 |
| 86 | Ga0070713_100084638 | 3300005436 | Bacteria | 2714 |
| 87 | Ga0070713_100148407 | 3300005436 | Bacteria | 2083 |
| 88 | Ga0070713_100204515 | 3300005436 | Bacteria | 1785 |
| 89 | Ga0070713_100277423 | 3300005436 | Bacteria | 1537 |
| 90 | Ga0070713_100309252 | 3300005436 | Bacteria | 1457 |
| 91 | Ga0070713_100365107 | 3300005436 | Bacteria | 1342 |
| 92 | Ga0070713_100505909 | 3300005436 | Unclassified | 1140 |
| 93 | Ga0070710_10002568 | 3300005437 | Bacteria | 8621 |
| 94 | Ga0070710_10220647 | 3300005437 | Bacteria | 1206 |
| 95 | Ga0070701_10017180 | 3300005438 | Unclassified | 3378 |
| 96 | Ga0070711_100000478 | 3300005439 | Bacteria | 20826 |
| 97 | Ga0070711_100015078 | 3300005439 | Bacteria | 4884 |
| 98 | Ga0070711_100176790 | 3300005439 | Bacteria | 1631 |
| 99 | Ga0070711_100188148 | 3300005439 | Bacteria | 1585 |
| 100 | Ga0070711_100279643 | 3300005439 | Bacteria | 1320 |
| 101 | Ga0070711_100569782 | 3300005439 | Bacteria | 941 |
| 102 | Ga0070711_100590184 | 3300005439 | Bacteria | 926 |
| 103 | Ga0070711_100742228 | 3300005439 | Bacteria | 829 |
| 104 | Ga0070705_100062843 | 3300005440 | Bacteria | 2212 |
| 105 | Ga0070700_100312578 | 3300005441 | Unclassified | 1151 |
| 106 | Ga0070694_100041259 | 3300005444 | Bacteria | 3078 |
| 107 | Ga0070708_100000527 | 3300005445 | Bacteria | 28842 |
| 108 | Ga0070708_100001078 | 3300005445 | Bacteria | 20858 |
| 109 | Ga0070708_100003900 | 3300005445 | Bacteria | 11706 |
| 110 | Ga0070708_100013160 | 3300005445 | Bacteria | 6769 |
| 111 | Ga0070708_100035100 | 3300005445 | Unclassified | 4367 |
| 112 | Ga0070708_100055104 | 3300005445 | Bacteria | 3535 |
| 113 | Ga0070708_100066072 | 3300005445 | Bacteria | 3245 |
| 114 | Ga0070708_100114938 | 3300005445 | Bacteria | 2477 |
| 115 | Ga0070708_100206787 | 3300005445 | Bacteria | 1839 |
| 116 | Ga0070708_100357972 | 3300005445 | Bacteria | 1375 |
| 117 | Ga0070663_100032756 | 3300005455 | Unclassified | 3585 |
| 118 | Ga0070663_100589773 | 3300005455 | Unclassified | 933 |
| 119 | Ga0070678_100355225 | 3300005456 | Bacteria | 1261 |
| 120 | Ga0070662_100005079 | 3300005457 | Bacteria | 8381 |
| 121 | Ga0070662_100225056 | 3300005457 | Unclassified | 1498 |
| 122 | Ga0070681_10000513 | 3300005458 | Bacteria | 31715 |
| 123 | Ga0070681_10001443 | 3300005458 | Bacteria | 20931 |
| 124 | Ga0070681_10047505 | 3300005458 | Bacteria | 4291 |
| 125 | Ga0070681_10071265 | 3300005458 | Bacteria | 3440 |
| 126 | Ga0070681_10231014 | 3300005458 | Bacteria | 1764 |
| 127 | Ga0068867_100016708 | 3300005459 | Bacteria | 5214 |
| 128 | Ga0068867_100053195 | 3300005459 | Bacteria | 2990 |
| 129 | Ga0068867_100428822 | 3300005459 | Bacteria | 1122 |
| 130 | Ga0070685_10001585 | 3300005466 | Bacteria | 12002 |
| 131 | Ga0070685_10238101 | 3300005466 | Bacteria | 1200 |
| 132 | Ga0070706_100000257 | 3300005467 | Bacteria | 64534 |
| 133 | Ga0070706_100000991 | 3300005467 | Bacteria | 30868 |
| 134 | Ga0070706_100094200 | 3300005467 | Bacteria | 2779 |
| 135 | Ga0070706_100113003 | 3300005467 | Bacteria | 2529 |
| 136 | Ga0070706_100204128 | 3300005467 | Bacteria | 1846 |
| 137 | Ga0070707_100001774 | 3300005468 | Bacteria | 20733 |
| 138 | Ga0070707_100062473 | 3300005468 | Bacteria | 3573 |
| 139 | Ga0070707_100072935 | 3300005468 | Bacteria | 3310 |
| 140 | Ga0070707_100535678 | 3300005468 | Bacteria | 1133 |
| 141 | Ga0070707_100569754 | 3300005468 | Bacteria | 1095 |
| 142 | Ga0070698_100000182 | 3300005471 | Bacteria | 59279 |
| 143 | Ga0070698_100012583 | 3300005471 | Bacteria | 8959 |
| 144 | Ga0070698_100389727 | 3300005471 | Bacteria | 1326 |
| 145 | Ga0070698_100791264 | 3300005471 | Bacteria | 892 |
| 146 | Ga0070699_100088406 | 3300005518 | Bacteria | 2706 |
| 147 | Ga0070699_100209163 | 3300005518 | Bacteria | 1736 |
| 148 | Ga0070699_100290372 | 3300005518 | Bacteria | 1466 |
| 149 | Ga0070679_100008087 | 3300005530 | Bacteria | 9887 |
| 150 | Ga0070679_100054487 | 3300005530 | Bacteria | 3982 |
| 151 | Ga0070679_100151665 | 3300005530 | Bacteria | 2294 |
| 152 | Ga0070679_100301683 | 3300005530 | Bacteria | 1552 |
| 153 | Ga0070684_100007581 | 3300005535 | Bacteria | 8452 |
| 154 | Ga0070684_100017780 | 3300005535 | Bacteria | 5842 |
| 155 | Ga0070684_100034929 | 3300005535 | Unclassified | 4301 |
| 156 | Ga0070684_100089161 | 3300005535 | Bacteria | 2741 |
| 157 | Ga0070684_100100259 | 3300005535 | Bacteria | 2586 |
| 158 | Ga0070684_100338931 | 3300005535 | Unclassified | 1382 |
| 159 | Ga0070697_100001487 | 3300005536 | Bacteria | 17834 |
| 160 | Ga0070697_100004056 | 3300005536 | Bacteria | 11237 |
| 161 | Ga0070697_100008463 | 3300005536 | Bacteria | 8027 |
| 162 | Ga0070697_100085791 | 3300005536 | Bacteria | 2597 |
| 163 | Ga0070697_100131291 | 3300005536 | Unclassified | 2101 |
| 164 | Ga0070697_100238772 | 3300005536 | Bacteria | 1551 |
| 165 | Ga0070697_100506852 | 3300005536 | Bacteria | 1055 |
| 166 | Ga0068853_100005004 | 3300005539 | Bacteria | 10328 |
| 167 | Ga0068853_100065061 | 3300005539 | Bacteria | 3163 |
| 168 | Ga0068853_100083675 | 3300005539 | Bacteria | 2796 |
| 169 | Ga0068853_100111845 | 3300005539 | Bacteria | 2427 |
| 170 | Ga0068853_100254637 | 3300005539 | Bacteria | 1612 |
| 171 | Ga0070672_100133123 | 3300005543 | Unclassified | 2045 |
| 172 | Ga0070672_100381838 | 3300005543 | Bacteria | 1205 |
| 173 | Ga0070686_100011657 | 3300005544 | Bacteria | 4993 |
| 174 | Ga0070686_100036014 | 3300005544 | Bacteria | 3060 |
| 175 | Ga0070696_100033625 | 3300005546 | Bacteria | 3524 |
| 176 | Ga0070693_100038251 | 3300005547 | Bacteria | 2680 |
| 177 | Ga0070693_100159312 | 3300005547 | Bacteria | 1436 |
| 178 | Ga0070693_100465557 | 3300005547 | Unclassified | 890 |
| 179 | Ga0070665_100146087 | 3300005548 | Bacteria | 2368 |
| 180 | Ga0068855_100000412 | 3300005563 | Bacteria | 52997 |
| 181 | Ga0068855_100000425 | 3300005563 | Bacteria | 52146 |
| 182 | Ga0068855_100018276 | 3300005563 | Bacteria | 8420 |
| 183 | Ga0068855_100062777 | 3300005563 | Bacteria | 4336 |
| 184 | Ga0068855_100106448 | 3300005563 | Bacteria | 3223 |
| 185 | Ga0068855_100947328 | 3300005563 | Bacteria | 907 |
| 186 | Ga0070664_100005786 | 3300005564 | Bacteria | 9974 |
| 187 | Ga0070664_100047341 | 3300005564 | Bacteria | 3632 |
| 188 | Ga0070664_100082144 | 3300005564 | Bacteria | 2778 |
| 189 | Ga0068857_100002572 | 3300005577 | Bacteria | 14860 |
| 190 | Ga0068857_100003408 | 3300005577 | Bacteria | 13246 |
| 191 | Ga0068857_100005929 | 3300005577 | Bacteria | 10432 |
| 192 | Ga0068857_100372991 | 3300005577 | Unclassified | 1324 |
| 193 | Ga0068857_100574953 | 3300005577 | Bacteria | 1063 |
| 194 | Ga0068854_100003492 | 3300005578 | Bacteria | 9822 |
| 195 | Ga0068854_100004475 | 3300005578 | Bacteria | 8814 |
| 196 | Ga0068854_100014550 | 3300005578 | Bacteria | 5191 |
| 197 | Ga0068854_100020751 | 3300005578 | Bacteria | 4452 |
| 198 | Ga0068856_100000670 | 3300005614 | Bacteria | 37158 |
| 199 | Ga0068856_100000708 | 3300005614 | Bacteria | 36263 |
| 200 | Ga0068856_100001577 | 3300005614 | Bacteria | 23871 |
| 201 | Ga0068856_100003544 | 3300005614 | Bacteria | 15716 |
| 202 | Ga0068856_100006243 | 3300005614 | Bacteria | 11695 |
| 203 | Ga0068856_100009111 | 3300005614 | Bacteria | 9649 |
| 204 | Ga0068856_100066387 | 3300005614 | Bacteria | 3565 |
| 205 | Ga0068856_100079175 | 3300005614 | Bacteria | 3259 |
| 206 | Ga0068856_100118901 | 3300005614 | Bacteria | 2643 |
| 207 | Ga0068856_100198992 | 3300005614 | Bacteria | 2018 |
| 208 | Ga0068856_100245198 | 3300005614 | Bacteria | 1807 |
| 209 | Ga0068856_100350195 | 3300005614 | Unclassified | 1495 |
| 210 | Ga0070702_100004396 | 3300005615 | Bacteria | 6431 |
| 211 | Ga0070702_100082649 | 3300005615 | Bacteria | 1927 |
| 212 | Ga0068852_100002637 | 3300005616 | Bacteria | 12389 |
| 213 | Ga0068852_100104839 | 3300005616 | Bacteria | 2560 |
| 214 | Ga0068852_100107391 | 3300005616 | Bacteria | 2532 |
| 215 | Ga0068852_100282013 | 3300005616 | Bacteria | 1602 |
| 216 | Ga0068852_100318137 | 3300005616 | Bacteria | 1510 |
| 217 | Ga0068859_100000279 | 3300005617 | Bacteria | 50882 |
| 218 | Ga0068859_100015855 | 3300005617 | Bacteria | 7572 |
| 219 | Ga0068859_100114376 | 3300005617 | Bacteria | 2762 |
| 220 | Ga0068859_100277541 | 3300005617 | Unclassified | 1768 |
| 221 | Ga0068864_100000722 | 3300005618 | Bacteria | 27599 |
| 222 | Ga0068864_100015807 | 3300005618 | Bacteria | 6279 |
| 223 | Ga0068864_100046245 | 3300005618 | Bacteria | 3734 |
| 224 | Ga0068866_10001418 | 3300005718 | Bacteria | 10276 |
| 225 | Ga0068866_10005261 | 3300005718 | Bacteria | 5333 |
| 226 | Ga0068866_10008503 | 3300005718 | Bacteria | 4330 |
| 227 | Ga0068866_10408602 | 3300005718 | Bacteria | 878 |
| 228 | Ga0068861_100051927 | 3300005719 | Unclassified | 3114 |
| 229 | Ga0068861_100175545 | 3300005719 | Bacteria | 1779 |
| 230 | Ga0068861_100392952 | 3300005719 | Bacteria | 1229 |
| 231 | Ga0068851_10001381 | 3300005834 | Bacteria | 10595 |
| 232 | Ga0068851_10015362 | 3300005834 | Bacteria | 3647 |
| 233 | Ga0068851_10253493 | 3300005834 | Unclassified | 999 |
| 234 | Ga0068870_10003763 | 3300005840 | Bacteria | 6454 |
| 235 | Ga0068870_10056296 | 3300005840 | Bacteria | 2098 |
| 236 | Ga0068870_10072395 | 3300005840 | Bacteria | 1883 |
| 237 | Ga0068863_100002208 | 3300005841 | Bacteria | 19334 |
| 238 | Ga0068863_100005729 | 3300005841 | Bacteria | 12193 |
| 239 | Ga0068863_100015579 | 3300005841 | Bacteria | 7305 |
| 240 | Ga0068863_100070921 | 3300005841 | Bacteria | 3296 |
| 241 | Ga0068863_100155975 | 3300005841 | Bacteria | 2186 |
| 242 | Ga0068863_100184605 | 3300005841 | Unclassified | 2003 |
| 243 | Ga0068863_100290982 | 3300005841 | Bacteria | 1583 |
| 244 | Ga0068858_100002272 | 3300005842 | Bacteria | 19444 |
| 245 | Ga0068858_100033976 | 3300005842 | Bacteria | 4731 |
| 246 | Ga0068858_100152304 | 3300005842 | Bacteria | 2174 |
| 247 | Ga0068858_100189865 | 3300005842 | Bacteria | 1941 |
| 248 | Ga0068858_100236897 | 3300005842 | Bacteria | 1731 |
| 249 | Ga0068858_100399579 | 3300005842 | Bacteria | 1320 |
| 250 | Ga0068860_100000202 | 3300005843 | Bacteria | 94520 |
| 251 | Ga0068860_100007256 | 3300005843 | Bacteria | 11086 |
| 252 | Ga0068860_100059449 | 3300005843 | Bacteria | 3633 |
| 253 | Ga0068860_100323717 | 3300005843 | Bacteria | 1513 |
| 254 | Ga0068862_100048413 | 3300005844 | Bacteria | 3629 |
| 255 | Ga0068862_100151358 | 3300005844 | Unclassified | 2065 |
| 256 | Ga0068862_100276330 | 3300005844 | Bacteria | 1538 |
| 257 | Ga0081540_1025691 | 3300005983 | Bacteria | 3382 |
| 258 | Ga0070717_10000577 | 3300006028 | Bacteria | 23420 |
| 259 | Ga0070717_10002339 | 3300006028 | Bacteria | 13349 |
| 260 | Ga0070717_10003511 | 3300006028 | Bacteria | 11227 |
| 261 | Ga0070717_10036520 | 3300006028 | Bacteria | 3985 |
| 262 | Ga0070717_10055045 | 3300006028 | Bacteria | 3282 |
| 263 | Ga0070717_10094410 | 3300006028 | Bacteria | 2530 |
| 264 | Ga0070717_10101727 | 3300006028 | Bacteria | 2441 |
| 265 | Ga0070717_10115354 | 3300006028 | Bacteria | 2295 |
| 266 | Ga0070717_10198558 | 3300006028 | Bacteria | 1756 |
| 267 | Ga0070717_10206549 | 3300006028 | Bacteria | 1722 |
| 268 | Ga0070717_10300122 | 3300006028 | Bacteria | 1428 |
| 269 | Ga0070717_10446116 | 3300006028 | Bacteria | 1166 |
| 270 | Ga0070717_10562457 | 3300006028 | Bacteria | 1033 |
| 271 | Ga0070717_10627222 | 3300006028 | Bacteria | 975 |
| 272 | Ga0070715_10037645 | 3300006163 | Bacteria | 2003 |
| 273 | Ga0070715_10042767 | 3300006163 | Bacteria | 1906 |
| 274 | Ga0070715_10099905 | 3300006163 | Bacteria | 1351 |
| 275 | Ga0070715_10122984 | 3300006163 | Bacteria | 1239 |
| 276 | Ga0070716_100005911 | 3300006173 | Bacteria | 5955 |
| 277 | Ga0070716_100028903 | 3300006173 | Bacteria | 2992 |
| 278 | Ga0070716_100135159 | 3300006173 | Bacteria | 1565 |
| 279 | Ga0070716_100155304 | 3300006173 | Bacteria | 1477 |
| 280 | Ga0070716_100240696 | 3300006173 | Bacteria | 1227 |
| 281 | Ga0070716_100380072 | 3300006173 | Bacteria | 1009 |
| 282 | Ga0070716_100432041 | 3300006173 | Unclassified | 955 |
| 283 | Ga0070712_100000948 | 3300006175 | Bacteria | 17440 |
| 284 | Ga0070712_100002033 | 3300006175 | Bacteria | 12399 |
| 285 | Ga0070712_100003822 | 3300006175 | Bacteria | 9275 |
| 286 | Ga0070712_100014441 | 3300006175 | Bacteria | 5069 |
| 287 | Ga0070712_100437864 | 3300006175 | Bacteria | 1086 |
| 288 | Ga0070712_100752610 | 3300006175 | Unclassified | 834 |
| 289 | Ga0097621_100000210 | 3300006237 | Bacteria | 38363 |
| 290 | Ga0097621_100000598 | 3300006237 | Bacteria | 25444 |
| 291 | Ga0097621_100001848 | 3300006237 | Bacteria | 14513 |
| 292 | Ga0097621_100005957 | 3300006237 | Bacteria | 8615 |
| 293 | Ga0097621_100006416 | 3300006237 | Bacteria | 8349 |
| 294 | Ga0097621_100030212 | 3300006237 | Bacteria | 4287 |
| 295 | Ga0097621_100049532 | 3300006237 | Bacteria | 3413 |
| 296 | Ga0097621_100149672 | 3300006237 | Bacteria | 2001 |
| 297 | Ga0097621_100569956 | 3300006237 | Bacteria | 1032 |
| 298 | Ga0097621_100639759 | 3300006237 | Unclassified | 975 |
| 299 | Ga0068871_100000168 | 3300006358 | Bacteria | 43632 |
| 300 | Ga0068871_100000745 | 3300006358 | Bacteria | 22042 |
| 301 | Ga0068871_100000787 | 3300006358 | Bacteria | 21292 |
| 302 | Ga0068871_100009189 | 3300006358 | Bacteria | 7148 |
| 303 | Ga0068871_100022428 | 3300006358 | Unclassified | 4866 |
| 304 | Ga0068871_100025233 | 3300006358 | Bacteria | 4621 |
| 305 | Ga0068871_100046525 | 3300006358 | Bacteria | 3495 |
| 306 | Ga0068871_100092083 | 3300006358 | Bacteria | 2528 |
| 307 | Ga0068871_100170830 | 3300006358 | Bacteria | 1863 |
| 308 | Ga0068871_100339426 | 3300006358 | Bacteria | 1326 |
| 309 | Ga0068871_100515283 | 3300006358 | Bacteria | 1079 |
| 310 | Ga0068871_100878048 | 3300006358 | Bacteria | 830 |
| 311 | Ga0075430_100064546 | 3300006846 | Bacteria | 3076 |
| 312 | Ga0075433_10005922 | 3300006852 | Bacteria | 9624 |
| 313 | Ga0075434_100000246 | 3300006871 | Bacteria | 37977 |
| 314 | Ga0075434_100046235 | 3300006871 | Bacteria | 4320 |
| 315 | Ga0075434_100225606 | 3300006871 | Bacteria | 1893 |
| 316 | Ga0075434_100261670 | 3300006871 | Bacteria | 1749 |
| 317 | Ga0075429_100112538 | 3300006880 | Bacteria | 2379 |
| 318 | Ga0068865_100004430 | 3300006881 | Bacteria | 8464 |
| 319 | Ga0068865_100005649 | 3300006881 | Bacteria | 7593 |
| 320 | Ga0068865_100059134 | 3300006881 | Bacteria | 2680 |
| 321 | Ga0068865_100076875 | 3300006881 | Bacteria | 2384 |
| 322 | Ga0075436_100009403 | 3300006914 | Bacteria | 6682 |
| 323 | Ga0075436_100052786 | 3300006914 | Bacteria | 2806 |
| 324 | Ga0097620_100000279 | 3300006931 | Bacteria | 50882 |
| 325 | Ga0097620_100015855 | 3300006931 | Bacteria | 7572 |
| 326 | Ga0097620_100114372 | 3300006931 | Bacteria | 2762 |
| 327 | Ga0097620_100277530 | 3300006931 | Unclassified | 1768 |
| 328 | Ga0075435_100003413 | 3300007076 | Bacteria | 10775 |
| 329 | Ga0099794_10013220 | 3300007265 | Bacteria | 3587 |
| 330 | Ga0099794_10027987 | 3300007265 | Bacteria | 2618 |
| 331 | Ga0099794_10032987 | 3300007265 | Bacteria | 2433 |
| 332 | Ga0099794_10070247 | 3300007265 | Bacteria | 1714 |
| 333 | Ga0099794_10312516 | 3300007265 | Bacteria | 814 |
| 334 | Ga0105250_10023835 | 3300009092 | Bacteria | 2467 |
| 335 | Ga0105240_10069762 | 3300009093 | Bacteria | 4349 |
| 336 | Ga0105240_10126859 | 3300009093 | Bacteria | 3065 |
| 337 | Ga0105240_10133132 | 3300009093 | Bacteria | 2979 |
| 338 | Ga0105240_10142711 | 3300009093 | Bacteria | 2862 |
| 339 | Ga0105240_10180234 | 3300009093 | Bacteria | 2493 |
| 340 | Ga0105240_10198550 | 3300009093 | Bacteria | 2353 |
| 341 | Ga0105240_10234012 | 3300009093 | Bacteria | 2133 |
| 342 | Ga0105240_10255657 | 3300009093 | Bacteria | 2023 |
| 343 | Ga0105240_10379745 | 3300009093 | Bacteria | 1596 |
| 344 | Ga0111539_10296716 | 3300009094 | Unclassified | 1881 |
| 345 | Ga0105245_10005402 | 3300009098 | Bacteria | 11229 |
| 346 | Ga0105245_10006763 | 3300009098 | Bacteria | 10055 |
| 347 | Ga0105245_10040838 | 3300009098 | Bacteria | 4134 |
| 348 | Ga0105245_10056423 | 3300009098 | Unclassified | 3530 |
| 349 | Ga0105245_10102519 | 3300009098 | Bacteria | 2650 |
| 350 | Ga0105247_10009853 | 3300009101 | Bacteria | 5790 |
| 351 | Ga0105247_10023440 | 3300009101 | Bacteria | 3719 |
| 352 | Ga0105247_10025376 | 3300009101 | Bacteria | 3574 |
| 353 | Ga0105247_10043865 | 3300009101 | Bacteria | 2741 |
| 354 | Ga0105247_10287524 | 3300009101 | Bacteria | 1136 |
| 355 | Ga0114129_10069552 | 3300009147 | Bacteria | 4907 |
| 356 | Ga0105241_10003965 | 3300009174 | Bacteria | 10942 |
| 357 | Ga0105241_10009776 | 3300009174 | Bacteria | 7049 |
| 358 | Ga0105241_10014319 | 3300009174 | Bacteria | 5807 |
| 359 | Ga0105241_10014699 | 3300009174 | Bacteria | 5729 |
| 360 | Ga0105241_10080020 | 3300009174 | Bacteria | 2556 |
| 361 | Ga0105241_10122744 | 3300009174 | Bacteria | 2094 |
| 362 | Ga0105241_10184639 | 3300009174 | Bacteria | 1732 |
| 363 | Ga0105241_10417172 | 3300009174 | Unclassified | 1180 |
| 364 | Ga0105242_10067475 | 3300009176 | Bacteria | 2957 |
| 365 | Ga0105242_10093037 | 3300009176 | Bacteria | 2541 |
| 366 | Ga0105242_10296485 | 3300009176 | Bacteria | 1474 |
| 367 | Ga0105242_10329709 | 3300009176 | Unclassified | 1403 |
| 368 | Ga0105248_10019962 | 3300009177 | Bacteria | 7419 |
| 369 | Ga0105248_10075041 | 3300009177 | Bacteria | 3800 |
| 370 | Ga0105248_10111193 | 3300009177 | Unclassified | 3090 |
| 371 | Ga0105248_10279014 | 3300009177 | Bacteria | 1881 |
| 372 | Ga0105248_10498440 | 3300009177 | Bacteria | 1373 |
| 373 | Ga0105248_10703549 | 3300009177 | Unclassified | 1140 |
| 374 | Ga0105237_10050649 | 3300009545 | Bacteria | 4172 |
| 375 | Ga0105237_10052099 | 3300009545 | Bacteria | 4109 |
| 376 | Ga0105237_10166347 | 3300009545 | Bacteria | 2204 |
| 377 | Ga0105237_10252481 | 3300009545 | Bacteria | 1766 |
| 378 | Ga0105237_10336095 | 3300009545 | Bacteria | 1515 |
| 379 | Ga0105238_10000382 | 3300009551 | Bacteria | 47455 |
| 380 | Ga0105238_10038278 | 3300009551 | Bacteria | 4870 |
| 381 | Ga0105238_10056428 | 3300009551 | Bacteria | 3940 |
| 382 | Ga0105238_10195615 | 3300009551 | Unclassified | 1998 |
| 383 | Ga0105238_10509822 | 3300009551 | Bacteria | 1205 |
| 384 | Ga0105249_10002069 | 3300009553 | Bacteria | 17385 |
| 385 | Ga0105249_10005159 | 3300009553 | Bacteria | 11268 |
| 386 | Ga0105249_10027251 | 3300009553 | Bacteria | 5156 |
| 387 | Ga0099796_10089984 | 3300010159 | Bacteria | 1139 |
| 388 | Ga0105239_10008900 | 3300010375 | Bacteria | 11363 |
| 389 | Ga0105239_10025445 | 3300010375 | Bacteria | 6517 |
| 390 | Ga0105239_10071895 | 3300010375 | Bacteria | 3801 |
| 391 | Ga0105239_10252226 | 3300010375 | Bacteria | 1982 |
| 392 | Ga0105239_10276784 | 3300010375 | Bacteria | 1889 |
| 393 | Ga0105239_10328075 | 3300010375 | Bacteria | 1726 |
| 394 | Ga0105239_10586432 | 3300010375 | Unclassified | 1271 |
| 395 | Ga0105239_10601201 | 3300010375 | Bacteria | 1255 |
| 396 | Ga0105246_10005905 | 3300011119 | Bacteria | 7467 |
| 397 | Ga0105246_10052960 | 3300011119 | Bacteria | 2791 |
| 398 | Ga0157373_10001551 | 3300013100 | Bacteria | 17528 |
| 399 | Ga0157373_10002773 | 3300013100 | Bacteria | 13254 |
| 400 | Ga0157373_10037161 | 3300013100 | Bacteria | 3492 |
| 401 | Ga0157371_10002011 | 3300013102 | Bacteria | 20094 |
| 402 | Ga0157371_10004936 | 3300013102 | Bacteria | 11459 |
| 403 | Ga0157371_10091878 | 3300013102 | Bacteria | 2150 |
| 404 | Ga0157370_10013342 | 3300013104 | Bacteria | 8464 |
| 405 | Ga0157370_10041226 | 3300013104 | Bacteria | 4456 |
| 406 | Ga0157370_10041413 | 3300013104 | Bacteria | 4444 |
| 407 | Ga0157370_10262601 | 3300013104 | Bacteria | 1596 |
| 408 | Ga0157370_10386571 | 3300013104 | Bacteria | 1289 |
| 409 | Ga0157370_10460855 | 3300013104 | Unclassified | 1168 |
| 410 | Ga0157369_10000269 | 3300013105 | Bacteria | 69979 |
| 411 | Ga0157369_10005474 | 3300013105 | Bacteria | 14757 |
| 412 | Ga0157369_10006683 | 3300013105 | Bacteria | 13322 |
| 413 | Ga0157369_10007966 | 3300013105 | Bacteria | 12173 |
| 414 | Ga0157369_10011776 | 3300013105 | Bacteria | 9932 |
| 415 | Ga0157369_10032265 | 3300013105 | Bacteria | 5761 |
| 416 | Ga0157369_10091948 | 3300013105 | Bacteria | 3238 |
| 417 | Ga0157369_10252497 | 3300013105 | Bacteria | 1840 |
| 418 | Ga0157374_10000436 | 3300013296 | Bacteria | 37798 |
| 419 | Ga0157374_10001029 | 3300013296 | Bacteria | 24206 |
| 420 | Ga0157374_10001822 | 3300013296 | Bacteria | 17965 |
| 421 | Ga0157374_10013417 | 3300013296 | Bacteria | 7152 |
| 422 | Ga0157374_10034779 | 3300013296 | Bacteria | 4606 |
| 423 | Ga0157374_10050314 | 3300013296 | Bacteria | 3873 |
| 424 | Ga0157374_10079255 | 3300013296 | Bacteria | 3112 |
| 425 | Ga0157374_10198645 | 3300013296 | Bacteria | 1963 |
| 426 | Ga0157374_10223184 | 3300013296 | Bacteria | 1850 |
| 427 | Ga0157374_10269873 | 3300013296 | Bacteria | 1677 |
| 428 | Ga0157374_10278228 | 3300013296 | Bacteria | 1652 |
| 429 | Ga0157374_10386565 | 3300013296 | Bacteria | 1394 |
| 430 | Ga0157378_10000014 | 3300013297 | Bacteria | 144214 |
| 431 | Ga0157378_10000344 | 3300013297 | Bacteria | 45774 |
| 432 | Ga0157378_10000413 | 3300013297 | Bacteria | 42040 |
| 433 | Ga0157378_10001268 | 3300013297 | Bacteria | 22736 |
| 434 | Ga0157378_10007193 | 3300013297 | Bacteria | 9723 |
| 435 | Ga0157378_10047597 | 3300013297 | Bacteria | 3813 |
| 436 | Ga0157378_10084794 | 3300013297 | Unclassified | 2869 |
| 437 | Ga0157378_10115437 | 3300013297 | Bacteria | 2467 |
| 438 | Ga0157378_10206337 | 3300013297 | Bacteria | 1861 |
| 439 | Ga0157378_10220523 | 3300013297 | Bacteria | 1803 |
| 440 | Ga0163162_10002239 | 3300013306 | Bacteria | 18167 |
| 441 | Ga0163162_10004542 | 3300013306 | Bacteria | 13372 |
| 442 | Ga0163162_10011418 | 3300013306 | Bacteria | 8661 |
| 443 | Ga0163162_10048955 | 3300013306 | Bacteria | 4235 |
| 444 | Ga0163162_10092562 | 3300013306 | Bacteria | 3107 |
| 445 | Ga0163162_10370132 | 3300013306 | Bacteria | 1566 |
| 446 | Ga0163162_10505475 | 3300013306 | Bacteria | 1339 |
| 447 | Ga0163162_11105459 | 3300013306 | Unclassified | 898 |
| 448 | Ga0157372_10000423 | 3300013307 | Bacteria | 46475 |
| 449 | Ga0157372_10000641 | 3300013307 | Bacteria | 38393 |
| 450 | Ga0157372_10002544 | 3300013307 | Bacteria | 19779 |
| 451 | Ga0157372_10004039 | 3300013307 | Bacteria | 15735 |
| 452 | Ga0157372_10005138 | 3300013307 | Bacteria | 13911 |
| 453 | Ga0157372_10015715 | 3300013307 | Bacteria | 8117 |
| 454 | Ga0157372_10016602 | 3300013307 | Bacteria | 7900 |
| 455 | Ga0157372_10022824 | 3300013307 | Bacteria | 6775 |
| 456 | Ga0157372_10036431 | 3300013307 | Bacteria | 5422 |
| 457 | Ga0157372_10062666 | 3300013307 | Bacteria | 4167 |
| 458 | Ga0157372_10166041 | 3300013307 | Bacteria | 2553 |
| 459 | Ga0157372_10198939 | 3300013307 | Bacteria | 2321 |
| 460 | Ga0157375_10035816 | 3300013308 | Bacteria | 4742 |
| 461 | Ga0157375_10044150 | 3300013308 | Bacteria | 4327 |
| 462 | Ga0163163_10026605 | 3300014325 | Bacteria | 5533 |
| 463 | Ga0163163_10027299 | 3300014325 | Bacteria | 5467 |
| 464 | Ga0163163_10093541 | 3300014325 | Bacteria | 3023 |
| 465 | Ga0163163_10096265 | 3300014325 | Bacteria | 2980 |
| 466 | Ga0163163_10113779 | 3300014325 | Unclassified | 2736 |
| 467 | Ga0163163_10386177 | 3300014325 | Bacteria | 1458 |
| 468 | Ga0182008_10001531 | 3300014497 | Bacteria | 15380 |
| 469 | Ga0182008_10009750 | 3300014497 | Bacteria | 5169 |
| 470 | Ga0157377_10023683 | 3300014745 | Bacteria | 3257 |
| 471 | Ga0157377_10166543 | 3300014745 | Bacteria | 1375 |
| 472 | Ga0157377_10438598 | 3300014745 | Unclassified | 899 |
| 473 | Ga0157379_10007798 | 3300014968 | Bacteria | 9271 |
| 474 | Ga0157379_10010844 | 3300014968 | Bacteria | 7948 |
| 475 | Ga0157379_10031809 | 3300014968 | Bacteria | 4701 |
| 476 | Ga0157379_10035204 | 3300014968 | Bacteria | 4464 |
| 477 | Ga0157379_10291860 | 3300014968 | Unclassified | 1485 |
| 478 | Ga0157376_10014425 | 3300014969 | Bacteria | 5933 |
| 479 | Ga0157376_10031198 | 3300014969 | Bacteria | 4265 |
| 480 | Ga0157376_10045515 | 3300014969 | Bacteria | 3613 |
| 481 | Ga0157376_10071439 | 3300014969 | Bacteria | 2950 |
| 482 | Ga0157376_10083990 | 3300014969 | Bacteria | 2741 |
| 483 | Ga0157376_10139774 | 3300014969 | Bacteria | 2171 |
| 484 | Ga0157376_10232048 | 3300014969 | Bacteria | 1715 |
| 485 | Ga0182007_10014472 | 3300015262 | Bacteria | 2973 |
| 486 | Ga0224570_100631 | 3300022730 | Bacteria | 2797 |
| 487 | Ga0224569_100133 | 3300022732 | Bacteria | 5518 |
| 488 | Ga0224572_1000066 | 3300024225 | Bacteria | 7223 |
| 489 | Ga0224572_1001114 | 3300024225 | Bacteria | 3797 |
| 490 | Ga0224572_1009514 | 3300024225 | Bacteria | 1814 |
| 491 | Ga0224572_1009608 | 3300024225 | Bacteria | 1807 |
| 492 | Ga0228598_1001112 | 3300024227 | Bacteria | 5938 |
| 493 | Ga0228598_1017099 | 3300024227 | Bacteria | 1430 |
| 494 | Ga0209437_102112 | 3300025233 | Bacteria | 4015 |
| 495 | Ga0209233_1007680 | 3300025261 | Bacteria | 3397 |
| 496 | Ga0209050_1041325 | 3300025298 | Bacteria | 1273 |
| 497 | Ga0207697_10002788 | 3300025315 | Bacteria | 8904 |
| 498 | Ga0207656_10130194 | 3300025321 | Unclassified | 1178 |
| 499 | Ga0207692_10010221 | 3300025898 | Bacteria | 3947 |
| 500 | Ga0207642_10002117 | 3300025899 | Bacteria | 6143 |
| 501 | Ga0207642_10014622 | 3300025899 | Bacteria | 2901 |
| 502 | Ga0207710_10059340 | 3300025900 | Bacteria | 1732 |
| 503 | Ga0207710_10085390 | 3300025900 | Unclassified | 1470 |
| 504 | Ga0207688_10019381 | 3300025901 | Unclassified | 3705 |
| 505 | Ga0207680_10010712 | 3300025903 | Bacteria | 4599 |
| 506 | Ga0207680_10044690 | 3300025903 | Bacteria | 2607 |
| 507 | Ga0207680_10330027 | 3300025903 | Unclassified | 1068 |
| 508 | Ga0207647_10001477 | 3300025904 | Bacteria | 18059 |
| 509 | Ga0207647_10006683 | 3300025904 | Bacteria | 8379 |
| 510 | Ga0207647_10022413 | 3300025904 | Bacteria | 4195 |
| 511 | Ga0207685_10072896 | 3300025905 | Bacteria | 1397 |
| 512 | Ga0207699_10000815 | 3300025906 | Bacteria | 14849 |
| 513 | Ga0207699_10018440 | 3300025906 | Bacteria | 3698 |
| 514 | Ga0207699_10058663 | 3300025906 | Bacteria | 2303 |
| 515 | Ga0207699_10095528 | 3300025906 | Bacteria | 1875 |
| 516 | Ga0207699_10108927 | 3300025906 | Bacteria | 1772 |
| 517 | Ga0207699_10373471 | 3300025906 | Bacteria | 1011 |
| 518 | Ga0207645_10000181 | 3300025907 | Bacteria | 50200 |
| 519 | Ga0207645_10007872 | 3300025907 | Bacteria | 7493 |
| 520 | Ga0207643_10000474 | 3300025908 | Bacteria | 25980 |
| 521 | Ga0207643_10097731 | 3300025908 | Unclassified | 1719 |
| 522 | Ga0207705_10255787 | 3300025909 | Bacteria | 1336 |
| 523 | Ga0207684_10001275 | 3300025910 | Bacteria | 27799 |
| 524 | Ga0207684_10018088 | 3300025910 | Bacteria | 6039 |
| 525 | Ga0207684_10081331 | 3300025910 | Bacteria | 2756 |
| 526 | Ga0207684_10178688 | 3300025910 | Bacteria | 1830 |
| 527 | Ga0207654_10002582 | 3300025911 | Bacteria | 9192 |
| 528 | Ga0207654_10014318 | 3300025911 | Bacteria | 4097 |
| 529 | Ga0207654_10056155 | 3300025911 | Bacteria | 2283 |
| 530 | Ga0207654_10110051 | 3300025911 | Bacteria | 1713 |
| 531 | Ga0207654_10123841 | 3300025911 | Bacteria | 1627 |
| 532 | Ga0207654_10255190 | 3300025911 | Unclassified | 1177 |
| 533 | Ga0207707_10000828 | 3300025912 | Bacteria | 30353 |
| 534 | Ga0207707_10038831 | 3300025912 | Bacteria | 4161 |
| 535 | Ga0207707_10081955 | 3300025912 | Bacteria | 2816 |
| 536 | Ga0207707_10099151 | 3300025912 | Bacteria | 2547 |
| 537 | Ga0207707_10220174 | 3300025912 | Bacteria | 1652 |
| 538 | Ga0207695_10043656 | 3300025913 | Bacteria | 4777 |
| 539 | Ga0207695_10077718 | 3300025913 | Unclassified | 3370 |
| 540 | Ga0207695_10171125 | 3300025913 | Bacteria | 2098 |
| 541 | Ga0207695_10271718 | 3300025913 | Bacteria | 1590 |
| 542 | Ga0207695_10323787 | 3300025913 | Bacteria | 1431 |
| 543 | Ga0207695_10711846 | 3300025913 | Bacteria | 884 |
| 544 | Ga0207671_10055720 | 3300025914 | Bacteria | 2929 |
| 545 | Ga0207671_10070131 | 3300025914 | Bacteria | 2612 |
| 546 | Ga0207671_10131435 | 3300025914 | Bacteria | 1922 |
| 547 | Ga0207671_10156068 | 3300025914 | Bacteria | 1765 |
| 548 | Ga0207671_10464186 | 3300025914 | Unclassified | 1009 |
| 549 | Ga0207693_10000090 | 3300025915 | Bacteria | 81069 |
| 550 | Ga0207693_10000173 | 3300025915 | Bacteria | 58862 |
| 551 | Ga0207693_10000621 | 3300025915 | Bacteria | 31746 |
| 552 | Ga0207693_10013135 | 3300025915 | Bacteria | 6680 |
| 553 | Ga0207693_10037643 | 3300025915 | Bacteria | 3813 |
| 554 | Ga0207693_10107683 | 3300025915 | Bacteria | 2186 |
| 555 | Ga0207663_10003822 | 3300025916 | Bacteria | 7435 |
| 556 | Ga0207663_10033068 | 3300025916 | Bacteria | 3077 |
| 557 | Ga0207663_10034666 | 3300025916 | Bacteria | 3021 |
| 558 | Ga0207663_10149945 | 3300025916 | Bacteria | 1635 |
| 559 | Ga0207663_10489488 | 3300025916 | Bacteria | 954 |
| 560 | Ga0207660_10185955 | 3300025917 | Bacteria | 1616 |
| 561 | Ga0207662_10001688 | 3300025918 | Bacteria | 10806 |
| 562 | Ga0207657_10005643 | 3300025919 | Bacteria | 13060 |
| 563 | Ga0207657_10007963 | 3300025919 | Bacteria | 10807 |
| 564 | Ga0207657_10008288 | 3300025919 | Bacteria | 10575 |
| 565 | Ga0207649_10000343 | 3300025920 | Bacteria | 35195 |
| 566 | Ga0207652_10076233 | 3300025921 | Bacteria | 2924 |
| 567 | Ga0207652_10120800 | 3300025921 | Bacteria | 2331 |
| 568 | Ga0207646_10002760 | 3300025922 | Bacteria | 20509 |
| 569 | Ga0207646_10007451 | 3300025922 | Bacteria | 11120 |
| 570 | Ga0207646_10039981 | 3300025922 | Bacteria | 4220 |
| 571 | Ga0207646_10103730 | 3300025922 | Bacteria | 2550 |
| 572 | Ga0207681_10020312 | 3300025923 | Bacteria | 4206 |
| 573 | Ga0207694_10000430 | 3300025924 | Bacteria | 39056 |
| 574 | Ga0207694_10043179 | 3300025924 | Bacteria | 3479 |
| 575 | Ga0207694_10089601 | 3300025924 | Bacteria | 2426 |
| 576 | Ga0207694_10287710 | 3300025924 | Bacteria | 1351 |
| 577 | Ga0207650_10000223 | 3300025925 | Bacteria | 64087 |
| 578 | Ga0207650_10000224 | 3300025925 | Bacteria | 63557 |
| 579 | Ga0207650_10000296 | 3300025925 | Bacteria | 50068 |
| 580 | Ga0207650_10001691 | 3300025925 | Bacteria | 15671 |
| 581 | Ga0207650_10289026 | 3300025925 | Bacteria | 1336 |
| 582 | Ga0207659_10470005 | 3300025926 | Unclassified | 1061 |
| 583 | Ga0207687_10017030 | 3300025927 | Bacteria | 4778 |
| 584 | Ga0207687_10058417 | 3300025927 | Bacteria | 2714 |
| 585 | Ga0207687_10173184 | 3300025927 | Bacteria | 1666 |
| 586 | Ga0207687_10385996 | 3300025927 | Bacteria | 1148 |
| 587 | Ga0207700_10002203 | 3300025928 | Bacteria | 11180 |
| 588 | Ga0207700_10072614 | 3300025928 | Bacteria | 2654 |
| 589 | Ga0207700_10073782 | 3300025928 | Bacteria | 2636 |
| 590 | Ga0207700_10105374 | 3300025928 | Bacteria | 2258 |
| 591 | Ga0207700_10180398 | 3300025928 | Bacteria | 1768 |
| 592 | Ga0207700_10255170 | 3300025928 | Bacteria | 1499 |
| 593 | Ga0207700_10287849 | 3300025928 | Bacteria | 1415 |
| 594 | Ga0207700_10298476 | 3300025928 | Bacteria | 1390 |
| 595 | Ga0207700_10331157 | 3300025928 | Unclassified | 1322 |
| 596 | Ga0207700_10359701 | 3300025928 | Bacteria | 1269 |
| 597 | Ga0207700_10360539 | 3300025928 | Bacteria | 1267 |
| 598 | Ga0207700_10405700 | 3300025928 | Unclassified | 1195 |
| 599 | Ga0207700_10650271 | 3300025928 | Unclassified | 940 |
| 600 | Ga0207664_10002844 | 3300025929 | Bacteria | 11490 |
| 601 | Ga0207664_10011335 | 3300025929 | Bacteria | 6328 |
| 602 | Ga0207664_10241814 | 3300025929 | Bacteria | 1572 |
| 603 | Ga0207644_10007871 | 3300025931 | Bacteria | 6964 |
| 604 | Ga0207644_10108673 | 3300025931 | Unclassified | 2094 |
| 605 | Ga0207690_10033784 | 3300025932 | Bacteria | 3291 |
| 606 | Ga0207690_10317592 | 3300025932 | Unclassified | 1223 |
| 607 | Ga0207690_10358566 | 3300025932 | Bacteria | 1154 |
| 608 | Ga0207706_10000613 | 3300025933 | Bacteria | 37863 |
| 609 | Ga0207706_10001122 | 3300025933 | Bacteria | 27226 |
| 610 | Ga0207706_10015847 | 3300025933 | Bacteria | 6816 |
| 611 | Ga0207686_10126583 | 3300025934 | Bacteria | 1747 |
| 612 | Ga0207670_10181872 | 3300025936 | Unclassified | 1584 |
| 613 | Ga0207670_10320786 | 3300025936 | Bacteria | 1219 |
| 614 | Ga0207704_10054816 | 3300025938 | Bacteria | 2433 |
| 615 | Ga0207704_10080675 | 3300025938 | Unclassified | 2101 |
| 616 | Ga0207704_10494860 | 3300025938 | Bacteria | 984 |
| 617 | Ga0207665_10000182 | 3300025939 | Bacteria | 42287 |
| 618 | Ga0207665_10047330 | 3300025939 | Bacteria | 2883 |
| 619 | Ga0207665_10048693 | 3300025939 | Bacteria | 2846 |
| 620 | Ga0207665_10083112 | 3300025939 | Bacteria | 2208 |
| 621 | Ga0207665_10112332 | 3300025939 | Unclassified | 1916 |
| 622 | Ga0207665_10235785 | 3300025939 | Bacteria | 1346 |
| 623 | Ga0207691_10000345 | 3300025940 | Bacteria | 46775 |
| 624 | Ga0207691_10296071 | 3300025940 | Bacteria | 1391 |
| 625 | Ga0207711_10002524 | 3300025941 | Bacteria | 16302 |
| 626 | Ga0207711_10125650 | 3300025941 | Bacteria | 2294 |
| 627 | Ga0207711_10248782 | 3300025941 | Bacteria | 1632 |
| 628 | Ga0207689_10000499 | 3300025942 | Bacteria | 37043 |
| 629 | Ga0207689_10001621 | 3300025942 | Bacteria | 21315 |
| 630 | Ga0207689_10063023 | 3300025942 | Bacteria | 3049 |
| 631 | Ga0207661_10001212 | 3300025944 | Bacteria | 17237 |
| 632 | Ga0207661_10161297 | 3300025944 | Bacteria | 1945 |
| 633 | Ga0207679_10000115 | 3300025945 | Bacteria | 64466 |
| 634 | Ga0207679_10001482 | 3300025945 | Bacteria | 14719 |
| 635 | Ga0207667_10000311 | 3300025949 | Bacteria | 67671 |
| 636 | Ga0207667_10005374 | 3300025949 | Bacteria | 15617 |
| 637 | Ga0207667_10028850 | 3300025949 | Bacteria | 6025 |
| 638 | Ga0207667_10113360 | 3300025949 | Bacteria | 2795 |
| 639 | Ga0207667_10142497 | 3300025949 | Bacteria | 2468 |
| 640 | Ga0207667_10537447 | 3300025949 | Bacteria | 1183 |
| 641 | Ga0207667_10723811 | 3300025949 | Unclassified | 996 |
| 642 | Ga0207667_10964156 | 3300025949 | Bacteria | 842 |
| 643 | Ga0207651_10003483 | 3300025960 | Bacteria | 7733 |
| 644 | Ga0207712_10051568 | 3300025961 | Bacteria | 2878 |
| 645 | Ga0207668_10052646 | 3300025972 | Bacteria | 2817 |
| 646 | Ga0207668_10103914 | 3300025972 | Bacteria | 2116 |
| 647 | Ga0207640_10003104 | 3300025981 | Bacteria | 8931 |
| 648 | Ga0207640_10007732 | 3300025981 | Bacteria | 5940 |
| 649 | Ga0207640_10030028 | 3300025981 | Bacteria | 3344 |
| 650 | Ga0207640_10159412 | 3300025981 | Unclassified | 1667 |
| 651 | Ga0207640_10363623 | 3300025981 | Unclassified | 1167 |
| 652 | Ga0207640_10505528 | 3300025981 | Bacteria | 1007 |
| 653 | Ga0207658_10007316 | 3300025986 | Bacteria | 7530 |
| 654 | Ga0207658_10393707 | 3300025986 | Bacteria | 1216 |
| 655 | Ga0207677_10002452 | 3300026023 | Bacteria | 9745 |
| 656 | Ga0207677_10017631 | 3300026023 | Bacteria | 4263 |
| 657 | Ga0207677_10053564 | 3300026023 | Bacteria | 2747 |
| 658 | Ga0207677_10055683 | 3300026023 | Bacteria | 2706 |
| 659 | Ga0207677_10569747 | 3300026023 | Bacteria | 990 |
| 660 | Ga0207677_10593511 | 3300026023 | Bacteria | 971 |
| 661 | Ga0207703_10001667 | 3300026035 | Bacteria | 19971 |
| 662 | Ga0207703_10006667 | 3300026035 | Bacteria | 9212 |
| 663 | Ga0207703_10067935 | 3300026035 | Bacteria | 2935 |
| 664 | Ga0207703_10365821 | 3300026035 | Bacteria | 1331 |
| 665 | Ga0207703_10712240 | 3300026035 | Bacteria | 955 |
| 666 | Ga0207639_10092099 | 3300026041 | Bacteria | 2429 |
| 667 | Ga0207639_10154627 | 3300026041 | Bacteria | 1925 |
| 668 | Ga0207639_11077881 | 3300026041 | Unclassified | 753 |
| 669 | Ga0207678_10000130 | 3300026067 | Bacteria | 63279 |
| 670 | Ga0207678_10000950 | 3300026067 | Bacteria | 26463 |
| 671 | Ga0207708_10246065 | 3300026075 | Bacteria | 1440 |
| 672 | Ga0207708_10375804 | 3300026075 | Unclassified | 1171 |
| 673 | Ga0207702_10000722 | 3300026078 | Bacteria | 35418 |
| 674 | Ga0207702_10001654 | 3300026078 | Bacteria | 22011 |
| 675 | Ga0207702_10002343 | 3300026078 | Bacteria | 18095 |
| 676 | Ga0207702_10002543 | 3300026078 | Bacteria | 17174 |
| 677 | Ga0207702_10019837 | 3300026078 | Bacteria | 5568 |
| 678 | Ga0207702_10070027 | 3300026078 | Unclassified | 3016 |
| 679 | Ga0207702_10070347 | 3300026078 | Bacteria | 3009 |
| 680 | Ga0207702_10097251 | 3300026078 | Unclassified | 2591 |
| 681 | Ga0207702_10176331 | 3300026078 | Bacteria | 1965 |
| 682 | Ga0207702_10184663 | 3300026078 | Bacteria | 1922 |
| 683 | Ga0207702_10196100 | 3300026078 | Bacteria | 1869 |
| 684 | Ga0207702_10839055 | 3300026078 | Bacteria | 909 |
| 685 | Ga0207641_10000287 | 3300026088 | Bacteria | 63251 |
| 686 | Ga0207641_10001947 | 3300026088 | Bacteria | 19809 |
| 687 | Ga0207641_10002584 | 3300026088 | Bacteria | 16638 |
| 688 | Ga0207641_10031067 | 3300026088 | Bacteria | 4428 |
| 689 | Ga0207641_10040850 | 3300026088 | Bacteria | 3886 |
| 690 | Ga0207641_10111882 | 3300026088 | Unclassified | 2422 |
| 691 | Ga0207641_10141200 | 3300026088 | Unclassified | 2173 |
| 692 | Ga0207641_10305177 | 3300026088 | Bacteria | 1505 |
| 693 | Ga0207648_10001253 | 3300026089 | Bacteria | 28381 |
| 694 | Ga0207648_10159247 | 3300026089 | Bacteria | 1994 |
| 695 | Ga0207648_10371630 | 3300026089 | Bacteria | 1291 |
| 696 | Ga0207676_10000115 | 3300026095 | Bacteria | 71633 |
| 697 | Ga0207676_10003051 | 3300026095 | Bacteria | 11952 |
| 698 | Ga0207676_10035713 | 3300026095 | Bacteria | 3775 |
| 699 | Ga0207676_10412252 | 3300026095 | Unclassified | 1265 |
| 700 | Ga0207674_10000788 | 3300026116 | Bacteria | 41336 |
| 701 | Ga0207674_10001340 | 3300026116 | Bacteria | 31912 |
| 702 | Ga0207674_10007893 | 3300026116 | Bacteria | 12363 |
| 703 | Ga0207674_10013852 | 3300026116 | Bacteria | 8922 |
| 704 | Ga0207674_10487679 | 3300026116 | Unclassified | 1191 |
| 705 | Ga0207674_10586096 | 3300026116 | Bacteria | 1077 |
| 706 | Ga0207675_100083379 | 3300026118 | Bacteria | 2998 |
| 707 | Ga0207683_10000217 | 3300026121 | Bacteria | 50192 |
| 708 | Ga0207683_10291083 | 3300026121 | Unclassified | 1493 |
| 709 | Ga0207698_10101020 | 3300026142 | Bacteria | 2391 |
| 710 | Ga0207698_10149736 | 3300026142 | Bacteria | 2023 |
| 711 | Ga0207698_10199580 | 3300026142 | Bacteria | 1790 |
| 712 | Ga0207698_10447055 | 3300026142 | Bacteria | 1247 |
| 713 | Ga0209179_1043846 | 3300027512 | Unclassified | 947 |
| 714 | Ga0209588_1016400 | 3300027671 | Bacteria | 2287 |
| 715 | Ga0209588_1070111 | 3300027671 | Bacteria | 1132 |
| 716 | Ga0265356_1000344 | 3300028017 | Bacteria | 8506 |
| 717 | Ga0268266_10000761 | 3300028379 | Bacteria | 43122 |
| 718 | Ga0268265_10073055 | 3300028380 | Unclassified | 2677 |
| 719 | Ga0268265_10296460 | 3300028380 | Bacteria | 1454 |
| 720 | Ga0268264_10000241 | 3300028381 | Bacteria | 103608 |
| 721 | Ga0268264_10004971 | 3300028381 | Bacteria | 11265 |
| 722 | Ga0268264_10044778 | 3300028381 | Bacteria | 3672 |
| 723 | Ga0268264_10046056 | 3300028381 | Bacteria | 3622 |
| 724 | Ga0268264_10257370 | 3300028381 | Bacteria | 1624 |
| 725 | Ga0265338_10001801 | 3300028800 | Bacteria | 33703 |
| 726 | Ga0265338_10010396 | 3300028800 | Bacteria | 10918 |
| 727 | Ga0265338_10080138 | 3300028800 | Bacteria | 2744 |
| 728 | Ga0265338_10132286 | 3300028800 | Bacteria | 1967 |
| 729 | Ga0265338_10241360 | 3300028800 | Bacteria | 1338 |
| 730 | Ga0265338_10274634 | 3300028800 | Bacteria | 1234 |
| 731 | Ga0265762_1004236 | 3300030760 | Bacteria | 2573 |
| 732 | Ga0265762_1006001 | 3300030760 | Bacteria | 2177 |
| 733 | Ga0265762_1015555 | 3300030760 | Bacteria | 1377 |
| 734 | Ga0265762_1025991 | 3300030760 | Unclassified | 1094 |
| 735 | Ga0265760_10000242 | 3300031090 | Bacteria | 14932 |
| 736 | Ga0265760_10003610 | 3300031090 | Bacteria | 4490 |
| 737 | Ga0265760_10005419 | 3300031090 | Bacteria | 3662 |
| 738 | Ga0265760_10007787 | 3300031090 | Bacteria | 3061 |
| 739 | Ga0265760_10017742 | 3300031090 | Bacteria | 2045 |
| 740 | Ga0265760_10018276 | 3300031090 | Bacteria | 2017 |
| 741 | Ga0265760_10058968 | 3300031090 | Bacteria | 1164 |
| 742 | Ga0265330_10036864 | 3300031235 | Bacteria | 2178 |
| 743 | Ga0265332_10071679 | 3300031238 | Bacteria | 1475 |
| 744 | Ga0265325_10014097 | 3300031241 | Bacteria | 4528 |
| 745 | Ga0265325_10015495 | 3300031241 | Bacteria | 4285 |
| 746 | Ga0265325_10045920 | 3300031241 | Bacteria | 2268 |
| 747 | Ga0265340_10149411 | 3300031247 | Bacteria | 1065 |
| 748 | Ga0265339_10014422 | 3300031249 | Bacteria | 4761 |
| 749 | Ga0265339_10051746 | 3300031249 | Bacteria | 2240 |
| 750 | Ga0265339_10092440 | 3300031249 | Bacteria | 1584 |
| 751 | Ga0265331_10094211 | 3300031250 | Bacteria | 1383 |
| 752 | Ga0265327_10032180 | 3300031251 | Bacteria | 2938 |
| 753 | Ga0265316_10019053 | 3300031344 | Bacteria | 5881 |
| 754 | Ga0265316_10043022 | 3300031344 | Bacteria | 3605 |
| 755 | Ga0265316_10450132 | 3300031344 | Bacteria | 923 |
| 756 | Ga0265313_10014628 | 3300031595 | Bacteria | 4625 |
| 757 | Ga0265314_10009028 | 3300031711 | Bacteria | 8474 |
| 758 | Ga0265314_10108988 | 3300031711 | Bacteria | 1763 |
| 759 | Ga0265314_10119534 | 3300031711 | Bacteria | 1661 |
| 760 | Ga0265342_10112470 | 3300031712 | Bacteria | 1540 |
| 761 | Ga0307416_101059012 | 3300032002 | Bacteria | 915 |
| 762 | Ga0316214_1005106 | 3300033545 | Bacteria | 1712 |
| 763 | Ga0316212_1006527 | 3300033547 | Bacteria | 1690 |
| 764 | Ga0373926_0004598 | 3300035083 | Bacteria | 4529 |
| 765 | Ga0373926_0005361 | 3300035083 | Bacteria | 4223 |
| 766 | Ga0373928_0042513 | 3300035084 | Bacteria | 1048 |
| 767 | Ga0373929_0020694 | 3300035085 | Bacteria | 1328 |
| 768 | Ga0373944_0049754 | 3300035089 | Bacteria | 1318 |
| 769 | Ga0373936_0004614 | 3300035113 | Bacteria | 5214 |
| 770 | Ga0373936_0063311 | 3300035113 | Bacteria | 1514 |
| 771 | Ga0373939_0046714 | 3300035114 | Bacteria | 1327 |
| 772 | Ga0373941_0019085 | 3300035115 | Bacteria | 1904 |
| 773 | Ga0373945_0082064 | 3300035116 | Bacteria | 1237 |
| 774 | Ga0373954_0192457 | 3300035118 | Bacteria | 1002 |
| 775 | Ga0373956_0121472 | 3300035119 | Unclassified | 1220 |
| 776 | Ga0373957_0086822 | 3300035120 | Bacteria | 1239 |
| 777 | Ga0373943_0052087 | 3300035170 | Bacteria | 2017 |
| 778 | Ga0373943_0054311 | 3300035170 | Bacteria | 1981 |
| 779 | Ga0373943_0067392 | 3300035170 | Bacteria | 1805 |
| 780 | Ga0373943_0209225 | 3300035170 | Unclassified | 1082 |
| 781 | Ga0373943_0298164 | 3300035170 | Bacteria | 915 |
| 782 | Ga0373943_0302457 | 3300035170 | Bacteria | 908 |
| 783 | Ga0373946_0004259 | 3300035171 | Bacteria | 5113 |
| 784 | Ga0373946_0010395 | 3300035171 | Unclassified | 3444 |
| 785 | Ga0373955_0042548 | 3300035172 | Bacteria | 2439 |
| 786 | Ga0373955_0163829 | 3300035172 | Bacteria | 1314 |
| 787 | Ga0373931_0052084 | 3300035691 | Bacteria | 2181 |
| 788 | Ga0373931_0247997 | 3300035691 | Bacteria | 1082 |
| 789 | Ga0373931_0309897 | 3300035691 | Bacteria | 977 |
| 790 | Ga0373935_0033631 | 3300035692 | Bacteria | 3192 |
| 791 | Ga0373935_0035710 | 3300035692 | Bacteria | 3103 |
| 792 | Ga0373935_0079637 | 3300035692 | Bacteria | 2127 |
| 793 | Ga0373935_0423944 | 3300035692 | Unclassified | 958 |
| 794 | Ga0373935_0696763 | 3300035692 | Unclassified | 747 |
| 795 | Ga0373927_0003975 | 3300035695 | Bacteria | 10456 |
| 796 | Ga0373927_0015301 | 3300035695 | Bacteria | 5067 |
| 797 | Ga0373927_0015335 | 3300035695 | Bacteria | 5061 |
| 798 | Ga0373927_0054495 | 3300035695 | Bacteria | 2587 |
| 799 | Ga0373927_0074146 | 3300035695 | Unclassified | 2203 |
| 800 | Ga0373927_0124228 | 3300035695 | Bacteria | 1685 |
| 801 | Ga0373933_0040395 | 3300035724 | Bacteria | 2749 |
| 802 | Ga0373933_0046243 | 3300035724 | Bacteria | 2583 |
| 803 | Ga0373933_0308046 | 3300035724 | Bacteria | 1026 |
| 804 | Ga0373947_0001902 | 3300035725 | Bacteria | 12757 |
| 805 | Ga0373947_0001950 | 3300035725 | Bacteria | 12629 |
| 806 | Ga0373947_0046121 | 3300035725 | Bacteria | 2609 |
| 807 | Ga0373947_0097458 | 3300035725 | Bacteria | 1843 |
| 808 | Ga0373947_0336867 | 3300035725 | Bacteria | 1010 |
| 809 | Ga0373947_0339554 | 3300035725 | Unclassified | 1006 |
| 810 | Ga0373937_0018254 | 3300036401 | Bacteria | 6262 |
| 811 | Ga0373937_0094316 | 3300036401 | Bacteria | 2775 |
| 812 | Ga0373937_0406085 | 3300036401 | Bacteria | 1292 |
| 813 | Ga0373937_0893321 | 3300036401 | Bacteria | 837 |
| 814 | Ga0373937_0922139 | 3300036401 | Bacteria | 822 |
| 815 | Ga0373925_0000165 | 3300037068 | Bacteria | 71445 |
| 816 | Ga0373925_0017686 | 3300037068 | Bacteria | 5172 |
| 817 | Ga0373925_0018110 | 3300037068 | Bacteria | 5115 |
| 818 | Ga0373925_0023470 | 3300037068 | Bacteria | 4500 |
| 819 | Ga0373925_0054200 | 3300037068 | Bacteria | 2999 |
| 820 | Ga0373925_0282884 | 3300037068 | Bacteria | 1336 |
| 821 | Ga0395905_0000096 | 3300037471 | Bacteria | 146075 |
| 822 | Ga0436364_1137452 | 3300037853 | Bacteria | 2214 |
| 823 | Ga0400490_03194 | 3300038726 | Bacteria | 2424 |
| 824 | Ga0400486_20280 | 3300038742 | Bacteria | 2381 |
| 825 | Ga0436365_1849740 | 3300039437 | Unclassified | 1737 |
| 826 | Ga0436363_0684377 | 3300039450 | Plasmid | 2896 |
| 827 | Ga0436363_1603702 | 3300039450 | Bacteria | 883 |
| 828 | Ga0436363_1709607 | 3300039450 | Bacteria | 1943 |
| 829 | Ga0436362_1117608 | 3300039453 | Unclassified | 4645 |
| 830 | Ga0451577_0003762 | 3300042876 | Bacteria | 16540 |
| 831 | Ga0451577_0064248 | 3300042876 | Bacteria | 3273 |
| 832 | Ga0451577_0407021 | 3300042876 | Bacteria | 1235 |
| 833 | Ga0453683_0004979 | 3300044673 | Bacteria | 9332 |
| 834 | Ga0453683_0005490 | 3300044673 | Bacteria | 8845 |
| 835 | Ga0453683_0251834 | 3300044673 | Bacteria | 1126 |
| 836 | Ga0453684_0000377 | 3300044712 | Bacteria | 183445 |
| 837 | Ga0453684_0005849 | 3300044712 | Bacteria | 23912 |
| 838 | Ga0453684_0018504 | 3300044712 | Bacteria | 10686 |
| 839 | Ga0453684_0061085 | 3300044712 | Bacteria | 4840 |
| 840 | Ga0453684_0096456 | 3300044712 | Bacteria | 3632 |
| 841 | Ga0466957_0000410 | 3300044842 | Bacteria | 21005 |
| 842 | Ga0451576_0000033 | 3300045051 | Bacteria | 393131 |
| 843 | Ga0451576_0018916 | 3300045051 | Bacteria | 7528 |
| 844 | Ga0451576_0165440 | 3300045051 | Bacteria | 2308 |
| 845 | Ga0451576_0220067 | 3300045051 | Bacteria | 1982 |
| 846 | Ga0451576_0273153 | 3300045051 | Bacteria | 1767 |
| 847 | Ga0451576_0301499 | 3300045051 | Bacteria | 1676 |
| 848 | Ga0451576_0635259 | 3300045051 | Bacteria | 1122 |
| 849 | Ga0451576_1312526 | 3300045051 | Bacteria | 754 |
| 850 | Ga0466967_0119894 | 3300045976 | Unclassified | 2429 |
| 851 | Ga0495592_0052355 | 3300046454 | Bacteria | 3031 |
| 852 | Ga0495603_0004371 | 3300046455 | Bacteria | 8425 |
| 853 | Ga0495629_0020122 | 3300046459 | Bacteria | 4765 |
| 854 | Ga0495629_0088319 | 3300046459 | Bacteria | 2162 |
| 855 | Ga0495651_0014952 | 3300046462 | Bacteria | 5999 |
| 856 | Ga0495653_0019126 | 3300046463 | Bacteria | 5557 |
| 857 | Ga0495580_0000074 | 3300046472 | Bacteria | 62279 |
| 858 | Ga0495580_0000337 | 3300046472 | Bacteria | 38443 |
| 859 | Ga0495580_0005142 | 3300046472 | Bacteria | 10883 |
| 860 | Ga0495580_0014509 | 3300046472 | Bacteria | 5974 |
| 861 | Ga0495580_0033054 | 3300046472 | Bacteria | 3728 |
| 862 | Ga0495580_0053725 | 3300046472 | Bacteria | 2842 |
| 863 | Ga0495580_0067428 | 3300046472 | Bacteria | 2504 |
| 864 | Ga0495580_0081143 | 3300046472 | Unclassified | 2261 |
| 865 | Ga0495580_0108116 | 3300046472 | Bacteria | 1931 |
| 866 | Ga0495580_0149657 | 3300046472 | Bacteria | 1617 |
| 867 | Ga0495580_0195440 | 3300046472 | Bacteria | 1395 |
| 868 | Ga0495580_0208472 | 3300046472 | Bacteria | 1345 |
| 869 | Ga0495580_0323642 | 3300046472 | Unclassified | 1048 |
| 870 | Ga0495580_0348395 | 3300046472 | Bacteria | 1004 |
| 871 | Ga0495582_0005452 | 3300046473 | Bacteria | 7094 |
| 872 | Ga0495582_0009992 | 3300046473 | Bacteria | 5223 |
| 873 | Ga0495582_0022220 | 3300046473 | Bacteria | 3471 |
| 874 | Ga0495639_0071872 | 3300046475 | Bacteria | 1599 |
| 875 | Ga0495664_0010014 | 3300046477 | Bacteria | 5319 |
| 876 | Ga0495664_0023289 | 3300046477 | Unclassified | 3594 |
| 877 | Ga0495584_0000002 | 3300046491 | Bacteria | 512179 |
| 878 | Ga0495594_0007103 | 3300046499 | Bacteria | 5760 |
| 879 | Ga0495594_0149616 | 3300046499 | Bacteria | 1325 |
| 880 | Ga0495608_0015944 | 3300046511 | Bacteria | 5202 |
| 881 | Ga0495608_0148646 | 3300046511 | Unclassified | 1494 |
| 882 | Ga0495618_0014035 | 3300046514 | Bacteria | 4877 |
| 883 | Ga0495628_0000167 | 3300046516 | Bacteria | 57173 |
| 884 | Ga0495628_0049805 | 3300046516 | Bacteria | 3316 |
| 885 | Ga0495630_0087969 | 3300046517 | Bacteria | 2346 |
| 886 | Ga0495630_0093306 | 3300046517 | Bacteria | 2275 |
| 887 | Ga0495630_0131284 | 3300046517 | Bacteria | 1902 |
| 888 | Ga0495630_0133671 | 3300046517 | Bacteria | 1884 |
| 889 | Ga0495666_0027633 | 3300046526 | Bacteria | 2793 |
| 890 | Ga0495666_0106709 | 3300046526 | Bacteria | 1317 |
| 891 | Ga0495652_0001713 | 3300046529 | Bacteria | 23626 |
| 892 | Ga0495652_0088019 | 3300046529 | Bacteria | 2546 |
| 893 | Ga0495665_0001072 | 3300046531 | Bacteria | 14517 |
| 894 | Ga0495665_0025425 | 3300046531 | Bacteria | 3181 |
| 895 | Ga0495665_0039056 | 3300046531 | Bacteria | 2529 |
| 896 | Ga0495665_0084143 | 3300046531 | Unclassified | 1672 |
| 897 | Ga0495665_0144780 | 3300046531 | Unclassified | 1241 |
| 898 | Ga0495640_0027205 | 3300046533 | Bacteria | 4127 |
| 899 | Ga0495640_0057591 | 3300046533 | Bacteria | 2652 |
| 900 | Ga0495640_0245598 | 3300046533 | Bacteria | 1122 |
| 901 | Ga0495586_0012586 | 3300046535 | Bacteria | 4488 |
| 902 | Ga0495586_0058509 | 3300046535 | Bacteria | 2093 |
| 903 | Ga0495586_0271800 | 3300046535 | Bacteria | 969 |
| 904 | Ga0495587_0003037 | 3300046536 | Bacteria | 11210 |
| 905 | Ga0495587_0069491 | 3300046536 | Bacteria | 2051 |
| 906 | Ga0495645_0006650 | 3300046543 | Bacteria | 8032 |
| 907 | Ga0495645_0007683 | 3300046543 | Bacteria | 7501 |
| 908 | Ga0495645_0079896 | 3300046543 | Bacteria | 2348 |
| 909 | Ga0495622_0159709 | 3300046557 | Bacteria | 1017 |
| 910 | Ga0495667_0027483 | 3300046559 | Bacteria | 3834 |
| 911 | Ga0495667_0216771 | 3300046559 | Bacteria | 1222 |
| 912 | Ga0495634_0025416 | 3300046642 | Bacteria | 4143 |
| 913 | Ga0495634_0069864 | 3300046642 | Bacteria | 2316 |
| 914 | Ga0495657_0009233 | 3300046675 | Bacteria | 7483 |
| 915 | Ga0495623_0011515 | 3300046679 | Bacteria | 5724 |
| 916 | Ga0495623_0377775 | 3300046679 | Bacteria | 767 |
| 917 | Ga0495647_0014408 | 3300046681 | Unclassified | 2755 |
| 918 | Ga0495658_0158287 | 3300046683 | Bacteria | 1395 |
| 919 | Ga0495669_0053711 | 3300046684 | Bacteria | 1812 |
| 920 | Ga0495613_0317024 | 3300046689 | Bacteria | 1077 |
| 921 | Ga0495624_0081571 | 3300046690 | Bacteria | 2003 |
| 922 | Ga0495600_0043489 | 3300046809 | Bacteria | 2930 |
| 923 | Ga0495600_0103323 | 3300046809 | Bacteria | 1857 |
| 924 | Ga0495581_0059356 | 3300047315 | Unclassified | 2210 |
| 925 | Ga0495581_0324868 | 3300047315 | Bacteria | 899 |
| 926 | Ga0495604_0003790 | 3300047317 | Bacteria | 12033 |
| 927 | Ga0495604_0076018 | 3300047317 | Bacteria | 2527 |
| 928 | Ga0495636_0023394 | 3300047318 | Bacteria | 2501 |
| 929 | Ga0495674_0013194 | 3300047319 | Bacteria | 7767 |
| 930 | Ga0495674_0051869 | 3300047319 | Bacteria | 3614 |
| 931 | Ga0495674_0139998 | 3300047319 | Bacteria | 2034 |
| 932 | Ga0495674_0283446 | 3300047319 | Bacteria | 1357 |
| 933 | Ga0495674_0315998 | 3300047319 | Bacteria | 1273 |
| 934 | Ga0495676_0259262 | 3300047321 | Bacteria | 1183 |
| 935 | Ga0495680_0001348 | 3300047322 | Bacteria | 26695 |
| 936 | Ga0495680_0010330 | 3300047322 | Bacteria | 8332 |
| 937 | Ga0495675_0000202 | 3300047444 | Bacteria | 43536 |
| 938 | Ga0495675_0053586 | 3300047444 | Bacteria | 2561 |
| 939 | Ga0495675_0240589 | 3300047444 | Bacteria | 1090 |
| 940 | Ga0495684_0012098 | 3300047471 | Bacteria | 6658 |
| 941 | Ga0495684_0022085 | 3300047471 | Bacteria | 4899 |
| 942 | Ga0495684_0493365 | 3300047471 | Bacteria | 843 |
| 943 | Ga0495593_0080671 | 3300047673 | Bacteria | 1683 |
| 944 | Ga0495593_0174034 | 3300047673 | Bacteria | 1085 |
| 945 | Ga0495593_0271292 | 3300047673 | Unclassified | 849 |
| 946 | Ga0495602_0022805 | 3300048088 | Bacteria | 6120 |
| 947 | Ga0496100_0114330 | 3300048903 | Bacteria | 1880 |
| 948 | Ga0496100_0232842 | 3300048903 | Bacteria | 1356 |
| 949 | Ga0496101_0143438 | 3300048904 | Bacteria | 1822 |
| 950 | Ga0496101_0360541 | 3300048904 | Bacteria | 1143 |
| 951 | Ga0496101_0369488 | 3300048904 | Bacteria | 1128 |
| 952 | Ga0496101_0389535 | 3300048904 | Bacteria | 1097 |
| 953 | Ga0496101_0563666 | 3300048904 | Bacteria | 901 |
| 954 | Ga0496102_0006673 | 3300048905 | Bacteria | 9863 |
| 955 | Ga0496102_0021353 | 3300048905 | Bacteria | 5726 |
| 956 | Ga0496102_0058632 | 3300048905 | Bacteria | 3518 |
| 957 | Ga0496102_0078406 | 3300048905 | Bacteria | 3041 |
| 958 | Ga0496102_0343567 | 3300048905 | Bacteria | 1405 |
| 959 | Ga0496102_0588681 | 3300048905 | Bacteria | 1035 |
| 960 | Ga0496102_1071373 | 3300048905 | Bacteria | 726 |
| 961 | Ga0496103_0014594 | 3300048906 | Bacteria | 4667 |
| 962 | Ga0496103_0336809 | 3300048906 | Unclassified | 970 |
| 963 | Ga0496103_0342546 | 3300048906 | Bacteria | 961 |
| 964 | Ga0496104_0000074 | 3300048907 | Bacteria | 103117 |
| 965 | Ga0496104_0024442 | 3300048907 | Bacteria | 5556 |
| 966 | Ga0496104_0125291 | 3300048907 | Unclassified | 2467 |
| 967 | Ga0496104_0317220 | 3300048907 | Bacteria | 1472 |
| 968 | Ga0496104_0325422 | 3300048907 | Bacteria | 1450 |
| 969 | Ga0496104_0630881 | 3300048907 | Bacteria | 981 |
| 970 | Ga0496106_0031581 | 3300048909 | Bacteria | 3947 |
| 971 | Ga0496106_0166006 | 3300048909 | Bacteria | 1748 |
| 972 | Ga0496107_0056921 | 3300048910 | Bacteria | 2826 |
| 973 | Ga0496107_0307304 | 3300048910 | Bacteria | 1180 |
| 974 | Ga0496108_0000325 | 3300048911 | Bacteria | 40507 |
| 975 | Ga0496109_0000117 | 3300048912 | Bacteria | 82245 |
| 976 | Ga0496109_0306029 | 3300048912 | Unclassified | 1499 |
| 977 | Ga0496109_0736047 | 3300048912 | Bacteria | 924 |
| 978 | Ga0496110_0002628 | 3300048913 | Bacteria | 13526 |
| 979 | Ga0496110_0061618 | 3300048913 | Bacteria | 3312 |
| 980 | Ga0496111_0004540 | 3300048914 | Bacteria | 8786 |
| 981 | Ga0496112_0000283 | 3300048915 | Bacteria | 32864 |
| 982 | Ga0496112_0001864 | 3300048915 | Bacteria | 16604 |
| 983 | Ga0496112_0076452 | 3300048915 | Bacteria | 3311 |
| 984 | Ga0496112_0143818 | 3300048915 | Bacteria | 2353 |
| 985 | Ga0496112_0168771 | 3300048915 | Bacteria | 2154 |
| 986 | Ga0496112_0531873 | 3300048915 | Unclassified | 1110 |
| 987 | Ga0496113_0000504 | 3300048916 | Bacteria | 19266 |
| 988 | Ga0496113_0036419 | 3300048916 | Bacteria | 3605 |
| 989 | Ga0496113_0435657 | 3300048916 | Bacteria | 1053 |
| 990 | Ga0496113_0538124 | 3300048916 | Bacteria | 937 |
| 991 | Ga0496114_0146119 | 3300048917 | Bacteria | 2050 |
| 992 | Ga0496114_0155073 | 3300048917 | Bacteria | 1988 |
| 993 | Ga0496115_0006382 | 3300048918 | Bacteria | 8641 |
| 994 | Ga0496115_0010817 | 3300048918 | Bacteria | 6824 |
| 995 | Ga0496115_0251515 | 3300048918 | Bacteria | 1455 |
| 996 | Ga0496115_0600636 | 3300048918 | Bacteria | 875 |
| 997 | Ga0496126_0000095 | 3300048929 | Bacteria | 207654 |
| 998 | Ga0501040_0138574 | 3300049576 | Bacteria | 1713 |
| 999 | nmdc:mga09592_61422_c1 | 3300050508 | Bacteria | 3178 |
| 1000 | nmdc:mga0qj67_207052_c1 | 3300050509 | Bacteria | 1593 |
| 1001 | nmdc:mga0n895_6139_c1 | 3300050512 | Bacteria | 10149 |
| 1002 | nmdc:mga0n895_8844_c1 | 3300050512 | Bacteria | 8765 |
| 1003 | nmdc:mga0n895_988254_c1 | 3300050512 | Bacteria | 823 |
| 1004 | nmdc:mga0rr50_119696_c1 | 3300050513 | Bacteria | 2094 |
| 1005 | nmdc:mga0rr50_22666_c1 | 3300050513 | Bacteria | 4315 |
| 1006 | nmdc:mga0rr50_251177_c1 | 3300050513 | Unclassified | 1469 |
| 1007 | nmdc:mga0rr50_88981_c1 | 3300050513 | Bacteria | 2400 |
| 1008 | nmdc:mga08x19_119477_c1 | 3300050514 | Bacteria | 1766 |
| 1009 | nmdc:mga08x19_575_c1 | 3300050514 | Bacteria | 23955 |
| 1010 | nmdc:mga08x19_59017_c2 | 3300050514 | Bacteria | 2026 |
| 1011 | nmdc:mga08x19_6689_c1 | 3300050514 | Bacteria | 6840 |
| 1012 | nmdc:mga0a205_937_c1 | 3300050515 | Bacteria | 24079 |
| 1013 | Ga0501084_0268223 | 3300054114 | Bacteria | 1441 |
| 1014 | 2644236120 | 2643221642 | Bacteria | 5357871 |
| 1015 | 2887377990 | 2887375801 | Bacteria | 5334027 |
| 1016 | 646812225 | 646564506 | Bacteria | 3192235 |
| 1017 | Ga0070717_10516524 | |||
| 1018 | MBSR1b_contig_201130 | |||
| 1019 | MBSR1b_contig_3160416 | |||
| 1020 | LJNas_1000129 | |||
| 1021 | JGI24752J21851_1006373 | |||
| 1022 | JGI24740J21852_10097993 | |||
| 1023 | JGI24737J22298_10034298 | |||
| 1024 | JGI24743J22301_10007079 | |||
| 1025 | JGI24034J26672_10000570 | |||
| 1026 | JGI24742J22300_10036682 | |||
| 1027 | JGI24751J29686_10023255 | |||
| 1028 | rootH1_10066128 | |||
| 1029 | Ga0065712_10082264 | |||
| 1030 | Ga0065715_10004441 | |||
| 1031 | Ga0065715_10203251 | |||
| 1032 | Ga0065707_10164984 | |||
| 1033 | Ga0070658_10012517 | |||
| 1034 | Ga0070658_10172599 | |||
| 1035 | Ga0070676_10032029 | |||
| 1036 | Ga0070676_10092810 | |||
| 1037 | Ga0070683_100000180 | |||
| 1038 | Ga0070683_100184739 | |||
| 1039 | Ga0070683_100567660 | |||
| 1040 | Ga0070690_100198034 | |||
| 1041 | Ga0070670_100001706 | |||
| 1042 | Ga0070670_100155017 | |||
| 1043 | Ga0070670_100391214 | |||
| 1044 | Ga0068869_100002390 | |||
| 1045 | Ga0068869_100014353 | |||
| 1046 | Ga0070666_10040208 | |||
| 1047 | Ga0070666_10087335 | |||
| 1048 | Ga0070680_100163322 | |||
| 1049 | Ga0070680_100201821 | |||
| 1050 | Ga0070680_100240366 | |||
| 1051 | Ga0070682_100047195 | |||
| 1052 | Ga0070682_100108040 | |||
| 1053 | Ga0068868_100002943 | |||
| 1054 | Ga0068868_100006066 | |||
| 1055 | Ga0068868_100019802 | |||
| 1056 | Ga0068868_100051856 | |||
| 1057 | Ga0068868_100261589 | |||
| 1058 | Ga0070660_100016682 | |||
| 1059 | Ga0070660_100240181 | |||
| 1060 | Ga0070660_100522864 | |||
| 1061 | Ga0070689_100016928 | |||
| 1062 | Ga0070689_100170285 | |||
| 1063 | Ga0070687_100023249 | |||
| 1064 | Ga0070661_100000886 | |||
| 1065 | Ga0070661_100226734 | |||
| 1066 | Ga0070692_10463847 | |||
| 1067 | Ga0070668_100013446 | |||
| 1068 | Ga0070669_100016274 | |||
| 1069 | Ga0070669_100095707 | |||
| 1070 | Ga0070675_100003414 | |||
| 1071 | Ga0070675_100507415 | |||
| 1072 | Ga0070671_100024798 | |||
| 1073 | Ga0070671_100032659 | |||
| 1074 | Ga0070671_100224112 | |||
| 1075 | Ga0070674_100008141 | |||
| 1076 | Ga0070674_100129520 | |||
| 1077 | Ga0070673_100106371 | |||
| 1078 | Ga0070673_100128982 | |||
| 1079 | Ga0070688_100001337 | |||
| 1080 | Ga0070659_100055418 | |||
| 1081 | Ga0070659_100083237 | |||
| 1082 | Ga0070659_100233724 | |||
| 1083 | Ga0070667_100009483 | |||
| 1084 | Ga0070667_100093961 | |||
| 1085 | Ga0070709_10015131 | |||
| 1086 | Ga0070709_10038441 | |||
| 1087 | Ga0070709_10057013 | |||
| 1088 | Ga0070709_10084591 | |||
| 1089 | Ga0070709_10147207 | |||
| 1090 | Ga0070709_10170516 | |||
| 1091 | Ga0070709_10170725 | |||
| 1092 | Ga0070709_10257488 | |||
| 1093 | Ga0070709_10667144 | |||
| 1094 | Ga0070714_100001114 | |||
| 1095 | Ga0070714_100016666 | |||
| 1096 | Ga0070714_100224122 | |||
| 1097 | Ga0070713_100000543 | |||
| 1098 | Ga0070713_100002121 | |||
| 1099 | Ga0070713_100029017 | |||
| 1100 | Ga0070713_100037336 | |||
| 1101 | Ga0070713_100040170 | |||
| 1102 | Ga0070713_100084638 | |||
| 1103 | Ga0070713_100148407 | |||
| 1104 | Ga0070713_100204515 | |||
| 1105 | Ga0070713_100277423 | |||
| 1106 | Ga0070713_100309252 | |||
| 1107 | Ga0070713_100365107 | |||
| 1108 | Ga0070713_100505909 | |||
| 1109 | Ga0070710_10002568 | |||
| 1110 | Ga0070710_10220647 | |||
| 1111 | Ga0070701_10017180 | |||
| 1112 | Ga0070711_100000478 | |||
| 1113 | Ga0070711_100015078 | |||
| 1114 | Ga0070711_100176790 | |||
| 1115 | Ga0070711_100188148 | |||
| 1116 | Ga0070711_100279643 | |||
| 1117 | Ga0070711_100569782 | |||
| 1118 | Ga0070711_100590184 | |||
| 1119 | Ga0070711_100742228 | |||
| 1120 | Ga0070705_100062843 | |||
| 1121 | Ga0070700_100312578 | |||
| 1122 | Ga0070694_100041259 | |||
| 1123 | Ga0070708_100000527 | |||
| 1124 | Ga0070708_100001078 | |||
| 1125 | Ga0070708_100003900 | |||
| 1126 | Ga0070708_100013160 | |||
| 1127 | Ga0070708_100035100 | |||
| 1128 | Ga0070708_100055104 | |||
| 1129 | Ga0070708_100066072 | |||
| 1130 | Ga0070708_100114938 | |||
| 1131 | Ga0070708_100206787 | |||
| 1132 | Ga0070708_100357972 | |||
| 1133 | Ga0070663_100032756 | |||
| 1134 | Ga0070663_100589773 | |||
| 1135 | Ga0070678_100355225 | |||
| 1136 | Ga0070662_100005079 | |||
| 1137 | Ga0070662_100225056 | |||
| 1138 | Ga0070681_10000513 | |||
| 1139 | Ga0070681_10001443 | |||
| 1140 | Ga0070681_10047505 | |||
| 1141 | Ga0070681_10071265 | |||
| 1142 | Ga0070681_10231014 | |||
| 1143 | Ga0068867_100016708 | |||
| 1144 | Ga0068867_100053195 | |||
| 1145 | Ga0068867_100428822 | |||
| 1146 | Ga0070685_10001585 | |||
| 1147 | Ga0070685_10238101 | |||
| 1148 | Ga0070706_100000257 | |||
| 1149 | Ga0070706_100000991 | |||
| 1150 | Ga0070706_100094200 | |||
| 1151 | Ga0070706_100113003 | |||
| 1152 | Ga0070706_100204128 | |||
| 1153 | Ga0070707_100001774 | |||
| 1154 | Ga0070707_100062473 | |||
| 1155 | Ga0070707_100072935 | |||
| 1156 | Ga0070707_100535678 | |||
| 1157 | Ga0070707_100569754 | |||
| 1158 | Ga0070698_100000182 | |||
| 1159 | Ga0070698_100012583 | |||
| 1160 | Ga0070698_100389727 | |||
| 1161 | Ga0070698_100791264 | |||
| 1162 | Ga0070699_100088406 | |||
| 1163 | Ga0070699_100209163 | |||
| 1164 | Ga0070699_100290372 | |||
| 1165 | Ga0070679_100008087 | |||
| 1166 | Ga0070679_100054487 | |||
| 1167 | Ga0070679_100151665 | |||
| 1168 | Ga0070679_100301683 | |||
| 1169 | Ga0070684_100007581 | |||
| 1170 | Ga0070684_100017780 | |||
| 1171 | Ga0070684_100034929 | |||
| 1172 | Ga0070684_100089161 | |||
| 1173 | Ga0070684_100100259 | |||
| 1174 | Ga0070684_100338931 | |||
| 1175 | Ga0070697_100001487 | |||
| 1176 | Ga0070697_100004056 | |||
| 1177 | Ga0070697_100008463 | |||
| 1178 | Ga0070697_100085791 | |||
| 1179 | Ga0070697_100131291 | |||
| 1180 | Ga0070697_100238772 | |||
| 1181 | Ga0070697_100506852 | |||
| 1182 | Ga0068853_100005004 | |||
| 1183 | Ga0068853_100065061 | |||
| 1184 | Ga0068853_100083675 | |||
| 1185 | Ga0068853_100111845 | |||
| 1186 | Ga0068853_100254637 | |||
| 1187 | Ga0070672_100133123 | |||
| 1188 | Ga0070672_100381838 | |||
| 1189 | Ga0070686_100011657 | |||
| 1190 | Ga0070686_100036014 | |||
| 1191 | Ga0070696_100033625 | |||
| 1192 | Ga0070693_100038251 | |||
| 1193 | Ga0070693_100159312 | |||
| 1194 | Ga0070693_100465557 | |||
| 1195 | Ga0070665_100146087 | |||
| 1196 | Ga0068855_100000412 | |||
| 1197 | Ga0068855_100000425 | |||
| 1198 | Ga0068855_100018276 | |||
| 1199 | Ga0068855_100062777 | |||
| 1200 | Ga0068855_100106448 | |||
| 1201 | Ga0068855_100947328 | |||
| 1202 | Ga0070664_100005786 | |||
| 1203 | Ga0070664_100047341 | |||
| 1204 | Ga0070664_100082144 | |||
| 1205 | Ga0068857_100002572 | |||
| 1206 | Ga0068857_100003408 | |||
| 1207 | Ga0068857_100005929 | |||
| 1208 | Ga0068857_100372991 | |||
| 1209 | Ga0068857_100574953 | |||
| 1210 | Ga0068854_100003492 | |||
| 1211 | Ga0068854_100004475 | |||
| 1212 | Ga0068854_100014550 | |||
| 1213 | Ga0068854_100020751 | |||
| 1214 | Ga0068856_100000670 | |||
| 1215 | Ga0068856_100000708 | |||
| 1216 | Ga0068856_100001577 | |||
| 1217 | Ga0068856_100003544 | |||
| 1218 | Ga0068856_100006243 | |||
| 1219 | Ga0068856_100009111 | |||
| 1220 | Ga0068856_100066387 | |||
| 1221 | Ga0068856_100079175 | |||
| 1222 | Ga0068856_100118901 | |||
| 1223 | Ga0068856_100198992 | |||
| 1224 | Ga0068856_100245198 | |||
| 1225 | Ga0068856_100350195 | |||
| 1226 | Ga0070702_100004396 | |||
| 1227 | Ga0070702_100082649 | |||
| 1228 | Ga0068852_100002637 | |||
| 1229 | Ga0068852_100104839 | |||
| 1230 | Ga0068852_100107391 | |||
| 1231 | Ga0068852_100282013 | |||
| 1232 | Ga0068852_100318137 | |||
| 1233 | Ga0068859_100000279 | |||
| 1234 | Ga0068859_100015855 | |||
| 1235 | Ga0068859_100114376 | |||
| 1236 | Ga0068859_100277541 | |||
| 1237 | Ga0068864_100000722 | |||
| 1238 | Ga0068864_100015807 | |||
| 1239 | Ga0068864_100046245 | |||
| 1240 | Ga0068866_10001418 | |||
| 1241 | Ga0068866_10005261 | |||
| 1242 | Ga0068866_10008503 | |||
| 1243 | Ga0068866_10408602 | |||
| 1244 | Ga0068861_100051927 | |||
| 1245 | Ga0068861_100175545 | |||
| 1246 | Ga0068861_100392952 | |||
| 1247 | Ga0068851_10001381 | |||
| 1248 | Ga0068851_10015362 | |||
| 1249 | Ga0068851_10253493 | |||
| 1250 | Ga0068870_10003763 | |||
| 1251 | Ga0068870_10056296 | |||
| 1252 | Ga0068870_10072395 | |||
| 1253 | Ga0068863_100002208 | |||
| 1254 | Ga0068863_100005729 | |||
| 1255 | Ga0068863_100015579 | |||
| 1256 | Ga0068863_100070921 | |||
| 1257 | Ga0068863_100155975 | |||
| 1258 | Ga0068863_100184605 | |||
| 1259 | Ga0068863_100290982 | |||
| 1260 | Ga0068858_100002272 | |||
| 1261 | Ga0068858_100033976 | |||
| 1262 | Ga0068858_100152304 | |||
| 1263 | Ga0068858_100189865 | |||
| 1264 | Ga0068858_100236897 | |||
| 1265 | Ga0068858_100399579 | |||
| 1266 | Ga0068860_100000202 | |||
| 1267 | Ga0068860_100007256 | |||
| 1268 | Ga0068860_100059449 | |||
| 1269 | Ga0068860_100323717 | |||
| 1270 | Ga0068862_100048413 | |||
| 1271 | Ga0068862_100151358 | |||
| 1272 | Ga0068862_100276330 | |||
| 1273 | Ga0081540_1025691 | |||
| 1274 | Ga0070717_10000577 | |||
| 1275 | Ga0070717_10002339 | |||
| 1276 | Ga0070717_10003511 | |||
| 1277 | Ga0070717_10036520 | |||
| 1278 | Ga0070717_10055045 | |||
| 1279 | Ga0070717_10094410 | |||
| 1280 | Ga0070717_10101727 | |||
| 1281 | Ga0070717_10115354 | |||
| 1282 | Ga0070717_10198558 | |||
| 1283 | Ga0070717_10206549 | |||
| 1284 | Ga0070717_10300122 | |||
| 1285 | Ga0070717_10446116 | |||
| 1286 | Ga0070717_10562457 | |||
| 1287 | Ga0070717_10627222 | |||
| 1288 | Ga0070715_10037645 | |||
| 1289 | Ga0070715_10042767 | |||
| 1290 | Ga0070715_10099905 | |||
| 1291 | Ga0070715_10122984 | |||
| 1292 | Ga0070716_100005911 | |||
| 1293 | Ga0070716_100028903 | |||
| 1294 | Ga0070716_100135159 | |||
| 1295 | Ga0070716_100155304 | |||
| 1296 | Ga0070716_100240696 | |||
| 1297 | Ga0070716_100380072 | |||
| 1298 | Ga0070716_100432041 | |||
| 1299 | Ga0070712_100000948 | |||
| 1300 | Ga0070712_100002033 | |||
| 1301 | Ga0070712_100003822 | |||
| 1302 | Ga0070712_100014441 | |||
| 1303 | Ga0070712_100437864 | |||
| 1304 | Ga0070712_100752610 | |||
| 1305 | Ga0097621_100000210 | |||
| 1306 | Ga0097621_100000598 | |||
| 1307 | Ga0097621_100001848 | |||
| 1308 | Ga0097621_100005957 | |||
| 1309 | Ga0097621_100006416 | |||
| 1310 | Ga0097621_100030212 | |||
| 1311 | Ga0097621_100049532 | |||
| 1312 | Ga0097621_100149672 | |||
| 1313 | Ga0097621_100569956 | |||
| 1314 | Ga0097621_100639759 | |||
| 1315 | Ga0068871_100000168 | |||
| 1316 | Ga0068871_100000745 | |||
| 1317 | Ga0068871_100000787 | |||
| 1318 | Ga0068871_100009189 | |||
| 1319 | Ga0068871_100022428 | |||
| 1320 | Ga0068871_100025233 | |||
| 1321 | Ga0068871_100046525 | |||
| 1322 | Ga0068871_100092083 | |||
| 1323 | Ga0068871_100170830 | |||
| 1324 | Ga0068871_100339426 | |||
| 1325 | Ga0068871_100515283 | |||
| 1326 | Ga0068871_100878048 | |||
| 1327 | Ga0075430_100064546 | |||
| 1328 | Ga0075433_10005922 | |||
| 1329 | Ga0075434_100000246 | |||
| 1330 | Ga0075434_100046235 | |||
| 1331 | Ga0075434_100225606 | |||
| 1332 | Ga0075434_100261670 | |||
| 1333 | Ga0075429_100112538 | |||
| 1334 | Ga0068865_100004430 | |||
| 1335 | Ga0068865_100005649 | |||
| 1336 | Ga0068865_100059134 | |||
| 1337 | Ga0068865_100076875 | |||
| 1338 | Ga0075436_100009403 | |||
| 1339 | Ga0075436_100052786 | |||
| 1340 | Ga0097620_100000279 | |||
| 1341 | Ga0097620_100015855 | |||
| 1342 | Ga0097620_100114372 | |||
| 1343 | Ga0097620_100277530 | |||
| 1344 | Ga0075435_100003413 | |||
| 1345 | Ga0099794_10013220 | |||
| 1346 | Ga0099794_10027987 | |||
| 1347 | Ga0099794_10032987 | |||
| 1348 | Ga0099794_10070247 | |||
| 1349 | Ga0099794_10312516 | |||
| 1350 | Ga0105250_10023835 | |||
| 1351 | Ga0105240_10069762 | |||
| 1352 | Ga0105240_10126859 | |||
| 1353 | Ga0105240_10133132 | |||
| 1354 | Ga0105240_10142711 | |||
| 1355 | Ga0105240_10180234 | |||
| 1356 | Ga0105240_10198550 | |||
| 1357 | Ga0105240_10234012 | |||
| 1358 | Ga0105240_10255657 | |||
| 1359 | Ga0105240_10379745 | |||
| 1360 | Ga0111539_10296716 | |||
| 1361 | Ga0105245_10005402 | |||
| 1362 | Ga0105245_10006763 | |||
| 1363 | Ga0105245_10040838 | |||
| 1364 | Ga0105245_10056423 | |||
| 1365 | Ga0105245_10102519 | |||
| 1366 | Ga0105247_10009853 | |||
| 1367 | Ga0105247_10023440 | |||
| 1368 | Ga0105247_10025376 | |||
| 1369 | Ga0105247_10043865 | |||
| 1370 | Ga0105247_10287524 | |||
| 1371 | Ga0114129_10069552 | |||
| 1372 | Ga0105241_10003965 | |||
| 1373 | Ga0105241_10009776 | |||
| 1374 | Ga0105241_10014319 | |||
| 1375 | Ga0105241_10014699 | |||
| 1376 | Ga0105241_10080020 | |||
| 1377 | Ga0105241_10122744 | |||
| 1378 | Ga0105241_10184639 | |||
| 1379 | Ga0105241_10417172 | |||
| 1380 | Ga0105242_10067475 | |||
| 1381 | Ga0105242_10093037 | |||
| 1382 | Ga0105242_10296485 | |||
| 1383 | Ga0105242_10329709 | |||
| 1384 | Ga0105248_10019962 | |||
| 1385 | Ga0105248_10075041 | |||
| 1386 | Ga0105248_10111193 | |||
| 1387 | Ga0105248_10279014 | |||
| 1388 | Ga0105248_10498440 | |||
| 1389 | Ga0105248_10703549 | |||
| 1390 | Ga0105237_10050649 | |||
| 1391 | Ga0105237_10052099 | |||
| 1392 | Ga0105237_10166347 | |||
| 1393 | Ga0105237_10252481 | |||
| 1394 | Ga0105237_10336095 | |||
| 1395 | Ga0105238_10000382 | |||
| 1396 | Ga0105238_10038278 | |||
| 1397 | Ga0105238_10056428 | |||
| 1398 | Ga0105238_10195615 | |||
| 1399 | Ga0105238_10509822 | |||
| 1400 | Ga0105249_10002069 | |||
| 1401 | Ga0105249_10005159 | |||
| 1402 | Ga0105249_10027251 | |||
| 1403 | Ga0099796_10089984 | |||
| 1404 | Ga0105239_10008900 | |||
| 1405 | Ga0105239_10025445 | |||
| 1406 | Ga0105239_10071895 | |||
| 1407 | Ga0105239_10252226 | |||
| 1408 | Ga0105239_10276784 | |||
| 1409 | Ga0105239_10328075 | |||
| 1410 | Ga0105239_10586432 | |||
| 1411 | Ga0105239_10601201 | |||
| 1412 | Ga0105246_10005905 | |||
| 1413 | Ga0105246_10052960 | |||
| 1414 | Ga0157373_10001551 | |||
| 1415 | Ga0157373_10002773 | |||
| 1416 | Ga0157373_10037161 | |||
| 1417 | Ga0157371_10002011 | |||
| 1418 | Ga0157371_10004936 | |||
| 1419 | Ga0157371_10091878 | |||
| 1420 | Ga0157370_10013342 | |||
| 1421 | Ga0157370_10041226 | |||
| 1422 | Ga0157370_10041413 | |||
| 1423 | Ga0157370_10262601 | |||
| 1424 | Ga0157370_10386571 | |||
| 1425 | Ga0157370_10460855 | |||
| 1426 | Ga0157369_10000269 | |||
| 1427 | Ga0157369_10005474 | |||
| 1428 | Ga0157369_10006683 | |||
| 1429 | Ga0157369_10007966 | |||
| 1430 | Ga0157369_10011776 | |||
| 1431 | Ga0157369_10032265 | |||
| 1432 | Ga0157369_10091948 | |||
| 1433 | Ga0157369_10252497 | |||
| 1434 | Ga0157374_10000436 | |||
| 1435 | Ga0157374_10001029 | |||
| 1436 | Ga0157374_10001822 | |||
| 1437 | Ga0157374_10013417 | |||
| 1438 | Ga0157374_10034779 | |||
| 1439 | Ga0157374_10050314 | |||
| 1440 | Ga0157374_10079255 | |||
| 1441 | Ga0157374_10198645 | |||
| 1442 | Ga0157374_10223184 | |||
| 1443 | Ga0157374_10269873 | |||
| 1444 | Ga0157374_10278228 | |||
| 1445 | Ga0157374_10386565 | |||
| 1446 | Ga0157378_10000014 | |||
| 1447 | Ga0157378_10000344 | |||
| 1448 | Ga0157378_10000413 | |||
| 1449 | Ga0157378_10001268 | |||
| 1450 | Ga0157378_10007193 | |||
| 1451 | Ga0157378_10047597 | |||
| 1452 | Ga0157378_10084794 | |||
| 1453 | Ga0157378_10115437 | |||
| 1454 | Ga0157378_10206337 | |||
| 1455 | Ga0157378_10220523 | |||
| 1456 | Ga0163162_10002239 | |||
| 1457 | Ga0163162_10004542 | |||
| 1458 | Ga0163162_10011418 | |||
| 1459 | Ga0163162_10048955 | |||
| 1460 | Ga0163162_10092562 | |||
| 1461 | Ga0163162_10370132 | |||
| 1462 | Ga0163162_10505475 | |||
| 1463 | Ga0163162_11105459 | |||
| 1464 | Ga0157372_10000423 | |||
| 1465 | Ga0157372_10000641 | |||
| 1466 | Ga0157372_10002544 | |||
| 1467 | Ga0157372_10004039 | |||
| 1468 | Ga0157372_10005138 | |||
| 1469 | Ga0157372_10015715 | |||
| 1470 | Ga0157372_10016602 | |||
| 1471 | Ga0157372_10022824 | |||
| 1472 | Ga0157372_10036431 | |||
| 1473 | Ga0157372_10062666 | |||
| 1474 | Ga0157372_10166041 | |||
| 1475 | Ga0157372_10198939 | |||
| 1476 | Ga0157375_10035816 | |||
| 1477 | Ga0157375_10044150 | |||
| 1478 | Ga0163163_10026605 | |||
| 1479 | Ga0163163_10027299 | |||
| 1480 | Ga0163163_10093541 | |||
| 1481 | Ga0163163_10096265 | |||
| 1482 | Ga0163163_10113779 | |||
| 1483 | Ga0163163_10386177 | |||
| 1484 | Ga0182008_10001531 | |||
| 1485 | Ga0182008_10009750 | |||
| 1486 | Ga0157377_10023683 | |||
| 1487 | Ga0157377_10166543 | |||
| 1488 | Ga0157377_10438598 | |||
| 1489 | Ga0157379_10007798 | |||
| 1490 | Ga0157379_10010844 | |||
| 1491 | Ga0157379_10031809 | |||
| 1492 | Ga0157379_10035204 | |||
| 1493 | Ga0157379_10291860 | |||
| 1494 | Ga0157376_10014425 | |||
| 1495 | Ga0157376_10031198 | |||
| 1496 | Ga0157376_10045515 | |||
| 1497 | Ga0157376_10071439 | |||
| 1498 | Ga0157376_10083990 | |||
| 1499 | Ga0157376_10139774 | |||
| 1500 | Ga0157376_10232048 | |||
| 1501 | Ga0182007_10014472 | |||
| 1502 | Ga0224570_100631 | |||
| 1503 | Ga0224569_100133 | |||
| 1504 | Ga0224572_1000066 | |||
| 1505 | Ga0224572_1001114 | |||
| 1506 | Ga0224572_1009514 | |||
| 1507 | Ga0224572_1009608 | |||
| 1508 | Ga0228598_1001112 | |||
| 1509 | Ga0228598_1017099 | |||
| 1510 | Ga0209437_102112 | |||
| 1511 | Ga0209233_1007680 | |||
| 1512 | Ga0209050_1041325 | |||
| 1513 | Ga0207697_10002788 | |||
| 1514 | Ga0207656_10130194 | |||
| 1515 | Ga0207692_10010221 | |||
| 1516 | Ga0207642_10002117 | |||
| 1517 | Ga0207642_10014622 | |||
| 1518 | Ga0207710_10059340 | |||
| 1519 | Ga0207710_10085390 | |||
| 1520 | Ga0207688_10019381 | |||
| 1521 | Ga0207680_10010712 | |||
| 1522 | Ga0207680_10044690 | |||
| 1523 | Ga0207680_10330027 | |||
| 1524 | Ga0207647_10001477 | |||
| 1525 | Ga0207647_10006683 | |||
| 1526 | Ga0207647_10022413 | |||
| 1527 | Ga0207685_10072896 | |||
| 1528 | Ga0207699_10000815 | |||
| 1529 | Ga0207699_10018440 | |||
| 1530 | Ga0207699_10058663 | |||
| 1531 | Ga0207699_10095528 | |||
| 1532 | Ga0207699_10108927 | |||
| 1533 | Ga0207699_10373471 | |||
| 1534 | Ga0207645_10000181 | |||
| 1535 | Ga0207645_10007872 | |||
| 1536 | Ga0207643_10000474 | |||
| 1537 | Ga0207643_10097731 | |||
| 1538 | Ga0207705_10255787 | |||
| 1539 | Ga0207684_10001275 | |||
| 1540 | Ga0207684_10018088 | |||
| 1541 | Ga0207684_10081331 | |||
| 1542 | Ga0207684_10178688 | |||
| 1543 | Ga0207654_10002582 | |||
| 1544 | Ga0207654_10014318 | |||
| 1545 | Ga0207654_10056155 | |||
| 1546 | Ga0207654_10110051 | |||
| 1547 | Ga0207654_10123841 | |||
| 1548 | Ga0207654_10255190 | |||
| 1549 | Ga0207707_10000828 | |||
| 1550 | Ga0207707_10038831 | |||
| 1551 | Ga0207707_10081955 | |||
| 1552 | Ga0207707_10099151 | |||
| 1553 | Ga0207707_10220174 | |||
| 1554 | Ga0207695_10043656 | |||
| 1555 | Ga0207695_10077718 | |||
| 1556 | Ga0207695_10171125 | |||
| 1557 | Ga0207695_10271718 | |||
| 1558 | Ga0207695_10323787 | |||
| 1559 | Ga0207695_10711846 | |||
| 1560 | Ga0207671_10055720 | |||
| 1561 | Ga0207671_10070131 | |||
| 1562 | Ga0207671_10131435 | |||
| 1563 | Ga0207671_10156068 | |||
| 1564 | Ga0207671_10464186 | |||
| 1565 | Ga0207693_10000090 | |||
| 1566 | Ga0207693_10000173 | |||
| 1567 | Ga0207693_10000621 | |||
| 1568 | Ga0207693_10013135 | |||
| 1569 | Ga0207693_10037643 | |||
| 1570 | Ga0207693_10107683 | |||
| 1571 | Ga0207663_10003822 | |||
| 1572 | Ga0207663_10033068 | |||
| 1573 | Ga0207663_10034666 | |||
| 1574 | Ga0207663_10149945 | |||
| 1575 | Ga0207663_10489488 | |||
| 1576 | Ga0207660_10185955 | |||
| 1577 | Ga0207662_10001688 | |||
| 1578 | Ga0207657_10005643 | |||
| 1579 | Ga0207657_10007963 | |||
| 1580 | Ga0207657_10008288 | |||
| 1581 | Ga0207649_10000343 | |||
| 1582 | Ga0207652_10076233 | |||
| 1583 | Ga0207652_10120800 | |||
| 1584 | Ga0207646_10002760 | |||
| 1585 | Ga0207646_10007451 | |||
| 1586 | Ga0207646_10039981 | |||
| 1587 | Ga0207646_10103730 | |||
| 1588 | Ga0207681_10020312 | |||
| 1589 | Ga0207694_10000430 | |||
| 1590 | Ga0207694_10043179 | |||
| 1591 | Ga0207694_10089601 | |||
| 1592 | Ga0207694_10287710 | |||
| 1593 | Ga0207650_10000223 | |||
| 1594 | Ga0207650_10000224 | |||
| 1595 | Ga0207650_10000296 | |||
| 1596 | Ga0207650_10001691 | |||
| 1597 | Ga0207650_10289026 | |||
| 1598 | Ga0207659_10470005 | |||
| 1599 | Ga0207687_10017030 | |||
| 1600 | Ga0207687_10058417 | |||
| 1601 | Ga0207687_10173184 | |||
| 1602 | Ga0207687_10385996 | |||
| 1603 | Ga0207700_10002203 | |||
| 1604 | Ga0207700_10072614 | |||
| 1605 | Ga0207700_10073782 | |||
| 1606 | Ga0207700_10105374 | |||
| 1607 | Ga0207700_10180398 | |||
| 1608 | Ga0207700_10255170 | |||
| 1609 | Ga0207700_10287849 | |||
| 1610 | Ga0207700_10298476 | |||
| 1611 | Ga0207700_10331157 | |||
| 1612 | Ga0207700_10359701 | |||
| 1613 | Ga0207700_10360539 | |||
| 1614 | Ga0207700_10405700 | |||
| 1615 | Ga0207700_10650271 | |||
| 1616 | Ga0207664_10002844 | |||
| 1617 | Ga0207664_10011335 | |||
| 1618 | Ga0207664_10241814 | |||
| 1619 | Ga0207644_10007871 | |||
| 1620 | Ga0207644_10108673 | |||
| 1621 | Ga0207690_10033784 | |||
| 1622 | Ga0207690_10317592 | |||
| 1623 | Ga0207690_10358566 | |||
| 1624 | Ga0207706_10000613 | |||
| 1625 | Ga0207706_10001122 | |||
| 1626 | Ga0207706_10015847 | |||
| 1627 | Ga0207686_10126583 | |||
| 1628 | Ga0207670_10181872 | |||
| 1629 | Ga0207670_10320786 | |||
| 1630 | Ga0207704_10054816 | |||
| 1631 | Ga0207704_10080675 | |||
| 1632 | Ga0207704_10494860 | |||
| 1633 | Ga0207665_10000182 | |||
| 1634 | Ga0207665_10047330 | |||
| 1635 | Ga0207665_10048693 | |||
| 1636 | Ga0207665_10083112 | |||
| 1637 | Ga0207665_10112332 | |||
| 1638 | Ga0207665_10235785 | |||
| 1639 | Ga0207691_10000345 | |||
| 1640 | Ga0207691_10296071 | |||
| 1641 | Ga0207711_10002524 | |||
| 1642 | Ga0207711_10125650 | |||
| 1643 | Ga0207711_10248782 | |||
| 1644 | Ga0207689_10000499 | |||
| 1645 | Ga0207689_10001621 | |||
| 1646 | Ga0207689_10063023 | |||
| 1647 | Ga0207661_10001212 | |||
| 1648 | Ga0207661_10161297 | |||
| 1649 | Ga0207679_10000115 | |||
| 1650 | Ga0207679_10001482 | |||
| 1651 | Ga0207667_10000311 | |||
| 1652 | Ga0207667_10005374 | |||
| 1653 | Ga0207667_10028850 | |||
| 1654 | Ga0207667_10113360 | |||
| 1655 | Ga0207667_10142497 | |||
| 1656 | Ga0207667_10537447 | |||
| 1657 | Ga0207667_10723811 | |||
| 1658 | Ga0207667_10964156 | |||
| 1659 | Ga0207651_10003483 | |||
| 1660 | Ga0207712_10051568 | |||
| 1661 | Ga0207668_10052646 | |||
| 1662 | Ga0207668_10103914 | |||
| 1663 | Ga0207640_10003104 | |||
| 1664 | Ga0207640_10007732 | |||
| 1665 | Ga0207640_10030028 | |||
| 1666 | Ga0207640_10159412 | |||
| 1667 | Ga0207640_10363623 | |||
| 1668 | Ga0207640_10505528 | |||
| 1669 | Ga0207658_10007316 | |||
| 1670 | Ga0207658_10393707 | |||
| 1671 | Ga0207677_10002452 | |||
| 1672 | Ga0207677_10017631 | |||
| 1673 | Ga0207677_10053564 | |||
| 1674 | Ga0207677_10055683 | |||
| 1675 | Ga0207677_10569747 | |||
| 1676 | Ga0207677_10593511 | |||
| 1677 | Ga0207703_10001667 | |||
| 1678 | Ga0207703_10006667 | |||
| 1679 | Ga0207703_10067935 | |||
| 1680 | Ga0207703_10365821 | |||
| 1681 | Ga0207703_10712240 | |||
| 1682 | Ga0207639_10092099 | |||
| 1683 | Ga0207639_10154627 | |||
| 1684 | Ga0207639_11077881 | |||
| 1685 | Ga0207678_10000130 | |||
| 1686 | Ga0207678_10000950 | |||
| 1687 | Ga0207708_10246065 | |||
| 1688 | Ga0207708_10375804 | |||
| 1689 | Ga0207702_10000722 | |||
| 1690 | Ga0207702_10001654 | |||
| 1691 | Ga0207702_10002343 | |||
| 1692 | Ga0207702_10002543 | |||
| 1693 | Ga0207702_10019837 | |||
| 1694 | Ga0207702_10070027 | |||
| 1695 | Ga0207702_10070347 | |||
| 1696 | Ga0207702_10097251 | |||
| 1697 | Ga0207702_10176331 | |||
| 1698 | Ga0207702_10184663 | |||
| 1699 | Ga0207702_10196100 | |||
| 1700 | Ga0207702_10839055 | |||
| 1701 | Ga0207641_10000287 | |||
| 1702 | Ga0207641_10001947 | |||
| 1703 | Ga0207641_10002584 | |||
| 1704 | Ga0207641_10031067 | |||
| 1705 | Ga0207641_10040850 | |||
| 1706 | Ga0207641_10111882 | |||
| 1707 | Ga0207641_10141200 | |||
| 1708 | Ga0207641_10305177 | |||
| 1709 | Ga0207648_10001253 | |||
| 1710 | Ga0207648_10159247 | |||
| 1711 | Ga0207648_10371630 | |||
| 1712 | Ga0207676_10000115 | |||
| 1713 | Ga0207676_10003051 | |||
| 1714 | Ga0207676_10035713 | |||
| 1715 | Ga0207676_10412252 | |||
| 1716 | Ga0207674_10000788 | |||
| 1717 | Ga0207674_10001340 | |||
| 1718 | Ga0207674_10007893 | |||
| 1719 | Ga0207674_10013852 | |||
| 1720 | Ga0207674_10487679 | |||
| 1721 | Ga0207674_10586096 | |||
| 1722 | Ga0207675_100083379 | |||
| 1723 | Ga0207683_10000217 | |||
| 1724 | Ga0207683_10291083 | |||
| 1725 | Ga0207698_10101020 | |||
| 1726 | Ga0207698_10149736 | |||
| 1727 | Ga0207698_10199580 | |||
| 1728 | Ga0207698_10447055 | |||
| 1729 | Ga0209179_1043846 | |||
| 1730 | Ga0209588_1016400 | |||
| 1731 | Ga0209588_1070111 | |||
| 1732 | Ga0265356_1000344 | |||
| 1733 | Ga0268266_10000761 | |||
| 1734 | Ga0268265_10073055 | |||
| 1735 | Ga0268265_10296460 | |||
| 1736 | Ga0268264_10000241 | |||
| 1737 | Ga0268264_10004971 | |||
| 1738 | Ga0268264_10044778 | |||
| 1739 | Ga0268264_10046056 | |||
| 1740 | Ga0268264_10257370 | |||
| 1741 | Ga0265338_10001801 | |||
| 1742 | Ga0265338_10010396 | |||
| 1743 | Ga0265338_10080138 | |||
| 1744 | Ga0265338_10132286 | |||
| 1745 | Ga0265338_10241360 | |||
| 1746 | Ga0265338_10274634 | |||
| 1747 | Ga0265762_1004236 | |||
| 1748 | Ga0265762_1006001 | |||
| 1749 | Ga0265762_1015555 | |||
| 1750 | Ga0265762_1025991 | |||
| 1751 | Ga0265760_10000242 | |||
| 1752 | Ga0265760_10003610 | |||
| 1753 | Ga0265760_10005419 | |||
| 1754 | Ga0265760_10007787 | |||
| 1755 | Ga0265760_10017742 | |||
| 1756 | Ga0265760_10018276 | |||
| 1757 | Ga0265760_10058968 | |||
| 1758 | Ga0265330_10036864 | |||
| 1759 | Ga0265332_10071679 | |||
| 1760 | Ga0265325_10014097 | |||
| 1761 | Ga0265325_10015495 | |||
| 1762 | Ga0265325_10045920 | |||
| 1763 | Ga0265340_10149411 | |||
| 1764 | Ga0265339_10014422 | |||
| 1765 | Ga0265339_10051746 | |||
| 1766 | Ga0265339_10092440 | |||
| 1767 | Ga0265331_10094211 | |||
| 1768 | Ga0265327_10032180 | |||
| 1769 | Ga0265316_10019053 | |||
| 1770 | Ga0265316_10043022 | |||
| 1771 | Ga0265316_10450132 | |||
| 1772 | Ga0265313_10014628 | |||
| 1773 | Ga0265314_10009028 | |||
| 1774 | Ga0265314_10108988 | |||
| 1775 | Ga0265314_10119534 | |||
| 1776 | Ga0265342_10112470 | |||
| 1777 | Ga0307416_101059012 | |||
| 1778 | Ga0316214_1005106 | |||
| 1779 | Ga0316212_1006527 | |||
| 1780 | Ga0373926_0004598 | |||
| 1781 | Ga0373926_0005361 | |||
| 1782 | Ga0373928_0042513 | |||
| 1783 | Ga0373929_0020694 | |||
| 1784 | Ga0373944_0049754 | |||
| 1785 | Ga0373936_0004614 | |||
| 1786 | Ga0373936_0063311 | |||
| 1787 | Ga0373939_0046714 | |||
| 1788 | Ga0373941_0019085 | |||
| 1789 | Ga0373945_0082064 | |||
| 1790 | Ga0373954_0192457 | |||
| 1791 | Ga0373956_0121472 | |||
| 1792 | Ga0373957_0086822 | |||
| 1793 | Ga0373943_0052087 | |||
| 1794 | Ga0373943_0054311 | |||
| 1795 | Ga0373943_0067392 | |||
| 1796 | Ga0373943_0209225 | |||
| 1797 | Ga0373943_0298164 | |||
| 1798 | Ga0373943_0302457 | |||
| 1799 | Ga0373946_0004259 | |||
| 1800 | Ga0373946_0010395 | |||
| 1801 | Ga0373955_0042548 | |||
| 1802 | Ga0373955_0163829 | |||
| 1803 | Ga0373931_0052084 | |||
| 1804 | Ga0373931_0247997 | |||
| 1805 | Ga0373931_0309897 | |||
| 1806 | Ga0373935_0033631 | |||
| 1807 | Ga0373935_0035710 | |||
| 1808 | Ga0373935_0079637 | |||
| 1809 | Ga0373935_0423944 | |||
| 1810 | Ga0373935_0696763 | |||
| 1811 | Ga0373927_0003975 | |||
| 1812 | Ga0373927_0015301 | |||
| 1813 | Ga0373927_0015335 | |||
| 1814 | Ga0373927_0054495 | |||
| 1815 | Ga0373927_0074146 | |||
| 1816 | Ga0373927_0124228 | |||
| 1817 | Ga0373933_0040395 | |||
| 1818 | Ga0373933_0046243 | |||
| 1819 | Ga0373933_0308046 | |||
| 1820 | Ga0373947_0001902 | |||
| 1821 | Ga0373947_0001950 | |||
| 1822 | Ga0373947_0046121 | |||
| 1823 | Ga0373947_0097458 | |||
| 1824 | Ga0373947_0336867 | |||
| 1825 | Ga0373947_0339554 | |||
| 1826 | Ga0373937_0018254 | |||
| 1827 | Ga0373937_0094316 | |||
| 1828 | Ga0373937_0406085 | |||
| 1829 | Ga0373937_0893321 | |||
| 1830 | Ga0373937_0922139 | |||
| 1831 | Ga0373925_0000165 | |||
| 1832 | Ga0373925_0017686 | |||
| 1833 | Ga0373925_0018110 | |||
| 1834 | Ga0373925_0023470 | |||
| 1835 | Ga0373925_0054200 | |||
| 1836 | Ga0373925_0282884 | |||
| 1837 | Ga0395905_0000096 | |||
| 1838 | Ga0436364_1137452 | |||
| 1839 | Ga0400490_03194 | |||
| 1840 | Ga0400486_20280 | |||
| 1841 | Ga0436365_1849740 | |||
| 1842 | Ga0436363_0684377 | |||
| 1843 | Ga0436363_1603702 | |||
| 1844 | Ga0436363_1709607 | |||
| 1845 | Ga0436362_1117608 | |||
| 1846 | Ga0451577_0003762 | |||
| 1847 | Ga0451577_0064248 | |||
| 1848 | Ga0451577_0407021 | |||
| 1849 | Ga0453683_0004979 | |||
| 1850 | Ga0453683_0005490 | |||
| 1851 | Ga0453683_0251834 | |||
| 1852 | Ga0453684_0000377 | |||
| 1853 | Ga0453684_0005849 | |||
| 1854 | Ga0453684_0018504 | |||
| 1855 | Ga0453684_0061085 | |||
| 1856 | Ga0453684_0096456 | |||
| 1857 | Ga0466957_0000410 | |||
| 1858 | Ga0451576_0000033 | |||
| 1859 | Ga0451576_0018916 | |||
| 1860 | Ga0451576_0165440 | |||
| 1861 | Ga0451576_0220067 | |||
| 1862 | Ga0451576_0273153 | |||
| 1863 | Ga0451576_0301499 | |||
| 1864 | Ga0451576_0635259 | |||
| 1865 | Ga0451576_1312526 | |||
| 1866 | Ga0466967_0119894 | |||
| 1867 | Ga0495592_0052355 | |||
| 1868 | Ga0495603_0004371 | |||
| 1869 | Ga0495629_0020122 | |||
| 1870 | Ga0495629_0088319 | |||
| 1871 | Ga0495651_0014952 | |||
| 1872 | Ga0495653_0019126 | |||
| 1873 | Ga0495580_0000074 | |||
| 1874 | Ga0495580_0000337 | |||
| 1875 | Ga0495580_0005142 | |||
| 1876 | Ga0495580_0014509 | |||
| 1877 | Ga0495580_0033054 | |||
| 1878 | Ga0495580_0053725 | |||
| 1879 | Ga0495580_0067428 | |||
| 1880 | Ga0495580_0081143 | |||
| 1881 | Ga0495580_0108116 | |||
| 1882 | Ga0495580_0149657 | |||
| 1883 | Ga0495580_0195440 | |||
| 1884 | Ga0495580_0208472 | |||
| 1885 | Ga0495580_0323642 | |||
| 1886 | Ga0495580_0348395 | |||
| 1887 | Ga0495582_0005452 | |||
| 1888 | Ga0495582_0009992 | |||
| 1889 | Ga0495582_0022220 | |||
| 1890 | Ga0495639_0071872 | |||
| 1891 | Ga0495664_0010014 | |||
| 1892 | Ga0495664_0023289 | |||
| 1893 | Ga0495584_0000002 | |||
| 1894 | Ga0495594_0007103 | |||
| 1895 | Ga0495594_0149616 | |||
| 1896 | Ga0495608_0015944 | |||
| 1897 | Ga0495608_0148646 | |||
| 1898 | Ga0495618_0014035 | |||
| 1899 | Ga0495628_0000167 | |||
| 1900 | Ga0495628_0049805 | |||
| 1901 | Ga0495630_0087969 | |||
| 1902 | Ga0495630_0093306 | |||
| 1903 | Ga0495630_0131284 | |||
| 1904 | Ga0495630_0133671 | |||
| 1905 | Ga0495666_0027633 | |||
| 1906 | Ga0495666_0106709 | |||
| 1907 | Ga0495652_0001713 | |||
| 1908 | Ga0495652_0088019 | |||
| 1909 | Ga0495665_0001072 | |||
| 1910 | Ga0495665_0025425 | |||
| 1911 | Ga0495665_0039056 | |||
| 1912 | Ga0495665_0084143 | |||
| 1913 | Ga0495665_0144780 | |||
| 1914 | Ga0495640_0027205 | |||
| 1915 | Ga0495640_0057591 | |||
| 1916 | Ga0495640_0245598 | |||
| 1917 | Ga0495586_0012586 | |||
| 1918 | Ga0495586_0058509 | |||
| 1919 | Ga0495586_0271800 | |||
| 1920 | Ga0495587_0003037 | |||
| 1921 | Ga0495587_0069491 | |||
| 1922 | Ga0495645_0006650 | |||
| 1923 | Ga0495645_0007683 | |||
| 1924 | Ga0495645_0079896 | |||
| 1925 | Ga0495622_0159709 | |||
| 1926 | Ga0495667_0027483 | |||
| 1927 | Ga0495667_0216771 | |||
| 1928 | Ga0495634_0025416 | |||
| 1929 | Ga0495634_0069864 | |||
| 1930 | Ga0495657_0009233 | |||
| 1931 | Ga0495623_0011515 | |||
| 1932 | Ga0495623_0377775 | |||
| 1933 | Ga0495647_0014408 | |||
| 1934 | Ga0495658_0158287 | |||
| 1935 | Ga0495669_0053711 | |||
| 1936 | Ga0495613_0317024 | |||
| 1937 | Ga0495624_0081571 | |||
| 1938 | Ga0495600_0043489 | |||
| 1939 | Ga0495600_0103323 | |||
| 1940 | Ga0495581_0059356 | |||
| 1941 | Ga0495581_0324868 | |||
| 1942 | Ga0495604_0003790 | |||
| 1943 | Ga0495604_0076018 | |||
| 1944 | Ga0495636_0023394 | |||
| 1945 | Ga0495674_0013194 | |||
| 1946 | Ga0495674_0051869 | |||
| 1947 | Ga0495674_0139998 | |||
| 1948 | Ga0495674_0283446 | |||
| 1949 | Ga0495674_0315998 | |||
| 1950 | Ga0495676_0259262 | |||
| 1951 | Ga0495680_0001348 | |||
| 1952 | Ga0495680_0010330 | |||
| 1953 | Ga0495675_0000202 | |||
| 1954 | Ga0495675_0053586 | |||
| 1955 | Ga0495675_0240589 | |||
| 1956 | Ga0495684_0012098 | |||
| 1957 | Ga0495684_0022085 | |||
| 1958 | Ga0495684_0493365 | |||
| 1959 | Ga0495593_0080671 | |||
| 1960 | Ga0495593_0174034 | |||
| 1961 | Ga0495593_0271292 | |||
| 1962 | Ga0495602_0022805 | |||
| 1963 | Ga0496100_0114330 | |||
| 1964 | Ga0496100_0232842 | |||
| 1965 | Ga0496101_0143438 | |||
| 1966 | Ga0496101_0360541 | |||
| 1967 | Ga0496101_0369488 | |||
| 1968 | Ga0496101_0389535 | |||
| 1969 | Ga0496101_0563666 | |||
| 1970 | Ga0496102_0006673 | |||
| 1971 | Ga0496102_0021353 | |||
| 1972 | Ga0496102_0058632 | |||
| 1973 | Ga0496102_0078406 | |||
| 1974 | Ga0496102_0343567 | |||
| 1975 | Ga0496102_0588681 | |||
| 1976 | Ga0496102_1071373 | |||
| 1977 | Ga0496103_0014594 | |||
| 1978 | Ga0496103_0336809 | |||
| 1979 | Ga0496103_0342546 | |||
| 1980 | Ga0496104_0000074 | |||
| 1981 | Ga0496104_0024442 | |||
| 1982 | Ga0496104_0125291 | |||
| 1983 | Ga0496104_0317220 | |||
| 1984 | Ga0496104_0325422 | |||
| 1985 | Ga0496104_0630881 | |||
| 1986 | Ga0496106_0031581 | |||
| 1987 | Ga0496106_0166006 | |||
| 1988 | Ga0496107_0056921 | |||
| 1989 | Ga0496107_0307304 | |||
| 1990 | Ga0496108_0000325 | |||
| 1991 | Ga0496109_0000117 | |||
| 1992 | Ga0496109_0306029 | |||
| 1993 | Ga0496109_0736047 | |||
| 1994 | Ga0496110_0002628 | |||
| 1995 | Ga0496110_0061618 | |||
| 1996 | Ga0496111_0004540 | |||
| 1997 | Ga0496112_0000283 | |||
| 1998 | Ga0496112_0001864 | |||
| 1999 | Ga0496112_0076452 | |||
| 2000 | Ga0496112_0143818 | |||
| 2001 | Ga0496112_0168771 | |||
| 2002 | Ga0496112_0531873 | |||
| 2003 | Ga0496113_0000504 | |||
| 2004 | Ga0496113_0036419 | |||
| 2005 | Ga0496113_0435657 | |||
| 2006 | Ga0496113_0538124 | |||
| 2007 | Ga0496114_0146119 | |||
| 2008 | Ga0496114_0155073 | |||
| 2009 | Ga0496115_0006382 | |||
| 2010 | Ga0496115_0010817 | |||
| 2011 | Ga0496115_0251515 | |||
| 2012 | Ga0496115_0600636 | |||
| 2013 | Ga0496126_0000095 | |||
| 2014 | Ga0501040_0138574 | |||
| 2015 | nmdc:mga09592_61422_c1 | |||
| 2016 | nmdc:mga0qj67_207052_c1 | |||
| 2017 | nmdc:mga0n895_6139_c1 | |||
| 2018 | nmdc:mga0n895_8844_c1 | |||
| 2019 | nmdc:mga0n895_988254_c1 | |||
| 2020 | nmdc:mga0rr50_119696_c1 | |||
| 2021 | nmdc:mga0rr50_22666_c1 | |||
| 2022 | nmdc:mga0rr50_251177_c1 | |||
| 2023 | nmdc:mga0rr50_88981_c1 | |||
| 2024 | nmdc:mga08x19_119477_c1 | |||
| 2025 | nmdc:mga08x19_575_c1 | |||
| 2026 | nmdc:mga08x19_59017_c2 | |||
| 2027 | nmdc:mga08x19_6689_c1 | |||
| 2028 | nmdc:mga0a205_937_c1 | |||
| 2029 | Ga0501084_0268223 | |||
| 2030 | 2644236120 | |||
| 2031 | 2887377990 | |||
| 2032 | 646812225 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
71
266
0.85
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.9295 | 4 | 210 |
| 2onk-assembly2.cif.gz_I | abc transporter modbc in complex with its binding protein moda | 0.8968 | 2 | 214 |
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.841 | 3 | 210 |
| 3d31-assembly1.cif.gz_C | modbc from methanosarcina acetivorans | 0.8351 | 4 | 210 |
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.835 | 4 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVX5_4_220_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9727 | 4 | 218 | 1.10.3720.10 |
| af_Q2FVX5_4_220_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9596 | 4 | 218 | 1.10.3720.10 |
| af_P0AF01_2_224_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9595 | 2 | 217 | 1.10.3720.10 |
| af_P9WG13_10_255_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.953 | 4 | 210 | 1.10.3720.10 |
| af_P0AEB0_20_277_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9452 | 4 | 214 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537QC36-F1-model_v4 | Molybdenum transport system permease | 0.9973 | 1 | 216 |
GO:0005886
GO:0015098 |
| AF-A0A848VX28-F1-model_v4 | Molybdenum transport system permease | 0.9936 | 1 | 215 |
GO:0005886
GO:0015098 |
| AF-A0A2W0A0E5-F1-model_v4 | Molybdenum transport system permease | 0.9901 | 1 | 189 |
GO:0005886
GO:0015098 |
| AF-A0A7Y4WE71-F1-model_v4 | Molybdenum transport system permease | 0.9892 | 1 | 216 |
GO:0005886
GO:0015098 |
| AF-A0A840I4S3-F1-model_v4 | Molybdenum transport system permease | 0.989 | 2 | 215 |
GO:0005886
GO:0015098 |