F488253

General Info

Members Datasets Scaffolds Average Seq Length
1016 327 2032 227

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10516524|Ga0070717_105165242
Length 271
Sequence VPHPSFALLRKRVGNLTFCKPAASTLFPRDFSTFPHCCYHSCATRMAIDWQTFRLTLELAFTVSVMLLALGLPIAYWIAFSRWRWRFLVEAFVALPIVLPPTVLGFYVLVALGPRSPLGRWWISLTGHTLAFTFTGLVVGSILYSLPFAVQPFASAFLAVDRKLIAASATLGASPFRTFRTVTVPLSVSGIVTGIALSFAHTMGEFGVVLMVGGNIPGITRTVSIDIYDRVQSSDYAGANQTALILLFICFALLALVYGLNRRAALMDAWK

Samples

Sample ID Description Type Environment
1 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
131 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
132 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
133 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
134 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
215 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
218 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
219 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
223 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
226 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
227 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
230 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
231 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
234 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
235 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
236 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
237 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
238 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
239 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
240 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
247 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
248 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
252 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
253 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
273 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
283 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
293 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
294 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
295 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
296 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
307 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
308 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
309 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
310 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
311 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
312 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
313 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
314 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
315 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
316 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
317 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 2643221642 Caulobacter sp. Root343 Isolate Unclassified
326 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
327 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 1.08
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 4.92
Rhizosphere 93.5
Stem 0
Stem Tuber 0
Unclassified 10.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070717_10516524 3300006028 Bacteria 1080
2 MBSR1b_contig_201130 2162886012 Bacteria 5475
3 MBSR1b_contig_3160416 2162886012 Bacteria 6945
4 LJNas_1000129 3300000546 Bacteria 11792
5 JGI24752J21851_1006373 3300001976 Unclassified 1542
6 JGI24740J21852_10097993 3300001979 Unclassified 749
7 JGI24737J22298_10034298 3300001990 Unclassified 1573
8 JGI24743J22301_10007079 3300001991 Bacteria 1935
9 JGI24034J26672_10000570 3300002239 Bacteria 4702
10 JGI24742J22300_10036682 3300002244 Unclassified 866
11 JGI24751J29686_10023255 3300002459 Unclassified 1285
12 rootH1_10066128 3300003323 Bacteria 5407
13 Ga0065712_10082264 3300005290 Unclassified 2931
14 Ga0065715_10004441 3300005293 Bacteria 7976
15 Ga0065715_10203251 3300005293 Bacteria 1350
16 Ga0065707_10164984 3300005295 Unclassified 1530
17 Ga0070658_10012517 3300005327 Bacteria 6806
18 Ga0070658_10172599 3300005327 Bacteria 1817
19 Ga0070676_10032029 3300005328 Bacteria 3009
20 Ga0070676_10092810 3300005328 Bacteria 1852
21 Ga0070683_100000180 3300005329 Bacteria 41854
22 Ga0070683_100184739 3300005329 Bacteria 1979
23 Ga0070683_100567660 3300005329 Bacteria 1085
24 Ga0070690_100198034 3300005330 Bacteria 1396
25 Ga0070670_100001706 3300005331 Bacteria 17892
26 Ga0070670_100155017 3300005331 Bacteria 1983
27 Ga0070670_100391214 3300005331 Bacteria 1226
28 Ga0068869_100002390 3300005334 Bacteria 11306
29 Ga0068869_100014353 3300005334 Bacteria 5289
30 Ga0070666_10040208 3300005335 Bacteria 3120
31 Ga0070666_10087335 3300005335 Bacteria 2137
32 Ga0070680_100163322 3300005336 Bacteria 1872
33 Ga0070680_100201821 3300005336 Bacteria 1677
34 Ga0070680_100240366 3300005336 Bacteria 1531
35 Ga0070682_100047195 3300005337 Bacteria 2677
36 Ga0070682_100108040 3300005337 Unclassified 1849
37 Ga0068868_100002943 3300005338 Bacteria 11818
38 Ga0068868_100006066 3300005338 Bacteria 8533
39 Ga0068868_100019802 3300005338 Bacteria 5048
40 Ga0068868_100051856 3300005338 Bacteria 3229
41 Ga0068868_100261589 3300005338 Bacteria 1459
42 Ga0070660_100016682 3300005339 Bacteria 5338
43 Ga0070660_100240181 3300005339 Unclassified 1475
44 Ga0070660_100522864 3300005339 Bacteria 988
45 Ga0070689_100016928 3300005340 Bacteria 5344
46 Ga0070689_100170285 3300005340 Bacteria 1764
47 Ga0070687_100023249 3300005343 Bacteria 2944
48 Ga0070661_100000886 3300005344 Bacteria 21512
49 Ga0070661_100226734 3300005344 Bacteria 1435
50 Ga0070692_10463847 3300005345 Unclassified 813
51 Ga0070668_100013446 3300005347 Bacteria 6110
52 Ga0070669_100016274 3300005353 Bacteria 5305
53 Ga0070669_100095707 3300005353 Bacteria 2233
54 Ga0070675_100003414 3300005354 Bacteria 12028
55 Ga0070675_100507415 3300005354 Bacteria 1087
56 Ga0070671_100024798 3300005355 Bacteria 4913
57 Ga0070671_100032659 3300005355 Bacteria 4301
58 Ga0070671_100224112 3300005355 Unclassified 1595
59 Ga0070674_100008141 3300005356 Bacteria 6219
60 Ga0070674_100129520 3300005356 Bacteria 1879
61 Ga0070673_100106371 3300005364 Bacteria 2319
62 Ga0070673_100128982 3300005364 Bacteria 2119
63 Ga0070688_100001337 3300005365 Bacteria 12230
64 Ga0070659_100055418 3300005366 Bacteria 3124
65 Ga0070659_100083237 3300005366 Bacteria 2557
66 Ga0070659_100233724 3300005366 Bacteria 1519
67 Ga0070667_100009483 3300005367 Bacteria 8075
68 Ga0070667_100093961 3300005367 Bacteria 2583
69 Ga0070709_10015131 3300005434 Bacteria 4383
70 Ga0070709_10038441 3300005434 Bacteria 2930
71 Ga0070709_10057013 3300005434 Bacteria 2473
72 Ga0070709_10084591 3300005434 Bacteria 2078
73 Ga0070709_10147207 3300005434 Bacteria 1624
74 Ga0070709_10170516 3300005434 Bacteria 1520
75 Ga0070709_10170725 3300005434 Bacteria 1519
76 Ga0070709_10257488 3300005434 Bacteria 1259
77 Ga0070709_10667144 3300005434 Bacteria 806
78 Ga0070714_100001114 3300005435 Bacteria 19295
79 Ga0070714_100016666 3300005435 Bacteria 5939
80 Ga0070714_100224122 3300005435 Bacteria 1729
81 Ga0070713_100000543 3300005436 Bacteria 23927
82 Ga0070713_100002121 3300005436 Bacteria 12836
83 Ga0070713_100029017 3300005436 Bacteria 4375
84 Ga0070713_100037336 3300005436 Bacteria 3927
85 Ga0070713_100040170 3300005436 Unclassified 3803
86 Ga0070713_100084638 3300005436 Bacteria 2714
87 Ga0070713_100148407 3300005436 Bacteria 2083
88 Ga0070713_100204515 3300005436 Bacteria 1785
89 Ga0070713_100277423 3300005436 Bacteria 1537
90 Ga0070713_100309252 3300005436 Bacteria 1457
91 Ga0070713_100365107 3300005436 Bacteria 1342
92 Ga0070713_100505909 3300005436 Unclassified 1140
93 Ga0070710_10002568 3300005437 Bacteria 8621
94 Ga0070710_10220647 3300005437 Bacteria 1206
95 Ga0070701_10017180 3300005438 Unclassified 3378
96 Ga0070711_100000478 3300005439 Bacteria 20826
97 Ga0070711_100015078 3300005439 Bacteria 4884
98 Ga0070711_100176790 3300005439 Bacteria 1631
99 Ga0070711_100188148 3300005439 Bacteria 1585
100 Ga0070711_100279643 3300005439 Bacteria 1320
101 Ga0070711_100569782 3300005439 Bacteria 941
102 Ga0070711_100590184 3300005439 Bacteria 926
103 Ga0070711_100742228 3300005439 Bacteria 829
104 Ga0070705_100062843 3300005440 Bacteria 2212
105 Ga0070700_100312578 3300005441 Unclassified 1151
106 Ga0070694_100041259 3300005444 Bacteria 3078
107 Ga0070708_100000527 3300005445 Bacteria 28842
108 Ga0070708_100001078 3300005445 Bacteria 20858
109 Ga0070708_100003900 3300005445 Bacteria 11706
110 Ga0070708_100013160 3300005445 Bacteria 6769
111 Ga0070708_100035100 3300005445 Unclassified 4367
112 Ga0070708_100055104 3300005445 Bacteria 3535
113 Ga0070708_100066072 3300005445 Bacteria 3245
114 Ga0070708_100114938 3300005445 Bacteria 2477
115 Ga0070708_100206787 3300005445 Bacteria 1839
116 Ga0070708_100357972 3300005445 Bacteria 1375
117 Ga0070663_100032756 3300005455 Unclassified 3585
118 Ga0070663_100589773 3300005455 Unclassified 933
119 Ga0070678_100355225 3300005456 Bacteria 1261
120 Ga0070662_100005079 3300005457 Bacteria 8381
121 Ga0070662_100225056 3300005457 Unclassified 1498
122 Ga0070681_10000513 3300005458 Bacteria 31715
123 Ga0070681_10001443 3300005458 Bacteria 20931
124 Ga0070681_10047505 3300005458 Bacteria 4291
125 Ga0070681_10071265 3300005458 Bacteria 3440
126 Ga0070681_10231014 3300005458 Bacteria 1764
127 Ga0068867_100016708 3300005459 Bacteria 5214
128 Ga0068867_100053195 3300005459 Bacteria 2990
129 Ga0068867_100428822 3300005459 Bacteria 1122
130 Ga0070685_10001585 3300005466 Bacteria 12002
131 Ga0070685_10238101 3300005466 Bacteria 1200
132 Ga0070706_100000257 3300005467 Bacteria 64534
133 Ga0070706_100000991 3300005467 Bacteria 30868
134 Ga0070706_100094200 3300005467 Bacteria 2779
135 Ga0070706_100113003 3300005467 Bacteria 2529
136 Ga0070706_100204128 3300005467 Bacteria 1846
137 Ga0070707_100001774 3300005468 Bacteria 20733
138 Ga0070707_100062473 3300005468 Bacteria 3573
139 Ga0070707_100072935 3300005468 Bacteria 3310
140 Ga0070707_100535678 3300005468 Bacteria 1133
141 Ga0070707_100569754 3300005468 Bacteria 1095
142 Ga0070698_100000182 3300005471 Bacteria 59279
143 Ga0070698_100012583 3300005471 Bacteria 8959
144 Ga0070698_100389727 3300005471 Bacteria 1326
145 Ga0070698_100791264 3300005471 Bacteria 892
146 Ga0070699_100088406 3300005518 Bacteria 2706
147 Ga0070699_100209163 3300005518 Bacteria 1736
148 Ga0070699_100290372 3300005518 Bacteria 1466
149 Ga0070679_100008087 3300005530 Bacteria 9887
150 Ga0070679_100054487 3300005530 Bacteria 3982
151 Ga0070679_100151665 3300005530 Bacteria 2294
152 Ga0070679_100301683 3300005530 Bacteria 1552
153 Ga0070684_100007581 3300005535 Bacteria 8452
154 Ga0070684_100017780 3300005535 Bacteria 5842
155 Ga0070684_100034929 3300005535 Unclassified 4301
156 Ga0070684_100089161 3300005535 Bacteria 2741
157 Ga0070684_100100259 3300005535 Bacteria 2586
158 Ga0070684_100338931 3300005535 Unclassified 1382
159 Ga0070697_100001487 3300005536 Bacteria 17834
160 Ga0070697_100004056 3300005536 Bacteria 11237
161 Ga0070697_100008463 3300005536 Bacteria 8027
162 Ga0070697_100085791 3300005536 Bacteria 2597
163 Ga0070697_100131291 3300005536 Unclassified 2101
164 Ga0070697_100238772 3300005536 Bacteria 1551
165 Ga0070697_100506852 3300005536 Bacteria 1055
166 Ga0068853_100005004 3300005539 Bacteria 10328
167 Ga0068853_100065061 3300005539 Bacteria 3163
168 Ga0068853_100083675 3300005539 Bacteria 2796
169 Ga0068853_100111845 3300005539 Bacteria 2427
170 Ga0068853_100254637 3300005539 Bacteria 1612
171 Ga0070672_100133123 3300005543 Unclassified 2045
172 Ga0070672_100381838 3300005543 Bacteria 1205
173 Ga0070686_100011657 3300005544 Bacteria 4993
174 Ga0070686_100036014 3300005544 Bacteria 3060
175 Ga0070696_100033625 3300005546 Bacteria 3524
176 Ga0070693_100038251 3300005547 Bacteria 2680
177 Ga0070693_100159312 3300005547 Bacteria 1436
178 Ga0070693_100465557 3300005547 Unclassified 890
179 Ga0070665_100146087 3300005548 Bacteria 2368
180 Ga0068855_100000412 3300005563 Bacteria 52997
181 Ga0068855_100000425 3300005563 Bacteria 52146
182 Ga0068855_100018276 3300005563 Bacteria 8420
183 Ga0068855_100062777 3300005563 Bacteria 4336
184 Ga0068855_100106448 3300005563 Bacteria 3223
185 Ga0068855_100947328 3300005563 Bacteria 907
186 Ga0070664_100005786 3300005564 Bacteria 9974
187 Ga0070664_100047341 3300005564 Bacteria 3632
188 Ga0070664_100082144 3300005564 Bacteria 2778
189 Ga0068857_100002572 3300005577 Bacteria 14860
190 Ga0068857_100003408 3300005577 Bacteria 13246
191 Ga0068857_100005929 3300005577 Bacteria 10432
192 Ga0068857_100372991 3300005577 Unclassified 1324
193 Ga0068857_100574953 3300005577 Bacteria 1063
194 Ga0068854_100003492 3300005578 Bacteria 9822
195 Ga0068854_100004475 3300005578 Bacteria 8814
196 Ga0068854_100014550 3300005578 Bacteria 5191
197 Ga0068854_100020751 3300005578 Bacteria 4452
198 Ga0068856_100000670 3300005614 Bacteria 37158
199 Ga0068856_100000708 3300005614 Bacteria 36263
200 Ga0068856_100001577 3300005614 Bacteria 23871
201 Ga0068856_100003544 3300005614 Bacteria 15716
202 Ga0068856_100006243 3300005614 Bacteria 11695
203 Ga0068856_100009111 3300005614 Bacteria 9649
204 Ga0068856_100066387 3300005614 Bacteria 3565
205 Ga0068856_100079175 3300005614 Bacteria 3259
206 Ga0068856_100118901 3300005614 Bacteria 2643
207 Ga0068856_100198992 3300005614 Bacteria 2018
208 Ga0068856_100245198 3300005614 Bacteria 1807
209 Ga0068856_100350195 3300005614 Unclassified 1495
210 Ga0070702_100004396 3300005615 Bacteria 6431
211 Ga0070702_100082649 3300005615 Bacteria 1927
212 Ga0068852_100002637 3300005616 Bacteria 12389
213 Ga0068852_100104839 3300005616 Bacteria 2560
214 Ga0068852_100107391 3300005616 Bacteria 2532
215 Ga0068852_100282013 3300005616 Bacteria 1602
216 Ga0068852_100318137 3300005616 Bacteria 1510
217 Ga0068859_100000279 3300005617 Bacteria 50882
218 Ga0068859_100015855 3300005617 Bacteria 7572
219 Ga0068859_100114376 3300005617 Bacteria 2762
220 Ga0068859_100277541 3300005617 Unclassified 1768
221 Ga0068864_100000722 3300005618 Bacteria 27599
222 Ga0068864_100015807 3300005618 Bacteria 6279
223 Ga0068864_100046245 3300005618 Bacteria 3734
224 Ga0068866_10001418 3300005718 Bacteria 10276
225 Ga0068866_10005261 3300005718 Bacteria 5333
226 Ga0068866_10008503 3300005718 Bacteria 4330
227 Ga0068866_10408602 3300005718 Bacteria 878
228 Ga0068861_100051927 3300005719 Unclassified 3114
229 Ga0068861_100175545 3300005719 Bacteria 1779
230 Ga0068861_100392952 3300005719 Bacteria 1229
231 Ga0068851_10001381 3300005834 Bacteria 10595
232 Ga0068851_10015362 3300005834 Bacteria 3647
233 Ga0068851_10253493 3300005834 Unclassified 999
234 Ga0068870_10003763 3300005840 Bacteria 6454
235 Ga0068870_10056296 3300005840 Bacteria 2098
236 Ga0068870_10072395 3300005840 Bacteria 1883
237 Ga0068863_100002208 3300005841 Bacteria 19334
238 Ga0068863_100005729 3300005841 Bacteria 12193
239 Ga0068863_100015579 3300005841 Bacteria 7305
240 Ga0068863_100070921 3300005841 Bacteria 3296
241 Ga0068863_100155975 3300005841 Bacteria 2186
242 Ga0068863_100184605 3300005841 Unclassified 2003
243 Ga0068863_100290982 3300005841 Bacteria 1583
244 Ga0068858_100002272 3300005842 Bacteria 19444
245 Ga0068858_100033976 3300005842 Bacteria 4731
246 Ga0068858_100152304 3300005842 Bacteria 2174
247 Ga0068858_100189865 3300005842 Bacteria 1941
248 Ga0068858_100236897 3300005842 Bacteria 1731
249 Ga0068858_100399579 3300005842 Bacteria 1320
250 Ga0068860_100000202 3300005843 Bacteria 94520
251 Ga0068860_100007256 3300005843 Bacteria 11086
252 Ga0068860_100059449 3300005843 Bacteria 3633
253 Ga0068860_100323717 3300005843 Bacteria 1513
254 Ga0068862_100048413 3300005844 Bacteria 3629
255 Ga0068862_100151358 3300005844 Unclassified 2065
256 Ga0068862_100276330 3300005844 Bacteria 1538
257 Ga0081540_1025691 3300005983 Bacteria 3382
258 Ga0070717_10000577 3300006028 Bacteria 23420
259 Ga0070717_10002339 3300006028 Bacteria 13349
260 Ga0070717_10003511 3300006028 Bacteria 11227
261 Ga0070717_10036520 3300006028 Bacteria 3985
262 Ga0070717_10055045 3300006028 Bacteria 3282
263 Ga0070717_10094410 3300006028 Bacteria 2530
264 Ga0070717_10101727 3300006028 Bacteria 2441
265 Ga0070717_10115354 3300006028 Bacteria 2295
266 Ga0070717_10198558 3300006028 Bacteria 1756
267 Ga0070717_10206549 3300006028 Bacteria 1722
268 Ga0070717_10300122 3300006028 Bacteria 1428
269 Ga0070717_10446116 3300006028 Bacteria 1166
270 Ga0070717_10562457 3300006028 Bacteria 1033
271 Ga0070717_10627222 3300006028 Bacteria 975
272 Ga0070715_10037645 3300006163 Bacteria 2003
273 Ga0070715_10042767 3300006163 Bacteria 1906
274 Ga0070715_10099905 3300006163 Bacteria 1351
275 Ga0070715_10122984 3300006163 Bacteria 1239
276 Ga0070716_100005911 3300006173 Bacteria 5955
277 Ga0070716_100028903 3300006173 Bacteria 2992
278 Ga0070716_100135159 3300006173 Bacteria 1565
279 Ga0070716_100155304 3300006173 Bacteria 1477
280 Ga0070716_100240696 3300006173 Bacteria 1227
281 Ga0070716_100380072 3300006173 Bacteria 1009
282 Ga0070716_100432041 3300006173 Unclassified 955
283 Ga0070712_100000948 3300006175 Bacteria 17440
284 Ga0070712_100002033 3300006175 Bacteria 12399
285 Ga0070712_100003822 3300006175 Bacteria 9275
286 Ga0070712_100014441 3300006175 Bacteria 5069
287 Ga0070712_100437864 3300006175 Bacteria 1086
288 Ga0070712_100752610 3300006175 Unclassified 834
289 Ga0097621_100000210 3300006237 Bacteria 38363
290 Ga0097621_100000598 3300006237 Bacteria 25444
291 Ga0097621_100001848 3300006237 Bacteria 14513
292 Ga0097621_100005957 3300006237 Bacteria 8615
293 Ga0097621_100006416 3300006237 Bacteria 8349
294 Ga0097621_100030212 3300006237 Bacteria 4287
295 Ga0097621_100049532 3300006237 Bacteria 3413
296 Ga0097621_100149672 3300006237 Bacteria 2001
297 Ga0097621_100569956 3300006237 Bacteria 1032
298 Ga0097621_100639759 3300006237 Unclassified 975
299 Ga0068871_100000168 3300006358 Bacteria 43632
300 Ga0068871_100000745 3300006358 Bacteria 22042
301 Ga0068871_100000787 3300006358 Bacteria 21292
302 Ga0068871_100009189 3300006358 Bacteria 7148
303 Ga0068871_100022428 3300006358 Unclassified 4866
304 Ga0068871_100025233 3300006358 Bacteria 4621
305 Ga0068871_100046525 3300006358 Bacteria 3495
306 Ga0068871_100092083 3300006358 Bacteria 2528
307 Ga0068871_100170830 3300006358 Bacteria 1863
308 Ga0068871_100339426 3300006358 Bacteria 1326
309 Ga0068871_100515283 3300006358 Bacteria 1079
310 Ga0068871_100878048 3300006358 Bacteria 830
311 Ga0075430_100064546 3300006846 Bacteria 3076
312 Ga0075433_10005922 3300006852 Bacteria 9624
313 Ga0075434_100000246 3300006871 Bacteria 37977
314 Ga0075434_100046235 3300006871 Bacteria 4320
315 Ga0075434_100225606 3300006871 Bacteria 1893
316 Ga0075434_100261670 3300006871 Bacteria 1749
317 Ga0075429_100112538 3300006880 Bacteria 2379
318 Ga0068865_100004430 3300006881 Bacteria 8464
319 Ga0068865_100005649 3300006881 Bacteria 7593
320 Ga0068865_100059134 3300006881 Bacteria 2680
321 Ga0068865_100076875 3300006881 Bacteria 2384
322 Ga0075436_100009403 3300006914 Bacteria 6682
323 Ga0075436_100052786 3300006914 Bacteria 2806
324 Ga0097620_100000279 3300006931 Bacteria 50882
325 Ga0097620_100015855 3300006931 Bacteria 7572
326 Ga0097620_100114372 3300006931 Bacteria 2762
327 Ga0097620_100277530 3300006931 Unclassified 1768
328 Ga0075435_100003413 3300007076 Bacteria 10775
329 Ga0099794_10013220 3300007265 Bacteria 3587
330 Ga0099794_10027987 3300007265 Bacteria 2618
331 Ga0099794_10032987 3300007265 Bacteria 2433
332 Ga0099794_10070247 3300007265 Bacteria 1714
333 Ga0099794_10312516 3300007265 Bacteria 814
334 Ga0105250_10023835 3300009092 Bacteria 2467
335 Ga0105240_10069762 3300009093 Bacteria 4349
336 Ga0105240_10126859 3300009093 Bacteria 3065
337 Ga0105240_10133132 3300009093 Bacteria 2979
338 Ga0105240_10142711 3300009093 Bacteria 2862
339 Ga0105240_10180234 3300009093 Bacteria 2493
340 Ga0105240_10198550 3300009093 Bacteria 2353
341 Ga0105240_10234012 3300009093 Bacteria 2133
342 Ga0105240_10255657 3300009093 Bacteria 2023
343 Ga0105240_10379745 3300009093 Bacteria 1596
344 Ga0111539_10296716 3300009094 Unclassified 1881
345 Ga0105245_10005402 3300009098 Bacteria 11229
346 Ga0105245_10006763 3300009098 Bacteria 10055
347 Ga0105245_10040838 3300009098 Bacteria 4134
348 Ga0105245_10056423 3300009098 Unclassified 3530
349 Ga0105245_10102519 3300009098 Bacteria 2650
350 Ga0105247_10009853 3300009101 Bacteria 5790
351 Ga0105247_10023440 3300009101 Bacteria 3719
352 Ga0105247_10025376 3300009101 Bacteria 3574
353 Ga0105247_10043865 3300009101 Bacteria 2741
354 Ga0105247_10287524 3300009101 Bacteria 1136
355 Ga0114129_10069552 3300009147 Bacteria 4907
356 Ga0105241_10003965 3300009174 Bacteria 10942
357 Ga0105241_10009776 3300009174 Bacteria 7049
358 Ga0105241_10014319 3300009174 Bacteria 5807
359 Ga0105241_10014699 3300009174 Bacteria 5729
360 Ga0105241_10080020 3300009174 Bacteria 2556
361 Ga0105241_10122744 3300009174 Bacteria 2094
362 Ga0105241_10184639 3300009174 Bacteria 1732
363 Ga0105241_10417172 3300009174 Unclassified 1180
364 Ga0105242_10067475 3300009176 Bacteria 2957
365 Ga0105242_10093037 3300009176 Bacteria 2541
366 Ga0105242_10296485 3300009176 Bacteria 1474
367 Ga0105242_10329709 3300009176 Unclassified 1403
368 Ga0105248_10019962 3300009177 Bacteria 7419
369 Ga0105248_10075041 3300009177 Bacteria 3800
370 Ga0105248_10111193 3300009177 Unclassified 3090
371 Ga0105248_10279014 3300009177 Bacteria 1881
372 Ga0105248_10498440 3300009177 Bacteria 1373
373 Ga0105248_10703549 3300009177 Unclassified 1140
374 Ga0105237_10050649 3300009545 Bacteria 4172
375 Ga0105237_10052099 3300009545 Bacteria 4109
376 Ga0105237_10166347 3300009545 Bacteria 2204
377 Ga0105237_10252481 3300009545 Bacteria 1766
378 Ga0105237_10336095 3300009545 Bacteria 1515
379 Ga0105238_10000382 3300009551 Bacteria 47455
380 Ga0105238_10038278 3300009551 Bacteria 4870
381 Ga0105238_10056428 3300009551 Bacteria 3940
382 Ga0105238_10195615 3300009551 Unclassified 1998
383 Ga0105238_10509822 3300009551 Bacteria 1205
384 Ga0105249_10002069 3300009553 Bacteria 17385
385 Ga0105249_10005159 3300009553 Bacteria 11268
386 Ga0105249_10027251 3300009553 Bacteria 5156
387 Ga0099796_10089984 3300010159 Bacteria 1139
388 Ga0105239_10008900 3300010375 Bacteria 11363
389 Ga0105239_10025445 3300010375 Bacteria 6517
390 Ga0105239_10071895 3300010375 Bacteria 3801
391 Ga0105239_10252226 3300010375 Bacteria 1982
392 Ga0105239_10276784 3300010375 Bacteria 1889
393 Ga0105239_10328075 3300010375 Bacteria 1726
394 Ga0105239_10586432 3300010375 Unclassified 1271
395 Ga0105239_10601201 3300010375 Bacteria 1255
396 Ga0105246_10005905 3300011119 Bacteria 7467
397 Ga0105246_10052960 3300011119 Bacteria 2791
398 Ga0157373_10001551 3300013100 Bacteria 17528
399 Ga0157373_10002773 3300013100 Bacteria 13254
400 Ga0157373_10037161 3300013100 Bacteria 3492
401 Ga0157371_10002011 3300013102 Bacteria 20094
402 Ga0157371_10004936 3300013102 Bacteria 11459
403 Ga0157371_10091878 3300013102 Bacteria 2150
404 Ga0157370_10013342 3300013104 Bacteria 8464
405 Ga0157370_10041226 3300013104 Bacteria 4456
406 Ga0157370_10041413 3300013104 Bacteria 4444
407 Ga0157370_10262601 3300013104 Bacteria 1596
408 Ga0157370_10386571 3300013104 Bacteria 1289
409 Ga0157370_10460855 3300013104 Unclassified 1168
410 Ga0157369_10000269 3300013105 Bacteria 69979
411 Ga0157369_10005474 3300013105 Bacteria 14757
412 Ga0157369_10006683 3300013105 Bacteria 13322
413 Ga0157369_10007966 3300013105 Bacteria 12173
414 Ga0157369_10011776 3300013105 Bacteria 9932
415 Ga0157369_10032265 3300013105 Bacteria 5761
416 Ga0157369_10091948 3300013105 Bacteria 3238
417 Ga0157369_10252497 3300013105 Bacteria 1840
418 Ga0157374_10000436 3300013296 Bacteria 37798
419 Ga0157374_10001029 3300013296 Bacteria 24206
420 Ga0157374_10001822 3300013296 Bacteria 17965
421 Ga0157374_10013417 3300013296 Bacteria 7152
422 Ga0157374_10034779 3300013296 Bacteria 4606
423 Ga0157374_10050314 3300013296 Bacteria 3873
424 Ga0157374_10079255 3300013296 Bacteria 3112
425 Ga0157374_10198645 3300013296 Bacteria 1963
426 Ga0157374_10223184 3300013296 Bacteria 1850
427 Ga0157374_10269873 3300013296 Bacteria 1677
428 Ga0157374_10278228 3300013296 Bacteria 1652
429 Ga0157374_10386565 3300013296 Bacteria 1394
430 Ga0157378_10000014 3300013297 Bacteria 144214
431 Ga0157378_10000344 3300013297 Bacteria 45774
432 Ga0157378_10000413 3300013297 Bacteria 42040
433 Ga0157378_10001268 3300013297 Bacteria 22736
434 Ga0157378_10007193 3300013297 Bacteria 9723
435 Ga0157378_10047597 3300013297 Bacteria 3813
436 Ga0157378_10084794 3300013297 Unclassified 2869
437 Ga0157378_10115437 3300013297 Bacteria 2467
438 Ga0157378_10206337 3300013297 Bacteria 1861
439 Ga0157378_10220523 3300013297 Bacteria 1803
440 Ga0163162_10002239 3300013306 Bacteria 18167
441 Ga0163162_10004542 3300013306 Bacteria 13372
442 Ga0163162_10011418 3300013306 Bacteria 8661
443 Ga0163162_10048955 3300013306 Bacteria 4235
444 Ga0163162_10092562 3300013306 Bacteria 3107
445 Ga0163162_10370132 3300013306 Bacteria 1566
446 Ga0163162_10505475 3300013306 Bacteria 1339
447 Ga0163162_11105459 3300013306 Unclassified 898
448 Ga0157372_10000423 3300013307 Bacteria 46475
449 Ga0157372_10000641 3300013307 Bacteria 38393
450 Ga0157372_10002544 3300013307 Bacteria 19779
451 Ga0157372_10004039 3300013307 Bacteria 15735
452 Ga0157372_10005138 3300013307 Bacteria 13911
453 Ga0157372_10015715 3300013307 Bacteria 8117
454 Ga0157372_10016602 3300013307 Bacteria 7900
455 Ga0157372_10022824 3300013307 Bacteria 6775
456 Ga0157372_10036431 3300013307 Bacteria 5422
457 Ga0157372_10062666 3300013307 Bacteria 4167
458 Ga0157372_10166041 3300013307 Bacteria 2553
459 Ga0157372_10198939 3300013307 Bacteria 2321
460 Ga0157375_10035816 3300013308 Bacteria 4742
461 Ga0157375_10044150 3300013308 Bacteria 4327
462 Ga0163163_10026605 3300014325 Bacteria 5533
463 Ga0163163_10027299 3300014325 Bacteria 5467
464 Ga0163163_10093541 3300014325 Bacteria 3023
465 Ga0163163_10096265 3300014325 Bacteria 2980
466 Ga0163163_10113779 3300014325 Unclassified 2736
467 Ga0163163_10386177 3300014325 Bacteria 1458
468 Ga0182008_10001531 3300014497 Bacteria 15380
469 Ga0182008_10009750 3300014497 Bacteria 5169
470 Ga0157377_10023683 3300014745 Bacteria 3257
471 Ga0157377_10166543 3300014745 Bacteria 1375
472 Ga0157377_10438598 3300014745 Unclassified 899
473 Ga0157379_10007798 3300014968 Bacteria 9271
474 Ga0157379_10010844 3300014968 Bacteria 7948
475 Ga0157379_10031809 3300014968 Bacteria 4701
476 Ga0157379_10035204 3300014968 Bacteria 4464
477 Ga0157379_10291860 3300014968 Unclassified 1485
478 Ga0157376_10014425 3300014969 Bacteria 5933
479 Ga0157376_10031198 3300014969 Bacteria 4265
480 Ga0157376_10045515 3300014969 Bacteria 3613
481 Ga0157376_10071439 3300014969 Bacteria 2950
482 Ga0157376_10083990 3300014969 Bacteria 2741
483 Ga0157376_10139774 3300014969 Bacteria 2171
484 Ga0157376_10232048 3300014969 Bacteria 1715
485 Ga0182007_10014472 3300015262 Bacteria 2973
486 Ga0224570_100631 3300022730 Bacteria 2797
487 Ga0224569_100133 3300022732 Bacteria 5518
488 Ga0224572_1000066 3300024225 Bacteria 7223
489 Ga0224572_1001114 3300024225 Bacteria 3797
490 Ga0224572_1009514 3300024225 Bacteria 1814
491 Ga0224572_1009608 3300024225 Bacteria 1807
492 Ga0228598_1001112 3300024227 Bacteria 5938
493 Ga0228598_1017099 3300024227 Bacteria 1430
494 Ga0209437_102112 3300025233 Bacteria 4015
495 Ga0209233_1007680 3300025261 Bacteria 3397
496 Ga0209050_1041325 3300025298 Bacteria 1273
497 Ga0207697_10002788 3300025315 Bacteria 8904
498 Ga0207656_10130194 3300025321 Unclassified 1178
499 Ga0207692_10010221 3300025898 Bacteria 3947
500 Ga0207642_10002117 3300025899 Bacteria 6143
501 Ga0207642_10014622 3300025899 Bacteria 2901
502 Ga0207710_10059340 3300025900 Bacteria 1732
503 Ga0207710_10085390 3300025900 Unclassified 1470
504 Ga0207688_10019381 3300025901 Unclassified 3705
505 Ga0207680_10010712 3300025903 Bacteria 4599
506 Ga0207680_10044690 3300025903 Bacteria 2607
507 Ga0207680_10330027 3300025903 Unclassified 1068
508 Ga0207647_10001477 3300025904 Bacteria 18059
509 Ga0207647_10006683 3300025904 Bacteria 8379
510 Ga0207647_10022413 3300025904 Bacteria 4195
511 Ga0207685_10072896 3300025905 Bacteria 1397
512 Ga0207699_10000815 3300025906 Bacteria 14849
513 Ga0207699_10018440 3300025906 Bacteria 3698
514 Ga0207699_10058663 3300025906 Bacteria 2303
515 Ga0207699_10095528 3300025906 Bacteria 1875
516 Ga0207699_10108927 3300025906 Bacteria 1772
517 Ga0207699_10373471 3300025906 Bacteria 1011
518 Ga0207645_10000181 3300025907 Bacteria 50200
519 Ga0207645_10007872 3300025907 Bacteria 7493
520 Ga0207643_10000474 3300025908 Bacteria 25980
521 Ga0207643_10097731 3300025908 Unclassified 1719
522 Ga0207705_10255787 3300025909 Bacteria 1336
523 Ga0207684_10001275 3300025910 Bacteria 27799
524 Ga0207684_10018088 3300025910 Bacteria 6039
525 Ga0207684_10081331 3300025910 Bacteria 2756
526 Ga0207684_10178688 3300025910 Bacteria 1830
527 Ga0207654_10002582 3300025911 Bacteria 9192
528 Ga0207654_10014318 3300025911 Bacteria 4097
529 Ga0207654_10056155 3300025911 Bacteria 2283
530 Ga0207654_10110051 3300025911 Bacteria 1713
531 Ga0207654_10123841 3300025911 Bacteria 1627
532 Ga0207654_10255190 3300025911 Unclassified 1177
533 Ga0207707_10000828 3300025912 Bacteria 30353
534 Ga0207707_10038831 3300025912 Bacteria 4161
535 Ga0207707_10081955 3300025912 Bacteria 2816
536 Ga0207707_10099151 3300025912 Bacteria 2547
537 Ga0207707_10220174 3300025912 Bacteria 1652
538 Ga0207695_10043656 3300025913 Bacteria 4777
539 Ga0207695_10077718 3300025913 Unclassified 3370
540 Ga0207695_10171125 3300025913 Bacteria 2098
541 Ga0207695_10271718 3300025913 Bacteria 1590
542 Ga0207695_10323787 3300025913 Bacteria 1431
543 Ga0207695_10711846 3300025913 Bacteria 884
544 Ga0207671_10055720 3300025914 Bacteria 2929
545 Ga0207671_10070131 3300025914 Bacteria 2612
546 Ga0207671_10131435 3300025914 Bacteria 1922
547 Ga0207671_10156068 3300025914 Bacteria 1765
548 Ga0207671_10464186 3300025914 Unclassified 1009
549 Ga0207693_10000090 3300025915 Bacteria 81069
550 Ga0207693_10000173 3300025915 Bacteria 58862
551 Ga0207693_10000621 3300025915 Bacteria 31746
552 Ga0207693_10013135 3300025915 Bacteria 6680
553 Ga0207693_10037643 3300025915 Bacteria 3813
554 Ga0207693_10107683 3300025915 Bacteria 2186
555 Ga0207663_10003822 3300025916 Bacteria 7435
556 Ga0207663_10033068 3300025916 Bacteria 3077
557 Ga0207663_10034666 3300025916 Bacteria 3021
558 Ga0207663_10149945 3300025916 Bacteria 1635
559 Ga0207663_10489488 3300025916 Bacteria 954
560 Ga0207660_10185955 3300025917 Bacteria 1616
561 Ga0207662_10001688 3300025918 Bacteria 10806
562 Ga0207657_10005643 3300025919 Bacteria 13060
563 Ga0207657_10007963 3300025919 Bacteria 10807
564 Ga0207657_10008288 3300025919 Bacteria 10575
565 Ga0207649_10000343 3300025920 Bacteria 35195
566 Ga0207652_10076233 3300025921 Bacteria 2924
567 Ga0207652_10120800 3300025921 Bacteria 2331
568 Ga0207646_10002760 3300025922 Bacteria 20509
569 Ga0207646_10007451 3300025922 Bacteria 11120
570 Ga0207646_10039981 3300025922 Bacteria 4220
571 Ga0207646_10103730 3300025922 Bacteria 2550
572 Ga0207681_10020312 3300025923 Bacteria 4206
573 Ga0207694_10000430 3300025924 Bacteria 39056
574 Ga0207694_10043179 3300025924 Bacteria 3479
575 Ga0207694_10089601 3300025924 Bacteria 2426
576 Ga0207694_10287710 3300025924 Bacteria 1351
577 Ga0207650_10000223 3300025925 Bacteria 64087
578 Ga0207650_10000224 3300025925 Bacteria 63557
579 Ga0207650_10000296 3300025925 Bacteria 50068
580 Ga0207650_10001691 3300025925 Bacteria 15671
581 Ga0207650_10289026 3300025925 Bacteria 1336
582 Ga0207659_10470005 3300025926 Unclassified 1061
583 Ga0207687_10017030 3300025927 Bacteria 4778
584 Ga0207687_10058417 3300025927 Bacteria 2714
585 Ga0207687_10173184 3300025927 Bacteria 1666
586 Ga0207687_10385996 3300025927 Bacteria 1148
587 Ga0207700_10002203 3300025928 Bacteria 11180
588 Ga0207700_10072614 3300025928 Bacteria 2654
589 Ga0207700_10073782 3300025928 Bacteria 2636
590 Ga0207700_10105374 3300025928 Bacteria 2258
591 Ga0207700_10180398 3300025928 Bacteria 1768
592 Ga0207700_10255170 3300025928 Bacteria 1499
593 Ga0207700_10287849 3300025928 Bacteria 1415
594 Ga0207700_10298476 3300025928 Bacteria 1390
595 Ga0207700_10331157 3300025928 Unclassified 1322
596 Ga0207700_10359701 3300025928 Bacteria 1269
597 Ga0207700_10360539 3300025928 Bacteria 1267
598 Ga0207700_10405700 3300025928 Unclassified 1195
599 Ga0207700_10650271 3300025928 Unclassified 940
600 Ga0207664_10002844 3300025929 Bacteria 11490
601 Ga0207664_10011335 3300025929 Bacteria 6328
602 Ga0207664_10241814 3300025929 Bacteria 1572
603 Ga0207644_10007871 3300025931 Bacteria 6964
604 Ga0207644_10108673 3300025931 Unclassified 2094
605 Ga0207690_10033784 3300025932 Bacteria 3291
606 Ga0207690_10317592 3300025932 Unclassified 1223
607 Ga0207690_10358566 3300025932 Bacteria 1154
608 Ga0207706_10000613 3300025933 Bacteria 37863
609 Ga0207706_10001122 3300025933 Bacteria 27226
610 Ga0207706_10015847 3300025933 Bacteria 6816
611 Ga0207686_10126583 3300025934 Bacteria 1747
612 Ga0207670_10181872 3300025936 Unclassified 1584
613 Ga0207670_10320786 3300025936 Bacteria 1219
614 Ga0207704_10054816 3300025938 Bacteria 2433
615 Ga0207704_10080675 3300025938 Unclassified 2101
616 Ga0207704_10494860 3300025938 Bacteria 984
617 Ga0207665_10000182 3300025939 Bacteria 42287
618 Ga0207665_10047330 3300025939 Bacteria 2883
619 Ga0207665_10048693 3300025939 Bacteria 2846
620 Ga0207665_10083112 3300025939 Bacteria 2208
621 Ga0207665_10112332 3300025939 Unclassified 1916
622 Ga0207665_10235785 3300025939 Bacteria 1346
623 Ga0207691_10000345 3300025940 Bacteria 46775
624 Ga0207691_10296071 3300025940 Bacteria 1391
625 Ga0207711_10002524 3300025941 Bacteria 16302
626 Ga0207711_10125650 3300025941 Bacteria 2294
627 Ga0207711_10248782 3300025941 Bacteria 1632
628 Ga0207689_10000499 3300025942 Bacteria 37043
629 Ga0207689_10001621 3300025942 Bacteria 21315
630 Ga0207689_10063023 3300025942 Bacteria 3049
631 Ga0207661_10001212 3300025944 Bacteria 17237
632 Ga0207661_10161297 3300025944 Bacteria 1945
633 Ga0207679_10000115 3300025945 Bacteria 64466
634 Ga0207679_10001482 3300025945 Bacteria 14719
635 Ga0207667_10000311 3300025949 Bacteria 67671
636 Ga0207667_10005374 3300025949 Bacteria 15617
637 Ga0207667_10028850 3300025949 Bacteria 6025
638 Ga0207667_10113360 3300025949 Bacteria 2795
639 Ga0207667_10142497 3300025949 Bacteria 2468
640 Ga0207667_10537447 3300025949 Bacteria 1183
641 Ga0207667_10723811 3300025949 Unclassified 996
642 Ga0207667_10964156 3300025949 Bacteria 842
643 Ga0207651_10003483 3300025960 Bacteria 7733
644 Ga0207712_10051568 3300025961 Bacteria 2878
645 Ga0207668_10052646 3300025972 Bacteria 2817
646 Ga0207668_10103914 3300025972 Bacteria 2116
647 Ga0207640_10003104 3300025981 Bacteria 8931
648 Ga0207640_10007732 3300025981 Bacteria 5940
649 Ga0207640_10030028 3300025981 Bacteria 3344
650 Ga0207640_10159412 3300025981 Unclassified 1667
651 Ga0207640_10363623 3300025981 Unclassified 1167
652 Ga0207640_10505528 3300025981 Bacteria 1007
653 Ga0207658_10007316 3300025986 Bacteria 7530
654 Ga0207658_10393707 3300025986 Bacteria 1216
655 Ga0207677_10002452 3300026023 Bacteria 9745
656 Ga0207677_10017631 3300026023 Bacteria 4263
657 Ga0207677_10053564 3300026023 Bacteria 2747
658 Ga0207677_10055683 3300026023 Bacteria 2706
659 Ga0207677_10569747 3300026023 Bacteria 990
660 Ga0207677_10593511 3300026023 Bacteria 971
661 Ga0207703_10001667 3300026035 Bacteria 19971
662 Ga0207703_10006667 3300026035 Bacteria 9212
663 Ga0207703_10067935 3300026035 Bacteria 2935
664 Ga0207703_10365821 3300026035 Bacteria 1331
665 Ga0207703_10712240 3300026035 Bacteria 955
666 Ga0207639_10092099 3300026041 Bacteria 2429
667 Ga0207639_10154627 3300026041 Bacteria 1925
668 Ga0207639_11077881 3300026041 Unclassified 753
669 Ga0207678_10000130 3300026067 Bacteria 63279
670 Ga0207678_10000950 3300026067 Bacteria 26463
671 Ga0207708_10246065 3300026075 Bacteria 1440
672 Ga0207708_10375804 3300026075 Unclassified 1171
673 Ga0207702_10000722 3300026078 Bacteria 35418
674 Ga0207702_10001654 3300026078 Bacteria 22011
675 Ga0207702_10002343 3300026078 Bacteria 18095
676 Ga0207702_10002543 3300026078 Bacteria 17174
677 Ga0207702_10019837 3300026078 Bacteria 5568
678 Ga0207702_10070027 3300026078 Unclassified 3016
679 Ga0207702_10070347 3300026078 Bacteria 3009
680 Ga0207702_10097251 3300026078 Unclassified 2591
681 Ga0207702_10176331 3300026078 Bacteria 1965
682 Ga0207702_10184663 3300026078 Bacteria 1922
683 Ga0207702_10196100 3300026078 Bacteria 1869
684 Ga0207702_10839055 3300026078 Bacteria 909
685 Ga0207641_10000287 3300026088 Bacteria 63251
686 Ga0207641_10001947 3300026088 Bacteria 19809
687 Ga0207641_10002584 3300026088 Bacteria 16638
688 Ga0207641_10031067 3300026088 Bacteria 4428
689 Ga0207641_10040850 3300026088 Bacteria 3886
690 Ga0207641_10111882 3300026088 Unclassified 2422
691 Ga0207641_10141200 3300026088 Unclassified 2173
692 Ga0207641_10305177 3300026088 Bacteria 1505
693 Ga0207648_10001253 3300026089 Bacteria 28381
694 Ga0207648_10159247 3300026089 Bacteria 1994
695 Ga0207648_10371630 3300026089 Bacteria 1291
696 Ga0207676_10000115 3300026095 Bacteria 71633
697 Ga0207676_10003051 3300026095 Bacteria 11952
698 Ga0207676_10035713 3300026095 Bacteria 3775
699 Ga0207676_10412252 3300026095 Unclassified 1265
700 Ga0207674_10000788 3300026116 Bacteria 41336
701 Ga0207674_10001340 3300026116 Bacteria 31912
702 Ga0207674_10007893 3300026116 Bacteria 12363
703 Ga0207674_10013852 3300026116 Bacteria 8922
704 Ga0207674_10487679 3300026116 Unclassified 1191
705 Ga0207674_10586096 3300026116 Bacteria 1077
706 Ga0207675_100083379 3300026118 Bacteria 2998
707 Ga0207683_10000217 3300026121 Bacteria 50192
708 Ga0207683_10291083 3300026121 Unclassified 1493
709 Ga0207698_10101020 3300026142 Bacteria 2391
710 Ga0207698_10149736 3300026142 Bacteria 2023
711 Ga0207698_10199580 3300026142 Bacteria 1790
712 Ga0207698_10447055 3300026142 Bacteria 1247
713 Ga0209179_1043846 3300027512 Unclassified 947
714 Ga0209588_1016400 3300027671 Bacteria 2287
715 Ga0209588_1070111 3300027671 Bacteria 1132
716 Ga0265356_1000344 3300028017 Bacteria 8506
717 Ga0268266_10000761 3300028379 Bacteria 43122
718 Ga0268265_10073055 3300028380 Unclassified 2677
719 Ga0268265_10296460 3300028380 Bacteria 1454
720 Ga0268264_10000241 3300028381 Bacteria 103608
721 Ga0268264_10004971 3300028381 Bacteria 11265
722 Ga0268264_10044778 3300028381 Bacteria 3672
723 Ga0268264_10046056 3300028381 Bacteria 3622
724 Ga0268264_10257370 3300028381 Bacteria 1624
725 Ga0265338_10001801 3300028800 Bacteria 33703
726 Ga0265338_10010396 3300028800 Bacteria 10918
727 Ga0265338_10080138 3300028800 Bacteria 2744
728 Ga0265338_10132286 3300028800 Bacteria 1967
729 Ga0265338_10241360 3300028800 Bacteria 1338
730 Ga0265338_10274634 3300028800 Bacteria 1234
731 Ga0265762_1004236 3300030760 Bacteria 2573
732 Ga0265762_1006001 3300030760 Bacteria 2177
733 Ga0265762_1015555 3300030760 Bacteria 1377
734 Ga0265762_1025991 3300030760 Unclassified 1094
735 Ga0265760_10000242 3300031090 Bacteria 14932
736 Ga0265760_10003610 3300031090 Bacteria 4490
737 Ga0265760_10005419 3300031090 Bacteria 3662
738 Ga0265760_10007787 3300031090 Bacteria 3061
739 Ga0265760_10017742 3300031090 Bacteria 2045
740 Ga0265760_10018276 3300031090 Bacteria 2017
741 Ga0265760_10058968 3300031090 Bacteria 1164
742 Ga0265330_10036864 3300031235 Bacteria 2178
743 Ga0265332_10071679 3300031238 Bacteria 1475
744 Ga0265325_10014097 3300031241 Bacteria 4528
745 Ga0265325_10015495 3300031241 Bacteria 4285
746 Ga0265325_10045920 3300031241 Bacteria 2268
747 Ga0265340_10149411 3300031247 Bacteria 1065
748 Ga0265339_10014422 3300031249 Bacteria 4761
749 Ga0265339_10051746 3300031249 Bacteria 2240
750 Ga0265339_10092440 3300031249 Bacteria 1584
751 Ga0265331_10094211 3300031250 Bacteria 1383
752 Ga0265327_10032180 3300031251 Bacteria 2938
753 Ga0265316_10019053 3300031344 Bacteria 5881
754 Ga0265316_10043022 3300031344 Bacteria 3605
755 Ga0265316_10450132 3300031344 Bacteria 923
756 Ga0265313_10014628 3300031595 Bacteria 4625
757 Ga0265314_10009028 3300031711 Bacteria 8474
758 Ga0265314_10108988 3300031711 Bacteria 1763
759 Ga0265314_10119534 3300031711 Bacteria 1661
760 Ga0265342_10112470 3300031712 Bacteria 1540
761 Ga0307416_101059012 3300032002 Bacteria 915
762 Ga0316214_1005106 3300033545 Bacteria 1712
763 Ga0316212_1006527 3300033547 Bacteria 1690
764 Ga0373926_0004598 3300035083 Bacteria 4529
765 Ga0373926_0005361 3300035083 Bacteria 4223
766 Ga0373928_0042513 3300035084 Bacteria 1048
767 Ga0373929_0020694 3300035085 Bacteria 1328
768 Ga0373944_0049754 3300035089 Bacteria 1318
769 Ga0373936_0004614 3300035113 Bacteria 5214
770 Ga0373936_0063311 3300035113 Bacteria 1514
771 Ga0373939_0046714 3300035114 Bacteria 1327
772 Ga0373941_0019085 3300035115 Bacteria 1904
773 Ga0373945_0082064 3300035116 Bacteria 1237
774 Ga0373954_0192457 3300035118 Bacteria 1002
775 Ga0373956_0121472 3300035119 Unclassified 1220
776 Ga0373957_0086822 3300035120 Bacteria 1239
777 Ga0373943_0052087 3300035170 Bacteria 2017
778 Ga0373943_0054311 3300035170 Bacteria 1981
779 Ga0373943_0067392 3300035170 Bacteria 1805
780 Ga0373943_0209225 3300035170 Unclassified 1082
781 Ga0373943_0298164 3300035170 Bacteria 915
782 Ga0373943_0302457 3300035170 Bacteria 908
783 Ga0373946_0004259 3300035171 Bacteria 5113
784 Ga0373946_0010395 3300035171 Unclassified 3444
785 Ga0373955_0042548 3300035172 Bacteria 2439
786 Ga0373955_0163829 3300035172 Bacteria 1314
787 Ga0373931_0052084 3300035691 Bacteria 2181
788 Ga0373931_0247997 3300035691 Bacteria 1082
789 Ga0373931_0309897 3300035691 Bacteria 977
790 Ga0373935_0033631 3300035692 Bacteria 3192
791 Ga0373935_0035710 3300035692 Bacteria 3103
792 Ga0373935_0079637 3300035692 Bacteria 2127
793 Ga0373935_0423944 3300035692 Unclassified 958
794 Ga0373935_0696763 3300035692 Unclassified 747
795 Ga0373927_0003975 3300035695 Bacteria 10456
796 Ga0373927_0015301 3300035695 Bacteria 5067
797 Ga0373927_0015335 3300035695 Bacteria 5061
798 Ga0373927_0054495 3300035695 Bacteria 2587
799 Ga0373927_0074146 3300035695 Unclassified 2203
800 Ga0373927_0124228 3300035695 Bacteria 1685
801 Ga0373933_0040395 3300035724 Bacteria 2749
802 Ga0373933_0046243 3300035724 Bacteria 2583
803 Ga0373933_0308046 3300035724 Bacteria 1026
804 Ga0373947_0001902 3300035725 Bacteria 12757
805 Ga0373947_0001950 3300035725 Bacteria 12629
806 Ga0373947_0046121 3300035725 Bacteria 2609
807 Ga0373947_0097458 3300035725 Bacteria 1843
808 Ga0373947_0336867 3300035725 Bacteria 1010
809 Ga0373947_0339554 3300035725 Unclassified 1006
810 Ga0373937_0018254 3300036401 Bacteria 6262
811 Ga0373937_0094316 3300036401 Bacteria 2775
812 Ga0373937_0406085 3300036401 Bacteria 1292
813 Ga0373937_0893321 3300036401 Bacteria 837
814 Ga0373937_0922139 3300036401 Bacteria 822
815 Ga0373925_0000165 3300037068 Bacteria 71445
816 Ga0373925_0017686 3300037068 Bacteria 5172
817 Ga0373925_0018110 3300037068 Bacteria 5115
818 Ga0373925_0023470 3300037068 Bacteria 4500
819 Ga0373925_0054200 3300037068 Bacteria 2999
820 Ga0373925_0282884 3300037068 Bacteria 1336
821 Ga0395905_0000096 3300037471 Bacteria 146075
822 Ga0436364_1137452 3300037853 Bacteria 2214
823 Ga0400490_03194 3300038726 Bacteria 2424
824 Ga0400486_20280 3300038742 Bacteria 2381
825 Ga0436365_1849740 3300039437 Unclassified 1737
826 Ga0436363_0684377 3300039450 Plasmid 2896
827 Ga0436363_1603702 3300039450 Bacteria 883
828 Ga0436363_1709607 3300039450 Bacteria 1943
829 Ga0436362_1117608 3300039453 Unclassified 4645
830 Ga0451577_0003762 3300042876 Bacteria 16540
831 Ga0451577_0064248 3300042876 Bacteria 3273
832 Ga0451577_0407021 3300042876 Bacteria 1235
833 Ga0453683_0004979 3300044673 Bacteria 9332
834 Ga0453683_0005490 3300044673 Bacteria 8845
835 Ga0453683_0251834 3300044673 Bacteria 1126
836 Ga0453684_0000377 3300044712 Bacteria 183445
837 Ga0453684_0005849 3300044712 Bacteria 23912
838 Ga0453684_0018504 3300044712 Bacteria 10686
839 Ga0453684_0061085 3300044712 Bacteria 4840
840 Ga0453684_0096456 3300044712 Bacteria 3632
841 Ga0466957_0000410 3300044842 Bacteria 21005
842 Ga0451576_0000033 3300045051 Bacteria 393131
843 Ga0451576_0018916 3300045051 Bacteria 7528
844 Ga0451576_0165440 3300045051 Bacteria 2308
845 Ga0451576_0220067 3300045051 Bacteria 1982
846 Ga0451576_0273153 3300045051 Bacteria 1767
847 Ga0451576_0301499 3300045051 Bacteria 1676
848 Ga0451576_0635259 3300045051 Bacteria 1122
849 Ga0451576_1312526 3300045051 Bacteria 754
850 Ga0466967_0119894 3300045976 Unclassified 2429
851 Ga0495592_0052355 3300046454 Bacteria 3031
852 Ga0495603_0004371 3300046455 Bacteria 8425
853 Ga0495629_0020122 3300046459 Bacteria 4765
854 Ga0495629_0088319 3300046459 Bacteria 2162
855 Ga0495651_0014952 3300046462 Bacteria 5999
856 Ga0495653_0019126 3300046463 Bacteria 5557
857 Ga0495580_0000074 3300046472 Bacteria 62279
858 Ga0495580_0000337 3300046472 Bacteria 38443
859 Ga0495580_0005142 3300046472 Bacteria 10883
860 Ga0495580_0014509 3300046472 Bacteria 5974
861 Ga0495580_0033054 3300046472 Bacteria 3728
862 Ga0495580_0053725 3300046472 Bacteria 2842
863 Ga0495580_0067428 3300046472 Bacteria 2504
864 Ga0495580_0081143 3300046472 Unclassified 2261
865 Ga0495580_0108116 3300046472 Bacteria 1931
866 Ga0495580_0149657 3300046472 Bacteria 1617
867 Ga0495580_0195440 3300046472 Bacteria 1395
868 Ga0495580_0208472 3300046472 Bacteria 1345
869 Ga0495580_0323642 3300046472 Unclassified 1048
870 Ga0495580_0348395 3300046472 Bacteria 1004
871 Ga0495582_0005452 3300046473 Bacteria 7094
872 Ga0495582_0009992 3300046473 Bacteria 5223
873 Ga0495582_0022220 3300046473 Bacteria 3471
874 Ga0495639_0071872 3300046475 Bacteria 1599
875 Ga0495664_0010014 3300046477 Bacteria 5319
876 Ga0495664_0023289 3300046477 Unclassified 3594
877 Ga0495584_0000002 3300046491 Bacteria 512179
878 Ga0495594_0007103 3300046499 Bacteria 5760
879 Ga0495594_0149616 3300046499 Bacteria 1325
880 Ga0495608_0015944 3300046511 Bacteria 5202
881 Ga0495608_0148646 3300046511 Unclassified 1494
882 Ga0495618_0014035 3300046514 Bacteria 4877
883 Ga0495628_0000167 3300046516 Bacteria 57173
884 Ga0495628_0049805 3300046516 Bacteria 3316
885 Ga0495630_0087969 3300046517 Bacteria 2346
886 Ga0495630_0093306 3300046517 Bacteria 2275
887 Ga0495630_0131284 3300046517 Bacteria 1902
888 Ga0495630_0133671 3300046517 Bacteria 1884
889 Ga0495666_0027633 3300046526 Bacteria 2793
890 Ga0495666_0106709 3300046526 Bacteria 1317
891 Ga0495652_0001713 3300046529 Bacteria 23626
892 Ga0495652_0088019 3300046529 Bacteria 2546
893 Ga0495665_0001072 3300046531 Bacteria 14517
894 Ga0495665_0025425 3300046531 Bacteria 3181
895 Ga0495665_0039056 3300046531 Bacteria 2529
896 Ga0495665_0084143 3300046531 Unclassified 1672
897 Ga0495665_0144780 3300046531 Unclassified 1241
898 Ga0495640_0027205 3300046533 Bacteria 4127
899 Ga0495640_0057591 3300046533 Bacteria 2652
900 Ga0495640_0245598 3300046533 Bacteria 1122
901 Ga0495586_0012586 3300046535 Bacteria 4488
902 Ga0495586_0058509 3300046535 Bacteria 2093
903 Ga0495586_0271800 3300046535 Bacteria 969
904 Ga0495587_0003037 3300046536 Bacteria 11210
905 Ga0495587_0069491 3300046536 Bacteria 2051
906 Ga0495645_0006650 3300046543 Bacteria 8032
907 Ga0495645_0007683 3300046543 Bacteria 7501
908 Ga0495645_0079896 3300046543 Bacteria 2348
909 Ga0495622_0159709 3300046557 Bacteria 1017
910 Ga0495667_0027483 3300046559 Bacteria 3834
911 Ga0495667_0216771 3300046559 Bacteria 1222
912 Ga0495634_0025416 3300046642 Bacteria 4143
913 Ga0495634_0069864 3300046642 Bacteria 2316
914 Ga0495657_0009233 3300046675 Bacteria 7483
915 Ga0495623_0011515 3300046679 Bacteria 5724
916 Ga0495623_0377775 3300046679 Bacteria 767
917 Ga0495647_0014408 3300046681 Unclassified 2755
918 Ga0495658_0158287 3300046683 Bacteria 1395
919 Ga0495669_0053711 3300046684 Bacteria 1812
920 Ga0495613_0317024 3300046689 Bacteria 1077
921 Ga0495624_0081571 3300046690 Bacteria 2003
922 Ga0495600_0043489 3300046809 Bacteria 2930
923 Ga0495600_0103323 3300046809 Bacteria 1857
924 Ga0495581_0059356 3300047315 Unclassified 2210
925 Ga0495581_0324868 3300047315 Bacteria 899
926 Ga0495604_0003790 3300047317 Bacteria 12033
927 Ga0495604_0076018 3300047317 Bacteria 2527
928 Ga0495636_0023394 3300047318 Bacteria 2501
929 Ga0495674_0013194 3300047319 Bacteria 7767
930 Ga0495674_0051869 3300047319 Bacteria 3614
931 Ga0495674_0139998 3300047319 Bacteria 2034
932 Ga0495674_0283446 3300047319 Bacteria 1357
933 Ga0495674_0315998 3300047319 Bacteria 1273
934 Ga0495676_0259262 3300047321 Bacteria 1183
935 Ga0495680_0001348 3300047322 Bacteria 26695
936 Ga0495680_0010330 3300047322 Bacteria 8332
937 Ga0495675_0000202 3300047444 Bacteria 43536
938 Ga0495675_0053586 3300047444 Bacteria 2561
939 Ga0495675_0240589 3300047444 Bacteria 1090
940 Ga0495684_0012098 3300047471 Bacteria 6658
941 Ga0495684_0022085 3300047471 Bacteria 4899
942 Ga0495684_0493365 3300047471 Bacteria 843
943 Ga0495593_0080671 3300047673 Bacteria 1683
944 Ga0495593_0174034 3300047673 Bacteria 1085
945 Ga0495593_0271292 3300047673 Unclassified 849
946 Ga0495602_0022805 3300048088 Bacteria 6120
947 Ga0496100_0114330 3300048903 Bacteria 1880
948 Ga0496100_0232842 3300048903 Bacteria 1356
949 Ga0496101_0143438 3300048904 Bacteria 1822
950 Ga0496101_0360541 3300048904 Bacteria 1143
951 Ga0496101_0369488 3300048904 Bacteria 1128
952 Ga0496101_0389535 3300048904 Bacteria 1097
953 Ga0496101_0563666 3300048904 Bacteria 901
954 Ga0496102_0006673 3300048905 Bacteria 9863
955 Ga0496102_0021353 3300048905 Bacteria 5726
956 Ga0496102_0058632 3300048905 Bacteria 3518
957 Ga0496102_0078406 3300048905 Bacteria 3041
958 Ga0496102_0343567 3300048905 Bacteria 1405
959 Ga0496102_0588681 3300048905 Bacteria 1035
960 Ga0496102_1071373 3300048905 Bacteria 726
961 Ga0496103_0014594 3300048906 Bacteria 4667
962 Ga0496103_0336809 3300048906 Unclassified 970
963 Ga0496103_0342546 3300048906 Bacteria 961
964 Ga0496104_0000074 3300048907 Bacteria 103117
965 Ga0496104_0024442 3300048907 Bacteria 5556
966 Ga0496104_0125291 3300048907 Unclassified 2467
967 Ga0496104_0317220 3300048907 Bacteria 1472
968 Ga0496104_0325422 3300048907 Bacteria 1450
969 Ga0496104_0630881 3300048907 Bacteria 981
970 Ga0496106_0031581 3300048909 Bacteria 3947
971 Ga0496106_0166006 3300048909 Bacteria 1748
972 Ga0496107_0056921 3300048910 Bacteria 2826
973 Ga0496107_0307304 3300048910 Bacteria 1180
974 Ga0496108_0000325 3300048911 Bacteria 40507
975 Ga0496109_0000117 3300048912 Bacteria 82245
976 Ga0496109_0306029 3300048912 Unclassified 1499
977 Ga0496109_0736047 3300048912 Bacteria 924
978 Ga0496110_0002628 3300048913 Bacteria 13526
979 Ga0496110_0061618 3300048913 Bacteria 3312
980 Ga0496111_0004540 3300048914 Bacteria 8786
981 Ga0496112_0000283 3300048915 Bacteria 32864
982 Ga0496112_0001864 3300048915 Bacteria 16604
983 Ga0496112_0076452 3300048915 Bacteria 3311
984 Ga0496112_0143818 3300048915 Bacteria 2353
985 Ga0496112_0168771 3300048915 Bacteria 2154
986 Ga0496112_0531873 3300048915 Unclassified 1110
987 Ga0496113_0000504 3300048916 Bacteria 19266
988 Ga0496113_0036419 3300048916 Bacteria 3605
989 Ga0496113_0435657 3300048916 Bacteria 1053
990 Ga0496113_0538124 3300048916 Bacteria 937
991 Ga0496114_0146119 3300048917 Bacteria 2050
992 Ga0496114_0155073 3300048917 Bacteria 1988
993 Ga0496115_0006382 3300048918 Bacteria 8641
994 Ga0496115_0010817 3300048918 Bacteria 6824
995 Ga0496115_0251515 3300048918 Bacteria 1455
996 Ga0496115_0600636 3300048918 Bacteria 875
997 Ga0496126_0000095 3300048929 Bacteria 207654
998 Ga0501040_0138574 3300049576 Bacteria 1713
999 nmdc:mga09592_61422_c1 3300050508 Bacteria 3178
1000 nmdc:mga0qj67_207052_c1 3300050509 Bacteria 1593
1001 nmdc:mga0n895_6139_c1 3300050512 Bacteria 10149
1002 nmdc:mga0n895_8844_c1 3300050512 Bacteria 8765
1003 nmdc:mga0n895_988254_c1 3300050512 Bacteria 823
1004 nmdc:mga0rr50_119696_c1 3300050513 Bacteria 2094
1005 nmdc:mga0rr50_22666_c1 3300050513 Bacteria 4315
1006 nmdc:mga0rr50_251177_c1 3300050513 Unclassified 1469
1007 nmdc:mga0rr50_88981_c1 3300050513 Bacteria 2400
1008 nmdc:mga08x19_119477_c1 3300050514 Bacteria 1766
1009 nmdc:mga08x19_575_c1 3300050514 Bacteria 23955
1010 nmdc:mga08x19_59017_c2 3300050514 Bacteria 2026
1011 nmdc:mga08x19_6689_c1 3300050514 Bacteria 6840
1012 nmdc:mga0a205_937_c1 3300050515 Bacteria 24079
1013 Ga0501084_0268223 3300054114 Bacteria 1441
1014 2644236120 2643221642 Bacteria 5357871
1015 2887377990 2887375801 Bacteria 5334027
1016 646812225 646564506 Bacteria 3192235
1017 Ga0070717_10516524
1018 MBSR1b_contig_201130
1019 MBSR1b_contig_3160416
1020 LJNas_1000129
1021 JGI24752J21851_1006373
1022 JGI24740J21852_10097993
1023 JGI24737J22298_10034298
1024 JGI24743J22301_10007079
1025 JGI24034J26672_10000570
1026 JGI24742J22300_10036682
1027 JGI24751J29686_10023255
1028 rootH1_10066128
1029 Ga0065712_10082264
1030 Ga0065715_10004441
1031 Ga0065715_10203251
1032 Ga0065707_10164984
1033 Ga0070658_10012517
1034 Ga0070658_10172599
1035 Ga0070676_10032029
1036 Ga0070676_10092810
1037 Ga0070683_100000180
1038 Ga0070683_100184739
1039 Ga0070683_100567660
1040 Ga0070690_100198034
1041 Ga0070670_100001706
1042 Ga0070670_100155017
1043 Ga0070670_100391214
1044 Ga0068869_100002390
1045 Ga0068869_100014353
1046 Ga0070666_10040208
1047 Ga0070666_10087335
1048 Ga0070680_100163322
1049 Ga0070680_100201821
1050 Ga0070680_100240366
1051 Ga0070682_100047195
1052 Ga0070682_100108040
1053 Ga0068868_100002943
1054 Ga0068868_100006066
1055 Ga0068868_100019802
1056 Ga0068868_100051856
1057 Ga0068868_100261589
1058 Ga0070660_100016682
1059 Ga0070660_100240181
1060 Ga0070660_100522864
1061 Ga0070689_100016928
1062 Ga0070689_100170285
1063 Ga0070687_100023249
1064 Ga0070661_100000886
1065 Ga0070661_100226734
1066 Ga0070692_10463847
1067 Ga0070668_100013446
1068 Ga0070669_100016274
1069 Ga0070669_100095707
1070 Ga0070675_100003414
1071 Ga0070675_100507415
1072 Ga0070671_100024798
1073 Ga0070671_100032659
1074 Ga0070671_100224112
1075 Ga0070674_100008141
1076 Ga0070674_100129520
1077 Ga0070673_100106371
1078 Ga0070673_100128982
1079 Ga0070688_100001337
1080 Ga0070659_100055418
1081 Ga0070659_100083237
1082 Ga0070659_100233724
1083 Ga0070667_100009483
1084 Ga0070667_100093961
1085 Ga0070709_10015131
1086 Ga0070709_10038441
1087 Ga0070709_10057013
1088 Ga0070709_10084591
1089 Ga0070709_10147207
1090 Ga0070709_10170516
1091 Ga0070709_10170725
1092 Ga0070709_10257488
1093 Ga0070709_10667144
1094 Ga0070714_100001114
1095 Ga0070714_100016666
1096 Ga0070714_100224122
1097 Ga0070713_100000543
1098 Ga0070713_100002121
1099 Ga0070713_100029017
1100 Ga0070713_100037336
1101 Ga0070713_100040170
1102 Ga0070713_100084638
1103 Ga0070713_100148407
1104 Ga0070713_100204515
1105 Ga0070713_100277423
1106 Ga0070713_100309252
1107 Ga0070713_100365107
1108 Ga0070713_100505909
1109 Ga0070710_10002568
1110 Ga0070710_10220647
1111 Ga0070701_10017180
1112 Ga0070711_100000478
1113 Ga0070711_100015078
1114 Ga0070711_100176790
1115 Ga0070711_100188148
1116 Ga0070711_100279643
1117 Ga0070711_100569782
1118 Ga0070711_100590184
1119 Ga0070711_100742228
1120 Ga0070705_100062843
1121 Ga0070700_100312578
1122 Ga0070694_100041259
1123 Ga0070708_100000527
1124 Ga0070708_100001078
1125 Ga0070708_100003900
1126 Ga0070708_100013160
1127 Ga0070708_100035100
1128 Ga0070708_100055104
1129 Ga0070708_100066072
1130 Ga0070708_100114938
1131 Ga0070708_100206787
1132 Ga0070708_100357972
1133 Ga0070663_100032756
1134 Ga0070663_100589773
1135 Ga0070678_100355225
1136 Ga0070662_100005079
1137 Ga0070662_100225056
1138 Ga0070681_10000513
1139 Ga0070681_10001443
1140 Ga0070681_10047505
1141 Ga0070681_10071265
1142 Ga0070681_10231014
1143 Ga0068867_100016708
1144 Ga0068867_100053195
1145 Ga0068867_100428822
1146 Ga0070685_10001585
1147 Ga0070685_10238101
1148 Ga0070706_100000257
1149 Ga0070706_100000991
1150 Ga0070706_100094200
1151 Ga0070706_100113003
1152 Ga0070706_100204128
1153 Ga0070707_100001774
1154 Ga0070707_100062473
1155 Ga0070707_100072935
1156 Ga0070707_100535678
1157 Ga0070707_100569754
1158 Ga0070698_100000182
1159 Ga0070698_100012583
1160 Ga0070698_100389727
1161 Ga0070698_100791264
1162 Ga0070699_100088406
1163 Ga0070699_100209163
1164 Ga0070699_100290372
1165 Ga0070679_100008087
1166 Ga0070679_100054487
1167 Ga0070679_100151665
1168 Ga0070679_100301683
1169 Ga0070684_100007581
1170 Ga0070684_100017780
1171 Ga0070684_100034929
1172 Ga0070684_100089161
1173 Ga0070684_100100259
1174 Ga0070684_100338931
1175 Ga0070697_100001487
1176 Ga0070697_100004056
1177 Ga0070697_100008463
1178 Ga0070697_100085791
1179 Ga0070697_100131291
1180 Ga0070697_100238772
1181 Ga0070697_100506852
1182 Ga0068853_100005004
1183 Ga0068853_100065061
1184 Ga0068853_100083675
1185 Ga0068853_100111845
1186 Ga0068853_100254637
1187 Ga0070672_100133123
1188 Ga0070672_100381838
1189 Ga0070686_100011657
1190 Ga0070686_100036014
1191 Ga0070696_100033625
1192 Ga0070693_100038251
1193 Ga0070693_100159312
1194 Ga0070693_100465557
1195 Ga0070665_100146087
1196 Ga0068855_100000412
1197 Ga0068855_100000425
1198 Ga0068855_100018276
1199 Ga0068855_100062777
1200 Ga0068855_100106448
1201 Ga0068855_100947328
1202 Ga0070664_100005786
1203 Ga0070664_100047341
1204 Ga0070664_100082144
1205 Ga0068857_100002572
1206 Ga0068857_100003408
1207 Ga0068857_100005929
1208 Ga0068857_100372991
1209 Ga0068857_100574953
1210 Ga0068854_100003492
1211 Ga0068854_100004475
1212 Ga0068854_100014550
1213 Ga0068854_100020751
1214 Ga0068856_100000670
1215 Ga0068856_100000708
1216 Ga0068856_100001577
1217 Ga0068856_100003544
1218 Ga0068856_100006243
1219 Ga0068856_100009111
1220 Ga0068856_100066387
1221 Ga0068856_100079175
1222 Ga0068856_100118901
1223 Ga0068856_100198992
1224 Ga0068856_100245198
1225 Ga0068856_100350195
1226 Ga0070702_100004396
1227 Ga0070702_100082649
1228 Ga0068852_100002637
1229 Ga0068852_100104839
1230 Ga0068852_100107391
1231 Ga0068852_100282013
1232 Ga0068852_100318137
1233 Ga0068859_100000279
1234 Ga0068859_100015855
1235 Ga0068859_100114376
1236 Ga0068859_100277541
1237 Ga0068864_100000722
1238 Ga0068864_100015807
1239 Ga0068864_100046245
1240 Ga0068866_10001418
1241 Ga0068866_10005261
1242 Ga0068866_10008503
1243 Ga0068866_10408602
1244 Ga0068861_100051927
1245 Ga0068861_100175545
1246 Ga0068861_100392952
1247 Ga0068851_10001381
1248 Ga0068851_10015362
1249 Ga0068851_10253493
1250 Ga0068870_10003763
1251 Ga0068870_10056296
1252 Ga0068870_10072395
1253 Ga0068863_100002208
1254 Ga0068863_100005729
1255 Ga0068863_100015579
1256 Ga0068863_100070921
1257 Ga0068863_100155975
1258 Ga0068863_100184605
1259 Ga0068863_100290982
1260 Ga0068858_100002272
1261 Ga0068858_100033976
1262 Ga0068858_100152304
1263 Ga0068858_100189865
1264 Ga0068858_100236897
1265 Ga0068858_100399579
1266 Ga0068860_100000202
1267 Ga0068860_100007256
1268 Ga0068860_100059449
1269 Ga0068860_100323717
1270 Ga0068862_100048413
1271 Ga0068862_100151358
1272 Ga0068862_100276330
1273 Ga0081540_1025691
1274 Ga0070717_10000577
1275 Ga0070717_10002339
1276 Ga0070717_10003511
1277 Ga0070717_10036520
1278 Ga0070717_10055045
1279 Ga0070717_10094410
1280 Ga0070717_10101727
1281 Ga0070717_10115354
1282 Ga0070717_10198558
1283 Ga0070717_10206549
1284 Ga0070717_10300122
1285 Ga0070717_10446116
1286 Ga0070717_10562457
1287 Ga0070717_10627222
1288 Ga0070715_10037645
1289 Ga0070715_10042767
1290 Ga0070715_10099905
1291 Ga0070715_10122984
1292 Ga0070716_100005911
1293 Ga0070716_100028903
1294 Ga0070716_100135159
1295 Ga0070716_100155304
1296 Ga0070716_100240696
1297 Ga0070716_100380072
1298 Ga0070716_100432041
1299 Ga0070712_100000948
1300 Ga0070712_100002033
1301 Ga0070712_100003822
1302 Ga0070712_100014441
1303 Ga0070712_100437864
1304 Ga0070712_100752610
1305 Ga0097621_100000210
1306 Ga0097621_100000598
1307 Ga0097621_100001848
1308 Ga0097621_100005957
1309 Ga0097621_100006416
1310 Ga0097621_100030212
1311 Ga0097621_100049532
1312 Ga0097621_100149672
1313 Ga0097621_100569956
1314 Ga0097621_100639759
1315 Ga0068871_100000168
1316 Ga0068871_100000745
1317 Ga0068871_100000787
1318 Ga0068871_100009189
1319 Ga0068871_100022428
1320 Ga0068871_100025233
1321 Ga0068871_100046525
1322 Ga0068871_100092083
1323 Ga0068871_100170830
1324 Ga0068871_100339426
1325 Ga0068871_100515283
1326 Ga0068871_100878048
1327 Ga0075430_100064546
1328 Ga0075433_10005922
1329 Ga0075434_100000246
1330 Ga0075434_100046235
1331 Ga0075434_100225606
1332 Ga0075434_100261670
1333 Ga0075429_100112538
1334 Ga0068865_100004430
1335 Ga0068865_100005649
1336 Ga0068865_100059134
1337 Ga0068865_100076875
1338 Ga0075436_100009403
1339 Ga0075436_100052786
1340 Ga0097620_100000279
1341 Ga0097620_100015855
1342 Ga0097620_100114372
1343 Ga0097620_100277530
1344 Ga0075435_100003413
1345 Ga0099794_10013220
1346 Ga0099794_10027987
1347 Ga0099794_10032987
1348 Ga0099794_10070247
1349 Ga0099794_10312516
1350 Ga0105250_10023835
1351 Ga0105240_10069762
1352 Ga0105240_10126859
1353 Ga0105240_10133132
1354 Ga0105240_10142711
1355 Ga0105240_10180234
1356 Ga0105240_10198550
1357 Ga0105240_10234012
1358 Ga0105240_10255657
1359 Ga0105240_10379745
1360 Ga0111539_10296716
1361 Ga0105245_10005402
1362 Ga0105245_10006763
1363 Ga0105245_10040838
1364 Ga0105245_10056423
1365 Ga0105245_10102519
1366 Ga0105247_10009853
1367 Ga0105247_10023440
1368 Ga0105247_10025376
1369 Ga0105247_10043865
1370 Ga0105247_10287524
1371 Ga0114129_10069552
1372 Ga0105241_10003965
1373 Ga0105241_10009776
1374 Ga0105241_10014319
1375 Ga0105241_10014699
1376 Ga0105241_10080020
1377 Ga0105241_10122744
1378 Ga0105241_10184639
1379 Ga0105241_10417172
1380 Ga0105242_10067475
1381 Ga0105242_10093037
1382 Ga0105242_10296485
1383 Ga0105242_10329709
1384 Ga0105248_10019962
1385 Ga0105248_10075041
1386 Ga0105248_10111193
1387 Ga0105248_10279014
1388 Ga0105248_10498440
1389 Ga0105248_10703549
1390 Ga0105237_10050649
1391 Ga0105237_10052099
1392 Ga0105237_10166347
1393 Ga0105237_10252481
1394 Ga0105237_10336095
1395 Ga0105238_10000382
1396 Ga0105238_10038278
1397 Ga0105238_10056428
1398 Ga0105238_10195615
1399 Ga0105238_10509822
1400 Ga0105249_10002069
1401 Ga0105249_10005159
1402 Ga0105249_10027251
1403 Ga0099796_10089984
1404 Ga0105239_10008900
1405 Ga0105239_10025445
1406 Ga0105239_10071895
1407 Ga0105239_10252226
1408 Ga0105239_10276784
1409 Ga0105239_10328075
1410 Ga0105239_10586432
1411 Ga0105239_10601201
1412 Ga0105246_10005905
1413 Ga0105246_10052960
1414 Ga0157373_10001551
1415 Ga0157373_10002773
1416 Ga0157373_10037161
1417 Ga0157371_10002011
1418 Ga0157371_10004936
1419 Ga0157371_10091878
1420 Ga0157370_10013342
1421 Ga0157370_10041226
1422 Ga0157370_10041413
1423 Ga0157370_10262601
1424 Ga0157370_10386571
1425 Ga0157370_10460855
1426 Ga0157369_10000269
1427 Ga0157369_10005474
1428 Ga0157369_10006683
1429 Ga0157369_10007966
1430 Ga0157369_10011776
1431 Ga0157369_10032265
1432 Ga0157369_10091948
1433 Ga0157369_10252497
1434 Ga0157374_10000436
1435 Ga0157374_10001029
1436 Ga0157374_10001822
1437 Ga0157374_10013417
1438 Ga0157374_10034779
1439 Ga0157374_10050314
1440 Ga0157374_10079255
1441 Ga0157374_10198645
1442 Ga0157374_10223184
1443 Ga0157374_10269873
1444 Ga0157374_10278228
1445 Ga0157374_10386565
1446 Ga0157378_10000014
1447 Ga0157378_10000344
1448 Ga0157378_10000413
1449 Ga0157378_10001268
1450 Ga0157378_10007193
1451 Ga0157378_10047597
1452 Ga0157378_10084794
1453 Ga0157378_10115437
1454 Ga0157378_10206337
1455 Ga0157378_10220523
1456 Ga0163162_10002239
1457 Ga0163162_10004542
1458 Ga0163162_10011418
1459 Ga0163162_10048955
1460 Ga0163162_10092562
1461 Ga0163162_10370132
1462 Ga0163162_10505475
1463 Ga0163162_11105459
1464 Ga0157372_10000423
1465 Ga0157372_10000641
1466 Ga0157372_10002544
1467 Ga0157372_10004039
1468 Ga0157372_10005138
1469 Ga0157372_10015715
1470 Ga0157372_10016602
1471 Ga0157372_10022824
1472 Ga0157372_10036431
1473 Ga0157372_10062666
1474 Ga0157372_10166041
1475 Ga0157372_10198939
1476 Ga0157375_10035816
1477 Ga0157375_10044150
1478 Ga0163163_10026605
1479 Ga0163163_10027299
1480 Ga0163163_10093541
1481 Ga0163163_10096265
1482 Ga0163163_10113779
1483 Ga0163163_10386177
1484 Ga0182008_10001531
1485 Ga0182008_10009750
1486 Ga0157377_10023683
1487 Ga0157377_10166543
1488 Ga0157377_10438598
1489 Ga0157379_10007798
1490 Ga0157379_10010844
1491 Ga0157379_10031809
1492 Ga0157379_10035204
1493 Ga0157379_10291860
1494 Ga0157376_10014425
1495 Ga0157376_10031198
1496 Ga0157376_10045515
1497 Ga0157376_10071439
1498 Ga0157376_10083990
1499 Ga0157376_10139774
1500 Ga0157376_10232048
1501 Ga0182007_10014472
1502 Ga0224570_100631
1503 Ga0224569_100133
1504 Ga0224572_1000066
1505 Ga0224572_1001114
1506 Ga0224572_1009514
1507 Ga0224572_1009608
1508 Ga0228598_1001112
1509 Ga0228598_1017099
1510 Ga0209437_102112
1511 Ga0209233_1007680
1512 Ga0209050_1041325
1513 Ga0207697_10002788
1514 Ga0207656_10130194
1515 Ga0207692_10010221
1516 Ga0207642_10002117
1517 Ga0207642_10014622
1518 Ga0207710_10059340
1519 Ga0207710_10085390
1520 Ga0207688_10019381
1521 Ga0207680_10010712
1522 Ga0207680_10044690
1523 Ga0207680_10330027
1524 Ga0207647_10001477
1525 Ga0207647_10006683
1526 Ga0207647_10022413
1527 Ga0207685_10072896
1528 Ga0207699_10000815
1529 Ga0207699_10018440
1530 Ga0207699_10058663
1531 Ga0207699_10095528
1532 Ga0207699_10108927
1533 Ga0207699_10373471
1534 Ga0207645_10000181
1535 Ga0207645_10007872
1536 Ga0207643_10000474
1537 Ga0207643_10097731
1538 Ga0207705_10255787
1539 Ga0207684_10001275
1540 Ga0207684_10018088
1541 Ga0207684_10081331
1542 Ga0207684_10178688
1543 Ga0207654_10002582
1544 Ga0207654_10014318
1545 Ga0207654_10056155
1546 Ga0207654_10110051
1547 Ga0207654_10123841
1548 Ga0207654_10255190
1549 Ga0207707_10000828
1550 Ga0207707_10038831
1551 Ga0207707_10081955
1552 Ga0207707_10099151
1553 Ga0207707_10220174
1554 Ga0207695_10043656
1555 Ga0207695_10077718
1556 Ga0207695_10171125
1557 Ga0207695_10271718
1558 Ga0207695_10323787
1559 Ga0207695_10711846
1560 Ga0207671_10055720
1561 Ga0207671_10070131
1562 Ga0207671_10131435
1563 Ga0207671_10156068
1564 Ga0207671_10464186
1565 Ga0207693_10000090
1566 Ga0207693_10000173
1567 Ga0207693_10000621
1568 Ga0207693_10013135
1569 Ga0207693_10037643
1570 Ga0207693_10107683
1571 Ga0207663_10003822
1572 Ga0207663_10033068
1573 Ga0207663_10034666
1574 Ga0207663_10149945
1575 Ga0207663_10489488
1576 Ga0207660_10185955
1577 Ga0207662_10001688
1578 Ga0207657_10005643
1579 Ga0207657_10007963
1580 Ga0207657_10008288
1581 Ga0207649_10000343
1582 Ga0207652_10076233
1583 Ga0207652_10120800
1584 Ga0207646_10002760
1585 Ga0207646_10007451
1586 Ga0207646_10039981
1587 Ga0207646_10103730
1588 Ga0207681_10020312
1589 Ga0207694_10000430
1590 Ga0207694_10043179
1591 Ga0207694_10089601
1592 Ga0207694_10287710
1593 Ga0207650_10000223
1594 Ga0207650_10000224
1595 Ga0207650_10000296
1596 Ga0207650_10001691
1597 Ga0207650_10289026
1598 Ga0207659_10470005
1599 Ga0207687_10017030
1600 Ga0207687_10058417
1601 Ga0207687_10173184
1602 Ga0207687_10385996
1603 Ga0207700_10002203
1604 Ga0207700_10072614
1605 Ga0207700_10073782
1606 Ga0207700_10105374
1607 Ga0207700_10180398
1608 Ga0207700_10255170
1609 Ga0207700_10287849
1610 Ga0207700_10298476
1611 Ga0207700_10331157
1612 Ga0207700_10359701
1613 Ga0207700_10360539
1614 Ga0207700_10405700
1615 Ga0207700_10650271
1616 Ga0207664_10002844
1617 Ga0207664_10011335
1618 Ga0207664_10241814
1619 Ga0207644_10007871
1620 Ga0207644_10108673
1621 Ga0207690_10033784
1622 Ga0207690_10317592
1623 Ga0207690_10358566
1624 Ga0207706_10000613
1625 Ga0207706_10001122
1626 Ga0207706_10015847
1627 Ga0207686_10126583
1628 Ga0207670_10181872
1629 Ga0207670_10320786
1630 Ga0207704_10054816
1631 Ga0207704_10080675
1632 Ga0207704_10494860
1633 Ga0207665_10000182
1634 Ga0207665_10047330
1635 Ga0207665_10048693
1636 Ga0207665_10083112
1637 Ga0207665_10112332
1638 Ga0207665_10235785
1639 Ga0207691_10000345
1640 Ga0207691_10296071
1641 Ga0207711_10002524
1642 Ga0207711_10125650
1643 Ga0207711_10248782
1644 Ga0207689_10000499
1645 Ga0207689_10001621
1646 Ga0207689_10063023
1647 Ga0207661_10001212
1648 Ga0207661_10161297
1649 Ga0207679_10000115
1650 Ga0207679_10001482
1651 Ga0207667_10000311
1652 Ga0207667_10005374
1653 Ga0207667_10028850
1654 Ga0207667_10113360
1655 Ga0207667_10142497
1656 Ga0207667_10537447
1657 Ga0207667_10723811
1658 Ga0207667_10964156
1659 Ga0207651_10003483
1660 Ga0207712_10051568
1661 Ga0207668_10052646
1662 Ga0207668_10103914
1663 Ga0207640_10003104
1664 Ga0207640_10007732
1665 Ga0207640_10030028
1666 Ga0207640_10159412
1667 Ga0207640_10363623
1668 Ga0207640_10505528
1669 Ga0207658_10007316
1670 Ga0207658_10393707
1671 Ga0207677_10002452
1672 Ga0207677_10017631
1673 Ga0207677_10053564
1674 Ga0207677_10055683
1675 Ga0207677_10569747
1676 Ga0207677_10593511
1677 Ga0207703_10001667
1678 Ga0207703_10006667
1679 Ga0207703_10067935
1680 Ga0207703_10365821
1681 Ga0207703_10712240
1682 Ga0207639_10092099
1683 Ga0207639_10154627
1684 Ga0207639_11077881
1685 Ga0207678_10000130
1686 Ga0207678_10000950
1687 Ga0207708_10246065
1688 Ga0207708_10375804
1689 Ga0207702_10000722
1690 Ga0207702_10001654
1691 Ga0207702_10002343
1692 Ga0207702_10002543
1693 Ga0207702_10019837
1694 Ga0207702_10070027
1695 Ga0207702_10070347
1696 Ga0207702_10097251
1697 Ga0207702_10176331
1698 Ga0207702_10184663
1699 Ga0207702_10196100
1700 Ga0207702_10839055
1701 Ga0207641_10000287
1702 Ga0207641_10001947
1703 Ga0207641_10002584
1704 Ga0207641_10031067
1705 Ga0207641_10040850
1706 Ga0207641_10111882
1707 Ga0207641_10141200
1708 Ga0207641_10305177
1709 Ga0207648_10001253
1710 Ga0207648_10159247
1711 Ga0207648_10371630
1712 Ga0207676_10000115
1713 Ga0207676_10003051
1714 Ga0207676_10035713
1715 Ga0207676_10412252
1716 Ga0207674_10000788
1717 Ga0207674_10001340
1718 Ga0207674_10007893
1719 Ga0207674_10013852
1720 Ga0207674_10487679
1721 Ga0207674_10586096
1722 Ga0207675_100083379
1723 Ga0207683_10000217
1724 Ga0207683_10291083
1725 Ga0207698_10101020
1726 Ga0207698_10149736
1727 Ga0207698_10199580
1728 Ga0207698_10447055
1729 Ga0209179_1043846
1730 Ga0209588_1016400
1731 Ga0209588_1070111
1732 Ga0265356_1000344
1733 Ga0268266_10000761
1734 Ga0268265_10073055
1735 Ga0268265_10296460
1736 Ga0268264_10000241
1737 Ga0268264_10004971
1738 Ga0268264_10044778
1739 Ga0268264_10046056
1740 Ga0268264_10257370
1741 Ga0265338_10001801
1742 Ga0265338_10010396
1743 Ga0265338_10080138
1744 Ga0265338_10132286
1745 Ga0265338_10241360
1746 Ga0265338_10274634
1747 Ga0265762_1004236
1748 Ga0265762_1006001
1749 Ga0265762_1015555
1750 Ga0265762_1025991
1751 Ga0265760_10000242
1752 Ga0265760_10003610
1753 Ga0265760_10005419
1754 Ga0265760_10007787
1755 Ga0265760_10017742
1756 Ga0265760_10018276
1757 Ga0265760_10058968
1758 Ga0265330_10036864
1759 Ga0265332_10071679
1760 Ga0265325_10014097
1761 Ga0265325_10015495
1762 Ga0265325_10045920
1763 Ga0265340_10149411
1764 Ga0265339_10014422
1765 Ga0265339_10051746
1766 Ga0265339_10092440
1767 Ga0265331_10094211
1768 Ga0265327_10032180
1769 Ga0265316_10019053
1770 Ga0265316_10043022
1771 Ga0265316_10450132
1772 Ga0265313_10014628
1773 Ga0265314_10009028
1774 Ga0265314_10108988
1775 Ga0265314_10119534
1776 Ga0265342_10112470
1777 Ga0307416_101059012
1778 Ga0316214_1005106
1779 Ga0316212_1006527
1780 Ga0373926_0004598
1781 Ga0373926_0005361
1782 Ga0373928_0042513
1783 Ga0373929_0020694
1784 Ga0373944_0049754
1785 Ga0373936_0004614
1786 Ga0373936_0063311
1787 Ga0373939_0046714
1788 Ga0373941_0019085
1789 Ga0373945_0082064
1790 Ga0373954_0192457
1791 Ga0373956_0121472
1792 Ga0373957_0086822
1793 Ga0373943_0052087
1794 Ga0373943_0054311
1795 Ga0373943_0067392
1796 Ga0373943_0209225
1797 Ga0373943_0298164
1798 Ga0373943_0302457
1799 Ga0373946_0004259
1800 Ga0373946_0010395
1801 Ga0373955_0042548
1802 Ga0373955_0163829
1803 Ga0373931_0052084
1804 Ga0373931_0247997
1805 Ga0373931_0309897
1806 Ga0373935_0033631
1807 Ga0373935_0035710
1808 Ga0373935_0079637
1809 Ga0373935_0423944
1810 Ga0373935_0696763
1811 Ga0373927_0003975
1812 Ga0373927_0015301
1813 Ga0373927_0015335
1814 Ga0373927_0054495
1815 Ga0373927_0074146
1816 Ga0373927_0124228
1817 Ga0373933_0040395
1818 Ga0373933_0046243
1819 Ga0373933_0308046
1820 Ga0373947_0001902
1821 Ga0373947_0001950
1822 Ga0373947_0046121
1823 Ga0373947_0097458
1824 Ga0373947_0336867
1825 Ga0373947_0339554
1826 Ga0373937_0018254
1827 Ga0373937_0094316
1828 Ga0373937_0406085
1829 Ga0373937_0893321
1830 Ga0373937_0922139
1831 Ga0373925_0000165
1832 Ga0373925_0017686
1833 Ga0373925_0018110
1834 Ga0373925_0023470
1835 Ga0373925_0054200
1836 Ga0373925_0282884
1837 Ga0395905_0000096
1838 Ga0436364_1137452
1839 Ga0400490_03194
1840 Ga0400486_20280
1841 Ga0436365_1849740
1842 Ga0436363_0684377
1843 Ga0436363_1603702
1844 Ga0436363_1709607
1845 Ga0436362_1117608
1846 Ga0451577_0003762
1847 Ga0451577_0064248
1848 Ga0451577_0407021
1849 Ga0453683_0004979
1850 Ga0453683_0005490
1851 Ga0453683_0251834
1852 Ga0453684_0000377
1853 Ga0453684_0005849
1854 Ga0453684_0018504
1855 Ga0453684_0061085
1856 Ga0453684_0096456
1857 Ga0466957_0000410
1858 Ga0451576_0000033
1859 Ga0451576_0018916
1860 Ga0451576_0165440
1861 Ga0451576_0220067
1862 Ga0451576_0273153
1863 Ga0451576_0301499
1864 Ga0451576_0635259
1865 Ga0451576_1312526
1866 Ga0466967_0119894
1867 Ga0495592_0052355
1868 Ga0495603_0004371
1869 Ga0495629_0020122
1870 Ga0495629_0088319
1871 Ga0495651_0014952
1872 Ga0495653_0019126
1873 Ga0495580_0000074
1874 Ga0495580_0000337
1875 Ga0495580_0005142
1876 Ga0495580_0014509
1877 Ga0495580_0033054
1878 Ga0495580_0053725
1879 Ga0495580_0067428
1880 Ga0495580_0081143
1881 Ga0495580_0108116
1882 Ga0495580_0149657
1883 Ga0495580_0195440
1884 Ga0495580_0208472
1885 Ga0495580_0323642
1886 Ga0495580_0348395
1887 Ga0495582_0005452
1888 Ga0495582_0009992
1889 Ga0495582_0022220
1890 Ga0495639_0071872
1891 Ga0495664_0010014
1892 Ga0495664_0023289
1893 Ga0495584_0000002
1894 Ga0495594_0007103
1895 Ga0495594_0149616
1896 Ga0495608_0015944
1897 Ga0495608_0148646
1898 Ga0495618_0014035
1899 Ga0495628_0000167
1900 Ga0495628_0049805
1901 Ga0495630_0087969
1902 Ga0495630_0093306
1903 Ga0495630_0131284
1904 Ga0495630_0133671
1905 Ga0495666_0027633
1906 Ga0495666_0106709
1907 Ga0495652_0001713
1908 Ga0495652_0088019
1909 Ga0495665_0001072
1910 Ga0495665_0025425
1911 Ga0495665_0039056
1912 Ga0495665_0084143
1913 Ga0495665_0144780
1914 Ga0495640_0027205
1915 Ga0495640_0057591
1916 Ga0495640_0245598
1917 Ga0495586_0012586
1918 Ga0495586_0058509
1919 Ga0495586_0271800
1920 Ga0495587_0003037
1921 Ga0495587_0069491
1922 Ga0495645_0006650
1923 Ga0495645_0007683
1924 Ga0495645_0079896
1925 Ga0495622_0159709
1926 Ga0495667_0027483
1927 Ga0495667_0216771
1928 Ga0495634_0025416
1929 Ga0495634_0069864
1930 Ga0495657_0009233
1931 Ga0495623_0011515
1932 Ga0495623_0377775
1933 Ga0495647_0014408
1934 Ga0495658_0158287
1935 Ga0495669_0053711
1936 Ga0495613_0317024
1937 Ga0495624_0081571
1938 Ga0495600_0043489
1939 Ga0495600_0103323
1940 Ga0495581_0059356
1941 Ga0495581_0324868
1942 Ga0495604_0003790
1943 Ga0495604_0076018
1944 Ga0495636_0023394
1945 Ga0495674_0013194
1946 Ga0495674_0051869
1947 Ga0495674_0139998
1948 Ga0495674_0283446
1949 Ga0495674_0315998
1950 Ga0495676_0259262
1951 Ga0495680_0001348
1952 Ga0495680_0010330
1953 Ga0495675_0000202
1954 Ga0495675_0053586
1955 Ga0495675_0240589
1956 Ga0495684_0012098
1957 Ga0495684_0022085
1958 Ga0495684_0493365
1959 Ga0495593_0080671
1960 Ga0495593_0174034
1961 Ga0495593_0271292
1962 Ga0495602_0022805
1963 Ga0496100_0114330
1964 Ga0496100_0232842
1965 Ga0496101_0143438
1966 Ga0496101_0360541
1967 Ga0496101_0369488
1968 Ga0496101_0389535
1969 Ga0496101_0563666
1970 Ga0496102_0006673
1971 Ga0496102_0021353
1972 Ga0496102_0058632
1973 Ga0496102_0078406
1974 Ga0496102_0343567
1975 Ga0496102_0588681
1976 Ga0496102_1071373
1977 Ga0496103_0014594
1978 Ga0496103_0336809
1979 Ga0496103_0342546
1980 Ga0496104_0000074
1981 Ga0496104_0024442
1982 Ga0496104_0125291
1983 Ga0496104_0317220
1984 Ga0496104_0325422
1985 Ga0496104_0630881
1986 Ga0496106_0031581
1987 Ga0496106_0166006
1988 Ga0496107_0056921
1989 Ga0496107_0307304
1990 Ga0496108_0000325
1991 Ga0496109_0000117
1992 Ga0496109_0306029
1993 Ga0496109_0736047
1994 Ga0496110_0002628
1995 Ga0496110_0061618
1996 Ga0496111_0004540
1997 Ga0496112_0000283
1998 Ga0496112_0001864
1999 Ga0496112_0076452
2000 Ga0496112_0143818
2001 Ga0496112_0168771
2002 Ga0496112_0531873
2003 Ga0496113_0000504
2004 Ga0496113_0036419
2005 Ga0496113_0435657
2006 Ga0496113_0538124
2007 Ga0496114_0146119
2008 Ga0496114_0155073
2009 Ga0496115_0006382
2010 Ga0496115_0010817
2011 Ga0496115_0251515
2012 Ga0496115_0600636
2013 Ga0496126_0000095
2014 Ga0501040_0138574
2015 nmdc:mga09592_61422_c1
2016 nmdc:mga0qj67_207052_c1
2017 nmdc:mga0n895_6139_c1
2018 nmdc:mga0n895_8844_c1
2019 nmdc:mga0n895_988254_c1
2020 nmdc:mga0rr50_119696_c1
2021 nmdc:mga0rr50_22666_c1
2022 nmdc:mga0rr50_251177_c1
2023 nmdc:mga0rr50_88981_c1
2024 nmdc:mga08x19_119477_c1
2025 nmdc:mga08x19_575_c1
2026 nmdc:mga08x19_59017_c2
2027 nmdc:mga08x19_6689_c1
2028 nmdc:mga0a205_937_c1
2029 Ga0501084_0268223
2030 2644236120
2031 2887377990
2032 646812225

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

71

266

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.9295 4 210
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8968 2 214
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.841 3 210
3d31-assembly1.cif.gz_C modbc from methanosarcina acetivorans 0.8351 4 210
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.835 4 210
ID Description Score Start End Superfamily
af_Q2FVX5_4_220_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9727 4 218 1.10.3720.10
af_Q2FVX5_4_220_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9596 4 218 1.10.3720.10
af_P0AF01_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9595 2 217 1.10.3720.10
af_P9WG13_10_255_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.953 4 210 1.10.3720.10
af_P0AEB0_20_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9452 4 214 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A537QC36-F1-model_v4 Molybdenum transport system permease 0.9973 1 216 GO:0005886
GO:0015098
AF-A0A848VX28-F1-model_v4 Molybdenum transport system permease 0.9936 1 215 GO:0005886
GO:0015098
AF-A0A2W0A0E5-F1-model_v4 Molybdenum transport system permease 0.9901 1 189 GO:0005886
GO:0015098
AF-A0A7Y4WE71-F1-model_v4 Molybdenum transport system permease 0.9892 1 216 GO:0005886
GO:0015098
AF-A0A840I4S3-F1-model_v4 Molybdenum transport system permease 0.989 2 215 GO:0005886
GO:0015098

Map