F488283
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1017 | 524 | 2034 | 469 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10009038|Ga0157372_100090387 |
| Length | 526 |
| Sequence | VIGGPTRTQRSPSHDHVSGWFARLAHSLAKPVGYNRFRKVGRVARDRFRKELSMSTVLIKGGMVINATGTGYADVLVDGETIAAVLKPGSALLGVDLETNVDEVVDAAGKYVIPGGIDPHTHMELPFGGTQASDTFETGTRAAAWGGTTTIIDFAVQRYGERVEDGLATWHAKAAGNACIDYGFHQIIGGVDEFSLKAMDSFIDEGVTSFKLFMAYPGVFYSDDAQILRAMQKSAETGLLTMMHAENGPAIDVLAEQLYSAGKASPYYHGIARAWQMEEEATHRAIMIANLTGAPLYVVHVSAKQAVAQLAAARDVGQNVFGETCPQYLYLSLEDQLGAPGFEGAKWVCSTPLRARAEGHQDAMWQALRSNDLQIVSTDHCPFCMKEQKELGLNDFRAIPNGIGGIEHRMDLMYQGVVTARISLQRWVELTSTTPALMFGLYGKKGVIQPGADADLVIYDPAGHTSIGYEKTHHMNMDYSAWEGFEIDGHVDWVMSRGAVLINDSGFVGTKGHGQYLKRDLSQYLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 7 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 127 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 209 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 214 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 218 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 232 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 233 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 234 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 250 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 251 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 252 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 253 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 254 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 255 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 256 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 257 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 258 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 259 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 260 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 261 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 267 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 272 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 273 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 343 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 344 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 345 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 346 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 347 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 348 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 349 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 350 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 351 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 352 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 353 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 354 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 405 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 406 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 407 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 408 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 409 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 411 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 413 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 414 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 415 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 416 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 417 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 418 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 419 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 420 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 422 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 423 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 424 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 425 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 426 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 427 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 428 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 429 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 430 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 431 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 432 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 435 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 436 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 437 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 438 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 439 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 440 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 441 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 442 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 443 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 444 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 445 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 446 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 447 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 448 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 449 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 450 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 451 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 452 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 453 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 454 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 455 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 456 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 457 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 458 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 459 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 460 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 461 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 462 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 463 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 464 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 465 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 466 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 467 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 468 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 469 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 470 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 471 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 472 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 473 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 474 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 475 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 476 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 477 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 478 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 479 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 480 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 481 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 482 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 483 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 484 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 485 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 486 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 487 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 488 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 489 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 490 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 491 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 492 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 493 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 494 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 495 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 496 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 497 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 498 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 499 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 500 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 501 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 502 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 503 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 504 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 505 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 506 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 507 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 508 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 509 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 510 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 511 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 512 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 513 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 514 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 515 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 516 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 517 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 518 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 519 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 520 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 521 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 522 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 523 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 524 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.76 |
| Metatranscriptomes | 0.49 |
| Isolates | 8.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 9.44 |
| Nodule | 0.39 |
| Rhizoplane | 4.52 |
| Rhizosphere | 72.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157372_10009038 | 3300013307 | Bacteria | 10588 |
| 2 | JGI24752J21851_1001068 | 3300001976 | Bacteria | 3734 |
| 3 | JGI24737J22298_10005045 | 3300001990 | Bacteria | 4576 |
| 4 | JGI24735J21928_10004087 | 3300002067 | Bacteria | 4925 |
| 5 | JGI24735J21928_10032210 | 3300002067 | Bacteria | 1552 |
| 6 | rootL2_10009820 | 3300003322 | Bacteria | 11824 |
| 7 | Ga0006562J51391_1043750 | 3300003578 | Bacteria | 5978 |
| 8 | Ga0055532_1000205 | 3300003758 | Bacteria | 48259 |
| 9 | Ga0055527_1005214 | 3300003760 | Bacteria | 1709 |
| 10 | Ga0055535_1000157 | 3300003761 | Bacteria | 72863 |
| 11 | Ga0055542_1000204 | 3300003762 | Bacteria | 72884 |
| 12 | Ga0055529_1000221 | 3300003763 | Bacteria | 73491 |
| 13 | Ga0055537_1000010 | 3300003773 | Bacteria | 138059 |
| 14 | Ga0055534_1000015 | 3300003784 | Bacteria | 148531 |
| 15 | Ga0055528_1000377 | 3300003790 | Bacteria | 36291 |
| 16 | Ga0055528_1000708 | 3300003790 | Bacteria | 23670 |
| 17 | Ga0065714_10065905 | 3300005288 | Bacteria | 8127 |
| 18 | Ga0065714_10072827 | 3300005288 | Bacteria | 3294 |
| 19 | Ga0065712_10068604 | 3300005290 | Bacteria | 9681 |
| 20 | Ga0070658_10000516 | 3300005327 | Bacteria | 33519 |
| 21 | Ga0070658_10015950 | 3300005327 | Bacteria | 6009 |
| 22 | Ga0070658_10018666 | 3300005327 | Bacteria | 5554 |
| 23 | Ga0070658_10026293 | 3300005327 | Bacteria | 4668 |
| 24 | Ga0070683_100163186 | 3300005329 | Bacteria | 2114 |
| 25 | Ga0070670_100001088 | 3300005331 | Bacteria | 21560 |
| 26 | Ga0070670_100014980 | 3300005331 | Bacteria | 6654 |
| 27 | Ga0070670_100021919 | 3300005331 | Bacteria | 5496 |
| 28 | Ga0068869_100005134 | 3300005334 | Bacteria | 8210 |
| 29 | Ga0068869_100103430 | 3300005334 | Bacteria | 2158 |
| 30 | Ga0070680_100031049 | 3300005336 | Bacteria | 4294 |
| 31 | Ga0070680_100063279 | 3300005336 | Bacteria | 3030 |
| 32 | Ga0070680_100090848 | 3300005336 | Bacteria | 2528 |
| 33 | Ga0068868_100019197 | 3300005338 | Bacteria | 5121 |
| 34 | Ga0068868_100046942 | 3300005338 | Bacteria | 3381 |
| 35 | Ga0070660_100026808 | 3300005339 | Bacteria | 4294 |
| 36 | Ga0070689_100008547 | 3300005340 | Bacteria | 7217 |
| 37 | Ga0070661_100064697 | 3300005344 | Bacteria | 2687 |
| 38 | Ga0070661_100162028 | 3300005344 | Bacteria | 1694 |
| 39 | Ga0070669_100057958 | 3300005353 | Bacteria | 2843 |
| 40 | Ga0070675_100000033 | 3300005354 | Bacteria | 94281 |
| 41 | Ga0070675_100008416 | 3300005354 | Bacteria | 8006 |
| 42 | Ga0070675_100017195 | 3300005354 | Bacteria | 5747 |
| 43 | Ga0070675_100278204 | 3300005354 | Bacteria | 1470 |
| 44 | Ga0070671_100000672 | 3300005355 | Bacteria | 24494 |
| 45 | Ga0070671_100005657 | 3300005355 | Bacteria | 9948 |
| 46 | Ga0070671_100021970 | 3300005355 | Bacteria | 5212 |
| 47 | Ga0070671_100107113 | 3300005355 | Bacteria | 2347 |
| 48 | Ga0070674_100042409 | 3300005356 | Bacteria | 3091 |
| 49 | Ga0070673_100034183 | 3300005364 | Bacteria | 3844 |
| 50 | Ga0070673_100037037 | 3300005364 | Bacteria | 3713 |
| 51 | Ga0070688_100047389 | 3300005365 | Bacteria | 2666 |
| 52 | Ga0070659_100001097 | 3300005366 | Bacteria | 19735 |
| 53 | Ga0070659_100058228 | 3300005366 | Bacteria | 3049 |
| 54 | Ga0070667_100015794 | 3300005367 | Bacteria | 6245 |
| 55 | Ga0070667_100029014 | 3300005367 | Bacteria | 4608 |
| 56 | Ga0070667_100029310 | 3300005367 | Bacteria | 4585 |
| 57 | Ga0070667_100161130 | 3300005367 | Bacteria | 1976 |
| 58 | Ga0070703_10023137 | 3300005406 | Bacteria | 1828 |
| 59 | Ga0070709_10000010 | 3300005434 | Bacteria | 175522 |
| 60 | Ga0070709_10007107 | 3300005434 | Bacteria | 6125 |
| 61 | Ga0070713_100033375 | 3300005436 | Bacteria | 4122 |
| 62 | Ga0070705_100119536 | 3300005440 | Bacteria | 1699 |
| 63 | Ga0070700_100009088 | 3300005441 | Bacteria | 5447 |
| 64 | Ga0070708_100029818 | 3300005445 | Bacteria | 4708 |
| 65 | Ga0070708_100173130 | 3300005445 | Unclassified | 2016 |
| 66 | Ga0070663_100015444 | 3300005455 | Bacteria | 4930 |
| 67 | Ga0070678_100025353 | 3300005456 | Bacteria | 3987 |
| 68 | Ga0070678_100035121 | 3300005456 | Bacteria | 3497 |
| 69 | Ga0070681_10137903 | 3300005458 | Bacteria | 2369 |
| 70 | Ga0070685_10035102 | 3300005466 | Bacteria | 2828 |
| 71 | Ga0070685_10085306 | 3300005466 | Bacteria | 1901 |
| 72 | Ga0070706_100016592 | 3300005467 | Bacteria | 6803 |
| 73 | Ga0070706_100030298 | 3300005467 | Bacteria | 4985 |
| 74 | Ga0070707_100021650 | 3300005468 | Bacteria | 6078 |
| 75 | Ga0070707_100114928 | 3300005468 | Bacteria | 2611 |
| 76 | Ga0070707_100121660 | 3300005468 | Bacteria | 2534 |
| 77 | Ga0070707_100131739 | 3300005468 | Bacteria | 2431 |
| 78 | Ga0070698_100000046 | 3300005471 | Bacteria | 85705 |
| 79 | Ga0070698_100009850 | 3300005471 | Bacteria | 10216 |
| 80 | Ga0070698_100017523 | 3300005471 | Bacteria | 7548 |
| 81 | Ga0070698_100062478 | 3300005471 | Bacteria | 3757 |
| 82 | Ga0070699_100031885 | 3300005518 | Bacteria | 4551 |
| 83 | Ga0070679_100008070 | 3300005530 | Bacteria | 9896 |
| 84 | Ga0070697_100063959 | 3300005536 | Bacteria | 3005 |
| 85 | Ga0070697_100096796 | 3300005536 | Bacteria | 2449 |
| 86 | Ga0068853_100000588 | 3300005539 | Bacteria | 24889 |
| 87 | Ga0068853_100006163 | 3300005539 | Bacteria | 9499 |
| 88 | Ga0070695_100008107 | 3300005545 | Bacteria | 6225 |
| 89 | Ga0070695_100064253 | 3300005545 | Bacteria | 2387 |
| 90 | Ga0070696_100004783 | 3300005546 | Bacteria | 9051 |
| 91 | Ga0070696_100031371 | 3300005546 | Bacteria | 3641 |
| 92 | Ga0070693_100000347 | 3300005547 | Bacteria | 21059 |
| 93 | Ga0070665_100000588 | 3300005548 | Bacteria | 50690 |
| 94 | Ga0070665_100003830 | 3300005548 | Bacteria | 15922 |
| 95 | Ga0070665_100011326 | 3300005548 | Bacteria | 9020 |
| 96 | Ga0070665_100027861 | 3300005548 | Bacteria | 5690 |
| 97 | Ga0070665_100091726 | 3300005548 | Bacteria | 3043 |
| 98 | Ga0070704_100077145 | 3300005549 | Bacteria | 2440 |
| 99 | Ga0068855_100019945 | 3300005563 | Bacteria | 8051 |
| 100 | Ga0068855_100106798 | 3300005563 | Bacteria | 3217 |
| 101 | Ga0070664_100002562 | 3300005564 | Bacteria | 14662 |
| 102 | Ga0070664_100047942 | 3300005564 | Bacteria | 3610 |
| 103 | Ga0070664_100075945 | 3300005564 | Bacteria | 2886 |
| 104 | Ga0070664_100188443 | 3300005564 | Bacteria | 1837 |
| 105 | Ga0068857_100004443 | 3300005577 | Bacteria | 11865 |
| 106 | Ga0068857_100015477 | 3300005577 | Bacteria | 6662 |
| 107 | Ga0068854_100000442 | 3300005578 | Bacteria | 25691 |
| 108 | Ga0068856_100009168 | 3300005614 | Bacteria | 9621 |
| 109 | Ga0068856_100013645 | 3300005614 | Bacteria | 7858 |
| 110 | Ga0068856_100121046 | 3300005614 | Bacteria | 2618 |
| 111 | Ga0068856_100146674 | 3300005614 | Bacteria | 2367 |
| 112 | Ga0070702_100002009 | 3300005615 | Bacteria | 8578 |
| 113 | Ga0068852_100121623 | 3300005616 | Bacteria | 2391 |
| 114 | Ga0068852_100123805 | 3300005616 | Bacteria | 2371 |
| 115 | Ga0068859_100007129 | 3300005617 | Bacteria | 11345 |
| 116 | Ga0068859_100041923 | 3300005617 | Bacteria | 4598 |
| 117 | Ga0068859_100112264 | 3300005617 | Bacteria | 2788 |
| 118 | Ga0068859_100156040 | 3300005617 | Bacteria | 2360 |
| 119 | Ga0068864_100007299 | 3300005618 | Bacteria | 9091 |
| 120 | Ga0068864_100024375 | 3300005618 | Bacteria | 5090 |
| 121 | Ga0068864_100025849 | 3300005618 | Bacteria | 4947 |
| 122 | Ga0068861_100105783 | 3300005719 | Bacteria | 2247 |
| 123 | Ga0068861_100120053 | 3300005719 | Bacteria | 2119 |
| 124 | Ga0068851_10000001 | 3300005834 | Bacteria | 495512 |
| 125 | Ga0068870_10001611 | 3300005840 | Bacteria | 9183 |
| 126 | Ga0068863_100000274 | 3300005841 | Bacteria | 53564 |
| 127 | Ga0068863_100006310 | 3300005841 | Bacteria | 11636 |
| 128 | Ga0068863_100013760 | 3300005841 | Bacteria | 7798 |
| 129 | Ga0068858_100000152 | 3300005842 | Bacteria | 72991 |
| 130 | Ga0068858_100034281 | 3300005842 | Bacteria | 4708 |
| 131 | Ga0068858_100049586 | 3300005842 | Bacteria | 3888 |
| 132 | Ga0068858_100226884 | 3300005842 | Bacteria | 1770 |
| 133 | Ga0068860_100026060 | 3300005843 | Bacteria | 5639 |
| 134 | Ga0068860_100071240 | 3300005843 | Bacteria | 3304 |
| 135 | Ga0068860_100326298 | 3300005843 | Bacteria | 1507 |
| 136 | Ga0068862_100006939 | 3300005844 | Bacteria | 9396 |
| 137 | Ga0068862_100232584 | 3300005844 | Bacteria | 1673 |
| 138 | Ga0081455_10003097 | 3300005937 | Bacteria | 19365 |
| 139 | Ga0081455_10003346 | 3300005937 | Bacteria | 18489 |
| 140 | Ga0081455_10024605 | 3300005937 | Bacteria | 5571 |
| 141 | Ga0081455_10030848 | 3300005937 | Bacteria | 4863 |
| 142 | Ga0081455_10091126 | 3300005937 | Bacteria | 2470 |
| 143 | Ga0081539_10008120 | 3300005985 | Bacteria | 9270 |
| 144 | Ga0075365_10001903 | 3300006038 | Bacteria | 9836 |
| 145 | Ga0075365_10061280 | 3300006038 | Bacteria | 2512 |
| 146 | Ga0075363_100047657 | 3300006048 | Bacteria | 2277 |
| 147 | Ga0075364_10003400 | 3300006051 | Bacteria | 9039 |
| 148 | Ga0075364_10003412 | 3300006051 | Bacteria | 9029 |
| 149 | Ga0075364_10086424 | 3300006051 | Bacteria | 2078 |
| 150 | Ga0075364_10103302 | 3300006051 | Bacteria | 1898 |
| 151 | Ga0070712_100086171 | 3300006175 | Bacteria | 2289 |
| 152 | Ga0075369_10028701 | 3300006186 | Bacteria | 2334 |
| 153 | Ga0075369_10041608 | 3300006186 | Bacteria | 1967 |
| 154 | Ga0075366_10005131 | 3300006195 | Bacteria | 7085 |
| 155 | Ga0075366_10036054 | 3300006195 | Bacteria | 2915 |
| 156 | Ga0097621_100004564 | 3300006237 | Bacteria | 9665 |
| 157 | Ga0097621_100011172 | 3300006237 | Bacteria | 6609 |
| 158 | Ga0075370_10013670 | 3300006353 | Bacteria | 4320 |
| 159 | Ga0075428_100147468 | 3300006844 | Bacteria | 2557 |
| 160 | Ga0075431_100012785 | 3300006847 | Bacteria | 8475 |
| 161 | Ga0075433_10027807 | 3300006852 | Bacteria | 4801 |
| 162 | Ga0075433_10212353 | 3300006852 | Bacteria | 1719 |
| 163 | Ga0075434_100006513 | 3300006871 | Bacteria | 10708 |
| 164 | Ga0075434_100080274 | 3300006871 | Bacteria | 3258 |
| 165 | Ga0075434_100126224 | 3300006871 | Bacteria | 2575 |
| 166 | Ga0075429_100001639 | 3300006880 | Bacteria | 18503 |
| 167 | Ga0068865_100004153 | 3300006881 | Bacteria | 8710 |
| 168 | Ga0075436_100001698 | 3300006914 | Bacteria | 15076 |
| 169 | Ga0097620_100007129 | 3300006931 | Bacteria | 11345 |
| 170 | Ga0097620_100041922 | 3300006931 | Bacteria | 4598 |
| 171 | Ga0097620_100112266 | 3300006931 | Bacteria | 2788 |
| 172 | Ga0097620_100156038 | 3300006931 | Bacteria | 2360 |
| 173 | Ga0099826_10000266 | 3300006948 | Bacteria | 23131 |
| 174 | Ga0075435_100027739 | 3300007076 | Bacteria | 4433 |
| 175 | Ga0075435_100051864 | 3300007076 | Bacteria | 3305 |
| 176 | Ga0105240_10008219 | 3300009093 | Bacteria | 14957 |
| 177 | Ga0105240_10069245 | 3300009093 | Bacteria | 4369 |
| 178 | Ga0105240_10094668 | 3300009093 | Bacteria | 3642 |
| 179 | Ga0105240_10177783 | 3300009093 | Bacteria | 2515 |
| 180 | Ga0111539_10009078 | 3300009094 | Bacteria | 12586 |
| 181 | Ga0111539_10012573 | 3300009094 | Bacteria | 10607 |
| 182 | Ga0111539_10194952 | 3300009094 | Bacteria | 2363 |
| 183 | Ga0105245_10000114 | 3300009098 | Bacteria | 78195 |
| 184 | Ga0105245_10005792 | 3300009098 | Bacteria | 10840 |
| 185 | Ga0105245_10010417 | 3300009098 | Bacteria | 8097 |
| 186 | Ga0105245_10036774 | 3300009098 | Bacteria | 4351 |
| 187 | Ga0105245_10113852 | 3300009098 | Bacteria | 2519 |
| 188 | Ga0105247_10000971 | 3300009101 | Bacteria | 21642 |
| 189 | Ga0105247_10003337 | 3300009101 | Bacteria | 10507 |
| 190 | Ga0105247_10003762 | 3300009101 | Bacteria | 9842 |
| 191 | Ga0105247_10102080 | 3300009101 | Bacteria | 1835 |
| 192 | Ga0114129_10002108 | 3300009147 | Bacteria | 27390 |
| 193 | Ga0114129_10004443 | 3300009147 | Bacteria | 19788 |
| 194 | Ga0114129_10005325 | 3300009147 | Bacteria | 18160 |
| 195 | Ga0114129_10011738 | 3300009147 | Bacteria | 12466 |
| 196 | Ga0114129_10016634 | 3300009147 | Bacteria | 10474 |
| 197 | Ga0114129_10026130 | 3300009147 | Bacteria | 8268 |
| 198 | Ga0114129_10031786 | 3300009147 | Bacteria | 7462 |
| 199 | Ga0114129_10052270 | 3300009147 | Bacteria | 5734 |
| 200 | Ga0114129_10071639 | 3300009147 | Bacteria | 4833 |
| 201 | Ga0114129_10181118 | 3300009147 | Bacteria | 2866 |
| 202 | Ga0105243_10000498 | 3300009148 | Bacteria | 40115 |
| 203 | Ga0105243_10080754 | 3300009148 | Bacteria | 2653 |
| 204 | Ga0105241_10024590 | 3300009174 | Bacteria | 4473 |
| 205 | Ga0105242_10000795 | 3300009176 | Bacteria | 24463 |
| 206 | Ga0105242_10001394 | 3300009176 | Bacteria | 19045 |
| 207 | Ga0105248_10000326 | 3300009177 | Bacteria | 56477 |
| 208 | Ga0105248_10004206 | 3300009177 | Bacteria | 15920 |
| 209 | Ga0105248_10030613 | 3300009177 | Bacteria | 6010 |
| 210 | Ga0105248_10042041 | 3300009177 | Bacteria | 5125 |
| 211 | Ga0105237_10000341 | 3300009545 | Bacteria | 65672 |
| 212 | Ga0105237_10005381 | 3300009545 | Bacteria | 14471 |
| 213 | Ga0105237_10088908 | 3300009545 | Bacteria | 3078 |
| 214 | Ga0105237_10124178 | 3300009545 | Bacteria | 2576 |
| 215 | Ga0105238_10072620 | 3300009551 | Bacteria | 3436 |
| 216 | Ga0105249_10003663 | 3300009553 | Bacteria | 13254 |
| 217 | Ga0105239_10009254 | 3300010375 | Bacteria | 11136 |
| 218 | Ga0105239_10013363 | 3300010375 | Bacteria | 9121 |
| 219 | Ga0105239_10082407 | 3300010375 | Bacteria | 3542 |
| 220 | Ga0105239_10109131 | 3300010375 | Bacteria | 3066 |
| 221 | Ga0105239_10194783 | 3300010375 | Bacteria | 2269 |
| 222 | Ga0105239_10359847 | 3300010375 | Bacteria | 1643 |
| 223 | Ga0105246_10068410 | 3300011119 | Bacteria | 2491 |
| 224 | Ga0157373_10125544 | 3300013100 | Bacteria | 1805 |
| 225 | Ga0157371_10075081 | 3300013102 | Bacteria | 2394 |
| 226 | Ga0157370_10031815 | 3300013104 | Bacteria | 5158 |
| 227 | Ga0157370_10032665 | 3300013104 | Bacteria | 5081 |
| 228 | Ga0157370_10040437 | 3300013104 | Bacteria | 4502 |
| 229 | Ga0157370_10050894 | 3300013104 | Bacteria | 3958 |
| 230 | Ga0157369_10006194 | 3300013105 | Bacteria | 13880 |
| 231 | Ga0157369_10191523 | 3300013105 | Bacteria | 2149 |
| 232 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 233 | Ga0157374_10015550 | 3300013296 | Bacteria | 6676 |
| 234 | Ga0157374_10026275 | 3300013296 | Bacteria | 5238 |
| 235 | Ga0157374_10281843 | 3300013296 | Bacteria | 1641 |
| 236 | Ga0157378_10003230 | 3300013297 | Bacteria | 14505 |
| 237 | Ga0157378_10179453 | 3300013297 | Bacteria | 1991 |
| 238 | Ga0163162_10153050 | 3300013306 | Bacteria | 2425 |
| 239 | Ga0163162_10389447 | 3300013306 | Bacteria | 1526 |
| 240 | Ga0157372_10019524 | 3300013307 | Bacteria | 7306 |
| 241 | Ga0157372_10040927 | 3300013307 | Bacteria | 5122 |
| 242 | Ga0157375_10179485 | 3300013308 | Bacteria | 2268 |
| 243 | Ga0157375_10378108 | 3300013308 | Bacteria | 1583 |
| 244 | Ga0163163_10001257 | 3300014325 | Bacteria | 21367 |
| 245 | Ga0163163_10005445 | 3300014325 | Bacteria | 11002 |
| 246 | Ga0163163_10071778 | 3300014325 | Bacteria | 3451 |
| 247 | Ga0163163_10076524 | 3300014325 | Bacteria | 3341 |
| 248 | Ga0157380_10023569 | 3300014326 | Bacteria | 4645 |
| 249 | Ga0157380_10064715 | 3300014326 | Bacteria | 2936 |
| 250 | Ga0182008_10012519 | 3300014497 | Bacteria | 4476 |
| 251 | Ga0157377_10010612 | 3300014745 | Bacteria | 4563 |
| 252 | Ga0157377_10013934 | 3300014745 | Bacteria | 4081 |
| 253 | Ga0157377_10041322 | 3300014745 | Bacteria | 2558 |
| 254 | Ga0157379_10001539 | 3300014968 | Bacteria | 18974 |
| 255 | Ga0157379_10007727 | 3300014968 | Bacteria | 9309 |
| 256 | Ga0157379_10031033 | 3300014968 | Bacteria | 4761 |
| 257 | Ga0157376_10024222 | 3300014969 | Bacteria | 4762 |
| 258 | Ga0157376_10028472 | 3300014969 | Bacteria | 4441 |
| 259 | Ga0157376_10164322 | 3300014969 | Bacteria | 2015 |
| 260 | Ga0197907_10064725 | 3300020069 | Bacteria | 3035 |
| 261 | Ga0206349_1803513 | 3300020075 | Bacteria | 2153 |
| 262 | Ga0206351_10658466 | 3300020077 | Bacteria | 8249 |
| 263 | Ga0154015_1452617 | 3300020610 | Bacteria | 3008 |
| 264 | Ga0213876_10009730 | 3300021384 | Bacteria | 5174 |
| 265 | Ga0228598_1000951 | 3300024227 | Bacteria | 6296 |
| 266 | Ga0209672_100044 | 3300025228 | Bacteria | 270292 |
| 267 | Ga0209672_100120 | 3300025228 | Bacteria | 83650 |
| 268 | Ga0209147_100039 | 3300025229 | Bacteria | 311101 |
| 269 | Ga0209258_100062 | 3300025242 | Bacteria | 311101 |
| 270 | Ga0209677_100143 | 3300025253 | Bacteria | 66162 |
| 271 | Ga0209148_1000075 | 3300025254 | Bacteria | 311101 |
| 272 | Ga0209148_1000695 | 3300025254 | Bacteria | 27262 |
| 273 | Ga0209565_1000025 | 3300025263 | Bacteria | 377969 |
| 274 | Ga0209565_1002453 | 3300025263 | Bacteria | 6678 |
| 275 | Ga0209455_1000067 | 3300025272 | Bacteria | 311101 |
| 276 | Ga0209673_1000044 | 3300025273 | Bacteria | 290647 |
| 277 | Ga0209673_1000077 | 3300025273 | Bacteria | 229470 |
| 278 | Ga0209675_1000017 | 3300025291 | Bacteria | 378002 |
| 279 | Ga0209025_1024717 | 3300025294 | Bacteria | 3090 |
| 280 | Ga0209564_1016007 | 3300025295 | Bacteria | 3016 |
| 281 | Ga0207656_10000002 | 3300025321 | Bacteria | 792178 |
| 282 | Ga0207692_10009035 | 3300025898 | Bacteria | 4150 |
| 283 | Ga0207642_10043156 | 3300025899 | Bacteria | 1987 |
| 284 | Ga0207710_10000682 | 3300025900 | Bacteria | 19100 |
| 285 | Ga0207710_10000764 | 3300025900 | Bacteria | 17589 |
| 286 | Ga0207710_10004037 | 3300025900 | Bacteria | 6457 |
| 287 | Ga0207710_10086269 | 3300025900 | Bacteria | 1463 |
| 288 | Ga0207688_10000765 | 3300025901 | Bacteria | 15989 |
| 289 | Ga0207688_10007019 | 3300025901 | Bacteria | 6124 |
| 290 | Ga0207680_10010080 | 3300025903 | Bacteria | 4714 |
| 291 | Ga0207680_10047824 | 3300025903 | Bacteria | 2537 |
| 292 | Ga0207647_10018243 | 3300025904 | Bacteria | 4753 |
| 293 | Ga0207647_10033585 | 3300025904 | Bacteria | 3285 |
| 294 | Ga0207699_10104198 | 3300025906 | Bacteria | 1806 |
| 295 | Ga0207643_10000049 | 3300025908 | Bacteria | 78784 |
| 296 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 297 | Ga0207705_10017953 | 3300025909 | Bacteria | 5060 |
| 298 | Ga0207705_10023382 | 3300025909 | Bacteria | 4409 |
| 299 | Ga0207684_10000152 | 3300025910 | Bacteria | 121082 |
| 300 | Ga0207684_10060237 | 3300025910 | Bacteria | 3224 |
| 301 | Ga0207684_10078287 | 3300025910 | Bacteria | 2812 |
| 302 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 303 | Ga0207654_10028648 | 3300025911 | Bacteria | 3038 |
| 304 | Ga0207707_10040010 | 3300025912 | Bacteria | 4097 |
| 305 | Ga0207707_10047329 | 3300025912 | Bacteria | 3745 |
| 306 | Ga0207695_10009910 | 3300025913 | Bacteria | 11708 |
| 307 | Ga0207695_10010927 | 3300025913 | Bacteria | 11043 |
| 308 | Ga0207695_10059071 | 3300025913 | Bacteria | 3979 |
| 309 | Ga0207671_10000002 | 3300025914 | Bacteria | 1144816 |
| 310 | Ga0207671_10008858 | 3300025914 | Bacteria | 8473 |
| 311 | Ga0207671_10087625 | 3300025914 | Bacteria | 2341 |
| 312 | Ga0207693_10014631 | 3300025915 | Bacteria | 6304 |
| 313 | Ga0207660_10010527 | 3300025917 | Bacteria | 6006 |
| 314 | Ga0207660_10016917 | 3300025917 | Bacteria | 4838 |
| 315 | Ga0207660_10042981 | 3300025917 | Bacteria | 3174 |
| 316 | Ga0207657_10062750 | 3300025919 | Bacteria | 3180 |
| 317 | Ga0207657_10069533 | 3300025919 | Bacteria | 2987 |
| 318 | Ga0207649_10021098 | 3300025920 | Bacteria | 3744 |
| 319 | Ga0207652_10037094 | 3300025921 | Bacteria | 4125 |
| 320 | Ga0207652_10046602 | 3300025921 | Bacteria | 3699 |
| 321 | Ga0207646_10000085 | 3300025922 | Bacteria | 125486 |
| 322 | Ga0207646_10003404 | 3300025922 | Bacteria | 17963 |
| 323 | Ga0207646_10006296 | 3300025922 | Bacteria | 12304 |
| 324 | Ga0207646_10041597 | 3300025922 | Bacteria | 4131 |
| 325 | Ga0207646_10097144 | 3300025922 | Bacteria | 2639 |
| 326 | Ga0207646_10109562 | 3300025922 | Bacteria | 2477 |
| 327 | Ga0207646_10117967 | 3300025922 | Bacteria | 2384 |
| 328 | Ga0207681_10020887 | 3300025923 | Bacteria | 4156 |
| 329 | Ga0207694_10000395 | 3300025924 | Bacteria | 40665 |
| 330 | Ga0207650_10004400 | 3300025925 | Bacteria | 9627 |
| 331 | Ga0207650_10006096 | 3300025925 | Bacteria | 8217 |
| 332 | Ga0207650_10009512 | 3300025925 | Bacteria | 6643 |
| 333 | Ga0207659_10000449 | 3300025926 | Bacteria | 24779 |
| 334 | Ga0207659_10006153 | 3300025926 | Bacteria | 7336 |
| 335 | Ga0207659_10011241 | 3300025926 | Bacteria | 5651 |
| 336 | Ga0207659_10069012 | 3300025926 | Bacteria | 2573 |
| 337 | Ga0207659_10181389 | 3300025926 | Bacteria | 1668 |
| 338 | Ga0207687_10000051 | 3300025927 | Bacteria | 92954 |
| 339 | Ga0207687_10005749 | 3300025927 | Bacteria | 8206 |
| 340 | Ga0207687_10038434 | 3300025927 | Bacteria | 3271 |
| 341 | Ga0207687_10148354 | 3300025927 | Bacteria | 1787 |
| 342 | Ga0207644_10000427 | 3300025931 | Bacteria | 27329 |
| 343 | Ga0207690_10000753 | 3300025932 | Bacteria | 20917 |
| 344 | Ga0207690_10007571 | 3300025932 | Bacteria | 6446 |
| 345 | Ga0207706_10010636 | 3300025933 | Bacteria | 8405 |
| 346 | Ga0207706_10050638 | 3300025933 | Bacteria | 3670 |
| 347 | Ga0207706_10096319 | 3300025933 | Bacteria | 2602 |
| 348 | Ga0207706_10111601 | 3300025933 | Bacteria | 2405 |
| 349 | Ga0207686_10030649 | 3300025934 | Bacteria | 3187 |
| 350 | Ga0207686_10062536 | 3300025934 | Bacteria | 2364 |
| 351 | Ga0207709_10001062 | 3300025935 | Bacteria | 20280 |
| 352 | Ga0207670_10018852 | 3300025936 | Bacteria | 4204 |
| 353 | Ga0207670_10028353 | 3300025936 | Bacteria | 3554 |
| 354 | Ga0207704_10052717 | 3300025938 | Bacteria | 2467 |
| 355 | Ga0207691_10021623 | 3300025940 | Bacteria | 6073 |
| 356 | Ga0207691_10024960 | 3300025940 | Bacteria | 5617 |
| 357 | Ga0207711_10001610 | 3300025941 | Bacteria | 20866 |
| 358 | Ga0207711_10012790 | 3300025941 | Bacteria | 6972 |
| 359 | Ga0207711_10018085 | 3300025941 | Bacteria | 5860 |
| 360 | Ga0207711_10023009 | 3300025941 | Bacteria | 5216 |
| 361 | Ga0207711_10031750 | 3300025941 | Bacteria | 4461 |
| 362 | Ga0207711_10095568 | 3300025941 | Bacteria | 2621 |
| 363 | Ga0207689_10000355 | 3300025942 | Bacteria | 42965 |
| 364 | Ga0207689_10142869 | 3300025942 | Bacteria | 1972 |
| 365 | Ga0207679_10003632 | 3300025945 | Bacteria | 9567 |
| 366 | Ga0207667_10000384 | 3300025949 | Bacteria | 59816 |
| 367 | Ga0207667_10006444 | 3300025949 | Bacteria | 14210 |
| 368 | Ga0207667_10021836 | 3300025949 | Bacteria | 7084 |
| 369 | Ga0207667_10069498 | 3300025949 | Bacteria | 3665 |
| 370 | Ga0207667_10072433 | 3300025949 | Bacteria | 3581 |
| 371 | Ga0207668_10136815 | 3300025972 | Bacteria | 1878 |
| 372 | Ga0207640_10000001 | 3300025981 | Bacteria | 628778 |
| 373 | Ga0207640_10089369 | 3300025981 | Bacteria | 2129 |
| 374 | Ga0207658_10038428 | 3300025986 | Bacteria | 3448 |
| 375 | Ga0207677_10009186 | 3300026023 | Bacteria | 5553 |
| 376 | Ga0207677_10016480 | 3300026023 | Bacteria | 4380 |
| 377 | Ga0207703_10000181 | 3300026035 | Bacteria | 73537 |
| 378 | Ga0207703_10006991 | 3300026035 | Bacteria | 8980 |
| 379 | Ga0207703_10013734 | 3300026035 | Bacteria | 6313 |
| 380 | Ga0207639_10000037 | 3300026041 | Bacteria | 147685 |
| 381 | Ga0207639_10010005 | 3300026041 | Bacteria | 6555 |
| 382 | Ga0207639_10046216 | 3300026041 | Bacteria | 3284 |
| 383 | Ga0207678_10000705 | 3300026067 | Bacteria | 30524 |
| 384 | Ga0207678_10011578 | 3300026067 | Bacteria | 7747 |
| 385 | Ga0207678_10099639 | 3300026067 | Bacteria | 2482 |
| 386 | Ga0207708_10014564 | 3300026075 | Bacteria | 5884 |
| 387 | Ga0207708_10016932 | 3300026075 | Bacteria | 5488 |
| 388 | Ga0207702_10001520 | 3300026078 | Bacteria | 22948 |
| 389 | Ga0207702_10026927 | 3300026078 | Bacteria | 4774 |
| 390 | Ga0207641_10000705 | 3300026088 | Bacteria | 35934 |
| 391 | Ga0207641_10000772 | 3300026088 | Bacteria | 34278 |
| 392 | Ga0207641_10003322 | 3300026088 | Bacteria | 14315 |
| 393 | Ga0207641_10053652 | 3300026088 | Bacteria | 3418 |
| 394 | Ga0207648_10020715 | 3300026089 | Bacteria | 5919 |
| 395 | Ga0207676_10003132 | 3300026095 | Bacteria | 11807 |
| 396 | Ga0207676_10035482 | 3300026095 | Bacteria | 3785 |
| 397 | Ga0207676_10055520 | 3300026095 | Bacteria | 3109 |
| 398 | Ga0207676_10170281 | 3300026095 | Bacteria | 1897 |
| 399 | Ga0207674_10003240 | 3300026116 | Bacteria | 20036 |
| 400 | Ga0207674_10006786 | 3300026116 | Bacteria | 13431 |
| 401 | Ga0207674_10058473 | 3300026116 | Bacteria | 3905 |
| 402 | Ga0207675_100027582 | 3300026118 | Bacteria | 5289 |
| 403 | Ga0207675_100056126 | 3300026118 | Bacteria | 3674 |
| 404 | Ga0207675_100107793 | 3300026118 | Bacteria | 2627 |
| 405 | Ga0207675_100135250 | 3300026118 | Bacteria | 2338 |
| 406 | Ga0207683_10000155 | 3300026121 | Bacteria | 57375 |
| 407 | Ga0207683_10013847 | 3300026121 | Bacteria | 6878 |
| 408 | Ga0207683_10186792 | 3300026121 | Bacteria | 1880 |
| 409 | Ga0207698_10000297 | 3300026142 | Bacteria | 29970 |
| 410 | Ga0207698_10017059 | 3300026142 | Bacteria | 4916 |
| 411 | Ga0207698_10101266 | 3300026142 | Bacteria | 2388 |
| 412 | Ga0209996_1000822 | 3300027395 | Bacteria | 3656 |
| 413 | Ga0209282_1000459 | 3300027666 | Bacteria | 19912 |
| 414 | Ga0209974_10027562 | 3300027876 | Bacteria | 1880 |
| 415 | Ga0207428_10002981 | 3300027907 | Bacteria | 16729 |
| 416 | Ga0207428_10003991 | 3300027907 | Bacteria | 14165 |
| 417 | Ga0207428_10010552 | 3300027907 | Bacteria | 8245 |
| 418 | Ga0207428_10011501 | 3300027907 | Bacteria | 7819 |
| 419 | Ga0207428_10024979 | 3300027907 | Bacteria | 5010 |
| 420 | Ga0207428_10088199 | 3300027907 | Bacteria | 2413 |
| 421 | Ga0268266_10005631 | 3300028379 | Bacteria | 11626 |
| 422 | Ga0268266_10007630 | 3300028379 | Bacteria | 9731 |
| 423 | Ga0268266_10012018 | 3300028379 | Bacteria | 7493 |
| 424 | Ga0268266_10017715 | 3300028379 | Bacteria | 6069 |
| 425 | Ga0268265_10003019 | 3300028380 | Bacteria | 12280 |
| 426 | Ga0268264_10030138 | 3300028381 | Bacteria | 4448 |
| 427 | Ga0268264_10053645 | 3300028381 | Bacteria | 3364 |
| 428 | Ga0307517_10000575 | 3300028786 | Bacteria | 62687 |
| 429 | Ga0307517_10104467 | 3300028786 | Bacteria | 2206 |
| 430 | Ga0307515_10000090 | 3300028794 | Bacteria | 215043 |
| 431 | Ga0307515_10000626 | 3300028794 | Bacteria | 82165 |
| 432 | Ga0307515_10016121 | 3300028794 | Bacteria | 13705 |
| 433 | Ga0307515_10033949 | 3300028794 | Bacteria | 8377 |
| 434 | Ga0307515_10056285 | 3300028794 | Bacteria | 5720 |
| 435 | Ga0265338_10023116 | 3300028800 | Bacteria | 6402 |
| 436 | Ga0265338_10069851 | 3300028800 | Bacteria | 3015 |
| 437 | Ga0265338_10112247 | 3300028800 | Bacteria | 2192 |
| 438 | Ga0265332_10009863 | 3300031238 | Bacteria | 4255 |
| 439 | Ga0265325_10014158 | 3300031241 | Bacteria | 4516 |
| 440 | Ga0265340_10018702 | 3300031247 | Bacteria | 3572 |
| 441 | Ga0265339_10017534 | 3300031249 | Bacteria | 4238 |
| 442 | Ga0265339_10021423 | 3300031249 | Bacteria | 3761 |
| 443 | Ga0265327_10000064 | 3300031251 | Bacteria | 231983 |
| 444 | Ga0265327_10002041 | 3300031251 | Bacteria | 22722 |
| 445 | Ga0265327_10011063 | 3300031251 | Bacteria | 6266 |
| 446 | Ga0265316_10061518 | 3300031344 | Bacteria | 2916 |
| 447 | Ga0265316_10063605 | 3300031344 | Bacteria | 2861 |
| 448 | Ga0307513_10001842 | 3300031456 | Bacteria | 30107 |
| 449 | Ga0307513_10021458 | 3300031456 | Bacteria | 7624 |
| 450 | Ga0307509_10001164 | 3300031507 | Bacteria | 44979 |
| 451 | Ga0307509_10002081 | 3300031507 | Bacteria | 32968 |
| 452 | Ga0307509_10006951 | 3300031507 | Bacteria | 15009 |
| 453 | Ga0307509_10013455 | 3300031507 | Bacteria | 9687 |
| 454 | Ga0307509_10222611 | 3300031507 | Bacteria | 1698 |
| 455 | Ga0307408_100012808 | 3300031548 | Bacteria | 5562 |
| 456 | Ga0307408_100028205 | 3300031548 | Bacteria | 3877 |
| 457 | Ga0265313_10036958 | 3300031595 | Bacteria | 2448 |
| 458 | Ga0265313_10040640 | 3300031595 | Bacteria | 2297 |
| 459 | Ga0307508_10000095 | 3300031616 | Bacteria | 103944 |
| 460 | Ga0307508_10005281 | 3300031616 | Bacteria | 12331 |
| 461 | Ga0307514_10000861 | 3300031649 | Bacteria | 48344 |
| 462 | Ga0316575_10041618 | 3300031665 | Bacteria | 1818 |
| 463 | Ga0265314_10024057 | 3300031711 | Bacteria | 4627 |
| 464 | Ga0265342_10045661 | 3300031712 | Bacteria | 2636 |
| 465 | Ga0316576_10002490 | 3300031727 | Bacteria | 10488 |
| 466 | Ga0316576_10020271 | 3300031727 | Bacteria | 4572 |
| 467 | Ga0316578_10008648 | 3300031728 | Bacteria | 5192 |
| 468 | Ga0316578_10021395 | 3300031728 | Bacteria | 3589 |
| 469 | Ga0307516_10001905 | 3300031730 | Bacteria | 28569 |
| 470 | Ga0307516_10027943 | 3300031730 | Bacteria | 5714 |
| 471 | Ga0307405_10043395 | 3300031731 | Bacteria | 2743 |
| 472 | Ga0316577_10053381 | 3300031733 | Bacteria | 2256 |
| 473 | Ga0307413_10005754 | 3300031824 | Bacteria | 5574 |
| 474 | Ga0307413_10007349 | 3300031824 | Bacteria | 5109 |
| 475 | Ga0307413_10141204 | 3300031824 | Bacteria | 1665 |
| 476 | Ga0307410_10000654 | 3300031852 | Bacteria | 14294 |
| 477 | Ga0307410_10063821 | 3300031852 | Bacteria | 2528 |
| 478 | Ga0307406_10000232 | 3300031901 | Bacteria | 33842 |
| 479 | Ga0307406_10015705 | 3300031901 | Bacteria | 4388 |
| 480 | Ga0307406_10087099 | 3300031901 | Bacteria | 2092 |
| 481 | Ga0307412_10132894 | 3300031911 | Bacteria | 1810 |
| 482 | Ga0307409_100000004 | 3300031995 | Bacteria | 84332 |
| 483 | Ga0307409_100001551 | 3300031995 | Bacteria | 11405 |
| 484 | Ga0307409_100013285 | 3300031995 | Bacteria | 5291 |
| 485 | Ga0307409_100016948 | 3300031995 | Bacteria | 4840 |
| 486 | Ga0307409_100190672 | 3300031995 | Bacteria | 1824 |
| 487 | Ga0307416_100000126 | 3300032002 | Bacteria | 46344 |
| 488 | Ga0307416_100014731 | 3300032002 | Bacteria | 5373 |
| 489 | Ga0307416_100021776 | 3300032002 | Bacteria | 4611 |
| 490 | Ga0307416_100036062 | 3300032002 | Bacteria | 3787 |
| 491 | Ga0307414_10003245 | 3300032004 | Bacteria | 8662 |
| 492 | Ga0307411_10021291 | 3300032005 | Bacteria | 3790 |
| 493 | Ga0307415_100008261 | 3300032126 | Bacteria | 5760 |
| 494 | Ga0316580_10011296 | 3300032139 | Bacteria | 2709 |
| 495 | Ga0307507_10053796 | 3300033179 | Bacteria | 3841 |
| 496 | Ga0307510_10016948 | 3300033180 | Bacteria | 8593 |
| 497 | Ga0373949_0000187 | 3300035090 | Bacteria | 23988 |
| 498 | Ga0373936_0000012 | 3300035113 | Bacteria | 228915 |
| 499 | Ga0373953_0028810 | 3300035117 | Bacteria | 2144 |
| 500 | Ga0373954_0045377 | 3300035118 | Bacteria | 2053 |
| 501 | Ga0373955_0114643 | 3300035172 | Bacteria | 1561 |
| 502 | Ga0373961_0000156 | 3300035241 | Bacteria | 32884 |
| 503 | Ga0316574_0018158 | 3300035398 | Bacteria | 4128 |
| 504 | Ga0316574_0180430 | 3300035398 | Bacteria | 1358 |
| 505 | Ga0316574_0199888 | 3300035398 | Bacteria | 1284 |
| 506 | Ga0373933_0003533 | 3300035724 | Bacteria | 8700 |
| 507 | Ga0373933_0109165 | 3300035724 | Bacteria | 1724 |
| 508 | Ga0373937_0000294 | 3300036401 | Bacteria | 47485 |
| 509 | Ga0373937_0044492 | 3300036401 | Bacteria | 4055 |
| 510 | Ga0373925_0048463 | 3300037068 | Bacteria | 3166 |
| 511 | Ga0373925_0188655 | 3300037068 | Bacteria | 1635 |
| 512 | Ga0395899_0038482 | 3300037312 | Bacteria | 3582 |
| 513 | Ga0395900_0003801 | 3300037418 | Bacteria | 16162 |
| 514 | Ga0395900_0024723 | 3300037418 | Bacteria | 6148 |
| 515 | Ga0395900_0082960 | 3300037418 | Bacteria | 3293 |
| 516 | Ga0395900_0155279 | 3300037418 | Bacteria | 2337 |
| 517 | Ga0395900_0167521 | 3300037418 | Bacteria | 2238 |
| 518 | Ga0395898_0029681 | 3300037466 | Bacteria | 5474 |
| 519 | Ga0395898_0154321 | 3300037466 | Bacteria | 2196 |
| 520 | Ga0395898_0156183 | 3300037466 | Bacteria | 2182 |
| 521 | Ga0395905_0171069 | 3300037471 | Bacteria | 2041 |
| 522 | Ga0395901_0090021 | 3300038443 | Bacteria | 3211 |
| 523 | Ga0395901_0127413 | 3300038443 | Bacteria | 2675 |
| 524 | Ga0400483_044815 | 3300039062 | Bacteria | 21564 |
| 525 | Ga0400483_124415 | 3300039062 | Bacteria | 2420 |
| 526 | Ga0400483_171783 | 3300039062 | Bacteria | 21158 |
| 527 | Ga0400483_215983 | 3300039062 | Bacteria | 44583 |
| 528 | Ga0400483_259819 | 3300039062 | Bacteria | 2340 |
| 529 | Ga0436365_0681063 | 3300039437 | Bacteria | 33078 |
| 530 | Ga0451853_0605618 | 3300041512 | Bacteria | 2641 |
| 531 | Ga0439445_0017068 | 3300042004 | Bacteria | 1791 |
| 532 | Ga0439448_0018642 | 3300042005 | Bacteria | 2130 |
| 533 | Ga0439455_0017323 | 3300042012 | Bacteria | 1677 |
| 534 | Ga0439463_001486 | 3300042016 | Bacteria | 6193 |
| 535 | Ga0439435_0000833 | 3300042436 | Bacteria | 5262 |
| 536 | Ga0439459_0002988 | 3300042438 | Bacteria | 2652 |
| 537 | Ga0439464_0005358 | 3300042439 | Bacteria | 3314 |
| 538 | Ga0439440_0003945 | 3300042993 | Bacteria | 2892 |
| 539 | Ga0466972_0045980 | 3300044658 | Bacteria | 2114 |
| 540 | Ga0466972_0051184 | 3300044658 | Bacteria | 1993 |
| 541 | Ga0466965_0000016 | 3300044683 | Bacteria | 81402 |
| 542 | Ga0466965_0005209 | 3300044683 | Bacteria | 5842 |
| 543 | Ga0466965_0017806 | 3300044683 | Bacteria | 3398 |
| 544 | Ga0466965_0027522 | 3300044683 | Bacteria | 2761 |
| 545 | Ga0466965_0039573 | 3300044683 | Bacteria | 2318 |
| 546 | Ga0466966_0021447 | 3300044684 | Bacteria | 4242 |
| 547 | Ga0466961_0008445 | 3300044693 | Bacteria | 6559 |
| 548 | Ga0466961_0014589 | 3300044693 | Bacteria | 5048 |
| 549 | Ga0466961_0018181 | 3300044693 | Bacteria | 4519 |
| 550 | Ga0466961_0024175 | 3300044693 | Bacteria | 3907 |
| 551 | Ga0466963_0006873 | 3300044694 | Bacteria | 6768 |
| 552 | Ga0466963_0014074 | 3300044694 | Bacteria | 4928 |
| 553 | Ga0466963_0038573 | 3300044694 | Bacteria | 3125 |
| 554 | Ga0466963_0104945 | 3300044694 | Bacteria | 1937 |
| 555 | Ga0466964_0001285 | 3300044706 | Bacteria | 8567 |
| 556 | Ga0453684_0391720 | 3300044712 | Bacteria | 1558 |
| 557 | Ga0466971_0004116 | 3300044719 | Bacteria | 6261 |
| 558 | Ga0466971_0024226 | 3300044719 | Bacteria | 2708 |
| 559 | Ga0466968_0016601 | 3300044735 | Bacteria | 2934 |
| 560 | Ga0466970_0001281 | 3300044765 | Bacteria | 12165 |
| 561 | Ga0466970_0013374 | 3300044765 | Bacteria | 4207 |
| 562 | Ga0466957_0001021 | 3300044842 | Bacteria | 14441 |
| 563 | Ga0466957_0049781 | 3300044842 | Bacteria | 2548 |
| 564 | Ga0466960_0004151 | 3300044901 | Bacteria | 5639 |
| 565 | Ga0466960_0022402 | 3300044901 | Bacteria | 2824 |
| 566 | Ga0466959_0010490 | 3300045049 | Bacteria | 6626 |
| 567 | Ga0466959_0117947 | 3300045049 | Bacteria | 1889 |
| 568 | Ga0466958_0006072 | 3300045836 | Bacteria | 6548 |
| 569 | Ga0466958_0006804 | 3300045836 | Bacteria | 6249 |
| 570 | Ga0466958_0013868 | 3300045836 | Bacteria | 4595 |
| 571 | Ga0466958_0025466 | 3300045836 | Bacteria | 3489 |
| 572 | Ga0466967_0002225 | 3300045976 | Bacteria | 11936 |
| 573 | Ga0466967_0006548 | 3300045976 | Bacteria | 8261 |
| 574 | Ga0466967_0017392 | 3300045976 | Bacteria | 5706 |
| 575 | Ga0466967_0026189 | 3300045976 | Bacteria | 4825 |
| 576 | Ga0466967_0075770 | 3300045976 | Bacteria | 3024 |
| 577 | Ga0495592_0001098 | 3300046454 | Bacteria | 18798 |
| 578 | Ga0495592_0034359 | 3300046454 | Bacteria | 3822 |
| 579 | Ga0495590_0000891 | 3300046457 | Bacteria | 13373 |
| 580 | Ga0495629_0002724 | 3300046459 | Bacteria | 13526 |
| 581 | Ga0495641_0006967 | 3300046461 | Bacteria | 7192 |
| 582 | Ga0495651_0000815 | 3300046462 | Bacteria | 24148 |
| 583 | Ga0495651_0050577 | 3300046462 | Bacteria | 3206 |
| 584 | Ga0495651_0149273 | 3300046462 | Bacteria | 1687 |
| 585 | Ga0495653_0001854 | 3300046463 | Bacteria | 16703 |
| 586 | Ga0495653_0153839 | 3300046463 | Bacteria | 1604 |
| 587 | Ga0495650_0002544 | 3300046471 | Bacteria | 14530 |
| 588 | Ga0495650_0003922 | 3300046471 | Bacteria | 10490 |
| 589 | Ga0495650_0052305 | 3300046471 | Bacteria | 1677 |
| 590 | Ga0495580_0008034 | 3300046472 | Bacteria | 8425 |
| 591 | Ga0495580_0008828 | 3300046472 | Bacteria | 7977 |
| 592 | Ga0495580_0142444 | 3300046472 | Bacteria | 1662 |
| 593 | Ga0495582_0019156 | 3300046473 | Bacteria | 3744 |
| 594 | Ga0495594_0012306 | 3300046499 | Bacteria | 4458 |
| 595 | Ga0495607_0039906 | 3300046501 | Bacteria | 2800 |
| 596 | Ga0495583_0000911 | 3300046506 | Bacteria | 34999 |
| 597 | Ga0495608_0000148 | 3300046511 | Bacteria | 50904 |
| 598 | Ga0495608_0128812 | 3300046511 | Bacteria | 1620 |
| 599 | Ga0495616_0004445 | 3300046513 | Bacteria | 8831 |
| 600 | Ga0495618_0002523 | 3300046514 | Bacteria | 11734 |
| 601 | Ga0495620_0035382 | 3300046515 | Bacteria | 2246 |
| 602 | Ga0495628_0047108 | 3300046516 | Bacteria | 3422 |
| 603 | Ga0495630_0024745 | 3300046517 | Bacteria | 4438 |
| 604 | Ga0495631_0001172 | 3300046518 | Bacteria | 16199 |
| 605 | Ga0495631_0041788 | 3300046518 | Bacteria | 2028 |
| 606 | Ga0495644_0036890 | 3300046523 | Bacteria | 1844 |
| 607 | Ga0495648_0060755 | 3300046524 | Bacteria | 2247 |
| 608 | Ga0495652_0020705 | 3300046529 | Bacteria | 5847 |
| 609 | Ga0495640_0003850 | 3300046533 | Bacteria | 12037 |
| 610 | Ga0495587_0001638 | 3300046536 | Bacteria | 14931 |
| 611 | Ga0495587_0069252 | 3300046536 | Bacteria | 2054 |
| 612 | Ga0495645_0004410 | 3300046543 | Bacteria | 9617 |
| 613 | Ga0495645_0034952 | 3300046543 | Bacteria | 3664 |
| 614 | Ga0495645_0051258 | 3300046543 | Bacteria | 3003 |
| 615 | Ga0495667_0010608 | 3300046559 | Bacteria | 6233 |
| 616 | Ga0495668_0055772 | 3300046616 | Bacteria | 2182 |
| 617 | Ga0495625_0015966 | 3300046660 | Bacteria | 5923 |
| 618 | Ga0495657_0005335 | 3300046675 | Bacteria | 10167 |
| 619 | Ga0495599_0051117 | 3300046678 | Bacteria | 2590 |
| 620 | Ga0495599_0093702 | 3300046678 | Bacteria | 1873 |
| 621 | Ga0495623_0003777 | 3300046679 | Bacteria | 9982 |
| 622 | Ga0495623_0062771 | 3300046679 | Bacteria | 2328 |
| 623 | Ga0495646_0010629 | 3300046680 | Bacteria | 5846 |
| 624 | Ga0495647_0001867 | 3300046681 | Bacteria | 6541 |
| 625 | Ga0495658_0005410 | 3300046683 | Bacteria | 6277 |
| 626 | Ga0495658_0088533 | 3300046683 | Bacteria | 1830 |
| 627 | Ga0495670_0036860 | 3300046691 | Bacteria | 2437 |
| 628 | Ga0495671_0000976 | 3300046692 | Bacteria | 19963 |
| 629 | Ga0495600_0084421 | 3300046809 | Bacteria | 2072 |
| 630 | Ga0495581_0129267 | 3300047315 | Bacteria | 1472 |
| 631 | Ga0495604_0004509 | 3300047317 | Bacteria | 11032 |
| 632 | Ga0495604_0016895 | 3300047317 | Bacteria | 5834 |
| 633 | Ga0495674_0000457 | 3300047319 | Bacteria | 36912 |
| 634 | Ga0495674_0081050 | 3300047319 | Bacteria | 2784 |
| 635 | Ga0495672_0002195 | 3300047320 | Bacteria | 18184 |
| 636 | Ga0495672_0002615 | 3300047320 | Bacteria | 16301 |
| 637 | Ga0495672_0005993 | 3300047320 | Bacteria | 9522 |
| 638 | Ga0495676_0060970 | 3300047321 | Bacteria | 2953 |
| 639 | Ga0495680_0000868 | 3300047322 | Bacteria | 33574 |
| 640 | Ga0495683_0000677 | 3300047323 | Bacteria | 25156 |
| 641 | Ga0495687_017509 | 3300047443 | Bacteria | 3572 |
| 642 | Ga0495687_020765 | 3300047443 | Bacteria | 3195 |
| 643 | Ga0495687_024200 | 3300047443 | Bacteria | 2889 |
| 644 | Ga0495675_0052266 | 3300047444 | Bacteria | 2594 |
| 645 | Ga0495681_0043727 | 3300047470 | Bacteria | 2158 |
| 646 | Ga0495684_0007437 | 3300047471 | Bacteria | 8489 |
| 647 | Ga0495686_0000048 | 3300047472 | Bacteria | 278044 |
| 648 | Ga0495686_0021863 | 3300047472 | Bacteria | 4239 |
| 649 | Ga0495686_0059698 | 3300047472 | Bacteria | 2373 |
| 650 | Ga0495602_0003749 | 3300048088 | Bacteria | 15782 |
| 651 | Ga0495602_0048605 | 3300048088 | Bacteria | 3810 |
| 652 | Ga0495602_0056601 | 3300048088 | Bacteria | 3447 |
| 653 | Ga0495614_0015333 | 3300048089 | Bacteria | 3340 |
| 654 | Ga0496100_0107330 | 3300048903 | Bacteria | 1934 |
| 655 | Ga0496101_0020991 | 3300048904 | Bacteria | 4482 |
| 656 | Ga0496101_0080824 | 3300048904 | Bacteria | 2402 |
| 657 | Ga0496102_0000059 | 3300048905 | Bacteria | 168633 |
| 658 | Ga0496102_0003569 | 3300048905 | Bacteria | 13183 |
| 659 | Ga0496102_0004742 | 3300048905 | Bacteria | 11512 |
| 660 | Ga0496102_0005091 | 3300048905 | Bacteria | 11137 |
| 661 | Ga0496102_0073462 | 3300048905 | Bacteria | 3143 |
| 662 | Ga0496103_0000063 | 3300048906 | Bacteria | 128503 |
| 663 | Ga0496103_0139931 | 3300048906 | Bacteria | 1547 |
| 664 | Ga0496104_0057728 | 3300048907 | Bacteria | 3673 |
| 665 | Ga0496104_0076160 | 3300048907 | Bacteria | 3195 |
| 666 | Ga0496105_0006741 | 3300048908 | Bacteria | 8830 |
| 667 | Ga0496105_0176699 | 3300048908 | Bacteria | 1749 |
| 668 | Ga0496106_0019275 | 3300048909 | Bacteria | 5058 |
| 669 | Ga0496106_0126818 | 3300048909 | Bacteria | 1999 |
| 670 | Ga0496107_0045962 | 3300048910 | Bacteria | 3142 |
| 671 | Ga0496107_0059514 | 3300048910 | Bacteria | 2764 |
| 672 | Ga0496108_0026484 | 3300048911 | Bacteria | 4782 |
| 673 | Ga0496108_0044659 | 3300048911 | Bacteria | 3699 |
| 674 | Ga0496108_0057426 | 3300048911 | Bacteria | 3270 |
| 675 | Ga0496108_0097031 | 3300048911 | Bacteria | 2511 |
| 676 | Ga0496108_0108718 | 3300048911 | Bacteria | 2369 |
| 677 | Ga0496109_0000016 | 3300048912 | Bacteria | 212455 |
| 678 | Ga0496109_0004796 | 3300048912 | Bacteria | 11290 |
| 679 | Ga0496109_0031854 | 3300048912 | Bacteria | 4736 |
| 680 | Ga0496109_0038731 | 3300048912 | Bacteria | 4311 |
| 681 | Ga0496109_0066056 | 3300048912 | Bacteria | 3311 |
| 682 | Ga0496109_0188087 | 3300048912 | Bacteria | 1940 |
| 683 | Ga0496110_0011966 | 3300048913 | Bacteria | 7125 |
| 684 | Ga0496110_0017590 | 3300048913 | Bacteria | 5978 |
| 685 | Ga0496111_0001803 | 3300048914 | Bacteria | 12568 |
| 686 | Ga0496111_0020992 | 3300048914 | Bacteria | 4553 |
| 687 | Ga0496111_0049728 | 3300048914 | Bacteria | 3023 |
| 688 | Ga0496111_0178983 | 3300048914 | Bacteria | 1576 |
| 689 | Ga0496112_0009924 | 3300048915 | Bacteria | 8612 |
| 690 | Ga0496112_0029168 | 3300048915 | Bacteria | 5334 |
| 691 | Ga0496112_0098558 | 3300048915 | Bacteria | 2892 |
| 692 | Ga0496113_0041450 | 3300048916 | Bacteria | 3398 |
| 693 | Ga0496113_0219316 | 3300048916 | Bacteria | 1515 |
| 694 | Ga0496114_0032778 | 3300048917 | Bacteria | 4279 |
| 695 | Ga0496114_0032896 | 3300048917 | Bacteria | 4270 |
| 696 | Ga0496114_0040981 | 3300048917 | Bacteria | 3837 |
| 697 | Ga0496114_0060374 | 3300048917 | Bacteria | 3169 |
| 698 | Ga0496114_0092169 | 3300048917 | Bacteria | 2574 |
| 699 | Ga0496115_0038565 | 3300048918 | Bacteria | 3791 |
| 700 | Ga0496116_0000371 | 3300048919 | Bacteria | 67456 |
| 701 | Ga0496117_0000063 | 3300048920 | Bacteria | 254446 |
| 702 | Ga0496117_0003104 | 3300048920 | Bacteria | 19864 |
| 703 | Ga0496117_0014490 | 3300048920 | Bacteria | 6787 |
| 704 | Ga0496117_0072118 | 3300048920 | Bacteria | 2311 |
| 705 | Ga0496118_0005850 | 3300048921 | Bacteria | 13789 |
| 706 | Ga0496118_0017172 | 3300048921 | Bacteria | 6602 |
| 707 | Ga0496118_0031324 | 3300048921 | Bacteria | 4411 |
| 708 | Ga0496118_0066813 | 3300048921 | Bacteria | 2623 |
| 709 | Ga0496118_0108852 | 3300048921 | Bacteria | 1846 |
| 710 | Ga0496119_0002091 | 3300048922 | Bacteria | 22550 |
| 711 | Ga0496119_0002848 | 3300048922 | Bacteria | 18479 |
| 712 | Ga0496119_0009813 | 3300048922 | Bacteria | 8143 |
| 713 | Ga0496119_0015267 | 3300048922 | Bacteria | 5932 |
| 714 | Ga0496119_0017098 | 3300048922 | Bacteria | 5480 |
| 715 | Ga0496119_0021931 | 3300048922 | Bacteria | 4593 |
| 716 | Ga0496119_0041167 | 3300048922 | Bacteria | 2946 |
| 717 | Ga0496120_0000882 | 3300048923 | Bacteria | 42252 |
| 718 | Ga0496120_0001936 | 3300048923 | Bacteria | 22752 |
| 719 | Ga0496120_0023873 | 3300048923 | Bacteria | 3821 |
| 720 | Ga0496120_0051027 | 3300048923 | Bacteria | 2365 |
| 721 | Ga0496120_0054044 | 3300048923 | Bacteria | 2279 |
| 722 | Ga0496120_0065865 | 3300048923 | Bacteria | 2005 |
| 723 | Ga0496121_0000015 | 3300048924 | Bacteria | 571958 |
| 724 | Ga0496121_0003574 | 3300048924 | Bacteria | 21974 |
| 725 | Ga0496121_0127698 | 3300048924 | Bacteria | 1909 |
| 726 | Ga0496122_0001461 | 3300048925 | Bacteria | 38115 |
| 727 | Ga0496122_0002058 | 3300048925 | Bacteria | 29852 |
| 728 | Ga0496122_0005683 | 3300048925 | Bacteria | 14724 |
| 729 | Ga0496122_0007542 | 3300048925 | Bacteria | 12055 |
| 730 | Ga0496122_0036490 | 3300048925 | Bacteria | 3973 |
| 731 | Ga0496122_0052756 | 3300048925 | Bacteria | 3074 |
| 732 | Ga0496122_0083894 | 3300048925 | Bacteria | 2207 |
| 733 | Ga0496123_0000179 | 3300048926 | Bacteria | 127833 |
| 734 | Ga0496123_0001148 | 3300048926 | Bacteria | 39511 |
| 735 | Ga0496123_0002798 | 3300048926 | Bacteria | 20726 |
| 736 | Ga0496123_0018712 | 3300048926 | Bacteria | 5490 |
| 737 | Ga0496124_0000389 | 3300048927 | Bacteria | 80434 |
| 738 | Ga0496124_0001764 | 3300048927 | Bacteria | 30135 |
| 739 | Ga0496124_0043977 | 3300048927 | Bacteria | 3836 |
| 740 | Ga0496124_0057024 | 3300048927 | Bacteria | 3292 |
| 741 | Ga0496124_0097086 | 3300048927 | Bacteria | 2393 |
| 742 | Ga0496125_0000350 | 3300048928 | Bacteria | 87293 |
| 743 | Ga0496125_0036635 | 3300048928 | Bacteria | 4278 |
| 744 | Ga0496126_0000075 | 3300048929 | Bacteria | 235121 |
| 745 | Ga0496126_0002220 | 3300048929 | Bacteria | 26882 |
| 746 | Ga0496126_0013693 | 3300048929 | Bacteria | 8233 |
| 747 | Ga0496126_0014189 | 3300048929 | Bacteria | 8064 |
| 748 | Ga0496126_0020829 | 3300048929 | Bacteria | 6418 |
| 749 | Ga0496126_0091545 | 3300048929 | Bacteria | 2674 |
| 750 | Ga0496126_0110632 | 3300048929 | Bacteria | 2393 |
| 751 | Ga0501292_005246 | 3300049515 | Bacteria | 1802 |
| 752 | Ga0501031_0032897 | 3300049568 | Bacteria | 3381 |
| 753 | Ga0501031_0068127 | 3300049568 | Bacteria | 2318 |
| 754 | Ga0501031_0114761 | 3300049568 | Bacteria | 1759 |
| 755 | Ga0501032_0027900 | 3300049569 | Bacteria | 3879 |
| 756 | Ga0501032_0040062 | 3300049569 | Bacteria | 3185 |
| 757 | Ga0501033_0028137 | 3300049570 | Bacteria | 4225 |
| 758 | Ga0501034_0002740 | 3300049571 | Bacteria | 20737 |
| 759 | Ga0501034_0005401 | 3300049571 | Bacteria | 13969 |
| 760 | Ga0501034_0017217 | 3300049571 | Bacteria | 7413 |
| 761 | Ga0501034_0019391 | 3300049571 | Bacteria | 6956 |
| 762 | Ga0501036_0022611 | 3300049572 | Bacteria | 5290 |
| 763 | Ga0501036_0033494 | 3300049572 | Bacteria | 4345 |
| 764 | Ga0501036_0201626 | 3300049572 | Bacteria | 1673 |
| 765 | Ga0501037_0010590 | 3300049573 | Bacteria | 6773 |
| 766 | Ga0501037_0067427 | 3300049573 | Bacteria | 2606 |
| 767 | Ga0501038_0012842 | 3300049574 | Bacteria | 7645 |
| 768 | Ga0501038_0139850 | 3300049574 | Bacteria | 1981 |
| 769 | Ga0501039_0030942 | 3300049575 | Bacteria | 4127 |
| 770 | Ga0501039_0185280 | 3300049575 | Bacteria | 1637 |
| 771 | Ga0501040_0003183 | 3300049576 | Bacteria | 10627 |
| 772 | Ga0501040_0009230 | 3300049576 | Bacteria | 6422 |
| 773 | Ga0501041_0004728 | 3300049577 | Bacteria | 7904 |
| 774 | Ga0501041_0025461 | 3300049577 | Bacteria | 3555 |
| 775 | Ga0501042_0000537 | 3300049578 | Bacteria | 19861 |
| 776 | Ga0501042_0000961 | 3300049578 | Bacteria | 16256 |
| 777 | Ga0501042_0002550 | 3300049578 | Bacteria | 11204 |
| 778 | Ga0501042_0056500 | 3300049578 | Bacteria | 2801 |
| 779 | Ga0501042_0112772 | 3300049578 | Bacteria | 1958 |
| 780 | Ga0501043_0001112 | 3300049579 | Bacteria | 23645 |
| 781 | Ga0501043_0004169 | 3300049579 | Bacteria | 11812 |
| 782 | Ga0501046_0008521 | 3300049580 | Bacteria | 8930 |
| 783 | Ga0501046_0038238 | 3300049580 | Bacteria | 3853 |
| 784 | Ga0501047_0111649 | 3300049581 | Bacteria | 2616 |
| 785 | Ga0501048_0005340 | 3300049582 | Bacteria | 9781 |
| 786 | Ga0501068_0011142 | 3300049584 | Bacteria | 5066 |
| 787 | Ga0501068_0013111 | 3300049584 | Bacteria | 4712 |
| 788 | Ga0501069_0016415 | 3300049585 | Bacteria | 3978 |
| 789 | Ga0501069_0024119 | 3300049585 | Bacteria | 3318 |
| 790 | Ga0501069_0117818 | 3300049585 | Bacteria | 1515 |
| 791 | Ga0501070_0000591 | 3300049586 | Bacteria | 33068 |
| 792 | Ga0501070_0001615 | 3300049586 | Bacteria | 19994 |
| 793 | Ga0501070_0024175 | 3300049586 | Bacteria | 5095 |
| 794 | Ga0501070_0033286 | 3300049586 | Bacteria | 4312 |
| 795 | Ga0501070_0087988 | 3300049586 | Bacteria | 2571 |
| 796 | Ga0501070_0135741 | 3300049586 | Bacteria | 2031 |
| 797 | Ga0501070_0139571 | 3300049586 | Bacteria | 2001 |
| 798 | Ga0501071_0022236 | 3300049587 | Bacteria | 4420 |
| 799 | Ga0501072_0002090 | 3300049588 | Bacteria | 14877 |
| 800 | Ga0501072_0241937 | 3300049588 | Bacteria | 1437 |
| 801 | Ga0501073_0000028 | 3300049589 | Bacteria | 118187 |
| 802 | Ga0501073_0000503 | 3300049589 | Bacteria | 27315 |
| 803 | Ga0501073_0009405 | 3300049589 | Bacteria | 7218 |
| 804 | Ga0501073_0036644 | 3300049589 | Bacteria | 3485 |
| 805 | Ga0501074_0022531 | 3300049590 | Bacteria | 4577 |
| 806 | Ga0501074_0063828 | 3300049590 | Bacteria | 2652 |
| 807 | Ga0501074_0178776 | 3300049590 | Bacteria | 1514 |
| 808 | Ga0501075_0000758 | 3300049591 | Bacteria | 20161 |
| 809 | Ga0501075_0021683 | 3300049591 | Bacteria | 4685 |
| 810 | Ga0501076_0001402 | 3300049592 | Bacteria | 16141 |
| 811 | Ga0501076_0067166 | 3300049592 | Bacteria | 2863 |
| 812 | Ga0501077_0032163 | 3300049593 | Bacteria | 3339 |
| 813 | Ga0501077_0164389 | 3300049593 | Bacteria | 1409 |
| 814 | Ga0501227_002689 | 3300049665 | Bacteria | 3901 |
| 815 | Ga0501079_0001374 | 3300049741 | Bacteria | 17131 |
| 816 | Ga0501079_0007080 | 3300049741 | Bacteria | 8463 |
| 817 | Ga0501080_0001558 | 3300049742 | Bacteria | 19389 |
| 818 | Ga0501080_0005011 | 3300049742 | Bacteria | 11797 |
| 819 | Ga0501081_0001441 | 3300049743 | Bacteria | 14545 |
| 820 | Ga0501081_0008218 | 3300049743 | Bacteria | 6774 |
| 821 | Ga0501083_0000028 | 3300049744 | Bacteria | 115481 |
| 822 | Ga0501083_0097660 | 3300049744 | Bacteria | 1938 |
| 823 | Ga0501083_0135155 | 3300049744 | Bacteria | 1616 |
| 824 | Ga0501035_0022879 | 3300049822 | Bacteria | 5739 |
| 825 | Ga0501035_0090360 | 3300049822 | Bacteria | 2696 |
| 826 | Ga0501035_0179159 | 3300049822 | Bacteria | 1827 |
| 827 | Ga0501044_0051779 | 3300049823 | Bacteria | 4232 |
| 828 | Ga0501044_0100878 | 3300049823 | Bacteria | 2904 |
| 829 | Ga0501045_0002501 | 3300049824 | Bacteria | 12495 |
| 830 | Ga0501045_0007779 | 3300049824 | Bacteria | 7454 |
| 831 | nmdc:mga03n38_24527_c1 | 3300050490 | Bacteria | 2467 |
| 832 | nmdc:mga00v17_22200_c1 | 3300050491 | Bacteria | 3659 |
| 833 | nmdc:mga00v17_454_c1 | 3300050491 | Bacteria | 17369 |
| 834 | nmdc:mga0yw44_16324_c1 | 3300050492 | Bacteria | 4008 |
| 835 | nmdc:mga0k408_6897_c1 | 3300050493 | Bacteria | 6062 |
| 836 | nmdc:mga05p37_1039_c1 | 3300050507 | Bacteria | 31636 |
| 837 | nmdc:mga05p37_1366_c1 | 3300050507 | Bacteria | 28371 |
| 838 | nmdc:mga05p37_1873_c2 | 3300050507 | Bacteria | 15278 |
| 839 | nmdc:mga05p37_2544_c2 | 3300050507 | Bacteria | 7408 |
| 840 | nmdc:mga05p37_2674_c1 | 3300050507 | Bacteria | 20751 |
| 841 | nmdc:mga05p37_27219_c1 | 3300050507 | Bacteria | 6960 |
| 842 | nmdc:mga05p37_33965_c1 | 3300050507 | Bacteria | 6248 |
| 843 | nmdc:mga05p37_37964_c1 | 3300050507 | Bacteria | 5907 |
| 844 | nmdc:mga09592_46707_c1 | 3300050508 | Bacteria | 3648 |
| 845 | nmdc:mga06r32_144047_c1 | 3300050510 | Bacteria | 2360 |
| 846 | nmdc:mga08y16_112543_c1 | 3300050511 | Bacteria | 2834 |
| 847 | nmdc:mga08y16_129531_c1 | 3300050511 | Bacteria | 2625 |
| 848 | nmdc:mga08y16_14406_c1 | 3300050511 | Bacteria | 8320 |
| 849 | nmdc:mga08y16_22724_c1 | 3300050511 | Bacteria | 6622 |
| 850 | nmdc:mga08y16_42598_c1 | 3300050511 | Bacteria | 4754 |
| 851 | nmdc:mga08y16_47684_c1 | 3300050511 | Bacteria | 4484 |
| 852 | nmdc:mga08y16_61285_c1 | 3300050511 | Bacteria | 3929 |
| 853 | nmdc:mga0n895_104833_c1 | 3300050512 | Bacteria | 2840 |
| 854 | nmdc:mga0n895_338266_c1 | 3300050512 | Bacteria | 1525 |
| 855 | nmdc:mga0n895_7649_c1 | 3300050512 | Bacteria | 9291 |
| 856 | nmdc:mga0rr50_7553_c1 | 3300050513 | Bacteria | 6714 |
| 857 | nmdc:mga0a205_135132_c1 | 3300050515 | Bacteria | 2367 |
| 858 | nmdc:mga0a205_15514_c1 | 3300050515 | Bacteria | 7119 |
| 859 | nmdc:mga0a205_48177_c1 | 3300050515 | Bacteria | 4113 |
| 860 | nmdc:mga0a205_6370_c1 | 3300050515 | Bacteria | 10661 |
| 861 | nmdc:mga0sz30_13563_c1 | 3300050516 | Bacteria | 3193 |
| 862 | nmdc:mga0sz30_6527_c1 | 3300050516 | Bacteria | 4334 |
| 863 | Ga0495601_0002029 | 3300053077 | Bacteria | 11368 |
| 864 | Ga0495612_0009945 | 3300053078 | Bacteria | 3851 |
| 865 | Ga0500610_0000935 | 3300053079 | Bacteria | 9460 |
| 866 | Ga0495595_0000521 | 3300053084 | Bacteria | 14671 |
| 867 | Ga0495619_0000089 | 3300053085 | Bacteria | 69604 |
| 868 | Ga0495619_0025913 | 3300053085 | Bacteria | 3770 |
| 869 | Ga0495619_0032884 | 3300053085 | Bacteria | 3367 |
| 870 | Ga0500643_000072 | 3300053087 | Bacteria | 112810 |
| 871 | Ga0500644_0014127 | 3300053088 | Bacteria | 2247 |
| 872 | Ga0500651_0000170 | 3300053093 | Bacteria | 42448 |
| 873 | Ga0500651_0000254 | 3300053093 | Bacteria | 32131 |
| 874 | Ga0500650_0003218 | 3300053098 | Bacteria | 5618 |
| 875 | Ga0500555_004172 | 3300053103 | Bacteria | 4114 |
| 876 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 877 | Ga0500556_0000064 | 3300053104 | Bacteria | 109213 |
| 878 | Ga0500562_002639 | 3300053108 | Bacteria | 4461 |
| 879 | Ga0500571_000075 | 3300053110 | Bacteria | 31313 |
| 880 | Ga0500572_001277 | 3300053111 | Bacteria | 7033 |
| 881 | Ga0500593_000096 | 3300053117 | Bacteria | 32939 |
| 882 | Ga0500593_011783 | 3300053117 | Bacteria | 3694 |
| 883 | Ga0500594_0022318 | 3300053118 | Bacteria | 1595 |
| 884 | Ga0500607_000146 | 3300053121 | Bacteria | 59939 |
| 885 | Ga0500608_012477 | 3300053122 | Bacteria | 3728 |
| 886 | Ga0500614_000030 | 3300053123 | Bacteria | 31743 |
| 887 | Ga0500642_0034783 | 3300053130 | Bacteria | 2135 |
| 888 | Ga0500655_001787 | 3300053133 | Bacteria | 4026 |
| 889 | Ga0500655_004546 | 3300053133 | Bacteria | 2496 |
| 890 | Ga0500658_0000134 | 3300053134 | Bacteria | 34937 |
| 891 | Ga0500658_0000142 | 3300053134 | Bacteria | 34080 |
| 892 | Ga0500559_0000043 | 3300053136 | Bacteria | 100617 |
| 893 | Ga0500559_0001053 | 3300053136 | Bacteria | 16797 |
| 894 | Ga0500559_0001058 | 3300053136 | Bacteria | 16716 |
| 895 | Ga0500559_0001135 | 3300053136 | Bacteria | 16041 |
| 896 | Ga0500559_0003767 | 3300053136 | Bacteria | 7364 |
| 897 | Ga0500568_0000003 | 3300053139 | Bacteria | 863587 |
| 898 | Ga0500568_0000071 | 3300053139 | Bacteria | 99625 |
| 899 | Ga0500568_0000714 | 3300053139 | Bacteria | 23777 |
| 900 | Ga0500568_0002404 | 3300053139 | Bacteria | 11048 |
| 901 | Ga0500568_0006419 | 3300053139 | Bacteria | 5902 |
| 902 | Ga0500568_0014148 | 3300053139 | Bacteria | 3613 |
| 903 | Ga0500568_0015864 | 3300053139 | Bacteria | 3362 |
| 904 | Ga0500573_0000001 | 3300053140 | Bacteria | 436394 |
| 905 | Ga0500573_0017028 | 3300053140 | Bacteria | 4134 |
| 906 | Ga0500573_0029238 | 3300053140 | Bacteria | 3177 |
| 907 | Ga0500573_0067896 | 3300053140 | Bacteria | 2036 |
| 908 | Ga0500573_0082135 | 3300053140 | Bacteria | 1830 |
| 909 | Ga0500590_001605 | 3300053148 | Bacteria | 9423 |
| 910 | Ga0500590_002157 | 3300053148 | Bacteria | 8559 |
| 911 | Ga0500603_009644 | 3300053150 | Bacteria | 2163 |
| 912 | Ga0500616_0000058 | 3300053153 | Bacteria | 266276 |
| 913 | Ga0500616_0000864 | 3300053153 | Bacteria | 33621 |
| 914 | Ga0500616_0000885 | 3300053153 | Bacteria | 33029 |
| 915 | Ga0500616_0005888 | 3300053153 | Bacteria | 8200 |
| 916 | Ga0500619_007827 | 3300053154 | Bacteria | 2558 |
| 917 | Ga0500620_000035 | 3300053155 | Bacteria | 25684 |
| 918 | Ga0500634_0024703 | 3300053161 | Bacteria | 3269 |
| 919 | Ga0500634_0036654 | 3300053161 | Bacteria | 2669 |
| 920 | Ga0500638_003114 | 3300053162 | Bacteria | 6047 |
| 921 | Ga0500636_0063523 | 3300053177 | Bacteria | 2152 |
| 922 | Ga0501084_0001798 | 3300054114 | Bacteria | 17094 |
| 923 | Ga0501084_0002749 | 3300054114 | Bacteria | 14196 |
| 924 | Ga0501082_0001924 | 3300060353 | Bacteria | 18254 |
| 925 | Ga0466962_0000651 | 3300061719 | Bacteria | 15399 |
| 926 | Ga0466962_0012651 | 3300061719 | Bacteria | 4061 |
| 927 | Ga0466962_0056023 | 3300061719 | Bacteria | 1884 |
| 928 | Ga0530510_0026832 | 3300061734 | Bacteria | 4125 |
| 929 | 2501069416 | 2501025501 | Bacteria | 7768574 |
| 930 | 2501408782 | 2501025504 | Bacteria | 8008976 |
| 931 | 2511098494 | 2510917014 | Bacteria | 8296963 |
| 932 | 2511106466 | 2510917015 | Bacteria | 7950052 |
| 933 | 2517762817 | 2517572101 | Bacteria | 6884336 |
| 934 | 2537898681 | 2537561592 | Bacteria | 4348607 |
| 935 | 2552112493 | 2551306166 | Bacteria | 9731570 |
| 936 | 2587861694 | 2585428094 | Bacteria | 3604039 |
| 937 | 2588107917 | 2585428157 | Bacteria | 3018951 |
| 938 | 2643769178 | 2643221549 | Bacteria | 4042819 |
| 939 | 2643847736 | 2643221566 | Bacteria | 3460379 |
| 940 | 2643890968 | 2643221576 | Bacteria | 5214352 |
| 941 | 2643960024 | 2643221590 | Bacteria | 5214697 |
| 942 | 2644034944 | 2643221604 | Bacteria | 5014917 |
| 943 | 2644112639 | 2643221619 | Bacteria | 4158469 |
| 944 | 2644198358 | 2643221635 | Bacteria | 2632343 |
| 945 | 2644278271 | 2643221649 | Bacteria | 3867359 |
| 946 | 2644506654 | 2643221690 | Bacteria | 4654705 |
| 947 | 2644512183 | 2643221692 | Bacteria | 7282860 |
| 948 | 2644526436 | 2643221694 | Bacteria | 4392972 |
| 949 | 2644671102 | 2643221722 | Bacteria | 4247614 |
| 950 | 2645720259 | 2643221961 | Bacteria | 3919167 |
| 951 | 2645723197 | 2643221962 | Bacteria | 3874254 |
| 952 | 2723643766 | 2721755702 | Bacteria | 4373124 |
| 953 | 2738692543 | 2738541272 | Bacteria | 6848551 |
| 954 | 2738868682 | 2738541305 | Bacteria | 4910150 |
| 955 | 2739323631 | 2738543027 | Bacteria | 6409078 |
| 956 | 2739367074 | 2738543034 | Bacteria | 6084756 |
| 957 | 2753037652 | 2751185725 | Bacteria | 5740550 |
| 958 | 2753325520 | 2751185792 | Bacteria | 5739090 |
| 959 | 2758226632 | 2757320536 | Bacteria | 3629334 |
| 960 | 2774381776 | 2773857758 | Bacteria | 3592392 |
| 961 | 2774396763 | 2773857762 | Bacteria | 5971770 |
| 962 | 2774400827 | 2773857763 | Bacteria | 4180068 |
| 963 | 2808628820 | 2808606306 | Bacteria | 3608896 |
| 964 | 2808900336 | 2808606372 | Bacteria | 4649509 |
| 965 | 2809198410 | 2808606439 | Bacteria | 5952208 |
| 966 | 2809226203 | 2808606447 | Bacteria | 3572005 |
| 967 | 2812324453 | 2811994872 | Bacteria | 4121241 |
| 968 | 2812349614 | 2811994878 | Bacteria | 5992952 |
| 969 | 2812365635 | 2811994880 | Bacteria | 4147780 |
| 970 | 2821268946 | 2821268502 | Bacteria | 3750023 |
| 971 | 2833709838 | 2833709550 | Bacteria | 4008291 |
| 972 | 2842736012 | 2842733646 | Bacteria | 5716726 |
| 973 | 2842748299 | 2842747753 | Bacteria | 5578255 |
| 974 | 2844856047 | 2844852863 | Bacteria | 3849151 |
| 975 | 2852632461 | 2852632344 | Bacteria | 3463163 |
| 976 | 2852646033 | 2852643534 | Bacteria | 3013378 |
| 977 | 2856289875 | 2856287931 | Bacteria | 7223934 |
| 978 | 2857363086 | 2857357740 | Bacteria | 9937880 |
| 979 | 2857485029 | 2857481737 | Bacteria | 4761446 |
| 980 | 2857733987 | 2857733635 | Bacteria | 3532004 |
| 981 | 2857739973 | 2857737099 | Bacteria | 3104305 |
| 982 | 2867350631 | 2867346516 | Bacteria | 7608576 |
| 983 | 2870624288 | 2870622029 | Bacteria | 3643329 |
| 984 | 2870629348 | 2870628048 | Bacteria | 3696012 |
| 985 | 2883822766 | 2883821847 | Bacteria | 5121194 |
| 986 | 2884994977 | 2884994152 | Bacteria | 4492978 |
| 987 | 2891969465 | 2891968417 | Bacteria | 5821697 |
| 988 | 2904511479 | 2904509784 | Bacteria | 3520416 |
| 989 | 2904770803 | 2904765812 | Bacteria | 5369154 |
| 990 | 2904776280 | 2904770941 | Bacteria | 5580202 |
| 991 | 2906801595 | 2906799679 | Bacteria | 4031749 |
| 992 | 2908679805 | 2908678064 | Bacteria | 3482747 |
| 993 | 2908812795 | 2908811453 | Bacteria | 5478616 |
| 994 | 2919073043 | 2919069694 | Bacteria | 3622919 |
| 995 | 2919425140 | 2919420072 | Bacteria | 5390363 |
| 996 | 2919437751 | 2919432681 | Bacteria | 5390474 |
| 997 | 2919444965 | 2919443155 | Bacteria | 4072969 |
| 998 | 2928088324 | 2928084124 | Bacteria | 7159212 |
| 999 | 2935413429 | 2935409751 | Bacteria | 4179611 |
| 1000 | 2939606909 | 2939602548 | Bacteria | 4950493 |
| 1001 | 2939658771 | 2939657138 | Bacteria | 3740283 |
| 1002 | 2939661577 | 2939660829 | Bacteria | 3784848 |
| 1003 | 2966922289 | 2966921586 | Bacteria | 3092803 |
| 1004 | 2974296855 | 2974294766 | Bacteria | 3767688 |
| 1005 | 2974316544 | 2974315732 | Bacteria | 4602776 |
| 1006 | 2974326910 | 2974324384 | Bacteria | 3750535 |
| 1007 | 2977231929 | 2977228692 | Bacteria | 3450105 |
| 1008 | 2977267248 | 2977264416 | Bacteria | 3750737 |
| 1009 | 2984524718 | 2984523437 | Bacteria | 4508481 |
| 1010 | 2984544925 | 2984542743 | Bacteria | 3569378 |
| 1011 | 8002791615 | 8002784119 | Bacteria | 9788632 |
| 1012 | 8004028520 | 8004025490 | Bacteria | 4327753 |
| 1013 | 8016257053 | 8016254467 | Bacteria | 3797036 |
| 1014 | 8045832126 | 8045830549 | Bacteria | 4444727 |
| 1015 | 8046354329 | 8046352972 | Bacteria | 3613806 |
| 1016 | 8056039932 | 8056037122 | Bacteria | 3854319 |
| 1017 | 8057348155 | 8057345674 | Bacteria | 4160394 |
| 1018 | Ga0157372_10009038 | |||
| 1019 | JGI24752J21851_1001068 | |||
| 1020 | JGI24737J22298_10005045 | |||
| 1021 | JGI24735J21928_10004087 | |||
| 1022 | JGI24735J21928_10032210 | |||
| 1023 | rootL2_10009820 | |||
| 1024 | Ga0006562J51391_1043750 | |||
| 1025 | Ga0055532_1000205 | |||
| 1026 | Ga0055527_1005214 | |||
| 1027 | Ga0055535_1000157 | |||
| 1028 | Ga0055542_1000204 | |||
| 1029 | Ga0055529_1000221 | |||
| 1030 | Ga0055537_1000010 | |||
| 1031 | Ga0055534_1000015 | |||
| 1032 | Ga0055528_1000377 | |||
| 1033 | Ga0055528_1000708 | |||
| 1034 | Ga0065714_10065905 | |||
| 1035 | Ga0065714_10072827 | |||
| 1036 | Ga0065712_10068604 | |||
| 1037 | Ga0070658_10000516 | |||
| 1038 | Ga0070658_10015950 | |||
| 1039 | Ga0070658_10018666 | |||
| 1040 | Ga0070658_10026293 | |||
| 1041 | Ga0070683_100163186 | |||
| 1042 | Ga0070670_100001088 | |||
| 1043 | Ga0070670_100014980 | |||
| 1044 | Ga0070670_100021919 | |||
| 1045 | Ga0068869_100005134 | |||
| 1046 | Ga0068869_100103430 | |||
| 1047 | Ga0070680_100031049 | |||
| 1048 | Ga0070680_100063279 | |||
| 1049 | Ga0070680_100090848 | |||
| 1050 | Ga0068868_100019197 | |||
| 1051 | Ga0068868_100046942 | |||
| 1052 | Ga0070660_100026808 | |||
| 1053 | Ga0070689_100008547 | |||
| 1054 | Ga0070661_100064697 | |||
| 1055 | Ga0070661_100162028 | |||
| 1056 | Ga0070669_100057958 | |||
| 1057 | Ga0070675_100000033 | |||
| 1058 | Ga0070675_100008416 | |||
| 1059 | Ga0070675_100017195 | |||
| 1060 | Ga0070675_100278204 | |||
| 1061 | Ga0070671_100000672 | |||
| 1062 | Ga0070671_100005657 | |||
| 1063 | Ga0070671_100021970 | |||
| 1064 | Ga0070671_100107113 | |||
| 1065 | Ga0070674_100042409 | |||
| 1066 | Ga0070673_100034183 | |||
| 1067 | Ga0070673_100037037 | |||
| 1068 | Ga0070688_100047389 | |||
| 1069 | Ga0070659_100001097 | |||
| 1070 | Ga0070659_100058228 | |||
| 1071 | Ga0070667_100015794 | |||
| 1072 | Ga0070667_100029014 | |||
| 1073 | Ga0070667_100029310 | |||
| 1074 | Ga0070667_100161130 | |||
| 1075 | Ga0070703_10023137 | |||
| 1076 | Ga0070709_10000010 | |||
| 1077 | Ga0070709_10007107 | |||
| 1078 | Ga0070713_100033375 | |||
| 1079 | Ga0070705_100119536 | |||
| 1080 | Ga0070700_100009088 | |||
| 1081 | Ga0070708_100029818 | |||
| 1082 | Ga0070708_100173130 | |||
| 1083 | Ga0070663_100015444 | |||
| 1084 | Ga0070678_100025353 | |||
| 1085 | Ga0070678_100035121 | |||
| 1086 | Ga0070681_10137903 | |||
| 1087 | Ga0070685_10035102 | |||
| 1088 | Ga0070685_10085306 | |||
| 1089 | Ga0070706_100016592 | |||
| 1090 | Ga0070706_100030298 | |||
| 1091 | Ga0070707_100021650 | |||
| 1092 | Ga0070707_100114928 | |||
| 1093 | Ga0070707_100121660 | |||
| 1094 | Ga0070707_100131739 | |||
| 1095 | Ga0070698_100000046 | |||
| 1096 | Ga0070698_100009850 | |||
| 1097 | Ga0070698_100017523 | |||
| 1098 | Ga0070698_100062478 | |||
| 1099 | Ga0070699_100031885 | |||
| 1100 | Ga0070679_100008070 | |||
| 1101 | Ga0070697_100063959 | |||
| 1102 | Ga0070697_100096796 | |||
| 1103 | Ga0068853_100000588 | |||
| 1104 | Ga0068853_100006163 | |||
| 1105 | Ga0070695_100008107 | |||
| 1106 | Ga0070695_100064253 | |||
| 1107 | Ga0070696_100004783 | |||
| 1108 | Ga0070696_100031371 | |||
| 1109 | Ga0070693_100000347 | |||
| 1110 | Ga0070665_100000588 | |||
| 1111 | Ga0070665_100003830 | |||
| 1112 | Ga0070665_100011326 | |||
| 1113 | Ga0070665_100027861 | |||
| 1114 | Ga0070665_100091726 | |||
| 1115 | Ga0070704_100077145 | |||
| 1116 | Ga0068855_100019945 | |||
| 1117 | Ga0068855_100106798 | |||
| 1118 | Ga0070664_100002562 | |||
| 1119 | Ga0070664_100047942 | |||
| 1120 | Ga0070664_100075945 | |||
| 1121 | Ga0070664_100188443 | |||
| 1122 | Ga0068857_100004443 | |||
| 1123 | Ga0068857_100015477 | |||
| 1124 | Ga0068854_100000442 | |||
| 1125 | Ga0068856_100009168 | |||
| 1126 | Ga0068856_100013645 | |||
| 1127 | Ga0068856_100121046 | |||
| 1128 | Ga0068856_100146674 | |||
| 1129 | Ga0070702_100002009 | |||
| 1130 | Ga0068852_100121623 | |||
| 1131 | Ga0068852_100123805 | |||
| 1132 | Ga0068859_100007129 | |||
| 1133 | Ga0068859_100041923 | |||
| 1134 | Ga0068859_100112264 | |||
| 1135 | Ga0068859_100156040 | |||
| 1136 | Ga0068864_100007299 | |||
| 1137 | Ga0068864_100024375 | |||
| 1138 | Ga0068864_100025849 | |||
| 1139 | Ga0068861_100105783 | |||
| 1140 | Ga0068861_100120053 | |||
| 1141 | Ga0068851_10000001 | |||
| 1142 | Ga0068870_10001611 | |||
| 1143 | Ga0068863_100000274 | |||
| 1144 | Ga0068863_100006310 | |||
| 1145 | Ga0068863_100013760 | |||
| 1146 | Ga0068858_100000152 | |||
| 1147 | Ga0068858_100034281 | |||
| 1148 | Ga0068858_100049586 | |||
| 1149 | Ga0068858_100226884 | |||
| 1150 | Ga0068860_100026060 | |||
| 1151 | Ga0068860_100071240 | |||
| 1152 | Ga0068860_100326298 | |||
| 1153 | Ga0068862_100006939 | |||
| 1154 | Ga0068862_100232584 | |||
| 1155 | Ga0081455_10003097 | |||
| 1156 | Ga0081455_10003346 | |||
| 1157 | Ga0081455_10024605 | |||
| 1158 | Ga0081455_10030848 | |||
| 1159 | Ga0081455_10091126 | |||
| 1160 | Ga0081539_10008120 | |||
| 1161 | Ga0075365_10001903 | |||
| 1162 | Ga0075365_10061280 | |||
| 1163 | Ga0075363_100047657 | |||
| 1164 | Ga0075364_10003400 | |||
| 1165 | Ga0075364_10003412 | |||
| 1166 | Ga0075364_10086424 | |||
| 1167 | Ga0075364_10103302 | |||
| 1168 | Ga0070712_100086171 | |||
| 1169 | Ga0075369_10028701 | |||
| 1170 | Ga0075369_10041608 | |||
| 1171 | Ga0075366_10005131 | |||
| 1172 | Ga0075366_10036054 | |||
| 1173 | Ga0097621_100004564 | |||
| 1174 | Ga0097621_100011172 | |||
| 1175 | Ga0075370_10013670 | |||
| 1176 | Ga0075428_100147468 | |||
| 1177 | Ga0075431_100012785 | |||
| 1178 | Ga0075433_10027807 | |||
| 1179 | Ga0075433_10212353 | |||
| 1180 | Ga0075434_100006513 | |||
| 1181 | Ga0075434_100080274 | |||
| 1182 | Ga0075434_100126224 | |||
| 1183 | Ga0075429_100001639 | |||
| 1184 | Ga0068865_100004153 | |||
| 1185 | Ga0075436_100001698 | |||
| 1186 | Ga0097620_100007129 | |||
| 1187 | Ga0097620_100041922 | |||
| 1188 | Ga0097620_100112266 | |||
| 1189 | Ga0097620_100156038 | |||
| 1190 | Ga0099826_10000266 | |||
| 1191 | Ga0075435_100027739 | |||
| 1192 | Ga0075435_100051864 | |||
| 1193 | Ga0105240_10008219 | |||
| 1194 | Ga0105240_10069245 | |||
| 1195 | Ga0105240_10094668 | |||
| 1196 | Ga0105240_10177783 | |||
| 1197 | Ga0111539_10009078 | |||
| 1198 | Ga0111539_10012573 | |||
| 1199 | Ga0111539_10194952 | |||
| 1200 | Ga0105245_10000114 | |||
| 1201 | Ga0105245_10005792 | |||
| 1202 | Ga0105245_10010417 | |||
| 1203 | Ga0105245_10036774 | |||
| 1204 | Ga0105245_10113852 | |||
| 1205 | Ga0105247_10000971 | |||
| 1206 | Ga0105247_10003337 | |||
| 1207 | Ga0105247_10003762 | |||
| 1208 | Ga0105247_10102080 | |||
| 1209 | Ga0114129_10002108 | |||
| 1210 | Ga0114129_10004443 | |||
| 1211 | Ga0114129_10005325 | |||
| 1212 | Ga0114129_10011738 | |||
| 1213 | Ga0114129_10016634 | |||
| 1214 | Ga0114129_10026130 | |||
| 1215 | Ga0114129_10031786 | |||
| 1216 | Ga0114129_10052270 | |||
| 1217 | Ga0114129_10071639 | |||
| 1218 | Ga0114129_10181118 | |||
| 1219 | Ga0105243_10000498 | |||
| 1220 | Ga0105243_10080754 | |||
| 1221 | Ga0105241_10024590 | |||
| 1222 | Ga0105242_10000795 | |||
| 1223 | Ga0105242_10001394 | |||
| 1224 | Ga0105248_10000326 | |||
| 1225 | Ga0105248_10004206 | |||
| 1226 | Ga0105248_10030613 | |||
| 1227 | Ga0105248_10042041 | |||
| 1228 | Ga0105237_10000341 | |||
| 1229 | Ga0105237_10005381 | |||
| 1230 | Ga0105237_10088908 | |||
| 1231 | Ga0105237_10124178 | |||
| 1232 | Ga0105238_10072620 | |||
| 1233 | Ga0105249_10003663 | |||
| 1234 | Ga0105239_10009254 | |||
| 1235 | Ga0105239_10013363 | |||
| 1236 | Ga0105239_10082407 | |||
| 1237 | Ga0105239_10109131 | |||
| 1238 | Ga0105239_10194783 | |||
| 1239 | Ga0105239_10359847 | |||
| 1240 | Ga0105246_10068410 | |||
| 1241 | Ga0157373_10125544 | |||
| 1242 | Ga0157371_10075081 | |||
| 1243 | Ga0157370_10031815 | |||
| 1244 | Ga0157370_10032665 | |||
| 1245 | Ga0157370_10040437 | |||
| 1246 | Ga0157370_10050894 | |||
| 1247 | Ga0157369_10006194 | |||
| 1248 | Ga0157369_10191523 | |||
| 1249 | Ga0171462_1001 | |||
| 1250 | Ga0157374_10015550 | |||
| 1251 | Ga0157374_10026275 | |||
| 1252 | Ga0157374_10281843 | |||
| 1253 | Ga0157378_10003230 | |||
| 1254 | Ga0157378_10179453 | |||
| 1255 | Ga0163162_10153050 | |||
| 1256 | Ga0163162_10389447 | |||
| 1257 | Ga0157372_10019524 | |||
| 1258 | Ga0157372_10040927 | |||
| 1259 | Ga0157375_10179485 | |||
| 1260 | Ga0157375_10378108 | |||
| 1261 | Ga0163163_10001257 | |||
| 1262 | Ga0163163_10005445 | |||
| 1263 | Ga0163163_10071778 | |||
| 1264 | Ga0163163_10076524 | |||
| 1265 | Ga0157380_10023569 | |||
| 1266 | Ga0157380_10064715 | |||
| 1267 | Ga0182008_10012519 | |||
| 1268 | Ga0157377_10010612 | |||
| 1269 | Ga0157377_10013934 | |||
| 1270 | Ga0157377_10041322 | |||
| 1271 | Ga0157379_10001539 | |||
| 1272 | Ga0157379_10007727 | |||
| 1273 | Ga0157379_10031033 | |||
| 1274 | Ga0157376_10024222 | |||
| 1275 | Ga0157376_10028472 | |||
| 1276 | Ga0157376_10164322 | |||
| 1277 | Ga0197907_10064725 | |||
| 1278 | Ga0206349_1803513 | |||
| 1279 | Ga0206351_10658466 | |||
| 1280 | Ga0154015_1452617 | |||
| 1281 | Ga0213876_10009730 | |||
| 1282 | Ga0228598_1000951 | |||
| 1283 | Ga0209672_100044 | |||
| 1284 | Ga0209672_100120 | |||
| 1285 | Ga0209147_100039 | |||
| 1286 | Ga0209258_100062 | |||
| 1287 | Ga0209677_100143 | |||
| 1288 | Ga0209148_1000075 | |||
| 1289 | Ga0209148_1000695 | |||
| 1290 | Ga0209565_1000025 | |||
| 1291 | Ga0209565_1002453 | |||
| 1292 | Ga0209455_1000067 | |||
| 1293 | Ga0209673_1000044 | |||
| 1294 | Ga0209673_1000077 | |||
| 1295 | Ga0209675_1000017 | |||
| 1296 | Ga0209025_1024717 | |||
| 1297 | Ga0209564_1016007 | |||
| 1298 | Ga0207656_10000002 | |||
| 1299 | Ga0207692_10009035 | |||
| 1300 | Ga0207642_10043156 | |||
| 1301 | Ga0207710_10000682 | |||
| 1302 | Ga0207710_10000764 | |||
| 1303 | Ga0207710_10004037 | |||
| 1304 | Ga0207710_10086269 | |||
| 1305 | Ga0207688_10000765 | |||
| 1306 | Ga0207688_10007019 | |||
| 1307 | Ga0207680_10010080 | |||
| 1308 | Ga0207680_10047824 | |||
| 1309 | Ga0207647_10018243 | |||
| 1310 | Ga0207647_10033585 | |||
| 1311 | Ga0207699_10104198 | |||
| 1312 | Ga0207643_10000049 | |||
| 1313 | Ga0207705_10000001 | |||
| 1314 | Ga0207705_10017953 | |||
| 1315 | Ga0207705_10023382 | |||
| 1316 | Ga0207684_10000152 | |||
| 1317 | Ga0207684_10060237 | |||
| 1318 | Ga0207684_10078287 | |||
| 1319 | Ga0207654_10000001 | |||
| 1320 | Ga0207654_10028648 | |||
| 1321 | Ga0207707_10040010 | |||
| 1322 | Ga0207707_10047329 | |||
| 1323 | Ga0207695_10009910 | |||
| 1324 | Ga0207695_10010927 | |||
| 1325 | Ga0207695_10059071 | |||
| 1326 | Ga0207671_10000002 | |||
| 1327 | Ga0207671_10008858 | |||
| 1328 | Ga0207671_10087625 | |||
| 1329 | Ga0207693_10014631 | |||
| 1330 | Ga0207660_10010527 | |||
| 1331 | Ga0207660_10016917 | |||
| 1332 | Ga0207660_10042981 | |||
| 1333 | Ga0207657_10062750 | |||
| 1334 | Ga0207657_10069533 | |||
| 1335 | Ga0207649_10021098 | |||
| 1336 | Ga0207652_10037094 | |||
| 1337 | Ga0207652_10046602 | |||
| 1338 | Ga0207646_10000085 | |||
| 1339 | Ga0207646_10003404 | |||
| 1340 | Ga0207646_10006296 | |||
| 1341 | Ga0207646_10041597 | |||
| 1342 | Ga0207646_10097144 | |||
| 1343 | Ga0207646_10109562 | |||
| 1344 | Ga0207646_10117967 | |||
| 1345 | Ga0207681_10020887 | |||
| 1346 | Ga0207694_10000395 | |||
| 1347 | Ga0207650_10004400 | |||
| 1348 | Ga0207650_10006096 | |||
| 1349 | Ga0207650_10009512 | |||
| 1350 | Ga0207659_10000449 | |||
| 1351 | Ga0207659_10006153 | |||
| 1352 | Ga0207659_10011241 | |||
| 1353 | Ga0207659_10069012 | |||
| 1354 | Ga0207659_10181389 | |||
| 1355 | Ga0207687_10000051 | |||
| 1356 | Ga0207687_10005749 | |||
| 1357 | Ga0207687_10038434 | |||
| 1358 | Ga0207687_10148354 | |||
| 1359 | Ga0207644_10000427 | |||
| 1360 | Ga0207690_10000753 | |||
| 1361 | Ga0207690_10007571 | |||
| 1362 | Ga0207706_10010636 | |||
| 1363 | Ga0207706_10050638 | |||
| 1364 | Ga0207706_10096319 | |||
| 1365 | Ga0207706_10111601 | |||
| 1366 | Ga0207686_10030649 | |||
| 1367 | Ga0207686_10062536 | |||
| 1368 | Ga0207709_10001062 | |||
| 1369 | Ga0207670_10018852 | |||
| 1370 | Ga0207670_10028353 | |||
| 1371 | Ga0207704_10052717 | |||
| 1372 | Ga0207691_10021623 | |||
| 1373 | Ga0207691_10024960 | |||
| 1374 | Ga0207711_10001610 | |||
| 1375 | Ga0207711_10012790 | |||
| 1376 | Ga0207711_10018085 | |||
| 1377 | Ga0207711_10023009 | |||
| 1378 | Ga0207711_10031750 | |||
| 1379 | Ga0207711_10095568 | |||
| 1380 | Ga0207689_10000355 | |||
| 1381 | Ga0207689_10142869 | |||
| 1382 | Ga0207679_10003632 | |||
| 1383 | Ga0207667_10000384 | |||
| 1384 | Ga0207667_10006444 | |||
| 1385 | Ga0207667_10021836 | |||
| 1386 | Ga0207667_10069498 | |||
| 1387 | Ga0207667_10072433 | |||
| 1388 | Ga0207668_10136815 | |||
| 1389 | Ga0207640_10000001 | |||
| 1390 | Ga0207640_10089369 | |||
| 1391 | Ga0207658_10038428 | |||
| 1392 | Ga0207677_10009186 | |||
| 1393 | Ga0207677_10016480 | |||
| 1394 | Ga0207703_10000181 | |||
| 1395 | Ga0207703_10006991 | |||
| 1396 | Ga0207703_10013734 | |||
| 1397 | Ga0207639_10000037 | |||
| 1398 | Ga0207639_10010005 | |||
| 1399 | Ga0207639_10046216 | |||
| 1400 | Ga0207678_10000705 | |||
| 1401 | Ga0207678_10011578 | |||
| 1402 | Ga0207678_10099639 | |||
| 1403 | Ga0207708_10014564 | |||
| 1404 | Ga0207708_10016932 | |||
| 1405 | Ga0207702_10001520 | |||
| 1406 | Ga0207702_10026927 | |||
| 1407 | Ga0207641_10000705 | |||
| 1408 | Ga0207641_10000772 | |||
| 1409 | Ga0207641_10003322 | |||
| 1410 | Ga0207641_10053652 | |||
| 1411 | Ga0207648_10020715 | |||
| 1412 | Ga0207676_10003132 | |||
| 1413 | Ga0207676_10035482 | |||
| 1414 | Ga0207676_10055520 | |||
| 1415 | Ga0207676_10170281 | |||
| 1416 | Ga0207674_10003240 | |||
| 1417 | Ga0207674_10006786 | |||
| 1418 | Ga0207674_10058473 | |||
| 1419 | Ga0207675_100027582 | |||
| 1420 | Ga0207675_100056126 | |||
| 1421 | Ga0207675_100107793 | |||
| 1422 | Ga0207675_100135250 | |||
| 1423 | Ga0207683_10000155 | |||
| 1424 | Ga0207683_10013847 | |||
| 1425 | Ga0207683_10186792 | |||
| 1426 | Ga0207698_10000297 | |||
| 1427 | Ga0207698_10017059 | |||
| 1428 | Ga0207698_10101266 | |||
| 1429 | Ga0209996_1000822 | |||
| 1430 | Ga0209282_1000459 | |||
| 1431 | Ga0209974_10027562 | |||
| 1432 | Ga0207428_10002981 | |||
| 1433 | Ga0207428_10003991 | |||
| 1434 | Ga0207428_10010552 | |||
| 1435 | Ga0207428_10011501 | |||
| 1436 | Ga0207428_10024979 | |||
| 1437 | Ga0207428_10088199 | |||
| 1438 | Ga0268266_10005631 | |||
| 1439 | Ga0268266_10007630 | |||
| 1440 | Ga0268266_10012018 | |||
| 1441 | Ga0268266_10017715 | |||
| 1442 | Ga0268265_10003019 | |||
| 1443 | Ga0268264_10030138 | |||
| 1444 | Ga0268264_10053645 | |||
| 1445 | Ga0307517_10000575 | |||
| 1446 | Ga0307517_10104467 | |||
| 1447 | Ga0307515_10000090 | |||
| 1448 | Ga0307515_10000626 | |||
| 1449 | Ga0307515_10016121 | |||
| 1450 | Ga0307515_10033949 | |||
| 1451 | Ga0307515_10056285 | |||
| 1452 | Ga0265338_10023116 | |||
| 1453 | Ga0265338_10069851 | |||
| 1454 | Ga0265338_10112247 | |||
| 1455 | Ga0265332_10009863 | |||
| 1456 | Ga0265325_10014158 | |||
| 1457 | Ga0265340_10018702 | |||
| 1458 | Ga0265339_10017534 | |||
| 1459 | Ga0265339_10021423 | |||
| 1460 | Ga0265327_10000064 | |||
| 1461 | Ga0265327_10002041 | |||
| 1462 | Ga0265327_10011063 | |||
| 1463 | Ga0265316_10061518 | |||
| 1464 | Ga0265316_10063605 | |||
| 1465 | Ga0307513_10001842 | |||
| 1466 | Ga0307513_10021458 | |||
| 1467 | Ga0307509_10001164 | |||
| 1468 | Ga0307509_10002081 | |||
| 1469 | Ga0307509_10006951 | |||
| 1470 | Ga0307509_10013455 | |||
| 1471 | Ga0307509_10222611 | |||
| 1472 | Ga0307408_100012808 | |||
| 1473 | Ga0307408_100028205 | |||
| 1474 | Ga0265313_10036958 | |||
| 1475 | Ga0265313_10040640 | |||
| 1476 | Ga0307508_10000095 | |||
| 1477 | Ga0307508_10005281 | |||
| 1478 | Ga0307514_10000861 | |||
| 1479 | Ga0316575_10041618 | |||
| 1480 | Ga0265314_10024057 | |||
| 1481 | Ga0265342_10045661 | |||
| 1482 | Ga0316576_10002490 | |||
| 1483 | Ga0316576_10020271 | |||
| 1484 | Ga0316578_10008648 | |||
| 1485 | Ga0316578_10021395 | |||
| 1486 | Ga0307516_10001905 | |||
| 1487 | Ga0307516_10027943 | |||
| 1488 | Ga0307405_10043395 | |||
| 1489 | Ga0316577_10053381 | |||
| 1490 | Ga0307413_10005754 | |||
| 1491 | Ga0307413_10007349 | |||
| 1492 | Ga0307413_10141204 | |||
| 1493 | Ga0307410_10000654 | |||
| 1494 | Ga0307410_10063821 | |||
| 1495 | Ga0307406_10000232 | |||
| 1496 | Ga0307406_10015705 | |||
| 1497 | Ga0307406_10087099 | |||
| 1498 | Ga0307412_10132894 | |||
| 1499 | Ga0307409_100000004 | |||
| 1500 | Ga0307409_100001551 | |||
| 1501 | Ga0307409_100013285 | |||
| 1502 | Ga0307409_100016948 | |||
| 1503 | Ga0307409_100190672 | |||
| 1504 | Ga0307416_100000126 | |||
| 1505 | Ga0307416_100014731 | |||
| 1506 | Ga0307416_100021776 | |||
| 1507 | Ga0307416_100036062 | |||
| 1508 | Ga0307414_10003245 | |||
| 1509 | Ga0307411_10021291 | |||
| 1510 | Ga0307415_100008261 | |||
| 1511 | Ga0316580_10011296 | |||
| 1512 | Ga0307507_10053796 | |||
| 1513 | Ga0307510_10016948 | |||
| 1514 | Ga0373949_0000187 | |||
| 1515 | Ga0373936_0000012 | |||
| 1516 | Ga0373953_0028810 | |||
| 1517 | Ga0373954_0045377 | |||
| 1518 | Ga0373955_0114643 | |||
| 1519 | Ga0373961_0000156 | |||
| 1520 | Ga0316574_0018158 | |||
| 1521 | Ga0316574_0180430 | |||
| 1522 | Ga0316574_0199888 | |||
| 1523 | Ga0373933_0003533 | |||
| 1524 | Ga0373933_0109165 | |||
| 1525 | Ga0373937_0000294 | |||
| 1526 | Ga0373937_0044492 | |||
| 1527 | Ga0373925_0048463 | |||
| 1528 | Ga0373925_0188655 | |||
| 1529 | Ga0395899_0038482 | |||
| 1530 | Ga0395900_0003801 | |||
| 1531 | Ga0395900_0024723 | |||
| 1532 | Ga0395900_0082960 | |||
| 1533 | Ga0395900_0155279 | |||
| 1534 | Ga0395900_0167521 | |||
| 1535 | Ga0395898_0029681 | |||
| 1536 | Ga0395898_0154321 | |||
| 1537 | Ga0395898_0156183 | |||
| 1538 | Ga0395905_0171069 | |||
| 1539 | Ga0395901_0090021 | |||
| 1540 | Ga0395901_0127413 | |||
| 1541 | Ga0400483_044815 | |||
| 1542 | Ga0400483_124415 | |||
| 1543 | Ga0400483_171783 | |||
| 1544 | Ga0400483_215983 | |||
| 1545 | Ga0400483_259819 | |||
| 1546 | Ga0436365_0681063 | |||
| 1547 | Ga0451853_0605618 | |||
| 1548 | Ga0439445_0017068 | |||
| 1549 | Ga0439448_0018642 | |||
| 1550 | Ga0439455_0017323 | |||
| 1551 | Ga0439463_001486 | |||
| 1552 | Ga0439435_0000833 | |||
| 1553 | Ga0439459_0002988 | |||
| 1554 | Ga0439464_0005358 | |||
| 1555 | Ga0439440_0003945 | |||
| 1556 | Ga0466972_0045980 | |||
| 1557 | Ga0466972_0051184 | |||
| 1558 | Ga0466965_0000016 | |||
| 1559 | Ga0466965_0005209 | |||
| 1560 | Ga0466965_0017806 | |||
| 1561 | Ga0466965_0027522 | |||
| 1562 | Ga0466965_0039573 | |||
| 1563 | Ga0466966_0021447 | |||
| 1564 | Ga0466961_0008445 | |||
| 1565 | Ga0466961_0014589 | |||
| 1566 | Ga0466961_0018181 | |||
| 1567 | Ga0466961_0024175 | |||
| 1568 | Ga0466963_0006873 | |||
| 1569 | Ga0466963_0014074 | |||
| 1570 | Ga0466963_0038573 | |||
| 1571 | Ga0466963_0104945 | |||
| 1572 | Ga0466964_0001285 | |||
| 1573 | Ga0453684_0391720 | |||
| 1574 | Ga0466971_0004116 | |||
| 1575 | Ga0466971_0024226 | |||
| 1576 | Ga0466968_0016601 | |||
| 1577 | Ga0466970_0001281 | |||
| 1578 | Ga0466970_0013374 | |||
| 1579 | Ga0466957_0001021 | |||
| 1580 | Ga0466957_0049781 | |||
| 1581 | Ga0466960_0004151 | |||
| 1582 | Ga0466960_0022402 | |||
| 1583 | Ga0466959_0010490 | |||
| 1584 | Ga0466959_0117947 | |||
| 1585 | Ga0466958_0006072 | |||
| 1586 | Ga0466958_0006804 | |||
| 1587 | Ga0466958_0013868 | |||
| 1588 | Ga0466958_0025466 | |||
| 1589 | Ga0466967_0002225 | |||
| 1590 | Ga0466967_0006548 | |||
| 1591 | Ga0466967_0017392 | |||
| 1592 | Ga0466967_0026189 | |||
| 1593 | Ga0466967_0075770 | |||
| 1594 | Ga0495592_0001098 | |||
| 1595 | Ga0495592_0034359 | |||
| 1596 | Ga0495590_0000891 | |||
| 1597 | Ga0495629_0002724 | |||
| 1598 | Ga0495641_0006967 | |||
| 1599 | Ga0495651_0000815 | |||
| 1600 | Ga0495651_0050577 | |||
| 1601 | Ga0495651_0149273 | |||
| 1602 | Ga0495653_0001854 | |||
| 1603 | Ga0495653_0153839 | |||
| 1604 | Ga0495650_0002544 | |||
| 1605 | Ga0495650_0003922 | |||
| 1606 | Ga0495650_0052305 | |||
| 1607 | Ga0495580_0008034 | |||
| 1608 | Ga0495580_0008828 | |||
| 1609 | Ga0495580_0142444 | |||
| 1610 | Ga0495582_0019156 | |||
| 1611 | Ga0495594_0012306 | |||
| 1612 | Ga0495607_0039906 | |||
| 1613 | Ga0495583_0000911 | |||
| 1614 | Ga0495608_0000148 | |||
| 1615 | Ga0495608_0128812 | |||
| 1616 | Ga0495616_0004445 | |||
| 1617 | Ga0495618_0002523 | |||
| 1618 | Ga0495620_0035382 | |||
| 1619 | Ga0495628_0047108 | |||
| 1620 | Ga0495630_0024745 | |||
| 1621 | Ga0495631_0001172 | |||
| 1622 | Ga0495631_0041788 | |||
| 1623 | Ga0495644_0036890 | |||
| 1624 | Ga0495648_0060755 | |||
| 1625 | Ga0495652_0020705 | |||
| 1626 | Ga0495640_0003850 | |||
| 1627 | Ga0495587_0001638 | |||
| 1628 | Ga0495587_0069252 | |||
| 1629 | Ga0495645_0004410 | |||
| 1630 | Ga0495645_0034952 | |||
| 1631 | Ga0495645_0051258 | |||
| 1632 | Ga0495667_0010608 | |||
| 1633 | Ga0495668_0055772 | |||
| 1634 | Ga0495625_0015966 | |||
| 1635 | Ga0495657_0005335 | |||
| 1636 | Ga0495599_0051117 | |||
| 1637 | Ga0495599_0093702 | |||
| 1638 | Ga0495623_0003777 | |||
| 1639 | Ga0495623_0062771 | |||
| 1640 | Ga0495646_0010629 | |||
| 1641 | Ga0495647_0001867 | |||
| 1642 | Ga0495658_0005410 | |||
| 1643 | Ga0495658_0088533 | |||
| 1644 | Ga0495670_0036860 | |||
| 1645 | Ga0495671_0000976 | |||
| 1646 | Ga0495600_0084421 | |||
| 1647 | Ga0495581_0129267 | |||
| 1648 | Ga0495604_0004509 | |||
| 1649 | Ga0495604_0016895 | |||
| 1650 | Ga0495674_0000457 | |||
| 1651 | Ga0495674_0081050 | |||
| 1652 | Ga0495672_0002195 | |||
| 1653 | Ga0495672_0002615 | |||
| 1654 | Ga0495672_0005993 | |||
| 1655 | Ga0495676_0060970 | |||
| 1656 | Ga0495680_0000868 | |||
| 1657 | Ga0495683_0000677 | |||
| 1658 | Ga0495687_017509 | |||
| 1659 | Ga0495687_020765 | |||
| 1660 | Ga0495687_024200 | |||
| 1661 | Ga0495675_0052266 | |||
| 1662 | Ga0495681_0043727 | |||
| 1663 | Ga0495684_0007437 | |||
| 1664 | Ga0495686_0000048 | |||
| 1665 | Ga0495686_0021863 | |||
| 1666 | Ga0495686_0059698 | |||
| 1667 | Ga0495602_0003749 | |||
| 1668 | Ga0495602_0048605 | |||
| 1669 | Ga0495602_0056601 | |||
| 1670 | Ga0495614_0015333 | |||
| 1671 | Ga0496100_0107330 | |||
| 1672 | Ga0496101_0020991 | |||
| 1673 | Ga0496101_0080824 | |||
| 1674 | Ga0496102_0000059 | |||
| 1675 | Ga0496102_0003569 | |||
| 1676 | Ga0496102_0004742 | |||
| 1677 | Ga0496102_0005091 | |||
| 1678 | Ga0496102_0073462 | |||
| 1679 | Ga0496103_0000063 | |||
| 1680 | Ga0496103_0139931 | |||
| 1681 | Ga0496104_0057728 | |||
| 1682 | Ga0496104_0076160 | |||
| 1683 | Ga0496105_0006741 | |||
| 1684 | Ga0496105_0176699 | |||
| 1685 | Ga0496106_0019275 | |||
| 1686 | Ga0496106_0126818 | |||
| 1687 | Ga0496107_0045962 | |||
| 1688 | Ga0496107_0059514 | |||
| 1689 | Ga0496108_0026484 | |||
| 1690 | Ga0496108_0044659 | |||
| 1691 | Ga0496108_0057426 | |||
| 1692 | Ga0496108_0097031 | |||
| 1693 | Ga0496108_0108718 | |||
| 1694 | Ga0496109_0000016 | |||
| 1695 | Ga0496109_0004796 | |||
| 1696 | Ga0496109_0031854 | |||
| 1697 | Ga0496109_0038731 | |||
| 1698 | Ga0496109_0066056 | |||
| 1699 | Ga0496109_0188087 | |||
| 1700 | Ga0496110_0011966 | |||
| 1701 | Ga0496110_0017590 | |||
| 1702 | Ga0496111_0001803 | |||
| 1703 | Ga0496111_0020992 | |||
| 1704 | Ga0496111_0049728 | |||
| 1705 | Ga0496111_0178983 | |||
| 1706 | Ga0496112_0009924 | |||
| 1707 | Ga0496112_0029168 | |||
| 1708 | Ga0496112_0098558 | |||
| 1709 | Ga0496113_0041450 | |||
| 1710 | Ga0496113_0219316 | |||
| 1711 | Ga0496114_0032778 | |||
| 1712 | Ga0496114_0032896 | |||
| 1713 | Ga0496114_0040981 | |||
| 1714 | Ga0496114_0060374 | |||
| 1715 | Ga0496114_0092169 | |||
| 1716 | Ga0496115_0038565 | |||
| 1717 | Ga0496116_0000371 | |||
| 1718 | Ga0496117_0000063 | |||
| 1719 | Ga0496117_0003104 | |||
| 1720 | Ga0496117_0014490 | |||
| 1721 | Ga0496117_0072118 | |||
| 1722 | Ga0496118_0005850 | |||
| 1723 | Ga0496118_0017172 | |||
| 1724 | Ga0496118_0031324 | |||
| 1725 | Ga0496118_0066813 | |||
| 1726 | Ga0496118_0108852 | |||
| 1727 | Ga0496119_0002091 | |||
| 1728 | Ga0496119_0002848 | |||
| 1729 | Ga0496119_0009813 | |||
| 1730 | Ga0496119_0015267 | |||
| 1731 | Ga0496119_0017098 | |||
| 1732 | Ga0496119_0021931 | |||
| 1733 | Ga0496119_0041167 | |||
| 1734 | Ga0496120_0000882 | |||
| 1735 | Ga0496120_0001936 | |||
| 1736 | Ga0496120_0023873 | |||
| 1737 | Ga0496120_0051027 | |||
| 1738 | Ga0496120_0054044 | |||
| 1739 | Ga0496120_0065865 | |||
| 1740 | Ga0496121_0000015 | |||
| 1741 | Ga0496121_0003574 | |||
| 1742 | Ga0496121_0127698 | |||
| 1743 | Ga0496122_0001461 | |||
| 1744 | Ga0496122_0002058 | |||
| 1745 | Ga0496122_0005683 | |||
| 1746 | Ga0496122_0007542 | |||
| 1747 | Ga0496122_0036490 | |||
| 1748 | Ga0496122_0052756 | |||
| 1749 | Ga0496122_0083894 | |||
| 1750 | Ga0496123_0000179 | |||
| 1751 | Ga0496123_0001148 | |||
| 1752 | Ga0496123_0002798 | |||
| 1753 | Ga0496123_0018712 | |||
| 1754 | Ga0496124_0000389 | |||
| 1755 | Ga0496124_0001764 | |||
| 1756 | Ga0496124_0043977 | |||
| 1757 | Ga0496124_0057024 | |||
| 1758 | Ga0496124_0097086 | |||
| 1759 | Ga0496125_0000350 | |||
| 1760 | Ga0496125_0036635 | |||
| 1761 | Ga0496126_0000075 | |||
| 1762 | Ga0496126_0002220 | |||
| 1763 | Ga0496126_0013693 | |||
| 1764 | Ga0496126_0014189 | |||
| 1765 | Ga0496126_0020829 | |||
| 1766 | Ga0496126_0091545 | |||
| 1767 | Ga0496126_0110632 | |||
| 1768 | Ga0501292_005246 | |||
| 1769 | Ga0501031_0032897 | |||
| 1770 | Ga0501031_0068127 | |||
| 1771 | Ga0501031_0114761 | |||
| 1772 | Ga0501032_0027900 | |||
| 1773 | Ga0501032_0040062 | |||
| 1774 | Ga0501033_0028137 | |||
| 1775 | Ga0501034_0002740 | |||
| 1776 | Ga0501034_0005401 | |||
| 1777 | Ga0501034_0017217 | |||
| 1778 | Ga0501034_0019391 | |||
| 1779 | Ga0501036_0022611 | |||
| 1780 | Ga0501036_0033494 | |||
| 1781 | Ga0501036_0201626 | |||
| 1782 | Ga0501037_0010590 | |||
| 1783 | Ga0501037_0067427 | |||
| 1784 | Ga0501038_0012842 | |||
| 1785 | Ga0501038_0139850 | |||
| 1786 | Ga0501039_0030942 | |||
| 1787 | Ga0501039_0185280 | |||
| 1788 | Ga0501040_0003183 | |||
| 1789 | Ga0501040_0009230 | |||
| 1790 | Ga0501041_0004728 | |||
| 1791 | Ga0501041_0025461 | |||
| 1792 | Ga0501042_0000537 | |||
| 1793 | Ga0501042_0000961 | |||
| 1794 | Ga0501042_0002550 | |||
| 1795 | Ga0501042_0056500 | |||
| 1796 | Ga0501042_0112772 | |||
| 1797 | Ga0501043_0001112 | |||
| 1798 | Ga0501043_0004169 | |||
| 1799 | Ga0501046_0008521 | |||
| 1800 | Ga0501046_0038238 | |||
| 1801 | Ga0501047_0111649 | |||
| 1802 | Ga0501048_0005340 | |||
| 1803 | Ga0501068_0011142 | |||
| 1804 | Ga0501068_0013111 | |||
| 1805 | Ga0501069_0016415 | |||
| 1806 | Ga0501069_0024119 | |||
| 1807 | Ga0501069_0117818 | |||
| 1808 | Ga0501070_0000591 | |||
| 1809 | Ga0501070_0001615 | |||
| 1810 | Ga0501070_0024175 | |||
| 1811 | Ga0501070_0033286 | |||
| 1812 | Ga0501070_0087988 | |||
| 1813 | Ga0501070_0135741 | |||
| 1814 | Ga0501070_0139571 | |||
| 1815 | Ga0501071_0022236 | |||
| 1816 | Ga0501072_0002090 | |||
| 1817 | Ga0501072_0241937 | |||
| 1818 | Ga0501073_0000028 | |||
| 1819 | Ga0501073_0000503 | |||
| 1820 | Ga0501073_0009405 | |||
| 1821 | Ga0501073_0036644 | |||
| 1822 | Ga0501074_0022531 | |||
| 1823 | Ga0501074_0063828 | |||
| 1824 | Ga0501074_0178776 | |||
| 1825 | Ga0501075_0000758 | |||
| 1826 | Ga0501075_0021683 | |||
| 1827 | Ga0501076_0001402 | |||
| 1828 | Ga0501076_0067166 | |||
| 1829 | Ga0501077_0032163 | |||
| 1830 | Ga0501077_0164389 | |||
| 1831 | Ga0501227_002689 | |||
| 1832 | Ga0501079_0001374 | |||
| 1833 | Ga0501079_0007080 | |||
| 1834 | Ga0501080_0001558 | |||
| 1835 | Ga0501080_0005011 | |||
| 1836 | Ga0501081_0001441 | |||
| 1837 | Ga0501081_0008218 | |||
| 1838 | Ga0501083_0000028 | |||
| 1839 | Ga0501083_0097660 | |||
| 1840 | Ga0501083_0135155 | |||
| 1841 | Ga0501035_0022879 | |||
| 1842 | Ga0501035_0090360 | |||
| 1843 | Ga0501035_0179159 | |||
| 1844 | Ga0501044_0051779 | |||
| 1845 | Ga0501044_0100878 | |||
| 1846 | Ga0501045_0002501 | |||
| 1847 | Ga0501045_0007779 | |||
| 1848 | nmdc:mga03n38_24527_c1 | |||
| 1849 | nmdc:mga00v17_22200_c1 | |||
| 1850 | nmdc:mga00v17_454_c1 | |||
| 1851 | nmdc:mga0yw44_16324_c1 | |||
| 1852 | nmdc:mga0k408_6897_c1 | |||
| 1853 | nmdc:mga05p37_1039_c1 | |||
| 1854 | nmdc:mga05p37_1366_c1 | |||
| 1855 | nmdc:mga05p37_1873_c2 | |||
| 1856 | nmdc:mga05p37_2544_c2 | |||
| 1857 | nmdc:mga05p37_2674_c1 | |||
| 1858 | nmdc:mga05p37_27219_c1 | |||
| 1859 | nmdc:mga05p37_33965_c1 | |||
| 1860 | nmdc:mga05p37_37964_c1 | |||
| 1861 | nmdc:mga09592_46707_c1 | |||
| 1862 | nmdc:mga06r32_144047_c1 | |||
| 1863 | nmdc:mga08y16_112543_c1 | |||
| 1864 | nmdc:mga08y16_129531_c1 | |||
| 1865 | nmdc:mga08y16_14406_c1 | |||
| 1866 | nmdc:mga08y16_22724_c1 | |||
| 1867 | nmdc:mga08y16_42598_c1 | |||
| 1868 | nmdc:mga08y16_47684_c1 | |||
| 1869 | nmdc:mga08y16_61285_c1 | |||
| 1870 | nmdc:mga0n895_104833_c1 | |||
| 1871 | nmdc:mga0n895_338266_c1 | |||
| 1872 | nmdc:mga0n895_7649_c1 | |||
| 1873 | nmdc:mga0rr50_7553_c1 | |||
| 1874 | nmdc:mga0a205_135132_c1 | |||
| 1875 | nmdc:mga0a205_15514_c1 | |||
| 1876 | nmdc:mga0a205_48177_c1 | |||
| 1877 | nmdc:mga0a205_6370_c1 | |||
| 1878 | nmdc:mga0sz30_13563_c1 | |||
| 1879 | nmdc:mga0sz30_6527_c1 | |||
| 1880 | Ga0495601_0002029 | |||
| 1881 | Ga0495612_0009945 | |||
| 1882 | Ga0500610_0000935 | |||
| 1883 | Ga0495595_0000521 | |||
| 1884 | Ga0495619_0000089 | |||
| 1885 | Ga0495619_0025913 | |||
| 1886 | Ga0495619_0032884 | |||
| 1887 | Ga0500643_000072 | |||
| 1888 | Ga0500644_0014127 | |||
| 1889 | Ga0500651_0000170 | |||
| 1890 | Ga0500651_0000254 | |||
| 1891 | Ga0500650_0003218 | |||
| 1892 | Ga0500555_004172 | |||
| 1893 | Ga0500556_0000001 | |||
| 1894 | Ga0500556_0000064 | |||
| 1895 | Ga0500562_002639 | |||
| 1896 | Ga0500571_000075 | |||
| 1897 | Ga0500572_001277 | |||
| 1898 | Ga0500593_000096 | |||
| 1899 | Ga0500593_011783 | |||
| 1900 | Ga0500594_0022318 | |||
| 1901 | Ga0500607_000146 | |||
| 1902 | Ga0500608_012477 | |||
| 1903 | Ga0500614_000030 | |||
| 1904 | Ga0500642_0034783 | |||
| 1905 | Ga0500655_001787 | |||
| 1906 | Ga0500655_004546 | |||
| 1907 | Ga0500658_0000134 | |||
| 1908 | Ga0500658_0000142 | |||
| 1909 | Ga0500559_0000043 | |||
| 1910 | Ga0500559_0001053 | |||
| 1911 | Ga0500559_0001058 | |||
| 1912 | Ga0500559_0001135 | |||
| 1913 | Ga0500559_0003767 | |||
| 1914 | Ga0500568_0000003 | |||
| 1915 | Ga0500568_0000071 | |||
| 1916 | Ga0500568_0000714 | |||
| 1917 | Ga0500568_0002404 | |||
| 1918 | Ga0500568_0006419 | |||
| 1919 | Ga0500568_0014148 | |||
| 1920 | Ga0500568_0015864 | |||
| 1921 | Ga0500573_0000001 | |||
| 1922 | Ga0500573_0017028 | |||
| 1923 | Ga0500573_0029238 | |||
| 1924 | Ga0500573_0067896 | |||
| 1925 | Ga0500573_0082135 | |||
| 1926 | Ga0500590_001605 | |||
| 1927 | Ga0500590_002157 | |||
| 1928 | Ga0500603_009644 | |||
| 1929 | Ga0500616_0000058 | |||
| 1930 | Ga0500616_0000864 | |||
| 1931 | Ga0500616_0000885 | |||
| 1932 | Ga0500616_0005888 | |||
| 1933 | Ga0500619_007827 | |||
| 1934 | Ga0500620_000035 | |||
| 1935 | Ga0500634_0024703 | |||
| 1936 | Ga0500634_0036654 | |||
| 1937 | Ga0500638_003114 | |||
| 1938 | Ga0500636_0063523 | |||
| 1939 | Ga0501084_0001798 | |||
| 1940 | Ga0501084_0002749 | |||
| 1941 | Ga0501082_0001924 | |||
| 1942 | Ga0466962_0000651 | |||
| 1943 | Ga0466962_0012651 | |||
| 1944 | Ga0466962_0056023 | |||
| 1945 | Ga0530510_0026832 | |||
| 1946 | 2501069416 | |||
| 1947 | 2501408782 | |||
| 1948 | 2511098494 | |||
| 1949 | 2511106466 | |||
| 1950 | 2517762817 | |||
| 1951 | 2537898681 | |||
| 1952 | 2552112493 | |||
| 1953 | 2587861694 | |||
| 1954 | 2588107917 | |||
| 1955 | 2643769178 | |||
| 1956 | 2643847736 | |||
| 1957 | 2643890968 | |||
| 1958 | 2643960024 | |||
| 1959 | 2644034944 | |||
| 1960 | 2644112639 | |||
| 1961 | 2644198358 | |||
| 1962 | 2644278271 | |||
| 1963 | 2644506654 | |||
| 1964 | 2644512183 | |||
| 1965 | 2644526436 | |||
| 1966 | 2644671102 | |||
| 1967 | 2645720259 | |||
| 1968 | 2645723197 | |||
| 1969 | 2723643766 | |||
| 1970 | 2738692543 | |||
| 1971 | 2738868682 | |||
| 1972 | 2739323631 | |||
| 1973 | 2739367074 | |||
| 1974 | 2753037652 | |||
| 1975 | 2753325520 | |||
| 1976 | 2758226632 | |||
| 1977 | 2774381776 | |||
| 1978 | 2774396763 | |||
| 1979 | 2774400827 | |||
| 1980 | 2808628820 | |||
| 1981 | 2808900336 | |||
| 1982 | 2809198410 | |||
| 1983 | 2809226203 | |||
| 1984 | 2812324453 | |||
| 1985 | 2812349614 | |||
| 1986 | 2812365635 | |||
| 1987 | 2821268946 | |||
| 1988 | 2833709838 | |||
| 1989 | 2842736012 | |||
| 1990 | 2842748299 | |||
| 1991 | 2844856047 | |||
| 1992 | 2852632461 | |||
| 1993 | 2852646033 | |||
| 1994 | 2856289875 | |||
| 1995 | 2857363086 | |||
| 1996 | 2857485029 | |||
| 1997 | 2857733987 | |||
| 1998 | 2857739973 | |||
| 1999 | 2867350631 | |||
| 2000 | 2870624288 | |||
| 2001 | 2870629348 | |||
| 2002 | 2883822766 | |||
| 2003 | 2884994977 | |||
| 2004 | 2891969465 | |||
| 2005 | 2904511479 | |||
| 2006 | 2904770803 | |||
| 2007 | 2904776280 | |||
| 2008 | 2906801595 | |||
| 2009 | 2908679805 | |||
| 2010 | 2908812795 | |||
| 2011 | 2919073043 | |||
| 2012 | 2919425140 | |||
| 2013 | 2919437751 | |||
| 2014 | 2919444965 | |||
| 2015 | 2928088324 | |||
| 2016 | 2935413429 | |||
| 2017 | 2939606909 | |||
| 2018 | 2939658771 | |||
| 2019 | 2939661577 | |||
| 2020 | 2966922289 | |||
| 2021 | 2974296855 | |||
| 2022 | 2974316544 | |||
| 2023 | 2974326910 | |||
| 2024 | 2977231929 | |||
| 2025 | 2977267248 | |||
| 2026 | 2984524718 | |||
| 2027 | 2984544925 | |||
| 2028 | 8002791615 | |||
| 2029 | 8004028520 | |||
| 2030 | 8016257053 | |||
| 2031 | 8045832126 | |||
| 2032 | 8046354329 | |||
| 2033 | 8056039932 | |||
| 2034 | 8057348155 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3sfw-assembly1.cif.gz_A | crystal structure of dihydropyrimidinase from brevibacillus agri nchu1002 | 0.9818 | 1 | 461 |
| 1k1d-assembly1.cif.gz_A | crystal structure of d-hydantoinase | 0.9816 | 1 | 459 |
| 4kqn-assembly1.cif.gz_A | 2.8 angstrom resolution crystal structure of d-hydantoinase from bacillus sp. ar9 in c2221 space group | 0.9816 | 3 | 461 |
| 1yny-assembly1.cif.gz_A | molecular structure of d-hydantoinase from a bacillus sp. ar9: evidence for mercury inhibition | 0.9807 | 3 | 461 |
| 1yny-assembly2.cif.gz_B | molecular structure of d-hydantoinase from a bacillus sp. ar9: evidence for mercury inhibition | 0.9801 | 3 | 460 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4tqtA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9774 | 1 | 442 | 3.20.20.140 |
| 1nfgA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9761 | 54 | 427 | 3.20.20.140 |
| 4lcrA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9738 | 2 | 443 | 3.20.20.140 |
| 1nfgA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9734 | 54 | 427 | 3.20.20.140 |
| af_Q14194_68_440_3.20.20.140 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases | 0.9726 | 54 | 426 | 3.20.20.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L6CTE9-F1-model_v4 | Dihydropyrimidinase (EC 3.5.2.2) | 0.9953 | 57 | 465 |
GO:0004157
GO:0005829 |
| AF-A0A656TWC4-F1-model_v4 | deleted | 0.993 | 60 | 464 |
|
| AF-A0A2V9FJX4-F1-model_v4 | Dihydropyrimidinase | 0.9927 | 129 | 240 |
GO:0005829
GO:0016812 |
| AF-A0A1I2DZI0-F1-model_v4 | Dihydropyrimidinase | 0.9921 | 1 | 465 |
GO:0005829
GO:0016812 |
| AF-A0A3D9M8P6-F1-model_v4 | deleted | 0.9917 | 69 | 394 |
|