F488262

General Info

Members Datasets Scaffolds Average Seq Length
1016 384 2032 100

Family's Representative Sequence

Representative Sequence 3300025938|Ga0207704_10000458|Ga0207704_100004588
Length 115
Sequence MSDDERWSPPVGPIDPEHPECAAVIAEVWTLLDGECTAETRDKLRHHLEECPTCLRYYGVEERVKSLIAKKCSGEKAPDRLRERLRIEISRTTIIRGKLRRKAPLGIGALSVICL

Samples

Sample ID Description Type Environment
1 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
103 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
207 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
223 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
224 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
225 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
226 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
227 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
228 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
229 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
230 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
231 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
234 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
235 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
236 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
237 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
238 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
239 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
251 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
266 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
282 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
307 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
308 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
328 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
336 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
337 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
338 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
339 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
342 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
343 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
346 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
347 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
348 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
349 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
350 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
351 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
352 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
353 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
354 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
355 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
356 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
357 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
358 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
359 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
360 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
361 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
364 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
365 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
366 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
367 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
368 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
369 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
372 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
373 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
374 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
375 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
376 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
377 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
378 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
379 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
380 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
381 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
382 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
383 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
384 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 0.59
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.52
Nodule 0.1
Rhizoplane 10.63
Rhizosphere 65.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207704_10000458 3300025938 Bacteria 18202
2 CNXas_1000300 3300000545 Bacteria 4777
3 CNXas_1005113 3300000545 Bacteria 928
4 JGI24746J21847_1011174 3300001977 Bacteria 1322
5 JGI24747J21853_1015315 3300001978 Bacteria 803
6 JGI24739J22299_10049710 3300001989 Bacteria 1358
7 JGI24737J22298_10012890 3300001990 Bacteria 2725
8 JGI24737J22298_10063782 3300001990 Bacteria 1106
9 JGI24737J22298_10239371 3300001990 Bacteria 536
10 JGI24743J22301_10122959 3300001991 Bacteria 570
11 JGI24750J21931_1010814 3300002070 Bacteria 1194
12 JGI24748J21848_1008609 3300002074 Bacteria 1200
13 JGI24748J21848_1042239 3300002074 Bacteria 582
14 JGI24749J21850_1027833 3300002076 Bacteria 807
15 JGI24744J21845_10000131 3300002077 Bacteria 10464
16 JGI24034J26672_10007839 3300002239 Bacteria 1554
17 JGI24742J22300_10000618 3300002244 Bacteria 5345
18 JGI24742J22300_10008441 3300002244 Bacteria 1699
19 JGI24751J29686_10011383 3300002459 Bacteria 1835
20 Ga0055528_1035658 3300003790 Bacteria 1203
21 Ga0055540_1000040 3300003792 Bacteria 157728
22 Ga0055540_1004993 3300003792 Bacteria 5768
23 Ga0055540_1024706 3300003792 Bacteria 1486
24 Ga0055540_1074105 3300003792 Bacteria 661
25 Ga0065704_10454399 3300005289 Bacteria 702
26 Ga0070676_10028426 3300005328 Bacteria 3176
27 Ga0070676_11392526 3300005328 Bacteria 538
28 Ga0070683_100183221 3300005329 Bacteria 1988
29 Ga0070690_100007203 3300005330 Bacteria 6364
30 Ga0070690_100730761 3300005330 Bacteria 763
31 Ga0070670_100086471 3300005331 Bacteria 2694
32 Ga0068869_100030180 3300005334 Bacteria 3804
33 Ga0068869_100267775 3300005334 Bacteria 1370
34 Ga0070666_10034273 3300005335 Bacteria 3365
35 Ga0070666_10845948 3300005335 Bacteria 675
36 Ga0070682_100047266 3300005337 Bacteria 2675
37 Ga0070682_100084985 3300005337 Bacteria 2057
38 Ga0070682_100210413 3300005337 Bacteria 1378
39 Ga0070682_100524732 3300005337 Bacteria 922
40 Ga0068868_100000203 3300005338 Bacteria 40057
41 Ga0068868_100131427 3300005338 Bacteria 2049
42 Ga0068868_100134492 3300005338 Bacteria 2025
43 Ga0068868_100635871 3300005338 Bacteria 949
44 Ga0068868_100826572 3300005338 Bacteria 838
45 Ga0070660_100954421 3300005339 Bacteria 724
46 Ga0070660_101627547 3300005339 Bacteria 550
47 Ga0070689_100054776 3300005340 Bacteria 3088
48 Ga0070689_101679834 3300005340 Bacteria 578
49 Ga0070691_10000914 3300005341 Bacteria 11972
50 Ga0070691_10134145 3300005341 Bacteria 1257
51 Ga0070687_100124024 3300005343 Bacteria 1482
52 Ga0070687_100549971 3300005343 Bacteria 785
53 Ga0070692_10216409 3300005345 Bacteria 1130
54 Ga0070692_10229364 3300005345 Bacteria 1102
55 Ga0070692_10796338 3300005345 Bacteria 645
56 Ga0070668_100000604 3300005347 Bacteria 24024
57 Ga0070668_100015315 3300005347 Bacteria 5729
58 Ga0070668_100053389 3300005347 Bacteria 3116
59 Ga0070668_100269506 3300005347 Bacteria 1419
60 Ga0070669_100000428 3300005353 Bacteria 32242
61 Ga0070669_100005387 3300005353 Bacteria 9228
62 Ga0070669_100211710 3300005353 Bacteria 1529
63 Ga0070675_100745249 3300005354 Bacteria 894
64 Ga0070671_100006503 3300005355 Bacteria 9343
65 Ga0070671_100043463 3300005355 Bacteria 3733
66 Ga0070671_100194584 3300005355 Bacteria 1719
67 Ga0070674_100000244 3300005356 Bacteria 26961
68 Ga0070674_100461193 3300005356 Bacteria 1051
69 Ga0070674_100626987 3300005356 Bacteria 911
70 Ga0070673_100304205 3300005364 Bacteria 1405
71 Ga0070688_100002188 3300005365 Bacteria 9856
72 Ga0070688_100026466 3300005365 Bacteria 3447
73 Ga0070659_100100888 3300005366 Bacteria 2323
74 Ga0070659_100636773 3300005366 Bacteria 918
75 Ga0070659_100680368 3300005366 Bacteria 889
76 Ga0070667_100000027 3300005367 Bacteria 181315
77 Ga0070667_100004957 3300005367 Bacteria 11153
78 Ga0070667_100016839 3300005367 Bacteria 6049
79 Ga0070667_100095421 3300005367 Bacteria 2564
80 Ga0070667_100123528 3300005367 Bacteria 2254
81 Ga0070667_100446306 3300005367 Bacteria 1182
82 Ga0070667_100448770 3300005367 Bacteria 1178
83 Ga0070667_101050879 3300005367 Bacteria 761
84 Ga0070703_10038930 3300005406 Bacteria 1472
85 Ga0070709_10056739 3300005434 Bacteria 2478
86 Ga0070709_10060096 3300005434 Bacteria 2415
87 Ga0070714_100018869 3300005435 Bacteria 5611
88 Ga0070714_100410244 3300005435 Bacteria 1282
89 Ga0070714_100705152 3300005435 Bacteria 974
90 Ga0070714_101606357 3300005435 Bacteria 635
91 Ga0070713_100118670 3300005436 Bacteria 2316
92 Ga0070710_10001501 3300005437 Bacteria 10996
93 Ga0070710_10014703 3300005437 Bacteria 3943
94 Ga0070710_11149494 3300005437 Bacteria 572
95 Ga0070701_10016528 3300005438 Bacteria 3433
96 Ga0070701_10394154 3300005438 Bacteria 876
97 Ga0070711_100001734 3300005439 Bacteria 12097
98 Ga0070711_100005574 3300005439 Bacteria 7537
99 Ga0070711_101509120 3300005439 Bacteria 586
100 Ga0070711_101877929 3300005439 Bacteria 526
101 Ga0070705_100004544 3300005440 Bacteria 6751
102 Ga0070705_100851348 3300005440 Bacteria 729
103 Ga0070700_100321132 3300005441 Bacteria 1137
104 Ga0070700_101227776 3300005441 Bacteria 627
105 Ga0070694_100004367 3300005444 Bacteria 8504
106 Ga0070694_100443404 3300005444 Bacteria 1024
107 Ga0070663_100021341 3300005455 Bacteria 4306
108 Ga0070663_100449770 3300005455 Bacteria 1061
109 Ga0070663_100952689 3300005455 Bacteria 744
110 Ga0070663_100969821 3300005455 Bacteria 738
111 Ga0070663_101257211 3300005455 Bacteria 652
112 Ga0070663_101855550 3300005455 Bacteria 541
113 Ga0070678_100001046 3300005456 Bacteria 14474
114 Ga0070678_100071210 3300005456 Bacteria 2602
115 Ga0070678_100478191 3300005456 Bacteria 1096
116 Ga0070678_101868519 3300005456 Bacteria 567
117 Ga0070662_100003739 3300005457 Bacteria 9524
118 Ga0070662_100196172 3300005457 Bacteria 1599
119 Ga0070662_101374459 3300005457 Bacteria 608
120 Ga0068867_100001211 3300005459 Bacteria 17725
121 Ga0068867_101418114 3300005459 Bacteria 644
122 Ga0068867_102030788 3300005459 Bacteria 544
123 Ga0070685_10505789 3300005466 Bacteria 856
124 Ga0070685_10525354 3300005466 Bacteria 841
125 Ga0070685_11002428 3300005466 Bacteria 627
126 Ga0070684_100281500 3300005535 Bacteria 1524
127 Ga0068853_100164539 3300005539 Bacteria 2004
128 Ga0068853_100849565 3300005539 Bacteria 875
129 Ga0070672_100034746 3300005543 Bacteria 3828
130 Ga0070672_100977005 3300005543 Bacteria 750
131 Ga0070686_100081511 3300005544 Bacteria 2143
132 Ga0070686_100577112 3300005544 Bacteria 883
133 Ga0070686_100807117 3300005544 Bacteria 757
134 Ga0070695_100002690 3300005545 Bacteria 10289
135 Ga0070695_100057660 3300005545 Bacteria 2510
136 Ga0070696_100004046 3300005546 Bacteria 9777
137 Ga0070693_100025200 3300005547 Bacteria 3199
138 Ga0070693_101118011 3300005547 Bacteria 602
139 Ga0070665_100046895 3300005548 Bacteria 4337
140 Ga0070665_100228267 3300005548 Bacteria 1862
141 Ga0070665_100235874 3300005548 Bacteria 1830
142 Ga0070665_100261070 3300005548 Bacteria 1733
143 Ga0070665_100993248 3300005548 Bacteria 852
144 Ga0070704_100002696 3300005549 Bacteria 10037
145 Ga0070704_100137889 3300005549 Bacteria 1900
146 Ga0068855_100181957 3300005563 Bacteria 2376
147 Ga0068855_100623678 3300005563 Bacteria 1161
148 Ga0068855_101245011 3300005563 Bacteria 772
149 Ga0068854_100000262 3300005578 Bacteria 35841
150 Ga0068854_100182885 3300005578 Bacteria 1638
151 Ga0068856_100558649 3300005614 Bacteria 1166
152 Ga0068856_102546793 3300005614 Bacteria 518
153 Ga0070702_100415830 3300005615 Bacteria 966
154 Ga0070702_101239923 3300005615 Bacteria 603
155 Ga0068852_100031689 3300005616 Bacteria 4367
156 Ga0068852_100210563 3300005616 Bacteria 1844
157 Ga0068852_102414700 3300005616 Bacteria 546
158 Ga0068859_100001466 3300005617 Bacteria 24023
159 Ga0068859_100002266 3300005617 Bacteria 19509
160 Ga0068859_100284757 3300005617 Bacteria 1745
161 Ga0068859_102927705 3300005617 Bacteria 522
162 Ga0068864_100093654 3300005618 Bacteria 2654
163 Ga0068864_101253565 3300005618 Bacteria 741
164 Ga0068866_10000681 3300005718 Bacteria 15451
165 Ga0068866_10066644 3300005718 Bacteria 1887
166 Ga0068866_10247575 3300005718 Bacteria 1089
167 Ga0068861_100013167 3300005719 Bacteria 5786
168 Ga0068861_100161744 3300005719 Bacteria 1847
169 Ga0068861_100179195 3300005719 Bacteria 1762
170 Ga0068861_101138994 3300005719 Bacteria 751
171 Ga0068861_101384194 3300005719 Bacteria 687
172 Ga0068851_10482902 3300005834 Bacteria 741
173 Ga0068851_10581628 3300005834 Bacteria 680
174 Ga0068870_10291984 3300005840 Bacteria 1026
175 Ga0068870_10862670 3300005840 Bacteria 637
176 Ga0068870_10983223 3300005840 Bacteria 601
177 Ga0068870_11397895 3300005840 Bacteria 513
178 Ga0068863_100003689 3300005841 Bacteria 15133
179 Ga0068863_100006164 3300005841 Bacteria 11758
180 Ga0068863_100869736 3300005841 Bacteria 901
181 Ga0068863_100950870 3300005841 Bacteria 861
182 Ga0068863_101677976 3300005841 Bacteria 645
183 Ga0068863_101838165 3300005841 Bacteria 616
184 Ga0068858_100001689 3300005842 Bacteria 22563
185 Ga0068858_100096341 3300005842 Bacteria 2757
186 Ga0068858_100126321 3300005842 Bacteria 2395
187 Ga0068858_100218475 3300005842 Bacteria 1805
188 Ga0068858_100547142 3300005842 Bacteria 1120
189 Ga0068858_101644456 3300005842 Bacteria 634
190 Ga0068858_101816941 3300005842 Bacteria 602
191 Ga0068860_100000141 3300005843 Bacteria 117843
192 Ga0068860_100001255 3300005843 Bacteria 27661
193 Ga0068860_100149757 3300005843 Bacteria 2247
194 Ga0068860_100197528 3300005843 Bacteria 1948
195 Ga0068860_102567264 3300005843 Bacteria 529
196 Ga0068860_102685411 3300005843 Bacteria 517
197 Ga0068862_100000138 3300005844 Bacteria 82578
198 Ga0068862_100001317 3300005844 Bacteria 23074
199 Ga0068862_100316850 3300005844 Bacteria 1438
200 Ga0068862_100746715 3300005844 Bacteria 952
201 Ga0068862_101109055 3300005844 Bacteria 787
202 Ga0081455_10036555 3300005937 Bacteria 4371
203 Ga0081455_10177818 3300005937 Bacteria 1614
204 Ga0081538_10035673 3300005981 Bacteria 3262
205 Ga0075365_10018382 3300006038 Bacteria 4297
206 Ga0075365_10046531 3300006038 Bacteria 2850
207 Ga0075365_10047539 3300006038 Bacteria 2821
208 Ga0075365_10055055 3300006038 Bacteria 2639
209 Ga0075365_10154536 3300006038 Bacteria 1597
210 Ga0075365_10286437 3300006038 Bacteria 1159
211 Ga0075365_10459401 3300006038 Bacteria 899
212 Ga0075365_10949959 3300006038 Bacteria 606
213 Ga0075365_11117835 3300006038 Bacteria 555
214 Ga0075368_10018592 3300006042 Bacteria 2612
215 Ga0075363_100025097 3300006048 Bacteria 3036
216 Ga0075363_100037020 3300006048 Bacteria 2561
217 Ga0075363_100040183 3300006048 Bacteria 2465
218 Ga0075363_100055671 3300006048 Bacteria 2119
219 Ga0075363_100058629 3300006048 Bacteria 2068
220 Ga0075363_100075522 3300006048 Bacteria 1836
221 Ga0075363_100127918 3300006048 Bacteria 1423
222 Ga0075363_100200914 3300006048 Bacteria 1139
223 Ga0075363_100337741 3300006048 Bacteria 878
224 Ga0075363_100897896 3300006048 Bacteria 542
225 Ga0075363_101027628 3300006048 Bacteria 509
226 Ga0075364_10001416 3300006051 Bacteria 13006
227 Ga0075364_10026321 3300006051 Bacteria 3710
228 Ga0075364_10038846 3300006051 Bacteria 3084
229 Ga0075364_10068636 3300006051 Bacteria 2332
230 Ga0075364_10078677 3300006051 Bacteria 2178
231 Ga0075364_10091412 3300006051 Bacteria 2019
232 Ga0075364_10103821 3300006051 Bacteria 1893
233 Ga0075364_10154835 3300006051 Bacteria 1546
234 Ga0075364_10176423 3300006051 Bacteria 1445
235 Ga0075364_10188648 3300006051 Bacteria 1396
236 Ga0075364_10304632 3300006051 Bacteria 1085
237 Ga0075364_10437265 3300006051 Bacteria 894
238 Ga0075364_10448407 3300006051 Bacteria 881
239 Ga0075364_10487519 3300006051 Bacteria 843
240 Ga0075364_10623698 3300006051 Bacteria 737
241 Ga0075364_11065817 3300006051 Bacteria 549
242 Ga0075432_10303066 3300006058 Bacteria 664
243 Ga0070715_10002294 3300006163 Bacteria 5830
244 Ga0070715_10405247 3300006163 Bacteria 759
245 Ga0070715_10416240 3300006163 Bacteria 751
246 Ga0070716_100001813 3300006173 Bacteria 9669
247 Ga0070716_100847150 3300006173 Bacteria 711
248 Ga0070716_101087791 3300006173 Bacteria 637
249 Ga0070712_100001225 3300006175 Bacteria 15514
250 Ga0070712_100004149 3300006175 Bacteria 8902
251 Ga0070712_100529520 3300006175 Bacteria 991
252 Ga0075362_10008854 3300006177 Bacteria 3868
253 Ga0075362_10058899 3300006177 Bacteria 1733
254 Ga0075362_10290559 3300006177 Bacteria 810
255 Ga0075362_10379157 3300006177 Bacteria 711
256 Ga0075367_10049248 3300006178 Bacteria 2483
257 Ga0075367_10226510 3300006178 Bacteria 1170
258 Ga0075367_10530305 3300006178 Bacteria 747
259 Ga0075369_10000571 3300006186 Bacteria 11638
260 Ga0075369_10002109 3300006186 Bacteria 7028
261 Ga0075369_10125352 3300006186 Bacteria 1164
262 Ga0075369_10138350 3300006186 Bacteria 1109
263 Ga0075369_10142413 3300006186 Bacteria 1094
264 Ga0075369_10218259 3300006186 Bacteria 882
265 Ga0075369_10268637 3300006186 Bacteria 793
266 Ga0075369_10490169 3300006186 Bacteria 584
267 Ga0075369_10517450 3300006186 Bacteria 568
268 Ga0075369_10546101 3300006186 Bacteria 553
269 Ga0075366_10147922 3300006195 Bacteria 1422
270 Ga0097621_100763541 3300006237 Bacteria 894
271 Ga0075370_10010995 3300006353 Bacteria 4746
272 Ga0075370_10049938 3300006353 Bacteria 2372
273 Ga0075370_10056762 3300006353 Bacteria 2225
274 Ga0075370_10065681 3300006353 Bacteria 2069
275 Ga0075370_10080869 3300006353 Bacteria 1867
276 Ga0075370_10130598 3300006353 Bacteria 1465
277 Ga0075370_10362970 3300006353 Bacteria 866
278 Ga0075370_10607977 3300006353 Bacteria 662
279 Ga0075370_10675245 3300006353 Bacteria 627
280 Ga0068871_100819008 3300006358 Bacteria 859
281 Ga0068871_100857918 3300006358 Bacteria 840
282 Ga0068871_101336655 3300006358 Bacteria 675
283 Ga0075428_100000939 3300006844 Bacteria 30809
284 Ga0075430_100059016 3300006846 Bacteria 3225
285 Ga0075430_100080000 3300006846 Bacteria 2738
286 Ga0075431_100021617 3300006847 Bacteria 6582
287 Ga0075434_100459143 3300006871 Bacteria 1295
288 Ga0075434_101693453 3300006871 Bacteria 640
289 Ga0068865_100004351 3300006881 Bacteria 8546
290 Ga0068865_100093332 3300006881 Bacteria 2188
291 Ga0068865_100550404 3300006881 Bacteria 969
292 Ga0097620_100001464 3300006931 Bacteria 24023
293 Ga0097620_100002267 3300006931 Bacteria 19509
294 Ga0097620_100284752 3300006931 Bacteria 1745
295 Ga0097620_102927781 3300006931 Bacteria 522
296 Ga0105251_10233167 3300009011 Bacteria 829
297 Ga0105250_10063025 3300009092 Bacteria 1492
298 Ga0105250_10084209 3300009092 Bacteria 1290
299 Ga0105250_10288945 3300009092 Bacteria 707
300 Ga0105240_11204609 3300009093 Bacteria 802
301 Ga0111539_13346294 3300009094 Bacteria 516
302 Ga0105245_10007730 3300009098 Bacteria 9417
303 Ga0105245_10674331 3300009098 Bacteria 1065
304 Ga0105245_11493368 3300009098 Bacteria 726
305 Ga0105247_10000237 3300009101 Bacteria 51740
306 Ga0105247_10000372 3300009101 Bacteria 38190
307 Ga0105247_10065096 3300009101 Bacteria 2267
308 Ga0105247_10066172 3300009101 Bacteria 2250
309 Ga0105247_10414385 3300009101 Bacteria 963
310 Ga0105247_11583189 3300009101 Bacteria 537
311 Ga0114129_10048020 3300009147 Bacteria 5998
312 Ga0114129_12826612 3300009147 Bacteria 576
313 Ga0105243_10000676 3300009148 Bacteria 33249
314 Ga0105241_10007378 3300009174 Bacteria 8089
315 Ga0105241_10149237 3300009174 Bacteria 1911
316 Ga0105241_10830079 3300009174 Bacteria 853
317 Ga0105241_11225082 3300009174 Bacteria 712
318 Ga0105242_10000197 3300009176 Bacteria 46948
319 Ga0105242_10208526 3300009176 Bacteria 1740
320 Ga0105242_10499514 3300009176 Bacteria 1157
321 Ga0105242_11927092 3300009176 Bacteria 632
322 Ga0105248_10000337 3300009177 Bacteria 55206
323 Ga0105248_10056212 3300009177 Bacteria 4415
324 Ga0105248_10087668 3300009177 Bacteria 3503
325 Ga0105248_10826344 3300009177 Bacteria 1046
326 Ga0105248_10898500 3300009177 Bacteria 1000
327 Ga0105248_11640690 3300009177 Bacteria 729
328 Ga0105237_10005565 3300009545 Bacteria 14206
329 Ga0105237_10015368 3300009545 Bacteria 7971
330 Ga0105237_10085017 3300009545 Bacteria 3153
331 Ga0105237_10689298 3300009545 Bacteria 1028
332 Ga0105237_11484663 3300009545 Bacteria 684
333 Ga0105238_10086299 3300009551 Bacteria 3126
334 Ga0105238_10317361 3300009551 Bacteria 1544
335 Ga0105238_10642662 3300009551 Bacteria 1071
336 Ga0105238_11043982 3300009551 Bacteria 839
337 Ga0105249_10000013 3300009553 Bacteria 283609
338 Ga0105249_10004426 3300009553 Bacteria 12148
339 Ga0105249_10022007 3300009553 Bacteria 5709
340 Ga0105249_10543436 3300009553 Bacteria 1212
341 Ga0105249_10816852 3300009553 Bacteria 997
342 Ga0099796_10010920 3300010159 Bacteria 2515
343 Ga0105239_10029337 3300010375 Bacteria 6048
344 Ga0105239_10032396 3300010375 Bacteria 5744
345 Ga0105239_10145014 3300010375 Bacteria 2647
346 Ga0105239_10690655 3300010375 Bacteria 1167
347 Ga0105239_10788219 3300010375 Bacteria 1089
348 Ga0105239_10996822 3300010375 Bacteria 963
349 Ga0105246_10217869 3300011119 Bacteria 1494
350 Ga0105246_10244744 3300011119 Bacteria 1420
351 Ga0105246_10667441 3300011119 Bacteria 907
352 Ga0157342_1068323 3300012507 Bacteria 536
353 Ga0157371_10312162 3300013102 Bacteria 1140
354 Ga0157371_11224263 3300013102 Bacteria 579
355 Ga0157369_10384304 3300013105 Bacteria 1457
356 Ga0157369_10631717 3300013105 Bacteria 1105
357 Ga0157374_10391860 3300013296 Bacteria 1384
358 Ga0157374_10694656 3300013296 Bacteria 1030
359 Ga0157378_10002889 3300013297 Bacteria 15295
360 Ga0157378_10036468 3300013297 Bacteria 4351
361 Ga0157378_10890388 3300013297 Bacteria 920
362 Ga0157378_11122549 3300013297 Bacteria 824
363 Ga0157378_12285943 3300013297 Bacteria 592
364 Ga0163162_10002808 3300013306 Bacteria 16565
365 Ga0163162_10091073 3300013306 Bacteria 3132
366 Ga0163162_10733765 3300013306 Bacteria 1108
367 Ga0163162_12823541 3300013306 Bacteria 559
368 Ga0157372_10006319 3300013307 Bacteria 12605
369 Ga0157372_10149591 3300013307 Bacteria 2694
370 Ga0157372_11466986 3300013307 Bacteria 786
371 Ga0157375_10017320 3300013308 Bacteria 6500
372 Ga0157375_10139581 3300013308 Bacteria 2550
373 Ga0157375_10225018 3300013308 Bacteria 2035
374 Ga0157375_10769970 3300013308 Bacteria 1113
375 Ga0157375_10786964 3300013308 Bacteria 1101
376 Ga0157375_11157478 3300013308 Bacteria 906
377 Ga0157375_11976728 3300013308 Bacteria 693
378 Ga0163163_10058326 3300014325 Bacteria 3817
379 Ga0163163_10191430 3300014325 Bacteria 2094
380 Ga0163163_10423346 3300014325 Bacteria 1390
381 Ga0163163_10756181 3300014325 Bacteria 1035
382 Ga0157380_10000136 3300014326 Bacteria 41118
383 Ga0157380_10249743 3300014326 Bacteria 1605
384 Ga0157380_10429896 3300014326 Bacteria 1262
385 Ga0157380_11649491 3300014326 Bacteria 698
386 Ga0157377_10175419 3300014745 Bacteria 1344
387 Ga0157377_10233756 3300014745 Bacteria 1183
388 Ga0157377_10863597 3300014745 Bacteria 673
389 Ga0157379_10038088 3300014968 Bacteria 4290
390 Ga0157379_10070088 3300014968 Bacteria 3136
391 Ga0157379_10130207 3300014968 Bacteria 2264
392 Ga0157379_11428335 3300014968 Bacteria 671
393 Ga0157376_10399308 3300014969 Bacteria 1329
394 Ga0157376_10444398 3300014969 Bacteria 1263
395 Ga0157376_12567272 3300014969 Bacteria 549
396 Ga0163161_10014033 3300017792 Bacteria 5578
397 Ga0163161_10083548 3300017792 Bacteria 2354
398 Ga0163161_10180097 3300017792 Bacteria 1620
399 Ga0163161_10839847 3300017792 Bacteria 774
400 Ga0163161_11408352 3300017792 Bacteria 609
401 Ga0213876_10530277 3300021384 Bacteria 627
402 Ga0209673_1028999 3300025273 Bacteria 1769
403 Ga0209025_1068996 3300025294 Bacteria 1266
404 Ga0209051_1000107 3300025303 Bacteria 157903
405 Ga0209051_1000122 3300025303 Bacteria 144507
406 Ga0209051_1001174 3300025303 Bacteria 23776
407 Ga0209051_1001471 3300025303 Bacteria 19929
408 Ga0209051_1022917 3300025303 Bacteria 2613
409 Ga0209051_1044453 3300025303 Bacteria 1546
410 Ga0207653_10243734 3300025885 Bacteria 687
411 Ga0207692_10001286 3300025898 Bacteria 9318
412 Ga0207692_10014299 3300025898 Bacteria 3465
413 Ga0207692_10283322 3300025898 Bacteria 1003
414 Ga0207642_10001214 3300025899 Bacteria 7975
415 Ga0207710_10000213 3300025900 Bacteria 51731
416 Ga0207710_10008148 3300025900 Bacteria 4424
417 Ga0207710_10185684 3300025900 Bacteria 1022
418 Ga0207710_10676890 3300025900 Bacteria 541
419 Ga0207688_10003068 3300025901 Bacteria 9113
420 Ga0207688_10005491 3300025901 Bacteria 6895
421 Ga0207688_10075820 3300025901 Bacteria 1915
422 Ga0207688_10753573 3300025901 Bacteria 617
423 Ga0207680_10072589 3300025903 Bacteria 2137
424 Ga0207680_10138610 3300025903 Bacteria 1611
425 Ga0207680_10338675 3300025903 Bacteria 1055
426 Ga0207685_10199934 3300025905 Bacteria 938
427 Ga0207685_10218094 3300025905 Bacteria 906
428 Ga0207699_10060695 3300025906 Bacteria 2272
429 Ga0207699_10417116 3300025906 Bacteria 958
430 Ga0207699_11478221 3300025906 Bacteria 503
431 Ga0207645_10004061 3300025907 Bacteria 10909
432 Ga0207643_10253687 3300025908 Bacteria 1084
433 Ga0207643_10487409 3300025908 Bacteria 787
434 Ga0207654_10077866 3300025911 Bacteria 1989
435 Ga0207654_10233114 3300025911 Bacteria 1227
436 Ga0207671_10014745 3300025914 Bacteria 6162
437 Ga0207671_10021340 3300025914 Bacteria 4914
438 Ga0207671_10031936 3300025914 Bacteria 3921
439 Ga0207693_10000507 3300025915 Bacteria 35136
440 Ga0207693_10003394 3300025915 Bacteria 13607
441 Ga0207663_10005170 3300025916 Bacteria 6565
442 Ga0207662_10211461 3300025918 Bacteria 1259
443 Ga0207662_10226473 3300025918 Bacteria 1219
444 Ga0207657_10023320 3300025919 Bacteria 5765
445 Ga0207657_10102233 3300025919 Bacteria 2377
446 Ga0207652_11251564 3300025921 Bacteria 644
447 Ga0207646_10399719 3300025922 Bacteria 1241
448 Ga0207681_10000866 3300025923 Bacteria 19891
449 Ga0207681_10042605 3300025923 Bacteria 3033
450 Ga0207681_10130610 3300025923 Bacteria 1857
451 Ga0207694_10145782 3300025924 Bacteria 1906
452 Ga0207694_10155070 3300025924 Bacteria 1847
453 Ga0207694_10837086 3300025924 Bacteria 777
454 Ga0207694_11660843 3300025924 Bacteria 538
455 Ga0207650_10109673 3300025925 Bacteria 2135
456 Ga0207659_10426038 3300025926 Bacteria 1114
457 Ga0207687_10009541 3300025927 Bacteria 6348
458 Ga0207687_10013417 3300025927 Bacteria 5349
459 Ga0207687_10350125 3300025927 Bacteria 1203
460 Ga0207664_10156204 3300025929 Bacteria 1942
461 Ga0207664_10396737 3300025929 Bacteria 1226
462 Ga0207664_10427349 3300025929 Bacteria 1180
463 Ga0207644_10027298 3300025931 Bacteria 3943
464 Ga0207644_10158883 3300025931 Bacteria 1755
465 Ga0207644_10197549 3300025931 Bacteria 1585
466 Ga0207644_10266659 3300025931 Bacteria 1371
467 Ga0207644_11423607 3300025931 Bacteria 582
468 Ga0207690_10132747 3300025932 Bacteria 1824
469 Ga0207690_10224812 3300025932 Bacteria 1438
470 Ga0207690_11020278 3300025932 Bacteria 688
471 Ga0207706_10001533 3300025933 Bacteria 22933
472 Ga0207686_10001322 3300025934 Bacteria 14150
473 Ga0207709_10085607 3300025935 Bacteria 2044
474 Ga0207709_10412239 3300025935 Bacteria 1036
475 Ga0207670_10104442 3300025936 Bacteria 2029
476 Ga0207670_11074164 3300025936 Bacteria 679
477 Ga0207670_11705969 3300025936 Bacteria 536
478 Ga0207670_11936265 3300025936 Bacteria 501
479 Ga0207669_10001482 3300025937 Bacteria 10023
480 Ga0207669_10158989 3300025937 Bacteria 1593
481 Ga0207669_10291106 3300025937 Bacteria 1237
482 Ga0207704_10128721 3300025938 Bacteria 1748
483 Ga0207665_10005493 3300025939 Bacteria 8460
484 Ga0207665_10015885 3300025939 Bacteria 4942
485 Ga0207665_10887760 3300025939 Bacteria 707
486 Ga0207665_10901349 3300025939 Bacteria 701
487 Ga0207691_10391942 3300025940 Bacteria 1185
488 Ga0207691_10440882 3300025940 Bacteria 1109
489 Ga0207711_10000753 3300025941 Bacteria 31755
490 Ga0207711_10020273 3300025941 Bacteria 5541
491 Ga0207711_10112050 3300025941 Bacteria 2428
492 Ga0207711_10374239 3300025941 Bacteria 1321
493 Ga0207711_10997712 3300025941 Bacteria 777
494 Ga0207711_11023253 3300025941 Bacteria 766
495 Ga0207689_10012131 3300025942 Bacteria 7375
496 Ga0207689_10055897 3300025942 Bacteria 3247
497 Ga0207667_10319758 3300025949 Bacteria 1585
498 Ga0207667_10634600 3300025949 Bacteria 1075
499 Ga0207651_11705602 3300025960 Bacteria 567
500 Ga0207712_10000018 3300025961 Bacteria 317921
501 Ga0207712_10130790 3300025961 Bacteria 1913
502 Ga0207712_10269342 3300025961 Bacteria 1385
503 Ga0207712_10313007 3300025961 Bacteria 1293
504 Ga0207668_10000770 3300025972 Bacteria 19610
505 Ga0207668_10016773 3300025972 Bacteria 4578
506 Ga0207668_10208317 3300025972 Bacteria 1562
507 Ga0207668_10232143 3300025972 Bacteria 1488
508 Ga0207668_10723113 3300025972 Bacteria 876
509 Ga0207640_10049671 3300025981 Bacteria 2717
510 Ga0207640_10121950 3300025981 Bacteria 1869
511 Ga0207658_10000383 3300025986 Bacteria 43201
512 Ga0207658_10004854 3300025986 Bacteria 9293
513 Ga0207658_10010991 3300025986 Bacteria 6165
514 Ga0207658_10011237 3300025986 Bacteria 6100
515 Ga0207658_10890683 3300025986 Bacteria 810
516 Ga0207658_10917992 3300025986 Bacteria 797
517 Ga0207658_10971359 3300025986 Bacteria 774
518 Ga0207677_10002864 3300026023 Bacteria 9103
519 Ga0207677_10201803 3300026023 Bacteria 1581
520 Ga0207677_10364941 3300026023 Bacteria 1214
521 Ga0207677_10622158 3300026023 Bacteria 950
522 Ga0207703_10000920 3300026035 Bacteria 28669
523 Ga0207703_10013422 3300026035 Bacteria 6381
524 Ga0207703_10259384 3300026035 Bacteria 1571
525 Ga0207703_10543410 3300026035 Bacteria 1095
526 Ga0207703_10580612 3300026035 Bacteria 1059
527 Ga0207703_10716983 3300026035 Bacteria 952
528 Ga0207639_10005136 3300026041 Bacteria 8822
529 Ga0207639_10016036 3300026041 Bacteria 5292
530 Ga0207639_10973174 3300026041 Bacteria 794
531 Ga0207678_10003253 3300026067 Bacteria 14661
532 Ga0207678_10015024 3300026067 Bacteria 6812
533 Ga0207678_10670745 3300026067 Bacteria 911
534 Ga0207678_10904505 3300026067 Bacteria 780
535 Ga0207708_10351959 3300026075 Bacteria 1208
536 Ga0207702_10267532 3300026078 Bacteria 1611
537 Ga0207641_10002928 3300026088 Bacteria 15449
538 Ga0207641_10029024 3300026088 Bacteria 4573
539 Ga0207641_10414173 3300026088 Bacteria 1296
540 Ga0207641_11833624 3300026088 Bacteria 608
541 Ga0207648_10021128 3300026089 Bacteria 5852
542 Ga0207648_10028299 3300026089 Bacteria 4970
543 Ga0207648_12033040 3300026089 Bacteria 536
544 Ga0207676_10070294 3300026095 Bacteria 2807
545 Ga0207676_10188226 3300026095 Bacteria 1814
546 Ga0207676_11258609 3300026095 Bacteria 734
547 Ga0207676_11469946 3300026095 Bacteria 678
548 Ga0207675_100000544 3300026118 Bacteria 36830
549 Ga0207675_100015163 3300026118 Bacteria 7187
550 Ga0207675_100172690 3300026118 Bacteria 2067
551 Ga0207675_100517790 3300026118 Bacteria 1189
552 Ga0207675_101833233 3300026118 Bacteria 626
553 Ga0207683_10000335 3300026121 Bacteria 42789
554 Ga0207683_10057779 3300026121 Bacteria 3405
555 Ga0207683_10451543 3300026121 Bacteria 1185
556 Ga0207683_10614671 3300026121 Bacteria 1006
557 Ga0207683_12012714 3300026121 Bacteria 526
558 Ga0207698_10138786 3300026142 Bacteria 2090
559 Ga0207698_10153911 3300026142 Bacteria 2000
560 Ga0207698_10229905 3300026142 Bacteria 1683
561 Ga0207428_10533328 3300027907 Bacteria 850
562 Ga0268266_10032648 3300028379 Bacteria 4423
563 Ga0268266_10190460 3300028379 Bacteria 1872
564 Ga0268266_10378892 3300028379 Bacteria 1334
565 Ga0268266_10590424 3300028379 Bacteria 1066
566 Ga0268266_10652806 3300028379 Bacteria 1012
567 Ga0268266_12060892 3300028379 Bacteria 544
568 Ga0268265_10000159 3300028380 Bacteria 82592
569 Ga0268265_10044071 3300028380 Bacteria 3320
570 Ga0268265_10194523 3300028380 Bacteria 1754
571 Ga0268265_10756464 3300028380 Bacteria 943
572 Ga0268264_10000005 3300028381 Bacteria 934972
573 Ga0268264_10001041 3300028381 Bacteria 27858
574 Ga0268264_10294371 3300028381 Bacteria 1526
575 Ga0268264_10511651 3300028381 Bacteria 1172
576 Ga0268264_11975181 3300028381 Bacteria 593
577 Ga0265327_10004280 3300031251 Bacteria 12774
578 Ga0307513_10743679 3300031456 Bacteria 686
579 Ga0307408_100762940 3300031548 Bacteria 875
580 Ga0307413_10115722 3300031824 Bacteria 1805
581 Ga0307413_10377010 3300031824 Bacteria 1104
582 Ga0307413_10500894 3300031824 Bacteria 975
583 Ga0307410_10015784 3300031852 Bacteria 4488
584 Ga0307410_11122565 3300031852 Bacteria 682
585 Ga0307406_10048745 3300031901 Bacteria 2677
586 Ga0307406_10539594 3300031901 Bacteria 952
587 Ga0307412_10041003 3300031911 Bacteria 2998
588 Ga0307409_100000649 3300031995 Bacteria 15381
589 Ga0307409_101232462 3300031995 Bacteria 772
590 Ga0307416_100002172 3300032002 Bacteria 11117
591 Ga0307416_101879339 3300032002 Bacteria 702
592 Ga0307414_11351095 3300032004 Bacteria 662
593 Ga0307411_10124695 3300032005 Bacteria 1871
594 Ga0307411_10188989 3300032005 Bacteria 1571
595 Ga0307411_10216432 3300032005 Bacteria 1483
596 Ga0307415_100043135 3300032126 Bacteria 3007
597 Ga0316580_10169555 3300032139 Bacteria 671
598 Ga0316593_10147375 3300032168 Bacteria 855
599 Ga0316592_1084493 3300033524 Bacteria 724
600 Ga0316596_1078760 3300033541 Bacteria 885
601 Ga0373949_0138647 3300035090 Bacteria 695
602 Ga0373951_0102485 3300035091 Bacteria 762
603 Ga0373943_0268297 3300035170 Bacteria 962
604 Ga0373962_0048327 3300035242 Bacteria 1220
605 Ga0373931_0042807 3300035691 Bacteria 2382
606 Ga0373931_0276572 3300035691 Bacteria 1029
607 Ga0373937_0616162 3300036401 Bacteria 1030
608 Ga0316584_0073524 3300036712 Bacteria 2562
609 Ga0436365_1279297 3300039437 Bacteria 559
610 Ga0436363_0907136 3300039450 Bacteria 886
611 Ga0436363_1032215 3300039450 Bacteria 2224
612 Ga0436363_1100965 3300039450 Bacteria 3035
613 Ga0439461_0017272 3300041410 Bacteria 1401
614 Ga0439461_0164438 3300041410 Bacteria 580
615 Ga0439466_0003336 3300041411 Bacteria 6244
616 Ga0439466_0005429 3300041411 Bacteria 4872
617 Ga0439466_0021376 3300041411 Bacteria 2294
618 Ga0439466_0044833 3300041411 Bacteria 1464
619 Ga0439465_0002390 3300041413 Bacteria 6141
620 Ga0439465_0007690 3300041413 Bacteria 3420
621 Ga0439465_0050299 3300041413 Bacteria 1363
622 Ga0451789_0678462 3300041443 Bacteria 895
623 Ga0451789_0888216 3300041443 Bacteria 1292
624 Ga0451794_05147 3300041446 Bacteria 562
625 Ga0451793_0184391 3300041452 Bacteria 2532
626 Ga0451793_0614440 3300041452 Bacteria 634
627 Ga0451797_1156091 3300041453 Bacteria 509
628 Ga0451798_0260113 3300041458 Bacteria 942
629 Ga0451802_1339380 3300041460 Bacteria 1854
630 Ga0451802_1992298 3300041460 Bacteria 641
631 Ga0451807_1241670 3300041486 Bacteria 1189
632 Ga0451841_0303713 3300041498 Bacteria 576
633 Ga0451841_1061137 3300041498 Bacteria 1461
634 Ga0451847_0431962 3300041503 Bacteria 843
635 Ga0451847_0576711 3300041503 Bacteria 842
636 Ga0451843_0772406 3300041509 Bacteria 724
637 Ga0451853_1496362 3300041512 Bacteria 521
638 Ga0439431_0000416 3300041997 Bacteria 8993
639 Ga0439431_0066392 3300041997 Bacteria 956
640 Ga0439442_034471 3300042002 Bacteria 1058
641 Ga0439442_082748 3300042002 Bacteria 688
642 Ga0439445_0001277 3300042004 Bacteria 5451
643 Ga0439445_0006277 3300042004 Bacteria 2730
644 Ga0439445_0009255 3300042004 Bacteria 2319
645 Ga0439448_0035093 3300042005 Bacteria 1605
646 Ga0439450_151198 3300042008 Bacteria 609
647 Ga0439434_0001827 3300042435 Bacteria 6189
648 Ga0439434_0002991 3300042435 Bacteria 4949
649 Ga0439434_0065829 3300042435 Bacteria 1137
650 Ga0439434_0112473 3300042435 Bacteria 883
651 Ga0466972_0014330 3300044658 Bacteria 3972
652 Ga0466972_0014708 3300044658 Bacteria 3915
653 Ga0466972_0044291 3300044658 Bacteria 2159
654 Ga0466972_0120226 3300044658 Bacteria 1239
655 Ga0466972_0566073 3300044658 Bacteria 536
656 Ga0466965_0002913 3300044683 Bacteria 7397
657 Ga0466965_0008663 3300044683 Bacteria 4708
658 Ga0466965_0029923 3300044683 Bacteria 2651
659 Ga0466965_0083523 3300044683 Bacteria 1617
660 Ga0466965_0102931 3300044683 Bacteria 1461
661 Ga0466965_0235939 3300044683 Bacteria 978
662 Ga0466965_0248482 3300044683 Bacteria 954
663 Ga0466965_0356052 3300044683 Bacteria 802
664 Ga0466961_0074698 3300044693 Bacteria 2149
665 Ga0466963_0228127 3300044694 Bacteria 1305
666 Ga0466964_0190974 3300044706 Bacteria 977
667 Ga0466971_0092650 3300044719 Bacteria 1384
668 Ga0466968_0004772 3300044735 Bacteria 5075
669 Ga0466968_0039664 3300044735 Bacteria 1983
670 Ga0466968_0048793 3300044735 Bacteria 1802
671 Ga0466970_0021122 3300044765 Bacteria 3388
672 Ga0466970_0027961 3300044765 Bacteria 2962
673 Ga0466970_0204061 3300044765 Bacteria 1100
674 Ga0466970_0223349 3300044765 Bacteria 1051
675 Ga0466970_0299152 3300044765 Bacteria 907
676 Ga0466970_0379278 3300044765 Bacteria 805
677 Ga0466957_0292223 3300044842 Bacteria 1093
678 Ga0466957_0311111 3300044842 Bacteria 1060
679 Ga0466957_0312379 3300044842 Bacteria 1059
680 Ga0466960_0001158 3300044901 Bacteria 9481
681 Ga0466960_0006575 3300044901 Bacteria 4669
682 Ga0466960_0282784 3300044901 Bacteria 930
683 Ga0466959_0030872 3300045049 Bacteria 3967
684 Ga0466959_0124827 3300045049 Bacteria 1827
685 Ga0466958_0079095 3300045836 Bacteria 2021
686 Ga0466967_0006912 3300045976 Bacteria 8109
687 Ga0466967_0032235 3300045976 Bacteria 4422
688 Ga0466967_0167085 3300045976 Bacteria 2068
689 Ga0466967_0176662 3300045976 Bacteria 2012
690 Ga0466967_0304473 3300045976 Bacteria 1534
691 Ga0466967_1395681 3300045976 Bacteria 698
692 Ga0495603_0049300 3300046455 Bacteria 2507
693 Ga0495629_0201647 3300046459 Bacteria 1375
694 Ga0495638_0007924 3300046460 Bacteria 7577
695 Ga0495638_0014570 3300046460 Bacteria 5308
696 Ga0495641_0012759 3300046461 Bacteria 4671
697 Ga0495582_0074468 3300046473 Bacteria 1880
698 Ga0495639_0079198 3300046475 Bacteria 1528
699 Ga0495664_0277376 3300046477 Bacteria 1013
700 Ga0495594_0174458 3300046499 Bacteria 1223
701 Ga0495596_0426665 3300046500 Bacteria 517
702 Ga0495606_0027477 3300046507 Bacteria 4034
703 Ga0495608_0723202 3300046511 Bacteria 591
704 Ga0495618_0911616 3300046514 Bacteria 507
705 Ga0495630_0145905 3300046517 Bacteria 1800
706 Ga0495648_0006968 3300046524 Bacteria 9115
707 Ga0495654_0076250 3300046530 Bacteria 1580
708 Ga0495665_0120992 3300046531 Bacteria 1371
709 Ga0495640_0077984 3300046533 Bacteria 2208
710 Ga0495668_0246567 3300046616 Bacteria 978
711 Ga0495634_0703167 3300046642 Bacteria 581
712 Ga0495611_0057947 3300046648 Bacteria 1756
713 Ga0495658_0078982 3300046683 Bacteria 1927
714 Ga0495671_0367385 3300046692 Bacteria 690
715 Ga0495604_0642552 3300047317 Bacteria 677
716 Ga0495674_0557760 3300047319 Bacteria 911
717 Ga0495672_0000892 3300047320 Bacteria 31349
718 Ga0495672_0085389 3300047320 Bacteria 1749
719 Ga0495672_0108020 3300047320 Bacteria 1498
720 Ga0495672_0130773 3300047320 Bacteria 1321
721 Ga0495680_0592854 3300047322 Bacteria 742
722 Ga0495673_0002880 3300047469 Bacteria 11698
723 Ga0495686_0139406 3300047472 Bacteria 1432
724 Ga0495593_0060093 3300047673 Bacteria 1990
725 Ga0495614_0535713 3300048089 Bacteria 559
726 Ga0495626_0174226 3300048091 Bacteria 895
727 Ga0495626_0257863 3300048091 Bacteria 698
728 Ga0496100_0000033 3300048903 Bacteria 98762
729 Ga0496100_0000307 3300048903 Bacteria 24158
730 Ga0496100_0000383 3300048903 Bacteria 21527
731 Ga0496100_0001064 3300048903 Bacteria 13233
732 Ga0496100_0025799 3300048903 Bacteria 3596
733 Ga0496100_0683213 3300048903 Bacteria 801
734 Ga0496101_0000008 3300048904 Bacteria 309720
735 Ga0496101_0000033 3300048904 Bacteria 183191
736 Ga0496101_0000270 3300048904 Bacteria 36620
737 Ga0496101_0003204 3300048904 Bacteria 10146
738 Ga0496101_0054409 3300048904 Bacteria 2890
739 Ga0496101_0155368 3300048904 Bacteria 1752
740 Ga0496101_0165900 3300048904 Bacteria 1695
741 Ga0496101_0431825 3300048904 Bacteria 1039
742 Ga0496101_0750292 3300048904 Bacteria 770
743 Ga0496102_0000005 3300048905 Bacteria 481937
744 Ga0496102_0000257 3300048905 Bacteria 69091
745 Ga0496102_0003067 3300048905 Bacteria 14142
746 Ga0496102_0004668 3300048905 Bacteria 11588
747 Ga0496102_0154202 3300048905 Bacteria 2159
748 Ga0496102_0285735 3300048905 Bacteria 1555
749 Ga0496102_0495546 3300048905 Bacteria 1143
750 Ga0496103_0000002 3300048906 Bacteria 605387
751 Ga0496103_0000393 3300048906 Bacteria 38826
752 Ga0496103_0000540 3300048906 Bacteria 30387
753 Ga0496103_0002854 3300048906 Bacteria 10742
754 Ga0496103_0374717 3300048906 Bacteria 915
755 Ga0496103_0512000 3300048906 Bacteria 767
756 Ga0496104_0004313 3300048907 Bacteria 12371
757 Ga0496104_0010659 3300048907 Bacteria 8214
758 Ga0496104_0229871 3300048907 Bacteria 1767
759 Ga0496104_0363310 3300048907 Bacteria 1360
760 Ga0496104_0754340 3300048907 Bacteria 880
761 Ga0496105_0019662 3300048908 Bacteria 5449
762 Ga0496105_0435057 3300048908 Bacteria 1037
763 Ga0496105_0484214 3300048908 Bacteria 973
764 Ga0496105_0506221 3300048908 Bacteria 947
765 Ga0496105_0758351 3300048908 Bacteria 741
766 Ga0496105_1221028 3300048908 Bacteria 553
767 Ga0496106_0000615 3300048909 Bacteria 25459
768 Ga0496106_0000777 3300048909 Bacteria 23032
769 Ga0496106_0012783 3300048909 Bacteria 6197
770 Ga0496106_0040081 3300048909 Bacteria 3506
771 Ga0496106_0174404 3300048909 Bacteria 1705
772 Ga0496106_0418838 3300048909 Bacteria 1076
773 Ga0496107_0000083 3300048910 Bacteria 45218
774 Ga0496107_0001171 3300048910 Bacteria 15903
775 Ga0496107_0005215 3300048910 Bacteria 8872
776 Ga0496107_0006327 3300048910 Bacteria 8140
777 Ga0496107_0062955 3300048910 Bacteria 2688
778 Ga0496107_0206319 3300048910 Bacteria 1461
779 Ga0496107_0206985 3300048910 Bacteria 1458
780 Ga0496108_0002478 3300048911 Bacteria 14776
781 Ga0496108_0003256 3300048911 Bacteria 13053
782 Ga0496108_0076780 3300048911 Bacteria 2824
783 Ga0496108_0093861 3300048911 Bacteria 2553
784 Ga0496108_0159426 3300048911 Bacteria 1949
785 Ga0496108_0248223 3300048911 Bacteria 1548
786 Ga0496108_0284525 3300048911 Bacteria 1439
787 Ga0496109_0000293 3300048912 Bacteria 47411
788 Ga0496109_0001978 3300048912 Bacteria 16987
789 Ga0496109_0038037 3300048912 Bacteria 4349
790 Ga0496109_0092322 3300048912 Bacteria 2800
791 Ga0496109_0167328 3300048912 Bacteria 2062
792 Ga0496109_0328787 3300048912 Bacteria 1443
793 Ga0496109_0473721 3300048912 Bacteria 1182
794 Ga0496109_0799007 3300048912 Bacteria 881
795 Ga0496110_0029596 3300048913 Bacteria 4715
796 Ga0496110_0042318 3300048913 Bacteria 3976
797 Ga0496110_0066830 3300048913 Bacteria 3179
798 Ga0496110_0251986 3300048913 Bacteria 1607
799 Ga0496110_0290617 3300048913 Bacteria 1489
800 Ga0496110_0600110 3300048913 Bacteria 999
801 Ga0496111_0016877 3300048914 Bacteria 5039
802 Ga0496111_0184564 3300048914 Bacteria 1551
803 Ga0496112_0047284 3300048915 Bacteria 4221
804 Ga0496112_0083953 3300048915 Bacteria 3150
805 Ga0496112_0086710 3300048915 Bacteria 3097
806 Ga0496112_0108326 3300048915 Bacteria 2748
807 Ga0496112_0278301 3300048915 Bacteria 1621
808 Ga0496112_0377459 3300048915 Bacteria 1359
809 Ga0496112_0489533 3300048915 Bacteria 1166
810 Ga0496112_0764416 3300048915 Bacteria 892
811 Ga0496113_0004725 3300048916 Bacteria 8408
812 Ga0496113_0073302 3300048916 Bacteria 2608
813 Ga0496113_0294515 3300048916 Bacteria 1299
814 Ga0496113_0372642 3300048916 Bacteria 1146
815 Ga0496113_0386083 3300048916 Bacteria 1124
816 Ga0496113_0858603 3300048916 Bacteria 719
817 Ga0496114_0000517 3300048917 Bacteria 28403
818 Ga0496114_0002766 3300048917 Bacteria 13427
819 Ga0496114_0010038 3300048917 Bacteria 7528
820 Ga0496114_0917726 3300048917 Bacteria 757
821 Ga0496114_1083034 3300048917 Bacteria 686
822 Ga0496115_0008855 3300048918 Bacteria 7460
823 Ga0496115_0134115 3300048918 Bacteria 2042
824 Ga0496115_1238275 3300048918 Bacteria 559
825 Ga0496115_1315795 3300048918 Bacteria 537
826 Ga0496116_0000034 3300048919 Bacteria 409567
827 Ga0496116_0001049 3300048919 Bacteria 33626
828 Ga0496116_0033542 3300048919 Bacteria 3642
829 Ga0496117_0000003 3300048920 Bacteria 1881097
830 Ga0496117_0000390 3300048920 Bacteria 75361
831 Ga0496117_0002218 3300048920 Bacteria 25147
832 Ga0496118_0000001 3300048921 Bacteria 1881100
833 Ga0496118_0002226 3300048921 Bacteria 26786
834 Ga0496118_0010693 3300048921 Bacteria 9047
835 Ga0496118_0509823 3300048921 Bacteria 596
836 Ga0496119_0001001 3300048922 Bacteria 36211
837 Ga0496119_0013888 3300048922 Bacteria 6357
838 Ga0496119_0015314 3300048922 Bacteria 5916
839 Ga0496119_0508129 3300048922 Bacteria 560
840 Ga0496120_0000241 3300048923 Bacteria 93282
841 Ga0496120_0047544 3300048923 Bacteria 2473
842 Ga0496120_0054340 3300048923 Bacteria 2270
843 Ga0496121_0000002 3300048924 Bacteria 1494588
844 Ga0496121_0000421 3300048924 Bacteria 83629
845 Ga0496121_0002203 3300048924 Bacteria 30428
846 Ga0496121_0401867 3300048924 Bacteria 897
847 Ga0496122_0000051 3300048925 Bacteria 265104
848 Ga0496122_0005578 3300048925 Bacteria 14897
849 Ga0496122_0514235 3300048925 Bacteria 579
850 Ga0496123_0001082 3300048926 Bacteria 41071
851 Ga0496123_0011189 3300048926 Bacteria 7809
852 Ga0496123_0179182 3300048926 Bacteria 1109
853 Ga0496124_0000002 3300048927 Bacteria 1494588
854 Ga0496124_0203268 3300048927 Bacteria 1504
855 Ga0496124_0925621 3300048927 Bacteria 526
856 Ga0496125_0000002 3300048928 Bacteria 1480920
857 Ga0496125_0023269 3300048928 Bacteria 5722
858 Ga0496126_0000011 3300048929 Bacteria 744275
859 Ga0496126_0000805 3300048929 Bacteria 56108
860 Ga0496126_0010992 3300048929 Bacteria 9418
861 Ga0496126_0012617 3300048929 Bacteria 8647
862 Ga0496126_0533481 3300048929 Bacteria 934
863 Ga0496126_0764614 3300048929 Bacteria 744
864 Ga0501032_0009298 3300049569 Bacteria 7119
865 Ga0501033_0212694 3300049570 Bacteria 1378
866 Ga0501034_0014878 3300049571 Bacteria 8003
867 Ga0501034_0061168 3300049571 Bacteria 3783
868 Ga0501036_0033970 3300049572 Bacteria 4314
869 Ga0501036_0216437 3300049572 Bacteria 1609
870 Ga0501037_0001465 3300049573 Bacteria 17304
871 Ga0501040_0268460 3300049576 Bacteria 1218
872 Ga0501043_0001059 3300049579 Bacteria 24169
873 Ga0501047_0001744 3300049581 Bacteria 21072
874 Ga0501047_0004294 3300049581 Bacteria 13412
875 Ga0501047_0911358 3300049581 Bacteria 692
876 Ga0501068_0635386 3300049584 Bacteria 696
877 Ga0501069_0015109 3300049585 Bacteria 4136
878 Ga0501070_0001045 3300049586 Bacteria 24930
879 Ga0501070_0090058 3300049586 Bacteria 2539
880 Ga0501070_0093122 3300049586 Bacteria 2493
881 Ga0501070_0331554 3300049586 Bacteria 1237
882 Ga0501071_0735291 3300049587 Bacteria 760
883 Ga0501077_0324311 3300049593 Bacteria 982
884 Ga0501079_0958133 3300049741 Bacteria 674
885 Ga0501080_0763685 3300049742 Bacteria 850
886 Ga0501080_1745031 3300049742 Bacteria 524
887 Ga0501035_0000824 3300049822 Bacteria 33083
888 Ga0501044_0000400 3300049823 Bacteria 53515
889 Ga0501044_0022680 3300049823 Bacteria 6685
890 Ga0501044_1245389 3300049823 Bacteria 611
891 nmdc:mga03683_282316_c1 3300050489 Bacteria 776
892 nmdc:mga03683_391298_c1 3300050489 Bacteria 663
893 nmdc:mga03683_41391_c1 3300050489 Bacteria 1892
894 nmdc:mga03683_47067_c1 3300050489 Bacteria 1789
895 nmdc:mga03683_4742_c1 3300050489 Bacteria 4535
896 nmdc:mga03683_49033_c1 3300050489 Bacteria 1242
897 nmdc:mga03683_63873_c1 3300050489 Bacteria 855
898 nmdc:mga03n38_14398_c1 3300050490 Bacteria 3030
899 nmdc:mga03n38_271052_c1 3300050490 Bacteria 903
900 nmdc:mga03n38_2737_c1 3300050490 Bacteria 5521
901 nmdc:mga03n38_284722_c1 3300050490 Bacteria 883
902 nmdc:mga03n38_294500_c1 3300050490 Bacteria 870
903 nmdc:mga03n38_336848_c1 3300050490 Bacteria 818
904 nmdc:mga03n38_355895_c1 3300050490 Bacteria 798
905 nmdc:mga03n38_561408_c1 3300050490 Bacteria 647
906 nmdc:mga03n38_7697_c1 3300050490 Bacteria 3823
907 nmdc:mga03n38_77171_c1 3300050490 Bacteria 1556
908 nmdc:mga03n38_7949_c1 3300050490 Bacteria 3777
909 nmdc:mga03n38_797118_c1 3300050490 Bacteria 550
910 nmdc:mga03n38_942519_c1 3300050490 Bacteria 509
911 nmdc:mga00v17_133133_c1 3300050491 Bacteria 1590
912 nmdc:mga00v17_166783_c1 3300050491 Bacteria 1419
913 nmdc:mga00v17_16828_c1 3300050491 Bacteria 4127
914 nmdc:mga00v17_182570_c1 3300050491 Bacteria 1354
915 nmdc:mga00v17_1839_c1 3300050491 Bacteria 10962
916 nmdc:mga00v17_208391_c1 3300050491 Bacteria 1264
917 nmdc:mga00v17_26886_c1 3300050491 Bacteria 3356
918 nmdc:mga00v17_28589_c1 3300050491 Bacteria 3266
919 nmdc:mga00v17_290297_c1 3300050491 Bacteria 1062
920 nmdc:mga00v17_312725_c1 3300050491 Bacteria 1021
921 nmdc:mga00v17_381401_c1 3300050491 Bacteria 916
922 nmdc:mga00v17_464724_c1 3300050491 Bacteria 821
923 nmdc:mga0yw44_1049171_c1 3300050492 Bacteria 551
924 nmdc:mga0yw44_111276_c1 3300050492 Bacteria 1755
925 nmdc:mga0yw44_135112_c1 3300050492 Bacteria 1599
926 nmdc:mga0yw44_143301_c1 3300050492 Bacteria 1554
927 nmdc:mga0yw44_161414_c1 3300050492 Bacteria 1467
928 nmdc:mga0yw44_217996_c1 3300050492 Bacteria 1264
929 nmdc:mga0yw44_263583_c1 3300050492 Bacteria 1149
930 nmdc:mga0yw44_424311_c1 3300050492 Bacteria 900
931 nmdc:mga0yw44_442646_c1 3300050492 Bacteria 574
932 nmdc:mga0yw44_465326_c1 3300050492 Bacteria 857
933 nmdc:mga0yw44_569474_c1 3300050492 Bacteria 769
934 nmdc:mga0yw44_890157_c1 3300050492 Bacteria 604
935 nmdc:mga0yw44_95642_c1 3300050492 Bacteria 1885
936 nmdc:mga0k408_41793_c1 3300050493 Bacteria 2639
937 nmdc:mga0k408_469831_c1 3300050493 Bacteria 746
938 nmdc:mga06z11_55944_c1 3300050494 Bacteria 2039
939 nmdc:mga06z11_603453_c1 3300050494 Bacteria 668
940 nmdc:mga06z11_795004_c1 3300050494 Bacteria 576
941 nmdc:mga04h51_21305_c1 3300050495 Bacteria 1948
942 nmdc:mga04h51_85760_c1 3300050495 Bacteria 1125
943 nmdc:mga07m45_10218_c1 3300050496 Bacteria 4895
944 nmdc:mga07m45_118121_c1 3300050496 Bacteria 1531
945 nmdc:mga07m45_27866_c1 3300050496 Bacteria 3116
946 nmdc:mga07m45_42475_c1 3300050496 Bacteria 2549
947 nmdc:mga07m45_45201_c1 3300050496 Bacteria 2472
948 nmdc:mga07m45_795161_c1 3300050496 Bacteria 542
949 nmdc:mga05p37_1568544_c1 3300050507 Bacteria 651
950 nmdc:mga05p37_87296_c1 3300050507 Bacteria 3844
951 nmdc:mga0qj67_19994_c1 3300050509 Bacteria 5124
952 nmdc:mga0qj67_51566_c1 3300050509 Bacteria 3254
953 nmdc:mga06r32_32424_c1 3300050510 Bacteria 4915
954 nmdc:mga08y16_1646474_c1 3300050511 Bacteria 598
955 nmdc:mga0n895_388641_c1 3300050512 Bacteria 1411
956 nmdc:mga0a205_331119_c1 3300050515 Bacteria 1392
957 nmdc:mga0sz30_103073_c2 3300050516 Bacteria 955
958 nmdc:mga0sz30_113708_c1 3300050516 Bacteria 1187
959 nmdc:mga0sz30_17777_c1 3300050516 Bacteria 2839
960 nmdc:mga0sz30_19424_c1 3300050516 Bacteria 1649
961 nmdc:mga0sz30_2053_c1 3300050516 Bacteria 7196
962 nmdc:mga0sz30_219_c1 3300050516 Bacteria 21835
963 nmdc:mga0sz30_239062_c1 3300050516 Bacteria 808
964 nmdc:mga0sz30_247223_c1 3300050516 Bacteria 794
965 nmdc:mga0sz30_27081_c2 3300050516 Bacteria 1707
966 nmdc:mga0sz30_279571_c1 3300050516 Bacteria 744
967 Ga0500610_0072788 3300053079 Bacteria 1792
968 Ga0500635_0033168 3300053080 Bacteria 1683
969 Ga0500635_0068357 3300053080 Bacteria 1255
970 Ga0495619_0045764 3300053085 Bacteria 2875
971 Ga0500578_0768663 3300053086 Bacteria 512
972 Ga0500643_002732 3300053087 Bacteria 8852
973 Ga0500643_003257 3300053087 Bacteria 7908
974 Ga0500581_301034 3300053089 Bacteria 638
975 Ga0500646_0039744 3300053090 Bacteria 1321
976 Ga0500583_0287899 3300053092 Bacteria 806
977 Ga0500651_0142671 3300053093 Bacteria 1443
978 Ga0500566_0429975 3300053094 Bacteria 583
979 Ga0500650_0434409 3300053098 Bacteria 564
980 Ga0500556_0001801 3300053104 Bacteria 7928
981 Ga0500556_0053181 3300053104 Bacteria 1471
982 Ga0500562_005249 3300053108 Bacteria 3255
983 Ga0500572_309658 3300053111 Bacteria 507
984 Ga0500642_0055010 3300053130 Bacteria 1769
985 Ga0500652_000992 3300053131 Bacteria 9298
986 Ga0500559_0251104 3300053136 Bacteria 833
987 Ga0500577_0092628 3300053142 Bacteria 1224
988 Ga0500588_0366193 3300053146 Bacteria 548
989 Ga0500604_0049468 3300053151 Bacteria 1293
990 Ga0500616_0002892 3300053153 Bacteria 13757
991 Ga0500616_0008826 3300053153 Bacteria 6200
992 Ga0500616_0089755 3300053153 Bacteria 1525
993 Ga0500620_040274 3300053155 Bacteria 1530
994 Ga0500627_0017142 3300053158 Bacteria 2840
995 Ga0500627_0202190 3300053158 Bacteria 890
996 Ga0500633_0047396 3300053160 Bacteria 1470
997 Ga0500634_0234517 3300053161 Bacteria 776
998 Ga0500638_268237 3300053162 Bacteria 677
999 Ga0500645_000110 3300053730 Bacteria 65408
1000 Ga0500645_013051 3300053730 Bacteria 2675
1001 Ga0587084_155780 3300059477 Bacteria 505
1002 Ga0587090_146616 3300059510 Bacteria 532
1003 Ga0466962_0024515 3300061719 Bacteria 2898
1004 2644489575 2643221687 Bacteria 6500351
1005 2644635318 2643221715 Bacteria 6671032
1006 2738666449 2738541264 Bacteria 5935393
1007 2738707059 2738541274 Bacteria 6909446
1008 2739146373 2738541356 Bacteria 5935017
1009 2739333510 2738543028 Bacteria 6917070
1010 2842137138 2842134933 Bacteria 5847019
1011 2902799266 2902792274 Bacteria 7270173
1012 2902802144 2902799365 Bacteria 5419524
1013 2902813241 2902810491 Bacteria 6794147
1014 2902842358 2902837492 Bacteria 6697721
1015 2929214256 2929212328 Bacteria 7708288
1016 2939588021 2939582691 Bacteria 7088898
1017 Ga0207704_10000458
1018 CNXas_1000300
1019 CNXas_1005113
1020 JGI24746J21847_1011174
1021 JGI24747J21853_1015315
1022 JGI24739J22299_10049710
1023 JGI24737J22298_10012890
1024 JGI24737J22298_10063782
1025 JGI24737J22298_10239371
1026 JGI24743J22301_10122959
1027 JGI24750J21931_1010814
1028 JGI24748J21848_1008609
1029 JGI24748J21848_1042239
1030 JGI24749J21850_1027833
1031 JGI24744J21845_10000131
1032 JGI24034J26672_10007839
1033 JGI24742J22300_10000618
1034 JGI24742J22300_10008441
1035 JGI24751J29686_10011383
1036 Ga0055528_1035658
1037 Ga0055540_1000040
1038 Ga0055540_1004993
1039 Ga0055540_1024706
1040 Ga0055540_1074105
1041 Ga0065704_10454399
1042 Ga0070676_10028426
1043 Ga0070676_11392526
1044 Ga0070683_100183221
1045 Ga0070690_100007203
1046 Ga0070690_100730761
1047 Ga0070670_100086471
1048 Ga0068869_100030180
1049 Ga0068869_100267775
1050 Ga0070666_10034273
1051 Ga0070666_10845948
1052 Ga0070682_100047266
1053 Ga0070682_100084985
1054 Ga0070682_100210413
1055 Ga0070682_100524732
1056 Ga0068868_100000203
1057 Ga0068868_100131427
1058 Ga0068868_100134492
1059 Ga0068868_100635871
1060 Ga0068868_100826572
1061 Ga0070660_100954421
1062 Ga0070660_101627547
1063 Ga0070689_100054776
1064 Ga0070689_101679834
1065 Ga0070691_10000914
1066 Ga0070691_10134145
1067 Ga0070687_100124024
1068 Ga0070687_100549971
1069 Ga0070692_10216409
1070 Ga0070692_10229364
1071 Ga0070692_10796338
1072 Ga0070668_100000604
1073 Ga0070668_100015315
1074 Ga0070668_100053389
1075 Ga0070668_100269506
1076 Ga0070669_100000428
1077 Ga0070669_100005387
1078 Ga0070669_100211710
1079 Ga0070675_100745249
1080 Ga0070671_100006503
1081 Ga0070671_100043463
1082 Ga0070671_100194584
1083 Ga0070674_100000244
1084 Ga0070674_100461193
1085 Ga0070674_100626987
1086 Ga0070673_100304205
1087 Ga0070688_100002188
1088 Ga0070688_100026466
1089 Ga0070659_100100888
1090 Ga0070659_100636773
1091 Ga0070659_100680368
1092 Ga0070667_100000027
1093 Ga0070667_100004957
1094 Ga0070667_100016839
1095 Ga0070667_100095421
1096 Ga0070667_100123528
1097 Ga0070667_100446306
1098 Ga0070667_100448770
1099 Ga0070667_101050879
1100 Ga0070703_10038930
1101 Ga0070709_10056739
1102 Ga0070709_10060096
1103 Ga0070714_100018869
1104 Ga0070714_100410244
1105 Ga0070714_100705152
1106 Ga0070714_101606357
1107 Ga0070713_100118670
1108 Ga0070710_10001501
1109 Ga0070710_10014703
1110 Ga0070710_11149494
1111 Ga0070701_10016528
1112 Ga0070701_10394154
1113 Ga0070711_100001734
1114 Ga0070711_100005574
1115 Ga0070711_101509120
1116 Ga0070711_101877929
1117 Ga0070705_100004544
1118 Ga0070705_100851348
1119 Ga0070700_100321132
1120 Ga0070700_101227776
1121 Ga0070694_100004367
1122 Ga0070694_100443404
1123 Ga0070663_100021341
1124 Ga0070663_100449770
1125 Ga0070663_100952689
1126 Ga0070663_100969821
1127 Ga0070663_101257211
1128 Ga0070663_101855550
1129 Ga0070678_100001046
1130 Ga0070678_100071210
1131 Ga0070678_100478191
1132 Ga0070678_101868519
1133 Ga0070662_100003739
1134 Ga0070662_100196172
1135 Ga0070662_101374459
1136 Ga0068867_100001211
1137 Ga0068867_101418114
1138 Ga0068867_102030788
1139 Ga0070685_10505789
1140 Ga0070685_10525354
1141 Ga0070685_11002428
1142 Ga0070684_100281500
1143 Ga0068853_100164539
1144 Ga0068853_100849565
1145 Ga0070672_100034746
1146 Ga0070672_100977005
1147 Ga0070686_100081511
1148 Ga0070686_100577112
1149 Ga0070686_100807117
1150 Ga0070695_100002690
1151 Ga0070695_100057660
1152 Ga0070696_100004046
1153 Ga0070693_100025200
1154 Ga0070693_101118011
1155 Ga0070665_100046895
1156 Ga0070665_100228267
1157 Ga0070665_100235874
1158 Ga0070665_100261070
1159 Ga0070665_100993248
1160 Ga0070704_100002696
1161 Ga0070704_100137889
1162 Ga0068855_100181957
1163 Ga0068855_100623678
1164 Ga0068855_101245011
1165 Ga0068854_100000262
1166 Ga0068854_100182885
1167 Ga0068856_100558649
1168 Ga0068856_102546793
1169 Ga0070702_100415830
1170 Ga0070702_101239923
1171 Ga0068852_100031689
1172 Ga0068852_100210563
1173 Ga0068852_102414700
1174 Ga0068859_100001466
1175 Ga0068859_100002266
1176 Ga0068859_100284757
1177 Ga0068859_102927705
1178 Ga0068864_100093654
1179 Ga0068864_101253565
1180 Ga0068866_10000681
1181 Ga0068866_10066644
1182 Ga0068866_10247575
1183 Ga0068861_100013167
1184 Ga0068861_100161744
1185 Ga0068861_100179195
1186 Ga0068861_101138994
1187 Ga0068861_101384194
1188 Ga0068851_10482902
1189 Ga0068851_10581628
1190 Ga0068870_10291984
1191 Ga0068870_10862670
1192 Ga0068870_10983223
1193 Ga0068870_11397895
1194 Ga0068863_100003689
1195 Ga0068863_100006164
1196 Ga0068863_100869736
1197 Ga0068863_100950870
1198 Ga0068863_101677976
1199 Ga0068863_101838165
1200 Ga0068858_100001689
1201 Ga0068858_100096341
1202 Ga0068858_100126321
1203 Ga0068858_100218475
1204 Ga0068858_100547142
1205 Ga0068858_101644456
1206 Ga0068858_101816941
1207 Ga0068860_100000141
1208 Ga0068860_100001255
1209 Ga0068860_100149757
1210 Ga0068860_100197528
1211 Ga0068860_102567264
1212 Ga0068860_102685411
1213 Ga0068862_100000138
1214 Ga0068862_100001317
1215 Ga0068862_100316850
1216 Ga0068862_100746715
1217 Ga0068862_101109055
1218 Ga0081455_10036555
1219 Ga0081455_10177818
1220 Ga0081538_10035673
1221 Ga0075365_10018382
1222 Ga0075365_10046531
1223 Ga0075365_10047539
1224 Ga0075365_10055055
1225 Ga0075365_10154536
1226 Ga0075365_10286437
1227 Ga0075365_10459401
1228 Ga0075365_10949959
1229 Ga0075365_11117835
1230 Ga0075368_10018592
1231 Ga0075363_100025097
1232 Ga0075363_100037020
1233 Ga0075363_100040183
1234 Ga0075363_100055671
1235 Ga0075363_100058629
1236 Ga0075363_100075522
1237 Ga0075363_100127918
1238 Ga0075363_100200914
1239 Ga0075363_100337741
1240 Ga0075363_100897896
1241 Ga0075363_101027628
1242 Ga0075364_10001416
1243 Ga0075364_10026321
1244 Ga0075364_10038846
1245 Ga0075364_10068636
1246 Ga0075364_10078677
1247 Ga0075364_10091412
1248 Ga0075364_10103821
1249 Ga0075364_10154835
1250 Ga0075364_10176423
1251 Ga0075364_10188648
1252 Ga0075364_10304632
1253 Ga0075364_10437265
1254 Ga0075364_10448407
1255 Ga0075364_10487519
1256 Ga0075364_10623698
1257 Ga0075364_11065817
1258 Ga0075432_10303066
1259 Ga0070715_10002294
1260 Ga0070715_10405247
1261 Ga0070715_10416240
1262 Ga0070716_100001813
1263 Ga0070716_100847150
1264 Ga0070716_101087791
1265 Ga0070712_100001225
1266 Ga0070712_100004149
1267 Ga0070712_100529520
1268 Ga0075362_10008854
1269 Ga0075362_10058899
1270 Ga0075362_10290559
1271 Ga0075362_10379157
1272 Ga0075367_10049248
1273 Ga0075367_10226510
1274 Ga0075367_10530305
1275 Ga0075369_10000571
1276 Ga0075369_10002109
1277 Ga0075369_10125352
1278 Ga0075369_10138350
1279 Ga0075369_10142413
1280 Ga0075369_10218259
1281 Ga0075369_10268637
1282 Ga0075369_10490169
1283 Ga0075369_10517450
1284 Ga0075369_10546101
1285 Ga0075366_10147922
1286 Ga0097621_100763541
1287 Ga0075370_10010995
1288 Ga0075370_10049938
1289 Ga0075370_10056762
1290 Ga0075370_10065681
1291 Ga0075370_10080869
1292 Ga0075370_10130598
1293 Ga0075370_10362970
1294 Ga0075370_10607977
1295 Ga0075370_10675245
1296 Ga0068871_100819008
1297 Ga0068871_100857918
1298 Ga0068871_101336655
1299 Ga0075428_100000939
1300 Ga0075430_100059016
1301 Ga0075430_100080000
1302 Ga0075431_100021617
1303 Ga0075434_100459143
1304 Ga0075434_101693453
1305 Ga0068865_100004351
1306 Ga0068865_100093332
1307 Ga0068865_100550404
1308 Ga0097620_100001464
1309 Ga0097620_100002267
1310 Ga0097620_100284752
1311 Ga0097620_102927781
1312 Ga0105251_10233167
1313 Ga0105250_10063025
1314 Ga0105250_10084209
1315 Ga0105250_10288945
1316 Ga0105240_11204609
1317 Ga0111539_13346294
1318 Ga0105245_10007730
1319 Ga0105245_10674331
1320 Ga0105245_11493368
1321 Ga0105247_10000237
1322 Ga0105247_10000372
1323 Ga0105247_10065096
1324 Ga0105247_10066172
1325 Ga0105247_10414385
1326 Ga0105247_11583189
1327 Ga0114129_10048020
1328 Ga0114129_12826612
1329 Ga0105243_10000676
1330 Ga0105241_10007378
1331 Ga0105241_10149237
1332 Ga0105241_10830079
1333 Ga0105241_11225082
1334 Ga0105242_10000197
1335 Ga0105242_10208526
1336 Ga0105242_10499514
1337 Ga0105242_11927092
1338 Ga0105248_10000337
1339 Ga0105248_10056212
1340 Ga0105248_10087668
1341 Ga0105248_10826344
1342 Ga0105248_10898500
1343 Ga0105248_11640690
1344 Ga0105237_10005565
1345 Ga0105237_10015368
1346 Ga0105237_10085017
1347 Ga0105237_10689298
1348 Ga0105237_11484663
1349 Ga0105238_10086299
1350 Ga0105238_10317361
1351 Ga0105238_10642662
1352 Ga0105238_11043982
1353 Ga0105249_10000013
1354 Ga0105249_10004426
1355 Ga0105249_10022007
1356 Ga0105249_10543436
1357 Ga0105249_10816852
1358 Ga0099796_10010920
1359 Ga0105239_10029337
1360 Ga0105239_10032396
1361 Ga0105239_10145014
1362 Ga0105239_10690655
1363 Ga0105239_10788219
1364 Ga0105239_10996822
1365 Ga0105246_10217869
1366 Ga0105246_10244744
1367 Ga0105246_10667441
1368 Ga0157342_1068323
1369 Ga0157371_10312162
1370 Ga0157371_11224263
1371 Ga0157369_10384304
1372 Ga0157369_10631717
1373 Ga0157374_10391860
1374 Ga0157374_10694656
1375 Ga0157378_10002889
1376 Ga0157378_10036468
1377 Ga0157378_10890388
1378 Ga0157378_11122549
1379 Ga0157378_12285943
1380 Ga0163162_10002808
1381 Ga0163162_10091073
1382 Ga0163162_10733765
1383 Ga0163162_12823541
1384 Ga0157372_10006319
1385 Ga0157372_10149591
1386 Ga0157372_11466986
1387 Ga0157375_10017320
1388 Ga0157375_10139581
1389 Ga0157375_10225018
1390 Ga0157375_10769970
1391 Ga0157375_10786964
1392 Ga0157375_11157478
1393 Ga0157375_11976728
1394 Ga0163163_10058326
1395 Ga0163163_10191430
1396 Ga0163163_10423346
1397 Ga0163163_10756181
1398 Ga0157380_10000136
1399 Ga0157380_10249743
1400 Ga0157380_10429896
1401 Ga0157380_11649491
1402 Ga0157377_10175419
1403 Ga0157377_10233756
1404 Ga0157377_10863597
1405 Ga0157379_10038088
1406 Ga0157379_10070088
1407 Ga0157379_10130207
1408 Ga0157379_11428335
1409 Ga0157376_10399308
1410 Ga0157376_10444398
1411 Ga0157376_12567272
1412 Ga0163161_10014033
1413 Ga0163161_10083548
1414 Ga0163161_10180097
1415 Ga0163161_10839847
1416 Ga0163161_11408352
1417 Ga0213876_10530277
1418 Ga0209673_1028999
1419 Ga0209025_1068996
1420 Ga0209051_1000107
1421 Ga0209051_1000122
1422 Ga0209051_1001174
1423 Ga0209051_1001471
1424 Ga0209051_1022917
1425 Ga0209051_1044453
1426 Ga0207653_10243734
1427 Ga0207692_10001286
1428 Ga0207692_10014299
1429 Ga0207692_10283322
1430 Ga0207642_10001214
1431 Ga0207710_10000213
1432 Ga0207710_10008148
1433 Ga0207710_10185684
1434 Ga0207710_10676890
1435 Ga0207688_10003068
1436 Ga0207688_10005491
1437 Ga0207688_10075820
1438 Ga0207688_10753573
1439 Ga0207680_10072589
1440 Ga0207680_10138610
1441 Ga0207680_10338675
1442 Ga0207685_10199934
1443 Ga0207685_10218094
1444 Ga0207699_10060695
1445 Ga0207699_10417116
1446 Ga0207699_11478221
1447 Ga0207645_10004061
1448 Ga0207643_10253687
1449 Ga0207643_10487409
1450 Ga0207654_10077866
1451 Ga0207654_10233114
1452 Ga0207671_10014745
1453 Ga0207671_10021340
1454 Ga0207671_10031936
1455 Ga0207693_10000507
1456 Ga0207693_10003394
1457 Ga0207663_10005170
1458 Ga0207662_10211461
1459 Ga0207662_10226473
1460 Ga0207657_10023320
1461 Ga0207657_10102233
1462 Ga0207652_11251564
1463 Ga0207646_10399719
1464 Ga0207681_10000866
1465 Ga0207681_10042605
1466 Ga0207681_10130610
1467 Ga0207694_10145782
1468 Ga0207694_10155070
1469 Ga0207694_10837086
1470 Ga0207694_11660843
1471 Ga0207650_10109673
1472 Ga0207659_10426038
1473 Ga0207687_10009541
1474 Ga0207687_10013417
1475 Ga0207687_10350125
1476 Ga0207664_10156204
1477 Ga0207664_10396737
1478 Ga0207664_10427349
1479 Ga0207644_10027298
1480 Ga0207644_10158883
1481 Ga0207644_10197549
1482 Ga0207644_10266659
1483 Ga0207644_11423607
1484 Ga0207690_10132747
1485 Ga0207690_10224812
1486 Ga0207690_11020278
1487 Ga0207706_10001533
1488 Ga0207686_10001322
1489 Ga0207709_10085607
1490 Ga0207709_10412239
1491 Ga0207670_10104442
1492 Ga0207670_11074164
1493 Ga0207670_11705969
1494 Ga0207670_11936265
1495 Ga0207669_10001482
1496 Ga0207669_10158989
1497 Ga0207669_10291106
1498 Ga0207704_10128721
1499 Ga0207665_10005493
1500 Ga0207665_10015885
1501 Ga0207665_10887760
1502 Ga0207665_10901349
1503 Ga0207691_10391942
1504 Ga0207691_10440882
1505 Ga0207711_10000753
1506 Ga0207711_10020273
1507 Ga0207711_10112050
1508 Ga0207711_10374239
1509 Ga0207711_10997712
1510 Ga0207711_11023253
1511 Ga0207689_10012131
1512 Ga0207689_10055897
1513 Ga0207667_10319758
1514 Ga0207667_10634600
1515 Ga0207651_11705602
1516 Ga0207712_10000018
1517 Ga0207712_10130790
1518 Ga0207712_10269342
1519 Ga0207712_10313007
1520 Ga0207668_10000770
1521 Ga0207668_10016773
1522 Ga0207668_10208317
1523 Ga0207668_10232143
1524 Ga0207668_10723113
1525 Ga0207640_10049671
1526 Ga0207640_10121950
1527 Ga0207658_10000383
1528 Ga0207658_10004854
1529 Ga0207658_10010991
1530 Ga0207658_10011237
1531 Ga0207658_10890683
1532 Ga0207658_10917992
1533 Ga0207658_10971359
1534 Ga0207677_10002864
1535 Ga0207677_10201803
1536 Ga0207677_10364941
1537 Ga0207677_10622158
1538 Ga0207703_10000920
1539 Ga0207703_10013422
1540 Ga0207703_10259384
1541 Ga0207703_10543410
1542 Ga0207703_10580612
1543 Ga0207703_10716983
1544 Ga0207639_10005136
1545 Ga0207639_10016036
1546 Ga0207639_10973174
1547 Ga0207678_10003253
1548 Ga0207678_10015024
1549 Ga0207678_10670745
1550 Ga0207678_10904505
1551 Ga0207708_10351959
1552 Ga0207702_10267532
1553 Ga0207641_10002928
1554 Ga0207641_10029024
1555 Ga0207641_10414173
1556 Ga0207641_11833624
1557 Ga0207648_10021128
1558 Ga0207648_10028299
1559 Ga0207648_12033040
1560 Ga0207676_10070294
1561 Ga0207676_10188226
1562 Ga0207676_11258609
1563 Ga0207676_11469946
1564 Ga0207675_100000544
1565 Ga0207675_100015163
1566 Ga0207675_100172690
1567 Ga0207675_100517790
1568 Ga0207675_101833233
1569 Ga0207683_10000335
1570 Ga0207683_10057779
1571 Ga0207683_10451543
1572 Ga0207683_10614671
1573 Ga0207683_12012714
1574 Ga0207698_10138786
1575 Ga0207698_10153911
1576 Ga0207698_10229905
1577 Ga0207428_10533328
1578 Ga0268266_10032648
1579 Ga0268266_10190460
1580 Ga0268266_10378892
1581 Ga0268266_10590424
1582 Ga0268266_10652806
1583 Ga0268266_12060892
1584 Ga0268265_10000159
1585 Ga0268265_10044071
1586 Ga0268265_10194523
1587 Ga0268265_10756464
1588 Ga0268264_10000005
1589 Ga0268264_10001041
1590 Ga0268264_10294371
1591 Ga0268264_10511651
1592 Ga0268264_11975181
1593 Ga0265327_10004280
1594 Ga0307513_10743679
1595 Ga0307408_100762940
1596 Ga0307413_10115722
1597 Ga0307413_10377010
1598 Ga0307413_10500894
1599 Ga0307410_10015784
1600 Ga0307410_11122565
1601 Ga0307406_10048745
1602 Ga0307406_10539594
1603 Ga0307412_10041003
1604 Ga0307409_100000649
1605 Ga0307409_101232462
1606 Ga0307416_100002172
1607 Ga0307416_101879339
1608 Ga0307414_11351095
1609 Ga0307411_10124695
1610 Ga0307411_10188989
1611 Ga0307411_10216432
1612 Ga0307415_100043135
1613 Ga0316580_10169555
1614 Ga0316593_10147375
1615 Ga0316592_1084493
1616 Ga0316596_1078760
1617 Ga0373949_0138647
1618 Ga0373951_0102485
1619 Ga0373943_0268297
1620 Ga0373962_0048327
1621 Ga0373931_0042807
1622 Ga0373931_0276572
1623 Ga0373937_0616162
1624 Ga0316584_0073524
1625 Ga0436365_1279297
1626 Ga0436363_0907136
1627 Ga0436363_1032215
1628 Ga0436363_1100965
1629 Ga0439461_0017272
1630 Ga0439461_0164438
1631 Ga0439466_0003336
1632 Ga0439466_0005429
1633 Ga0439466_0021376
1634 Ga0439466_0044833
1635 Ga0439465_0002390
1636 Ga0439465_0007690
1637 Ga0439465_0050299
1638 Ga0451789_0678462
1639 Ga0451789_0888216
1640 Ga0451794_05147
1641 Ga0451793_0184391
1642 Ga0451793_0614440
1643 Ga0451797_1156091
1644 Ga0451798_0260113
1645 Ga0451802_1339380
1646 Ga0451802_1992298
1647 Ga0451807_1241670
1648 Ga0451841_0303713
1649 Ga0451841_1061137
1650 Ga0451847_0431962
1651 Ga0451847_0576711
1652 Ga0451843_0772406
1653 Ga0451853_1496362
1654 Ga0439431_0000416
1655 Ga0439431_0066392
1656 Ga0439442_034471
1657 Ga0439442_082748
1658 Ga0439445_0001277
1659 Ga0439445_0006277
1660 Ga0439445_0009255
1661 Ga0439448_0035093
1662 Ga0439450_151198
1663 Ga0439434_0001827
1664 Ga0439434_0002991
1665 Ga0439434_0065829
1666 Ga0439434_0112473
1667 Ga0466972_0014330
1668 Ga0466972_0014708
1669 Ga0466972_0044291
1670 Ga0466972_0120226
1671 Ga0466972_0566073
1672 Ga0466965_0002913
1673 Ga0466965_0008663
1674 Ga0466965_0029923
1675 Ga0466965_0083523
1676 Ga0466965_0102931
1677 Ga0466965_0235939
1678 Ga0466965_0248482
1679 Ga0466965_0356052
1680 Ga0466961_0074698
1681 Ga0466963_0228127
1682 Ga0466964_0190974
1683 Ga0466971_0092650
1684 Ga0466968_0004772
1685 Ga0466968_0039664
1686 Ga0466968_0048793
1687 Ga0466970_0021122
1688 Ga0466970_0027961
1689 Ga0466970_0204061
1690 Ga0466970_0223349
1691 Ga0466970_0299152
1692 Ga0466970_0379278
1693 Ga0466957_0292223
1694 Ga0466957_0311111
1695 Ga0466957_0312379
1696 Ga0466960_0001158
1697 Ga0466960_0006575
1698 Ga0466960_0282784
1699 Ga0466959_0030872
1700 Ga0466959_0124827
1701 Ga0466958_0079095
1702 Ga0466967_0006912
1703 Ga0466967_0032235
1704 Ga0466967_0167085
1705 Ga0466967_0176662
1706 Ga0466967_0304473
1707 Ga0466967_1395681
1708 Ga0495603_0049300
1709 Ga0495629_0201647
1710 Ga0495638_0007924
1711 Ga0495638_0014570
1712 Ga0495641_0012759
1713 Ga0495582_0074468
1714 Ga0495639_0079198
1715 Ga0495664_0277376
1716 Ga0495594_0174458
1717 Ga0495596_0426665
1718 Ga0495606_0027477
1719 Ga0495608_0723202
1720 Ga0495618_0911616
1721 Ga0495630_0145905
1722 Ga0495648_0006968
1723 Ga0495654_0076250
1724 Ga0495665_0120992
1725 Ga0495640_0077984
1726 Ga0495668_0246567
1727 Ga0495634_0703167
1728 Ga0495611_0057947
1729 Ga0495658_0078982
1730 Ga0495671_0367385
1731 Ga0495604_0642552
1732 Ga0495674_0557760
1733 Ga0495672_0000892
1734 Ga0495672_0085389
1735 Ga0495672_0108020
1736 Ga0495672_0130773
1737 Ga0495680_0592854
1738 Ga0495673_0002880
1739 Ga0495686_0139406
1740 Ga0495593_0060093
1741 Ga0495614_0535713
1742 Ga0495626_0174226
1743 Ga0495626_0257863
1744 Ga0496100_0000033
1745 Ga0496100_0000307
1746 Ga0496100_0000383
1747 Ga0496100_0001064
1748 Ga0496100_0025799
1749 Ga0496100_0683213
1750 Ga0496101_0000008
1751 Ga0496101_0000033
1752 Ga0496101_0000270
1753 Ga0496101_0003204
1754 Ga0496101_0054409
1755 Ga0496101_0155368
1756 Ga0496101_0165900
1757 Ga0496101_0431825
1758 Ga0496101_0750292
1759 Ga0496102_0000005
1760 Ga0496102_0000257
1761 Ga0496102_0003067
1762 Ga0496102_0004668
1763 Ga0496102_0154202
1764 Ga0496102_0285735
1765 Ga0496102_0495546
1766 Ga0496103_0000002
1767 Ga0496103_0000393
1768 Ga0496103_0000540
1769 Ga0496103_0002854
1770 Ga0496103_0374717
1771 Ga0496103_0512000
1772 Ga0496104_0004313
1773 Ga0496104_0010659
1774 Ga0496104_0229871
1775 Ga0496104_0363310
1776 Ga0496104_0754340
1777 Ga0496105_0019662
1778 Ga0496105_0435057
1779 Ga0496105_0484214
1780 Ga0496105_0506221
1781 Ga0496105_0758351
1782 Ga0496105_1221028
1783 Ga0496106_0000615
1784 Ga0496106_0000777
1785 Ga0496106_0012783
1786 Ga0496106_0040081
1787 Ga0496106_0174404
1788 Ga0496106_0418838
1789 Ga0496107_0000083
1790 Ga0496107_0001171
1791 Ga0496107_0005215
1792 Ga0496107_0006327
1793 Ga0496107_0062955
1794 Ga0496107_0206319
1795 Ga0496107_0206985
1796 Ga0496108_0002478
1797 Ga0496108_0003256
1798 Ga0496108_0076780
1799 Ga0496108_0093861
1800 Ga0496108_0159426
1801 Ga0496108_0248223
1802 Ga0496108_0284525
1803 Ga0496109_0000293
1804 Ga0496109_0001978
1805 Ga0496109_0038037
1806 Ga0496109_0092322
1807 Ga0496109_0167328
1808 Ga0496109_0328787
1809 Ga0496109_0473721
1810 Ga0496109_0799007
1811 Ga0496110_0029596
1812 Ga0496110_0042318
1813 Ga0496110_0066830
1814 Ga0496110_0251986
1815 Ga0496110_0290617
1816 Ga0496110_0600110
1817 Ga0496111_0016877
1818 Ga0496111_0184564
1819 Ga0496112_0047284
1820 Ga0496112_0083953
1821 Ga0496112_0086710
1822 Ga0496112_0108326
1823 Ga0496112_0278301
1824 Ga0496112_0377459
1825 Ga0496112_0489533
1826 Ga0496112_0764416
1827 Ga0496113_0004725
1828 Ga0496113_0073302
1829 Ga0496113_0294515
1830 Ga0496113_0372642
1831 Ga0496113_0386083
1832 Ga0496113_0858603
1833 Ga0496114_0000517
1834 Ga0496114_0002766
1835 Ga0496114_0010038
1836 Ga0496114_0917726
1837 Ga0496114_1083034
1838 Ga0496115_0008855
1839 Ga0496115_0134115
1840 Ga0496115_1238275
1841 Ga0496115_1315795
1842 Ga0496116_0000034
1843 Ga0496116_0001049
1844 Ga0496116_0033542
1845 Ga0496117_0000003
1846 Ga0496117_0000390
1847 Ga0496117_0002218
1848 Ga0496118_0000001
1849 Ga0496118_0002226
1850 Ga0496118_0010693
1851 Ga0496118_0509823
1852 Ga0496119_0001001
1853 Ga0496119_0013888
1854 Ga0496119_0015314
1855 Ga0496119_0508129
1856 Ga0496120_0000241
1857 Ga0496120_0047544
1858 Ga0496120_0054340
1859 Ga0496121_0000002
1860 Ga0496121_0000421
1861 Ga0496121_0002203
1862 Ga0496121_0401867
1863 Ga0496122_0000051
1864 Ga0496122_0005578
1865 Ga0496122_0514235
1866 Ga0496123_0001082
1867 Ga0496123_0011189
1868 Ga0496123_0179182
1869 Ga0496124_0000002
1870 Ga0496124_0203268
1871 Ga0496124_0925621
1872 Ga0496125_0000002
1873 Ga0496125_0023269
1874 Ga0496126_0000011
1875 Ga0496126_0000805
1876 Ga0496126_0010992
1877 Ga0496126_0012617
1878 Ga0496126_0533481
1879 Ga0496126_0764614
1880 Ga0501032_0009298
1881 Ga0501033_0212694
1882 Ga0501034_0014878
1883 Ga0501034_0061168
1884 Ga0501036_0033970
1885 Ga0501036_0216437
1886 Ga0501037_0001465
1887 Ga0501040_0268460
1888 Ga0501043_0001059
1889 Ga0501047_0001744
1890 Ga0501047_0004294
1891 Ga0501047_0911358
1892 Ga0501068_0635386
1893 Ga0501069_0015109
1894 Ga0501070_0001045
1895 Ga0501070_0090058
1896 Ga0501070_0093122
1897 Ga0501070_0331554
1898 Ga0501071_0735291
1899 Ga0501077_0324311
1900 Ga0501079_0958133
1901 Ga0501080_0763685
1902 Ga0501080_1745031
1903 Ga0501035_0000824
1904 Ga0501044_0000400
1905 Ga0501044_0022680
1906 Ga0501044_1245389
1907 nmdc:mga03683_282316_c1
1908 nmdc:mga03683_391298_c1
1909 nmdc:mga03683_41391_c1
1910 nmdc:mga03683_47067_c1
1911 nmdc:mga03683_4742_c1
1912 nmdc:mga03683_49033_c1
1913 nmdc:mga03683_63873_c1
1914 nmdc:mga03n38_14398_c1
1915 nmdc:mga03n38_271052_c1
1916 nmdc:mga03n38_2737_c1
1917 nmdc:mga03n38_284722_c1
1918 nmdc:mga03n38_294500_c1
1919 nmdc:mga03n38_336848_c1
1920 nmdc:mga03n38_355895_c1
1921 nmdc:mga03n38_561408_c1
1922 nmdc:mga03n38_7697_c1
1923 nmdc:mga03n38_77171_c1
1924 nmdc:mga03n38_7949_c1
1925 nmdc:mga03n38_797118_c1
1926 nmdc:mga03n38_942519_c1
1927 nmdc:mga00v17_133133_c1
1928 nmdc:mga00v17_166783_c1
1929 nmdc:mga00v17_16828_c1
1930 nmdc:mga00v17_182570_c1
1931 nmdc:mga00v17_1839_c1
1932 nmdc:mga00v17_208391_c1
1933 nmdc:mga00v17_26886_c1
1934 nmdc:mga00v17_28589_c1
1935 nmdc:mga00v17_290297_c1
1936 nmdc:mga00v17_312725_c1
1937 nmdc:mga00v17_381401_c1
1938 nmdc:mga00v17_464724_c1
1939 nmdc:mga0yw44_1049171_c1
1940 nmdc:mga0yw44_111276_c1
1941 nmdc:mga0yw44_135112_c1
1942 nmdc:mga0yw44_143301_c1
1943 nmdc:mga0yw44_161414_c1
1944 nmdc:mga0yw44_217996_c1
1945 nmdc:mga0yw44_263583_c1
1946 nmdc:mga0yw44_424311_c1
1947 nmdc:mga0yw44_442646_c1
1948 nmdc:mga0yw44_465326_c1
1949 nmdc:mga0yw44_569474_c1
1950 nmdc:mga0yw44_890157_c1
1951 nmdc:mga0yw44_95642_c1
1952 nmdc:mga0k408_41793_c1
1953 nmdc:mga0k408_469831_c1
1954 nmdc:mga06z11_55944_c1
1955 nmdc:mga06z11_603453_c1
1956 nmdc:mga06z11_795004_c1
1957 nmdc:mga04h51_21305_c1
1958 nmdc:mga04h51_85760_c1
1959 nmdc:mga07m45_10218_c1
1960 nmdc:mga07m45_118121_c1
1961 nmdc:mga07m45_27866_c1
1962 nmdc:mga07m45_42475_c1
1963 nmdc:mga07m45_45201_c1
1964 nmdc:mga07m45_795161_c1
1965 nmdc:mga05p37_1568544_c1
1966 nmdc:mga05p37_87296_c1
1967 nmdc:mga0qj67_19994_c1
1968 nmdc:mga0qj67_51566_c1
1969 nmdc:mga06r32_32424_c1
1970 nmdc:mga08y16_1646474_c1
1971 nmdc:mga0n895_388641_c1
1972 nmdc:mga0a205_331119_c1
1973 nmdc:mga0sz30_103073_c2
1974 nmdc:mga0sz30_113708_c1
1975 nmdc:mga0sz30_17777_c1
1976 nmdc:mga0sz30_19424_c1
1977 nmdc:mga0sz30_2053_c1
1978 nmdc:mga0sz30_219_c1
1979 nmdc:mga0sz30_239062_c1
1980 nmdc:mga0sz30_247223_c1
1981 nmdc:mga0sz30_27081_c2
1982 nmdc:mga0sz30_279571_c1
1983 Ga0500610_0072788
1984 Ga0500635_0033168
1985 Ga0500635_0068357
1986 Ga0495619_0045764
1987 Ga0500578_0768663
1988 Ga0500643_002732
1989 Ga0500643_003257
1990 Ga0500581_301034
1991 Ga0500646_0039744
1992 Ga0500583_0287899
1993 Ga0500651_0142671
1994 Ga0500566_0429975
1995 Ga0500650_0434409
1996 Ga0500556_0001801
1997 Ga0500556_0053181
1998 Ga0500562_005249
1999 Ga0500572_309658
2000 Ga0500642_0055010
2001 Ga0500652_000992
2002 Ga0500559_0251104
2003 Ga0500577_0092628
2004 Ga0500588_0366193
2005 Ga0500604_0049468
2006 Ga0500616_0002892
2007 Ga0500616_0008826
2008 Ga0500616_0089755
2009 Ga0500620_040274
2010 Ga0500627_0017142
2011 Ga0500627_0202190
2012 Ga0500633_0047396
2013 Ga0500634_0234517
2014 Ga0500638_268237
2015 Ga0500645_000110
2016 Ga0500645_013051
2017 Ga0587084_155780
2018 Ga0587090_146616
2019 Ga0466962_0024515
2020 2644489575
2021 2644635318
2022 2738666449
2023 2738707059
2024 2739146373
2025 2739333510
2026 2842137138
2027 2902799266
2028 2902802144
2029 2902813241
2030 2902842358
2031 2929214256
2032 2939588021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

21

55

0.97

Map