F488283

General Info

Members Datasets Scaffolds Average Seq Length
1017 524 2034 469

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10009038|Ga0157372_100090387
Length 526
Sequence VIGGPTRTQRSPSHDHVSGWFARLAHSLAKPVGYNRFRKVGRVARDRFRKELSMSTVLIKGGMVINATGTGYADVLVDGETIAAVLKPGSALLGVDLETNVDEVVDAAGKYVIPGGIDPHTHMELPFGGTQASDTFETGTRAAAWGGTTTIIDFAVQRYGERVEDGLATWHAKAAGNACIDYGFHQIIGGVDEFSLKAMDSFIDEGVTSFKLFMAYPGVFYSDDAQILRAMQKSAETGLLTMMHAENGPAIDVLAEQLYSAGKASPYYHGIARAWQMEEEATHRAIMIANLTGAPLYVVHVSAKQAVAQLAAARDVGQNVFGETCPQYLYLSLEDQLGAPGFEGAKWVCSTPLRARAEGHQDAMWQALRSNDLQIVSTDHCPFCMKEQKELGLNDFRAIPNGIGGIEHRMDLMYQGVVTARISLQRWVELTSTTPALMFGLYGKKGVIQPGADADLVIYDPAGHTSIGYEKTHHMNMDYSAWEGFEIDGHVDWVMSRGAVLINDSGFVGTKGHGQYLKRDLSQYLS

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
214 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
218 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
232 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
240 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
241 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
250 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
253 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
254 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
255 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
256 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
257 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
258 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
259 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
287 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
288 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
289 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
290 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
316 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
317 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
318 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
319 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
320 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
321 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
347 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
348 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
349 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
350 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
351 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
352 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
353 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
354 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
371 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
372 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
373 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
374 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
375 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
376 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
379 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
387 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
401 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
402 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
403 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
404 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
405 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
406 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
407 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
408 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
409 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
410 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
411 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
412 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
413 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
414 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
415 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
416 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
417 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
418 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
419 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
420 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
421 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
422 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
423 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
424 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
425 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
426 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
427 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
428 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
429 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
430 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
431 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
432 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
433 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
434 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
435 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
436 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
437 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
438 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
439 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
440 2517572101 Frankia sp. DC12 Isolate Nodule
441 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
442 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
443 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
444 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
445 2643221549 Agromyces sp. Root1464 Isolate Unclassified
446 2643221566 Microbacterium sp. Root166 Isolate Unclassified
447 2643221576 Nocardioides sp. Root614 Isolate Unclassified
448 2643221590 Nocardioides sp. Root682 Isolate Unclassified
449 2643221604 Nocardioides sp. Root190 Isolate Unclassified
450 2643221619 Agromyces sp. Root81 Isolate Unclassified
451 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
452 2643221649 Leifsonia sp. Root4 Isolate Unclassified
453 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
454 2643221692 Nocardia sp. Root136 Isolate Unclassified
455 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
456 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
457 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
458 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
459 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
460 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
461 2738541305 Nocardioides sp. CF167 Isolate Unclassified
462 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
463 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
464 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
465 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
466 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
467 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
468 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
469 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
470 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
471 2808606372 Agromyces sp. 23-23 Isolate Unclassified
472 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
473 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
474 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
475 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
476 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
477 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
478 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
479 2842733646 Variovorax sp. R-72446 Isolate Unclassified
480 2842747753 Variovorax sp. R-72060 Isolate Unclassified
481 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
482 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
483 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
484 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
485 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
486 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
487 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
488 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
489 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
490 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
491 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
492 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
493 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
494 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
495 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
496 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
497 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
498 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
499 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
500 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
501 2919069694 Microbacterium sp. 1154 Isolate Unclassified
502 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
503 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
504 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
505 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
506 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
507 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
508 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
509 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
510 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
511 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
512 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
513 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
514 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
515 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
516 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
517 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
518 8002784119 Frankia sp. AgB1.9 Isolate Nodule
519 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
520 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
521 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
522 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
523 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
524 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.76
Metatranscriptomes 0.49
Isolates 8.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 9.44
Nodule 0.39
Rhizoplane 4.52
Rhizosphere 72.07
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10009038 3300013307 Bacteria 10588
2 JGI24752J21851_1001068 3300001976 Bacteria 3734
3 JGI24737J22298_10005045 3300001990 Bacteria 4576
4 JGI24735J21928_10004087 3300002067 Bacteria 4925
5 JGI24735J21928_10032210 3300002067 Bacteria 1552
6 rootL2_10009820 3300003322 Bacteria 11824
7 Ga0006562J51391_1043750 3300003578 Bacteria 5978
8 Ga0055532_1000205 3300003758 Bacteria 48259
9 Ga0055527_1005214 3300003760 Bacteria 1709
10 Ga0055535_1000157 3300003761 Bacteria 72863
11 Ga0055542_1000204 3300003762 Bacteria 72884
12 Ga0055529_1000221 3300003763 Bacteria 73491
13 Ga0055537_1000010 3300003773 Bacteria 138059
14 Ga0055534_1000015 3300003784 Bacteria 148531
15 Ga0055528_1000377 3300003790 Bacteria 36291
16 Ga0055528_1000708 3300003790 Bacteria 23670
17 Ga0065714_10065905 3300005288 Bacteria 8127
18 Ga0065714_10072827 3300005288 Bacteria 3294
19 Ga0065712_10068604 3300005290 Bacteria 9681
20 Ga0070658_10000516 3300005327 Bacteria 33519
21 Ga0070658_10015950 3300005327 Bacteria 6009
22 Ga0070658_10018666 3300005327 Bacteria 5554
23 Ga0070658_10026293 3300005327 Bacteria 4668
24 Ga0070683_100163186 3300005329 Bacteria 2114
25 Ga0070670_100001088 3300005331 Bacteria 21560
26 Ga0070670_100014980 3300005331 Bacteria 6654
27 Ga0070670_100021919 3300005331 Bacteria 5496
28 Ga0068869_100005134 3300005334 Bacteria 8210
29 Ga0068869_100103430 3300005334 Bacteria 2158
30 Ga0070680_100031049 3300005336 Bacteria 4294
31 Ga0070680_100063279 3300005336 Bacteria 3030
32 Ga0070680_100090848 3300005336 Bacteria 2528
33 Ga0068868_100019197 3300005338 Bacteria 5121
34 Ga0068868_100046942 3300005338 Bacteria 3381
35 Ga0070660_100026808 3300005339 Bacteria 4294
36 Ga0070689_100008547 3300005340 Bacteria 7217
37 Ga0070661_100064697 3300005344 Bacteria 2687
38 Ga0070661_100162028 3300005344 Bacteria 1694
39 Ga0070669_100057958 3300005353 Bacteria 2843
40 Ga0070675_100000033 3300005354 Bacteria 94281
41 Ga0070675_100008416 3300005354 Bacteria 8006
42 Ga0070675_100017195 3300005354 Bacteria 5747
43 Ga0070675_100278204 3300005354 Bacteria 1470
44 Ga0070671_100000672 3300005355 Bacteria 24494
45 Ga0070671_100005657 3300005355 Bacteria 9948
46 Ga0070671_100021970 3300005355 Bacteria 5212
47 Ga0070671_100107113 3300005355 Bacteria 2347
48 Ga0070674_100042409 3300005356 Bacteria 3091
49 Ga0070673_100034183 3300005364 Bacteria 3844
50 Ga0070673_100037037 3300005364 Bacteria 3713
51 Ga0070688_100047389 3300005365 Bacteria 2666
52 Ga0070659_100001097 3300005366 Bacteria 19735
53 Ga0070659_100058228 3300005366 Bacteria 3049
54 Ga0070667_100015794 3300005367 Bacteria 6245
55 Ga0070667_100029014 3300005367 Bacteria 4608
56 Ga0070667_100029310 3300005367 Bacteria 4585
57 Ga0070667_100161130 3300005367 Bacteria 1976
58 Ga0070703_10023137 3300005406 Bacteria 1828
59 Ga0070709_10000010 3300005434 Bacteria 175522
60 Ga0070709_10007107 3300005434 Bacteria 6125
61 Ga0070713_100033375 3300005436 Bacteria 4122
62 Ga0070705_100119536 3300005440 Bacteria 1699
63 Ga0070700_100009088 3300005441 Bacteria 5447
64 Ga0070708_100029818 3300005445 Bacteria 4708
65 Ga0070708_100173130 3300005445 Unclassified 2016
66 Ga0070663_100015444 3300005455 Bacteria 4930
67 Ga0070678_100025353 3300005456 Bacteria 3987
68 Ga0070678_100035121 3300005456 Bacteria 3497
69 Ga0070681_10137903 3300005458 Bacteria 2369
70 Ga0070685_10035102 3300005466 Bacteria 2828
71 Ga0070685_10085306 3300005466 Bacteria 1901
72 Ga0070706_100016592 3300005467 Bacteria 6803
73 Ga0070706_100030298 3300005467 Bacteria 4985
74 Ga0070707_100021650 3300005468 Bacteria 6078
75 Ga0070707_100114928 3300005468 Bacteria 2611
76 Ga0070707_100121660 3300005468 Bacteria 2534
77 Ga0070707_100131739 3300005468 Bacteria 2431
78 Ga0070698_100000046 3300005471 Bacteria 85705
79 Ga0070698_100009850 3300005471 Bacteria 10216
80 Ga0070698_100017523 3300005471 Bacteria 7548
81 Ga0070698_100062478 3300005471 Bacteria 3757
82 Ga0070699_100031885 3300005518 Bacteria 4551
83 Ga0070679_100008070 3300005530 Bacteria 9896
84 Ga0070697_100063959 3300005536 Bacteria 3005
85 Ga0070697_100096796 3300005536 Bacteria 2449
86 Ga0068853_100000588 3300005539 Bacteria 24889
87 Ga0068853_100006163 3300005539 Bacteria 9499
88 Ga0070695_100008107 3300005545 Bacteria 6225
89 Ga0070695_100064253 3300005545 Bacteria 2387
90 Ga0070696_100004783 3300005546 Bacteria 9051
91 Ga0070696_100031371 3300005546 Bacteria 3641
92 Ga0070693_100000347 3300005547 Bacteria 21059
93 Ga0070665_100000588 3300005548 Bacteria 50690
94 Ga0070665_100003830 3300005548 Bacteria 15922
95 Ga0070665_100011326 3300005548 Bacteria 9020
96 Ga0070665_100027861 3300005548 Bacteria 5690
97 Ga0070665_100091726 3300005548 Bacteria 3043
98 Ga0070704_100077145 3300005549 Bacteria 2440
99 Ga0068855_100019945 3300005563 Bacteria 8051
100 Ga0068855_100106798 3300005563 Bacteria 3217
101 Ga0070664_100002562 3300005564 Bacteria 14662
102 Ga0070664_100047942 3300005564 Bacteria 3610
103 Ga0070664_100075945 3300005564 Bacteria 2886
104 Ga0070664_100188443 3300005564 Bacteria 1837
105 Ga0068857_100004443 3300005577 Bacteria 11865
106 Ga0068857_100015477 3300005577 Bacteria 6662
107 Ga0068854_100000442 3300005578 Bacteria 25691
108 Ga0068856_100009168 3300005614 Bacteria 9621
109 Ga0068856_100013645 3300005614 Bacteria 7858
110 Ga0068856_100121046 3300005614 Bacteria 2618
111 Ga0068856_100146674 3300005614 Bacteria 2367
112 Ga0070702_100002009 3300005615 Bacteria 8578
113 Ga0068852_100121623 3300005616 Bacteria 2391
114 Ga0068852_100123805 3300005616 Bacteria 2371
115 Ga0068859_100007129 3300005617 Bacteria 11345
116 Ga0068859_100041923 3300005617 Bacteria 4598
117 Ga0068859_100112264 3300005617 Bacteria 2788
118 Ga0068859_100156040 3300005617 Bacteria 2360
119 Ga0068864_100007299 3300005618 Bacteria 9091
120 Ga0068864_100024375 3300005618 Bacteria 5090
121 Ga0068864_100025849 3300005618 Bacteria 4947
122 Ga0068861_100105783 3300005719 Bacteria 2247
123 Ga0068861_100120053 3300005719 Bacteria 2119
124 Ga0068851_10000001 3300005834 Bacteria 495512
125 Ga0068870_10001611 3300005840 Bacteria 9183
126 Ga0068863_100000274 3300005841 Bacteria 53564
127 Ga0068863_100006310 3300005841 Bacteria 11636
128 Ga0068863_100013760 3300005841 Bacteria 7798
129 Ga0068858_100000152 3300005842 Bacteria 72991
130 Ga0068858_100034281 3300005842 Bacteria 4708
131 Ga0068858_100049586 3300005842 Bacteria 3888
132 Ga0068858_100226884 3300005842 Bacteria 1770
133 Ga0068860_100026060 3300005843 Bacteria 5639
134 Ga0068860_100071240 3300005843 Bacteria 3304
135 Ga0068860_100326298 3300005843 Bacteria 1507
136 Ga0068862_100006939 3300005844 Bacteria 9396
137 Ga0068862_100232584 3300005844 Bacteria 1673
138 Ga0081455_10003097 3300005937 Bacteria 19365
139 Ga0081455_10003346 3300005937 Bacteria 18489
140 Ga0081455_10024605 3300005937 Bacteria 5571
141 Ga0081455_10030848 3300005937 Bacteria 4863
142 Ga0081455_10091126 3300005937 Bacteria 2470
143 Ga0081539_10008120 3300005985 Bacteria 9270
144 Ga0075365_10001903 3300006038 Bacteria 9836
145 Ga0075365_10061280 3300006038 Bacteria 2512
146 Ga0075363_100047657 3300006048 Bacteria 2277
147 Ga0075364_10003400 3300006051 Bacteria 9039
148 Ga0075364_10003412 3300006051 Bacteria 9029
149 Ga0075364_10086424 3300006051 Bacteria 2078
150 Ga0075364_10103302 3300006051 Bacteria 1898
151 Ga0070712_100086171 3300006175 Bacteria 2289
152 Ga0075369_10028701 3300006186 Bacteria 2334
153 Ga0075369_10041608 3300006186 Bacteria 1967
154 Ga0075366_10005131 3300006195 Bacteria 7085
155 Ga0075366_10036054 3300006195 Bacteria 2915
156 Ga0097621_100004564 3300006237 Bacteria 9665
157 Ga0097621_100011172 3300006237 Bacteria 6609
158 Ga0075370_10013670 3300006353 Bacteria 4320
159 Ga0075428_100147468 3300006844 Bacteria 2557
160 Ga0075431_100012785 3300006847 Bacteria 8475
161 Ga0075433_10027807 3300006852 Bacteria 4801
162 Ga0075433_10212353 3300006852 Bacteria 1719
163 Ga0075434_100006513 3300006871 Bacteria 10708
164 Ga0075434_100080274 3300006871 Bacteria 3258
165 Ga0075434_100126224 3300006871 Bacteria 2575
166 Ga0075429_100001639 3300006880 Bacteria 18503
167 Ga0068865_100004153 3300006881 Bacteria 8710
168 Ga0075436_100001698 3300006914 Bacteria 15076
169 Ga0097620_100007129 3300006931 Bacteria 11345
170 Ga0097620_100041922 3300006931 Bacteria 4598
171 Ga0097620_100112266 3300006931 Bacteria 2788
172 Ga0097620_100156038 3300006931 Bacteria 2360
173 Ga0099826_10000266 3300006948 Bacteria 23131
174 Ga0075435_100027739 3300007076 Bacteria 4433
175 Ga0075435_100051864 3300007076 Bacteria 3305
176 Ga0105240_10008219 3300009093 Bacteria 14957
177 Ga0105240_10069245 3300009093 Bacteria 4369
178 Ga0105240_10094668 3300009093 Bacteria 3642
179 Ga0105240_10177783 3300009093 Bacteria 2515
180 Ga0111539_10009078 3300009094 Bacteria 12586
181 Ga0111539_10012573 3300009094 Bacteria 10607
182 Ga0111539_10194952 3300009094 Bacteria 2363
183 Ga0105245_10000114 3300009098 Bacteria 78195
184 Ga0105245_10005792 3300009098 Bacteria 10840
185 Ga0105245_10010417 3300009098 Bacteria 8097
186 Ga0105245_10036774 3300009098 Bacteria 4351
187 Ga0105245_10113852 3300009098 Bacteria 2519
188 Ga0105247_10000971 3300009101 Bacteria 21642
189 Ga0105247_10003337 3300009101 Bacteria 10507
190 Ga0105247_10003762 3300009101 Bacteria 9842
191 Ga0105247_10102080 3300009101 Bacteria 1835
192 Ga0114129_10002108 3300009147 Bacteria 27390
193 Ga0114129_10004443 3300009147 Bacteria 19788
194 Ga0114129_10005325 3300009147 Bacteria 18160
195 Ga0114129_10011738 3300009147 Bacteria 12466
196 Ga0114129_10016634 3300009147 Bacteria 10474
197 Ga0114129_10026130 3300009147 Bacteria 8268
198 Ga0114129_10031786 3300009147 Bacteria 7462
199 Ga0114129_10052270 3300009147 Bacteria 5734
200 Ga0114129_10071639 3300009147 Bacteria 4833
201 Ga0114129_10181118 3300009147 Bacteria 2866
202 Ga0105243_10000498 3300009148 Bacteria 40115
203 Ga0105243_10080754 3300009148 Bacteria 2653
204 Ga0105241_10024590 3300009174 Bacteria 4473
205 Ga0105242_10000795 3300009176 Bacteria 24463
206 Ga0105242_10001394 3300009176 Bacteria 19045
207 Ga0105248_10000326 3300009177 Bacteria 56477
208 Ga0105248_10004206 3300009177 Bacteria 15920
209 Ga0105248_10030613 3300009177 Bacteria 6010
210 Ga0105248_10042041 3300009177 Bacteria 5125
211 Ga0105237_10000341 3300009545 Bacteria 65672
212 Ga0105237_10005381 3300009545 Bacteria 14471
213 Ga0105237_10088908 3300009545 Bacteria 3078
214 Ga0105237_10124178 3300009545 Bacteria 2576
215 Ga0105238_10072620 3300009551 Bacteria 3436
216 Ga0105249_10003663 3300009553 Bacteria 13254
217 Ga0105239_10009254 3300010375 Bacteria 11136
218 Ga0105239_10013363 3300010375 Bacteria 9121
219 Ga0105239_10082407 3300010375 Bacteria 3542
220 Ga0105239_10109131 3300010375 Bacteria 3066
221 Ga0105239_10194783 3300010375 Bacteria 2269
222 Ga0105239_10359847 3300010375 Bacteria 1643
223 Ga0105246_10068410 3300011119 Bacteria 2491
224 Ga0157373_10125544 3300013100 Bacteria 1805
225 Ga0157371_10075081 3300013102 Bacteria 2394
226 Ga0157370_10031815 3300013104 Bacteria 5158
227 Ga0157370_10032665 3300013104 Bacteria 5081
228 Ga0157370_10040437 3300013104 Bacteria 4502
229 Ga0157370_10050894 3300013104 Bacteria 3958
230 Ga0157369_10006194 3300013105 Bacteria 13880
231 Ga0157369_10191523 3300013105 Bacteria 2149
232 Ga0171462_1001 3300013250 Bacteria 1135406
233 Ga0157374_10015550 3300013296 Bacteria 6676
234 Ga0157374_10026275 3300013296 Bacteria 5238
235 Ga0157374_10281843 3300013296 Bacteria 1641
236 Ga0157378_10003230 3300013297 Bacteria 14505
237 Ga0157378_10179453 3300013297 Bacteria 1991
238 Ga0163162_10153050 3300013306 Bacteria 2425
239 Ga0163162_10389447 3300013306 Bacteria 1526
240 Ga0157372_10019524 3300013307 Bacteria 7306
241 Ga0157372_10040927 3300013307 Bacteria 5122
242 Ga0157375_10179485 3300013308 Bacteria 2268
243 Ga0157375_10378108 3300013308 Bacteria 1583
244 Ga0163163_10001257 3300014325 Bacteria 21367
245 Ga0163163_10005445 3300014325 Bacteria 11002
246 Ga0163163_10071778 3300014325 Bacteria 3451
247 Ga0163163_10076524 3300014325 Bacteria 3341
248 Ga0157380_10023569 3300014326 Bacteria 4645
249 Ga0157380_10064715 3300014326 Bacteria 2936
250 Ga0182008_10012519 3300014497 Bacteria 4476
251 Ga0157377_10010612 3300014745 Bacteria 4563
252 Ga0157377_10013934 3300014745 Bacteria 4081
253 Ga0157377_10041322 3300014745 Bacteria 2558
254 Ga0157379_10001539 3300014968 Bacteria 18974
255 Ga0157379_10007727 3300014968 Bacteria 9309
256 Ga0157379_10031033 3300014968 Bacteria 4761
257 Ga0157376_10024222 3300014969 Bacteria 4762
258 Ga0157376_10028472 3300014969 Bacteria 4441
259 Ga0157376_10164322 3300014969 Bacteria 2015
260 Ga0197907_10064725 3300020069 Bacteria 3035
261 Ga0206349_1803513 3300020075 Bacteria 2153
262 Ga0206351_10658466 3300020077 Bacteria 8249
263 Ga0154015_1452617 3300020610 Bacteria 3008
264 Ga0213876_10009730 3300021384 Bacteria 5174
265 Ga0228598_1000951 3300024227 Bacteria 6296
266 Ga0209672_100044 3300025228 Bacteria 270292
267 Ga0209672_100120 3300025228 Bacteria 83650
268 Ga0209147_100039 3300025229 Bacteria 311101
269 Ga0209258_100062 3300025242 Bacteria 311101
270 Ga0209677_100143 3300025253 Bacteria 66162
271 Ga0209148_1000075 3300025254 Bacteria 311101
272 Ga0209148_1000695 3300025254 Bacteria 27262
273 Ga0209565_1000025 3300025263 Bacteria 377969
274 Ga0209565_1002453 3300025263 Bacteria 6678
275 Ga0209455_1000067 3300025272 Bacteria 311101
276 Ga0209673_1000044 3300025273 Bacteria 290647
277 Ga0209673_1000077 3300025273 Bacteria 229470
278 Ga0209675_1000017 3300025291 Bacteria 378002
279 Ga0209025_1024717 3300025294 Bacteria 3090
280 Ga0209564_1016007 3300025295 Bacteria 3016
281 Ga0207656_10000002 3300025321 Bacteria 792178
282 Ga0207692_10009035 3300025898 Bacteria 4150
283 Ga0207642_10043156 3300025899 Bacteria 1987
284 Ga0207710_10000682 3300025900 Bacteria 19100
285 Ga0207710_10000764 3300025900 Bacteria 17589
286 Ga0207710_10004037 3300025900 Bacteria 6457
287 Ga0207710_10086269 3300025900 Bacteria 1463
288 Ga0207688_10000765 3300025901 Bacteria 15989
289 Ga0207688_10007019 3300025901 Bacteria 6124
290 Ga0207680_10010080 3300025903 Bacteria 4714
291 Ga0207680_10047824 3300025903 Bacteria 2537
292 Ga0207647_10018243 3300025904 Bacteria 4753
293 Ga0207647_10033585 3300025904 Bacteria 3285
294 Ga0207699_10104198 3300025906 Bacteria 1806
295 Ga0207643_10000049 3300025908 Bacteria 78784
296 Ga0207705_10000001 3300025909 Bacteria 2061880
297 Ga0207705_10017953 3300025909 Bacteria 5060
298 Ga0207705_10023382 3300025909 Bacteria 4409
299 Ga0207684_10000152 3300025910 Bacteria 121082
300 Ga0207684_10060237 3300025910 Bacteria 3224
301 Ga0207684_10078287 3300025910 Bacteria 2812
302 Ga0207654_10000001 3300025911 Bacteria 1816198
303 Ga0207654_10028648 3300025911 Bacteria 3038
304 Ga0207707_10040010 3300025912 Bacteria 4097
305 Ga0207707_10047329 3300025912 Bacteria 3745
306 Ga0207695_10009910 3300025913 Bacteria 11708
307 Ga0207695_10010927 3300025913 Bacteria 11043
308 Ga0207695_10059071 3300025913 Bacteria 3979
309 Ga0207671_10000002 3300025914 Bacteria 1144816
310 Ga0207671_10008858 3300025914 Bacteria 8473
311 Ga0207671_10087625 3300025914 Bacteria 2341
312 Ga0207693_10014631 3300025915 Bacteria 6304
313 Ga0207660_10010527 3300025917 Bacteria 6006
314 Ga0207660_10016917 3300025917 Bacteria 4838
315 Ga0207660_10042981 3300025917 Bacteria 3174
316 Ga0207657_10062750 3300025919 Bacteria 3180
317 Ga0207657_10069533 3300025919 Bacteria 2987
318 Ga0207649_10021098 3300025920 Bacteria 3744
319 Ga0207652_10037094 3300025921 Bacteria 4125
320 Ga0207652_10046602 3300025921 Bacteria 3699
321 Ga0207646_10000085 3300025922 Bacteria 125486
322 Ga0207646_10003404 3300025922 Bacteria 17963
323 Ga0207646_10006296 3300025922 Bacteria 12304
324 Ga0207646_10041597 3300025922 Bacteria 4131
325 Ga0207646_10097144 3300025922 Bacteria 2639
326 Ga0207646_10109562 3300025922 Bacteria 2477
327 Ga0207646_10117967 3300025922 Bacteria 2384
328 Ga0207681_10020887 3300025923 Bacteria 4156
329 Ga0207694_10000395 3300025924 Bacteria 40665
330 Ga0207650_10004400 3300025925 Bacteria 9627
331 Ga0207650_10006096 3300025925 Bacteria 8217
332 Ga0207650_10009512 3300025925 Bacteria 6643
333 Ga0207659_10000449 3300025926 Bacteria 24779
334 Ga0207659_10006153 3300025926 Bacteria 7336
335 Ga0207659_10011241 3300025926 Bacteria 5651
336 Ga0207659_10069012 3300025926 Bacteria 2573
337 Ga0207659_10181389 3300025926 Bacteria 1668
338 Ga0207687_10000051 3300025927 Bacteria 92954
339 Ga0207687_10005749 3300025927 Bacteria 8206
340 Ga0207687_10038434 3300025927 Bacteria 3271
341 Ga0207687_10148354 3300025927 Bacteria 1787
342 Ga0207644_10000427 3300025931 Bacteria 27329
343 Ga0207690_10000753 3300025932 Bacteria 20917
344 Ga0207690_10007571 3300025932 Bacteria 6446
345 Ga0207706_10010636 3300025933 Bacteria 8405
346 Ga0207706_10050638 3300025933 Bacteria 3670
347 Ga0207706_10096319 3300025933 Bacteria 2602
348 Ga0207706_10111601 3300025933 Bacteria 2405
349 Ga0207686_10030649 3300025934 Bacteria 3187
350 Ga0207686_10062536 3300025934 Bacteria 2364
351 Ga0207709_10001062 3300025935 Bacteria 20280
352 Ga0207670_10018852 3300025936 Bacteria 4204
353 Ga0207670_10028353 3300025936 Bacteria 3554
354 Ga0207704_10052717 3300025938 Bacteria 2467
355 Ga0207691_10021623 3300025940 Bacteria 6073
356 Ga0207691_10024960 3300025940 Bacteria 5617
357 Ga0207711_10001610 3300025941 Bacteria 20866
358 Ga0207711_10012790 3300025941 Bacteria 6972
359 Ga0207711_10018085 3300025941 Bacteria 5860
360 Ga0207711_10023009 3300025941 Bacteria 5216
361 Ga0207711_10031750 3300025941 Bacteria 4461
362 Ga0207711_10095568 3300025941 Bacteria 2621
363 Ga0207689_10000355 3300025942 Bacteria 42965
364 Ga0207689_10142869 3300025942 Bacteria 1972
365 Ga0207679_10003632 3300025945 Bacteria 9567
366 Ga0207667_10000384 3300025949 Bacteria 59816
367 Ga0207667_10006444 3300025949 Bacteria 14210
368 Ga0207667_10021836 3300025949 Bacteria 7084
369 Ga0207667_10069498 3300025949 Bacteria 3665
370 Ga0207667_10072433 3300025949 Bacteria 3581
371 Ga0207668_10136815 3300025972 Bacteria 1878
372 Ga0207640_10000001 3300025981 Bacteria 628778
373 Ga0207640_10089369 3300025981 Bacteria 2129
374 Ga0207658_10038428 3300025986 Bacteria 3448
375 Ga0207677_10009186 3300026023 Bacteria 5553
376 Ga0207677_10016480 3300026023 Bacteria 4380
377 Ga0207703_10000181 3300026035 Bacteria 73537
378 Ga0207703_10006991 3300026035 Bacteria 8980
379 Ga0207703_10013734 3300026035 Bacteria 6313
380 Ga0207639_10000037 3300026041 Bacteria 147685
381 Ga0207639_10010005 3300026041 Bacteria 6555
382 Ga0207639_10046216 3300026041 Bacteria 3284
383 Ga0207678_10000705 3300026067 Bacteria 30524
384 Ga0207678_10011578 3300026067 Bacteria 7747
385 Ga0207678_10099639 3300026067 Bacteria 2482
386 Ga0207708_10014564 3300026075 Bacteria 5884
387 Ga0207708_10016932 3300026075 Bacteria 5488
388 Ga0207702_10001520 3300026078 Bacteria 22948
389 Ga0207702_10026927 3300026078 Bacteria 4774
390 Ga0207641_10000705 3300026088 Bacteria 35934
391 Ga0207641_10000772 3300026088 Bacteria 34278
392 Ga0207641_10003322 3300026088 Bacteria 14315
393 Ga0207641_10053652 3300026088 Bacteria 3418
394 Ga0207648_10020715 3300026089 Bacteria 5919
395 Ga0207676_10003132 3300026095 Bacteria 11807
396 Ga0207676_10035482 3300026095 Bacteria 3785
397 Ga0207676_10055520 3300026095 Bacteria 3109
398 Ga0207676_10170281 3300026095 Bacteria 1897
399 Ga0207674_10003240 3300026116 Bacteria 20036
400 Ga0207674_10006786 3300026116 Bacteria 13431
401 Ga0207674_10058473 3300026116 Bacteria 3905
402 Ga0207675_100027582 3300026118 Bacteria 5289
403 Ga0207675_100056126 3300026118 Bacteria 3674
404 Ga0207675_100107793 3300026118 Bacteria 2627
405 Ga0207675_100135250 3300026118 Bacteria 2338
406 Ga0207683_10000155 3300026121 Bacteria 57375
407 Ga0207683_10013847 3300026121 Bacteria 6878
408 Ga0207683_10186792 3300026121 Bacteria 1880
409 Ga0207698_10000297 3300026142 Bacteria 29970
410 Ga0207698_10017059 3300026142 Bacteria 4916
411 Ga0207698_10101266 3300026142 Bacteria 2388
412 Ga0209996_1000822 3300027395 Bacteria 3656
413 Ga0209282_1000459 3300027666 Bacteria 19912
414 Ga0209974_10027562 3300027876 Bacteria 1880
415 Ga0207428_10002981 3300027907 Bacteria 16729
416 Ga0207428_10003991 3300027907 Bacteria 14165
417 Ga0207428_10010552 3300027907 Bacteria 8245
418 Ga0207428_10011501 3300027907 Bacteria 7819
419 Ga0207428_10024979 3300027907 Bacteria 5010
420 Ga0207428_10088199 3300027907 Bacteria 2413
421 Ga0268266_10005631 3300028379 Bacteria 11626
422 Ga0268266_10007630 3300028379 Bacteria 9731
423 Ga0268266_10012018 3300028379 Bacteria 7493
424 Ga0268266_10017715 3300028379 Bacteria 6069
425 Ga0268265_10003019 3300028380 Bacteria 12280
426 Ga0268264_10030138 3300028381 Bacteria 4448
427 Ga0268264_10053645 3300028381 Bacteria 3364
428 Ga0307517_10000575 3300028786 Bacteria 62687
429 Ga0307517_10104467 3300028786 Bacteria 2206
430 Ga0307515_10000090 3300028794 Bacteria 215043
431 Ga0307515_10000626 3300028794 Bacteria 82165
432 Ga0307515_10016121 3300028794 Bacteria 13705
433 Ga0307515_10033949 3300028794 Bacteria 8377
434 Ga0307515_10056285 3300028794 Bacteria 5720
435 Ga0265338_10023116 3300028800 Bacteria 6402
436 Ga0265338_10069851 3300028800 Bacteria 3015
437 Ga0265338_10112247 3300028800 Bacteria 2192
438 Ga0265332_10009863 3300031238 Bacteria 4255
439 Ga0265325_10014158 3300031241 Bacteria 4516
440 Ga0265340_10018702 3300031247 Bacteria 3572
441 Ga0265339_10017534 3300031249 Bacteria 4238
442 Ga0265339_10021423 3300031249 Bacteria 3761
443 Ga0265327_10000064 3300031251 Bacteria 231983
444 Ga0265327_10002041 3300031251 Bacteria 22722
445 Ga0265327_10011063 3300031251 Bacteria 6266
446 Ga0265316_10061518 3300031344 Bacteria 2916
447 Ga0265316_10063605 3300031344 Bacteria 2861
448 Ga0307513_10001842 3300031456 Bacteria 30107
449 Ga0307513_10021458 3300031456 Bacteria 7624
450 Ga0307509_10001164 3300031507 Bacteria 44979
451 Ga0307509_10002081 3300031507 Bacteria 32968
452 Ga0307509_10006951 3300031507 Bacteria 15009
453 Ga0307509_10013455 3300031507 Bacteria 9687
454 Ga0307509_10222611 3300031507 Bacteria 1698
455 Ga0307408_100012808 3300031548 Bacteria 5562
456 Ga0307408_100028205 3300031548 Bacteria 3877
457 Ga0265313_10036958 3300031595 Bacteria 2448
458 Ga0265313_10040640 3300031595 Bacteria 2297
459 Ga0307508_10000095 3300031616 Bacteria 103944
460 Ga0307508_10005281 3300031616 Bacteria 12331
461 Ga0307514_10000861 3300031649 Bacteria 48344
462 Ga0316575_10041618 3300031665 Bacteria 1818
463 Ga0265314_10024057 3300031711 Bacteria 4627
464 Ga0265342_10045661 3300031712 Bacteria 2636
465 Ga0316576_10002490 3300031727 Bacteria 10488
466 Ga0316576_10020271 3300031727 Bacteria 4572
467 Ga0316578_10008648 3300031728 Bacteria 5192
468 Ga0316578_10021395 3300031728 Bacteria 3589
469 Ga0307516_10001905 3300031730 Bacteria 28569
470 Ga0307516_10027943 3300031730 Bacteria 5714
471 Ga0307405_10043395 3300031731 Bacteria 2743
472 Ga0316577_10053381 3300031733 Bacteria 2256
473 Ga0307413_10005754 3300031824 Bacteria 5574
474 Ga0307413_10007349 3300031824 Bacteria 5109
475 Ga0307413_10141204 3300031824 Bacteria 1665
476 Ga0307410_10000654 3300031852 Bacteria 14294
477 Ga0307410_10063821 3300031852 Bacteria 2528
478 Ga0307406_10000232 3300031901 Bacteria 33842
479 Ga0307406_10015705 3300031901 Bacteria 4388
480 Ga0307406_10087099 3300031901 Bacteria 2092
481 Ga0307412_10132894 3300031911 Bacteria 1810
482 Ga0307409_100000004 3300031995 Bacteria 84332
483 Ga0307409_100001551 3300031995 Bacteria 11405
484 Ga0307409_100013285 3300031995 Bacteria 5291
485 Ga0307409_100016948 3300031995 Bacteria 4840
486 Ga0307409_100190672 3300031995 Bacteria 1824
487 Ga0307416_100000126 3300032002 Bacteria 46344
488 Ga0307416_100014731 3300032002 Bacteria 5373
489 Ga0307416_100021776 3300032002 Bacteria 4611
490 Ga0307416_100036062 3300032002 Bacteria 3787
491 Ga0307414_10003245 3300032004 Bacteria 8662
492 Ga0307411_10021291 3300032005 Bacteria 3790
493 Ga0307415_100008261 3300032126 Bacteria 5760
494 Ga0316580_10011296 3300032139 Bacteria 2709
495 Ga0307507_10053796 3300033179 Bacteria 3841
496 Ga0307510_10016948 3300033180 Bacteria 8593
497 Ga0373949_0000187 3300035090 Bacteria 23988
498 Ga0373936_0000012 3300035113 Bacteria 228915
499 Ga0373953_0028810 3300035117 Bacteria 2144
500 Ga0373954_0045377 3300035118 Bacteria 2053
501 Ga0373955_0114643 3300035172 Bacteria 1561
502 Ga0373961_0000156 3300035241 Bacteria 32884
503 Ga0316574_0018158 3300035398 Bacteria 4128
504 Ga0316574_0180430 3300035398 Bacteria 1358
505 Ga0316574_0199888 3300035398 Bacteria 1284
506 Ga0373933_0003533 3300035724 Bacteria 8700
507 Ga0373933_0109165 3300035724 Bacteria 1724
508 Ga0373937_0000294 3300036401 Bacteria 47485
509 Ga0373937_0044492 3300036401 Bacteria 4055
510 Ga0373925_0048463 3300037068 Bacteria 3166
511 Ga0373925_0188655 3300037068 Bacteria 1635
512 Ga0395899_0038482 3300037312 Bacteria 3582
513 Ga0395900_0003801 3300037418 Bacteria 16162
514 Ga0395900_0024723 3300037418 Bacteria 6148
515 Ga0395900_0082960 3300037418 Bacteria 3293
516 Ga0395900_0155279 3300037418 Bacteria 2337
517 Ga0395900_0167521 3300037418 Bacteria 2238
518 Ga0395898_0029681 3300037466 Bacteria 5474
519 Ga0395898_0154321 3300037466 Bacteria 2196
520 Ga0395898_0156183 3300037466 Bacteria 2182
521 Ga0395905_0171069 3300037471 Bacteria 2041
522 Ga0395901_0090021 3300038443 Bacteria 3211
523 Ga0395901_0127413 3300038443 Bacteria 2675
524 Ga0400483_044815 3300039062 Bacteria 21564
525 Ga0400483_124415 3300039062 Bacteria 2420
526 Ga0400483_171783 3300039062 Bacteria 21158
527 Ga0400483_215983 3300039062 Bacteria 44583
528 Ga0400483_259819 3300039062 Bacteria 2340
529 Ga0436365_0681063 3300039437 Bacteria 33078
530 Ga0451853_0605618 3300041512 Bacteria 2641
531 Ga0439445_0017068 3300042004 Bacteria 1791
532 Ga0439448_0018642 3300042005 Bacteria 2130
533 Ga0439455_0017323 3300042012 Bacteria 1677
534 Ga0439463_001486 3300042016 Bacteria 6193
535 Ga0439435_0000833 3300042436 Bacteria 5262
536 Ga0439459_0002988 3300042438 Bacteria 2652
537 Ga0439464_0005358 3300042439 Bacteria 3314
538 Ga0439440_0003945 3300042993 Bacteria 2892
539 Ga0466972_0045980 3300044658 Bacteria 2114
540 Ga0466972_0051184 3300044658 Bacteria 1993
541 Ga0466965_0000016 3300044683 Bacteria 81402
542 Ga0466965_0005209 3300044683 Bacteria 5842
543 Ga0466965_0017806 3300044683 Bacteria 3398
544 Ga0466965_0027522 3300044683 Bacteria 2761
545 Ga0466965_0039573 3300044683 Bacteria 2318
546 Ga0466966_0021447 3300044684 Bacteria 4242
547 Ga0466961_0008445 3300044693 Bacteria 6559
548 Ga0466961_0014589 3300044693 Bacteria 5048
549 Ga0466961_0018181 3300044693 Bacteria 4519
550 Ga0466961_0024175 3300044693 Bacteria 3907
551 Ga0466963_0006873 3300044694 Bacteria 6768
552 Ga0466963_0014074 3300044694 Bacteria 4928
553 Ga0466963_0038573 3300044694 Bacteria 3125
554 Ga0466963_0104945 3300044694 Bacteria 1937
555 Ga0466964_0001285 3300044706 Bacteria 8567
556 Ga0453684_0391720 3300044712 Bacteria 1558
557 Ga0466971_0004116 3300044719 Bacteria 6261
558 Ga0466971_0024226 3300044719 Bacteria 2708
559 Ga0466968_0016601 3300044735 Bacteria 2934
560 Ga0466970_0001281 3300044765 Bacteria 12165
561 Ga0466970_0013374 3300044765 Bacteria 4207
562 Ga0466957_0001021 3300044842 Bacteria 14441
563 Ga0466957_0049781 3300044842 Bacteria 2548
564 Ga0466960_0004151 3300044901 Bacteria 5639
565 Ga0466960_0022402 3300044901 Bacteria 2824
566 Ga0466959_0010490 3300045049 Bacteria 6626
567 Ga0466959_0117947 3300045049 Bacteria 1889
568 Ga0466958_0006072 3300045836 Bacteria 6548
569 Ga0466958_0006804 3300045836 Bacteria 6249
570 Ga0466958_0013868 3300045836 Bacteria 4595
571 Ga0466958_0025466 3300045836 Bacteria 3489
572 Ga0466967_0002225 3300045976 Bacteria 11936
573 Ga0466967_0006548 3300045976 Bacteria 8261
574 Ga0466967_0017392 3300045976 Bacteria 5706
575 Ga0466967_0026189 3300045976 Bacteria 4825
576 Ga0466967_0075770 3300045976 Bacteria 3024
577 Ga0495592_0001098 3300046454 Bacteria 18798
578 Ga0495592_0034359 3300046454 Bacteria 3822
579 Ga0495590_0000891 3300046457 Bacteria 13373
580 Ga0495629_0002724 3300046459 Bacteria 13526
581 Ga0495641_0006967 3300046461 Bacteria 7192
582 Ga0495651_0000815 3300046462 Bacteria 24148
583 Ga0495651_0050577 3300046462 Bacteria 3206
584 Ga0495651_0149273 3300046462 Bacteria 1687
585 Ga0495653_0001854 3300046463 Bacteria 16703
586 Ga0495653_0153839 3300046463 Bacteria 1604
587 Ga0495650_0002544 3300046471 Bacteria 14530
588 Ga0495650_0003922 3300046471 Bacteria 10490
589 Ga0495650_0052305 3300046471 Bacteria 1677
590 Ga0495580_0008034 3300046472 Bacteria 8425
591 Ga0495580_0008828 3300046472 Bacteria 7977
592 Ga0495580_0142444 3300046472 Bacteria 1662
593 Ga0495582_0019156 3300046473 Bacteria 3744
594 Ga0495594_0012306 3300046499 Bacteria 4458
595 Ga0495607_0039906 3300046501 Bacteria 2800
596 Ga0495583_0000911 3300046506 Bacteria 34999
597 Ga0495608_0000148 3300046511 Bacteria 50904
598 Ga0495608_0128812 3300046511 Bacteria 1620
599 Ga0495616_0004445 3300046513 Bacteria 8831
600 Ga0495618_0002523 3300046514 Bacteria 11734
601 Ga0495620_0035382 3300046515 Bacteria 2246
602 Ga0495628_0047108 3300046516 Bacteria 3422
603 Ga0495630_0024745 3300046517 Bacteria 4438
604 Ga0495631_0001172 3300046518 Bacteria 16199
605 Ga0495631_0041788 3300046518 Bacteria 2028
606 Ga0495644_0036890 3300046523 Bacteria 1844
607 Ga0495648_0060755 3300046524 Bacteria 2247
608 Ga0495652_0020705 3300046529 Bacteria 5847
609 Ga0495640_0003850 3300046533 Bacteria 12037
610 Ga0495587_0001638 3300046536 Bacteria 14931
611 Ga0495587_0069252 3300046536 Bacteria 2054
612 Ga0495645_0004410 3300046543 Bacteria 9617
613 Ga0495645_0034952 3300046543 Bacteria 3664
614 Ga0495645_0051258 3300046543 Bacteria 3003
615 Ga0495667_0010608 3300046559 Bacteria 6233
616 Ga0495668_0055772 3300046616 Bacteria 2182
617 Ga0495625_0015966 3300046660 Bacteria 5923
618 Ga0495657_0005335 3300046675 Bacteria 10167
619 Ga0495599_0051117 3300046678 Bacteria 2590
620 Ga0495599_0093702 3300046678 Bacteria 1873
621 Ga0495623_0003777 3300046679 Bacteria 9982
622 Ga0495623_0062771 3300046679 Bacteria 2328
623 Ga0495646_0010629 3300046680 Bacteria 5846
624 Ga0495647_0001867 3300046681 Bacteria 6541
625 Ga0495658_0005410 3300046683 Bacteria 6277
626 Ga0495658_0088533 3300046683 Bacteria 1830
627 Ga0495670_0036860 3300046691 Bacteria 2437
628 Ga0495671_0000976 3300046692 Bacteria 19963
629 Ga0495600_0084421 3300046809 Bacteria 2072
630 Ga0495581_0129267 3300047315 Bacteria 1472
631 Ga0495604_0004509 3300047317 Bacteria 11032
632 Ga0495604_0016895 3300047317 Bacteria 5834
633 Ga0495674_0000457 3300047319 Bacteria 36912
634 Ga0495674_0081050 3300047319 Bacteria 2784
635 Ga0495672_0002195 3300047320 Bacteria 18184
636 Ga0495672_0002615 3300047320 Bacteria 16301
637 Ga0495672_0005993 3300047320 Bacteria 9522
638 Ga0495676_0060970 3300047321 Bacteria 2953
639 Ga0495680_0000868 3300047322 Bacteria 33574
640 Ga0495683_0000677 3300047323 Bacteria 25156
641 Ga0495687_017509 3300047443 Bacteria 3572
642 Ga0495687_020765 3300047443 Bacteria 3195
643 Ga0495687_024200 3300047443 Bacteria 2889
644 Ga0495675_0052266 3300047444 Bacteria 2594
645 Ga0495681_0043727 3300047470 Bacteria 2158
646 Ga0495684_0007437 3300047471 Bacteria 8489
647 Ga0495686_0000048 3300047472 Bacteria 278044
648 Ga0495686_0021863 3300047472 Bacteria 4239
649 Ga0495686_0059698 3300047472 Bacteria 2373
650 Ga0495602_0003749 3300048088 Bacteria 15782
651 Ga0495602_0048605 3300048088 Bacteria 3810
652 Ga0495602_0056601 3300048088 Bacteria 3447
653 Ga0495614_0015333 3300048089 Bacteria 3340
654 Ga0496100_0107330 3300048903 Bacteria 1934
655 Ga0496101_0020991 3300048904 Bacteria 4482
656 Ga0496101_0080824 3300048904 Bacteria 2402
657 Ga0496102_0000059 3300048905 Bacteria 168633
658 Ga0496102_0003569 3300048905 Bacteria 13183
659 Ga0496102_0004742 3300048905 Bacteria 11512
660 Ga0496102_0005091 3300048905 Bacteria 11137
661 Ga0496102_0073462 3300048905 Bacteria 3143
662 Ga0496103_0000063 3300048906 Bacteria 128503
663 Ga0496103_0139931 3300048906 Bacteria 1547
664 Ga0496104_0057728 3300048907 Bacteria 3673
665 Ga0496104_0076160 3300048907 Bacteria 3195
666 Ga0496105_0006741 3300048908 Bacteria 8830
667 Ga0496105_0176699 3300048908 Bacteria 1749
668 Ga0496106_0019275 3300048909 Bacteria 5058
669 Ga0496106_0126818 3300048909 Bacteria 1999
670 Ga0496107_0045962 3300048910 Bacteria 3142
671 Ga0496107_0059514 3300048910 Bacteria 2764
672 Ga0496108_0026484 3300048911 Bacteria 4782
673 Ga0496108_0044659 3300048911 Bacteria 3699
674 Ga0496108_0057426 3300048911 Bacteria 3270
675 Ga0496108_0097031 3300048911 Bacteria 2511
676 Ga0496108_0108718 3300048911 Bacteria 2369
677 Ga0496109_0000016 3300048912 Bacteria 212455
678 Ga0496109_0004796 3300048912 Bacteria 11290
679 Ga0496109_0031854 3300048912 Bacteria 4736
680 Ga0496109_0038731 3300048912 Bacteria 4311
681 Ga0496109_0066056 3300048912 Bacteria 3311
682 Ga0496109_0188087 3300048912 Bacteria 1940
683 Ga0496110_0011966 3300048913 Bacteria 7125
684 Ga0496110_0017590 3300048913 Bacteria 5978
685 Ga0496111_0001803 3300048914 Bacteria 12568
686 Ga0496111_0020992 3300048914 Bacteria 4553
687 Ga0496111_0049728 3300048914 Bacteria 3023
688 Ga0496111_0178983 3300048914 Bacteria 1576
689 Ga0496112_0009924 3300048915 Bacteria 8612
690 Ga0496112_0029168 3300048915 Bacteria 5334
691 Ga0496112_0098558 3300048915 Bacteria 2892
692 Ga0496113_0041450 3300048916 Bacteria 3398
693 Ga0496113_0219316 3300048916 Bacteria 1515
694 Ga0496114_0032778 3300048917 Bacteria 4279
695 Ga0496114_0032896 3300048917 Bacteria 4270
696 Ga0496114_0040981 3300048917 Bacteria 3837
697 Ga0496114_0060374 3300048917 Bacteria 3169
698 Ga0496114_0092169 3300048917 Bacteria 2574
699 Ga0496115_0038565 3300048918 Bacteria 3791
700 Ga0496116_0000371 3300048919 Bacteria 67456
701 Ga0496117_0000063 3300048920 Bacteria 254446
702 Ga0496117_0003104 3300048920 Bacteria 19864
703 Ga0496117_0014490 3300048920 Bacteria 6787
704 Ga0496117_0072118 3300048920 Bacteria 2311
705 Ga0496118_0005850 3300048921 Bacteria 13789
706 Ga0496118_0017172 3300048921 Bacteria 6602
707 Ga0496118_0031324 3300048921 Bacteria 4411
708 Ga0496118_0066813 3300048921 Bacteria 2623
709 Ga0496118_0108852 3300048921 Bacteria 1846
710 Ga0496119_0002091 3300048922 Bacteria 22550
711 Ga0496119_0002848 3300048922 Bacteria 18479
712 Ga0496119_0009813 3300048922 Bacteria 8143
713 Ga0496119_0015267 3300048922 Bacteria 5932
714 Ga0496119_0017098 3300048922 Bacteria 5480
715 Ga0496119_0021931 3300048922 Bacteria 4593
716 Ga0496119_0041167 3300048922 Bacteria 2946
717 Ga0496120_0000882 3300048923 Bacteria 42252
718 Ga0496120_0001936 3300048923 Bacteria 22752
719 Ga0496120_0023873 3300048923 Bacteria 3821
720 Ga0496120_0051027 3300048923 Bacteria 2365
721 Ga0496120_0054044 3300048923 Bacteria 2279
722 Ga0496120_0065865 3300048923 Bacteria 2005
723 Ga0496121_0000015 3300048924 Bacteria 571958
724 Ga0496121_0003574 3300048924 Bacteria 21974
725 Ga0496121_0127698 3300048924 Bacteria 1909
726 Ga0496122_0001461 3300048925 Bacteria 38115
727 Ga0496122_0002058 3300048925 Bacteria 29852
728 Ga0496122_0005683 3300048925 Bacteria 14724
729 Ga0496122_0007542 3300048925 Bacteria 12055
730 Ga0496122_0036490 3300048925 Bacteria 3973
731 Ga0496122_0052756 3300048925 Bacteria 3074
732 Ga0496122_0083894 3300048925 Bacteria 2207
733 Ga0496123_0000179 3300048926 Bacteria 127833
734 Ga0496123_0001148 3300048926 Bacteria 39511
735 Ga0496123_0002798 3300048926 Bacteria 20726
736 Ga0496123_0018712 3300048926 Bacteria 5490
737 Ga0496124_0000389 3300048927 Bacteria 80434
738 Ga0496124_0001764 3300048927 Bacteria 30135
739 Ga0496124_0043977 3300048927 Bacteria 3836
740 Ga0496124_0057024 3300048927 Bacteria 3292
741 Ga0496124_0097086 3300048927 Bacteria 2393
742 Ga0496125_0000350 3300048928 Bacteria 87293
743 Ga0496125_0036635 3300048928 Bacteria 4278
744 Ga0496126_0000075 3300048929 Bacteria 235121
745 Ga0496126_0002220 3300048929 Bacteria 26882
746 Ga0496126_0013693 3300048929 Bacteria 8233
747 Ga0496126_0014189 3300048929 Bacteria 8064
748 Ga0496126_0020829 3300048929 Bacteria 6418
749 Ga0496126_0091545 3300048929 Bacteria 2674
750 Ga0496126_0110632 3300048929 Bacteria 2393
751 Ga0501292_005246 3300049515 Bacteria 1802
752 Ga0501031_0032897 3300049568 Bacteria 3381
753 Ga0501031_0068127 3300049568 Bacteria 2318
754 Ga0501031_0114761 3300049568 Bacteria 1759
755 Ga0501032_0027900 3300049569 Bacteria 3879
756 Ga0501032_0040062 3300049569 Bacteria 3185
757 Ga0501033_0028137 3300049570 Bacteria 4225
758 Ga0501034_0002740 3300049571 Bacteria 20737
759 Ga0501034_0005401 3300049571 Bacteria 13969
760 Ga0501034_0017217 3300049571 Bacteria 7413
761 Ga0501034_0019391 3300049571 Bacteria 6956
762 Ga0501036_0022611 3300049572 Bacteria 5290
763 Ga0501036_0033494 3300049572 Bacteria 4345
764 Ga0501036_0201626 3300049572 Bacteria 1673
765 Ga0501037_0010590 3300049573 Bacteria 6773
766 Ga0501037_0067427 3300049573 Bacteria 2606
767 Ga0501038_0012842 3300049574 Bacteria 7645
768 Ga0501038_0139850 3300049574 Bacteria 1981
769 Ga0501039_0030942 3300049575 Bacteria 4127
770 Ga0501039_0185280 3300049575 Bacteria 1637
771 Ga0501040_0003183 3300049576 Bacteria 10627
772 Ga0501040_0009230 3300049576 Bacteria 6422
773 Ga0501041_0004728 3300049577 Bacteria 7904
774 Ga0501041_0025461 3300049577 Bacteria 3555
775 Ga0501042_0000537 3300049578 Bacteria 19861
776 Ga0501042_0000961 3300049578 Bacteria 16256
777 Ga0501042_0002550 3300049578 Bacteria 11204
778 Ga0501042_0056500 3300049578 Bacteria 2801
779 Ga0501042_0112772 3300049578 Bacteria 1958
780 Ga0501043_0001112 3300049579 Bacteria 23645
781 Ga0501043_0004169 3300049579 Bacteria 11812
782 Ga0501046_0008521 3300049580 Bacteria 8930
783 Ga0501046_0038238 3300049580 Bacteria 3853
784 Ga0501047_0111649 3300049581 Bacteria 2616
785 Ga0501048_0005340 3300049582 Bacteria 9781
786 Ga0501068_0011142 3300049584 Bacteria 5066
787 Ga0501068_0013111 3300049584 Bacteria 4712
788 Ga0501069_0016415 3300049585 Bacteria 3978
789 Ga0501069_0024119 3300049585 Bacteria 3318
790 Ga0501069_0117818 3300049585 Bacteria 1515
791 Ga0501070_0000591 3300049586 Bacteria 33068
792 Ga0501070_0001615 3300049586 Bacteria 19994
793 Ga0501070_0024175 3300049586 Bacteria 5095
794 Ga0501070_0033286 3300049586 Bacteria 4312
795 Ga0501070_0087988 3300049586 Bacteria 2571
796 Ga0501070_0135741 3300049586 Bacteria 2031
797 Ga0501070_0139571 3300049586 Bacteria 2001
798 Ga0501071_0022236 3300049587 Bacteria 4420
799 Ga0501072_0002090 3300049588 Bacteria 14877
800 Ga0501072_0241937 3300049588 Bacteria 1437
801 Ga0501073_0000028 3300049589 Bacteria 118187
802 Ga0501073_0000503 3300049589 Bacteria 27315
803 Ga0501073_0009405 3300049589 Bacteria 7218
804 Ga0501073_0036644 3300049589 Bacteria 3485
805 Ga0501074_0022531 3300049590 Bacteria 4577
806 Ga0501074_0063828 3300049590 Bacteria 2652
807 Ga0501074_0178776 3300049590 Bacteria 1514
808 Ga0501075_0000758 3300049591 Bacteria 20161
809 Ga0501075_0021683 3300049591 Bacteria 4685
810 Ga0501076_0001402 3300049592 Bacteria 16141
811 Ga0501076_0067166 3300049592 Bacteria 2863
812 Ga0501077_0032163 3300049593 Bacteria 3339
813 Ga0501077_0164389 3300049593 Bacteria 1409
814 Ga0501227_002689 3300049665 Bacteria 3901
815 Ga0501079_0001374 3300049741 Bacteria 17131
816 Ga0501079_0007080 3300049741 Bacteria 8463
817 Ga0501080_0001558 3300049742 Bacteria 19389
818 Ga0501080_0005011 3300049742 Bacteria 11797
819 Ga0501081_0001441 3300049743 Bacteria 14545
820 Ga0501081_0008218 3300049743 Bacteria 6774
821 Ga0501083_0000028 3300049744 Bacteria 115481
822 Ga0501083_0097660 3300049744 Bacteria 1938
823 Ga0501083_0135155 3300049744 Bacteria 1616
824 Ga0501035_0022879 3300049822 Bacteria 5739
825 Ga0501035_0090360 3300049822 Bacteria 2696
826 Ga0501035_0179159 3300049822 Bacteria 1827
827 Ga0501044_0051779 3300049823 Bacteria 4232
828 Ga0501044_0100878 3300049823 Bacteria 2904
829 Ga0501045_0002501 3300049824 Bacteria 12495
830 Ga0501045_0007779 3300049824 Bacteria 7454
831 nmdc:mga03n38_24527_c1 3300050490 Bacteria 2467
832 nmdc:mga00v17_22200_c1 3300050491 Bacteria 3659
833 nmdc:mga00v17_454_c1 3300050491 Bacteria 17369
834 nmdc:mga0yw44_16324_c1 3300050492 Bacteria 4008
835 nmdc:mga0k408_6897_c1 3300050493 Bacteria 6062
836 nmdc:mga05p37_1039_c1 3300050507 Bacteria 31636
837 nmdc:mga05p37_1366_c1 3300050507 Bacteria 28371
838 nmdc:mga05p37_1873_c2 3300050507 Bacteria 15278
839 nmdc:mga05p37_2544_c2 3300050507 Bacteria 7408
840 nmdc:mga05p37_2674_c1 3300050507 Bacteria 20751
841 nmdc:mga05p37_27219_c1 3300050507 Bacteria 6960
842 nmdc:mga05p37_33965_c1 3300050507 Bacteria 6248
843 nmdc:mga05p37_37964_c1 3300050507 Bacteria 5907
844 nmdc:mga09592_46707_c1 3300050508 Bacteria 3648
845 nmdc:mga06r32_144047_c1 3300050510 Bacteria 2360
846 nmdc:mga08y16_112543_c1 3300050511 Bacteria 2834
847 nmdc:mga08y16_129531_c1 3300050511 Bacteria 2625
848 nmdc:mga08y16_14406_c1 3300050511 Bacteria 8320
849 nmdc:mga08y16_22724_c1 3300050511 Bacteria 6622
850 nmdc:mga08y16_42598_c1 3300050511 Bacteria 4754
851 nmdc:mga08y16_47684_c1 3300050511 Bacteria 4484
852 nmdc:mga08y16_61285_c1 3300050511 Bacteria 3929
853 nmdc:mga0n895_104833_c1 3300050512 Bacteria 2840
854 nmdc:mga0n895_338266_c1 3300050512 Bacteria 1525
855 nmdc:mga0n895_7649_c1 3300050512 Bacteria 9291
856 nmdc:mga0rr50_7553_c1 3300050513 Bacteria 6714
857 nmdc:mga0a205_135132_c1 3300050515 Bacteria 2367
858 nmdc:mga0a205_15514_c1 3300050515 Bacteria 7119
859 nmdc:mga0a205_48177_c1 3300050515 Bacteria 4113
860 nmdc:mga0a205_6370_c1 3300050515 Bacteria 10661
861 nmdc:mga0sz30_13563_c1 3300050516 Bacteria 3193
862 nmdc:mga0sz30_6527_c1 3300050516 Bacteria 4334
863 Ga0495601_0002029 3300053077 Bacteria 11368
864 Ga0495612_0009945 3300053078 Bacteria 3851
865 Ga0500610_0000935 3300053079 Bacteria 9460
866 Ga0495595_0000521 3300053084 Bacteria 14671
867 Ga0495619_0000089 3300053085 Bacteria 69604
868 Ga0495619_0025913 3300053085 Bacteria 3770
869 Ga0495619_0032884 3300053085 Bacteria 3367
870 Ga0500643_000072 3300053087 Bacteria 112810
871 Ga0500644_0014127 3300053088 Bacteria 2247
872 Ga0500651_0000170 3300053093 Bacteria 42448
873 Ga0500651_0000254 3300053093 Bacteria 32131
874 Ga0500650_0003218 3300053098 Bacteria 5618
875 Ga0500555_004172 3300053103 Bacteria 4114
876 Ga0500556_0000001 3300053104 Bacteria 1135060
877 Ga0500556_0000064 3300053104 Bacteria 109213
878 Ga0500562_002639 3300053108 Bacteria 4461
879 Ga0500571_000075 3300053110 Bacteria 31313
880 Ga0500572_001277 3300053111 Bacteria 7033
881 Ga0500593_000096 3300053117 Bacteria 32939
882 Ga0500593_011783 3300053117 Bacteria 3694
883 Ga0500594_0022318 3300053118 Bacteria 1595
884 Ga0500607_000146 3300053121 Bacteria 59939
885 Ga0500608_012477 3300053122 Bacteria 3728
886 Ga0500614_000030 3300053123 Bacteria 31743
887 Ga0500642_0034783 3300053130 Bacteria 2135
888 Ga0500655_001787 3300053133 Bacteria 4026
889 Ga0500655_004546 3300053133 Bacteria 2496
890 Ga0500658_0000134 3300053134 Bacteria 34937
891 Ga0500658_0000142 3300053134 Bacteria 34080
892 Ga0500559_0000043 3300053136 Bacteria 100617
893 Ga0500559_0001053 3300053136 Bacteria 16797
894 Ga0500559_0001058 3300053136 Bacteria 16716
895 Ga0500559_0001135 3300053136 Bacteria 16041
896 Ga0500559_0003767 3300053136 Bacteria 7364
897 Ga0500568_0000003 3300053139 Bacteria 863587
898 Ga0500568_0000071 3300053139 Bacteria 99625
899 Ga0500568_0000714 3300053139 Bacteria 23777
900 Ga0500568_0002404 3300053139 Bacteria 11048
901 Ga0500568_0006419 3300053139 Bacteria 5902
902 Ga0500568_0014148 3300053139 Bacteria 3613
903 Ga0500568_0015864 3300053139 Bacteria 3362
904 Ga0500573_0000001 3300053140 Bacteria 436394
905 Ga0500573_0017028 3300053140 Bacteria 4134
906 Ga0500573_0029238 3300053140 Bacteria 3177
907 Ga0500573_0067896 3300053140 Bacteria 2036
908 Ga0500573_0082135 3300053140 Bacteria 1830
909 Ga0500590_001605 3300053148 Bacteria 9423
910 Ga0500590_002157 3300053148 Bacteria 8559
911 Ga0500603_009644 3300053150 Bacteria 2163
912 Ga0500616_0000058 3300053153 Bacteria 266276
913 Ga0500616_0000864 3300053153 Bacteria 33621
914 Ga0500616_0000885 3300053153 Bacteria 33029
915 Ga0500616_0005888 3300053153 Bacteria 8200
916 Ga0500619_007827 3300053154 Bacteria 2558
917 Ga0500620_000035 3300053155 Bacteria 25684
918 Ga0500634_0024703 3300053161 Bacteria 3269
919 Ga0500634_0036654 3300053161 Bacteria 2669
920 Ga0500638_003114 3300053162 Bacteria 6047
921 Ga0500636_0063523 3300053177 Bacteria 2152
922 Ga0501084_0001798 3300054114 Bacteria 17094
923 Ga0501084_0002749 3300054114 Bacteria 14196
924 Ga0501082_0001924 3300060353 Bacteria 18254
925 Ga0466962_0000651 3300061719 Bacteria 15399
926 Ga0466962_0012651 3300061719 Bacteria 4061
927 Ga0466962_0056023 3300061719 Bacteria 1884
928 Ga0530510_0026832 3300061734 Bacteria 4125
929 2501069416 2501025501 Bacteria 7768574
930 2501408782 2501025504 Bacteria 8008976
931 2511098494 2510917014 Bacteria 8296963
932 2511106466 2510917015 Bacteria 7950052
933 2517762817 2517572101 Bacteria 6884336
934 2537898681 2537561592 Bacteria 4348607
935 2552112493 2551306166 Bacteria 9731570
936 2587861694 2585428094 Bacteria 3604039
937 2588107917 2585428157 Bacteria 3018951
938 2643769178 2643221549 Bacteria 4042819
939 2643847736 2643221566 Bacteria 3460379
940 2643890968 2643221576 Bacteria 5214352
941 2643960024 2643221590 Bacteria 5214697
942 2644034944 2643221604 Bacteria 5014917
943 2644112639 2643221619 Bacteria 4158469
944 2644198358 2643221635 Bacteria 2632343
945 2644278271 2643221649 Bacteria 3867359
946 2644506654 2643221690 Bacteria 4654705
947 2644512183 2643221692 Bacteria 7282860
948 2644526436 2643221694 Bacteria 4392972
949 2644671102 2643221722 Bacteria 4247614
950 2645720259 2643221961 Bacteria 3919167
951 2645723197 2643221962 Bacteria 3874254
952 2723643766 2721755702 Bacteria 4373124
953 2738692543 2738541272 Bacteria 6848551
954 2738868682 2738541305 Bacteria 4910150
955 2739323631 2738543027 Bacteria 6409078
956 2739367074 2738543034 Bacteria 6084756
957 2753037652 2751185725 Bacteria 5740550
958 2753325520 2751185792 Bacteria 5739090
959 2758226632 2757320536 Bacteria 3629334
960 2774381776 2773857758 Bacteria 3592392
961 2774396763 2773857762 Bacteria 5971770
962 2774400827 2773857763 Bacteria 4180068
963 2808628820 2808606306 Bacteria 3608896
964 2808900336 2808606372 Bacteria 4649509
965 2809198410 2808606439 Bacteria 5952208
966 2809226203 2808606447 Bacteria 3572005
967 2812324453 2811994872 Bacteria 4121241
968 2812349614 2811994878 Bacteria 5992952
969 2812365635 2811994880 Bacteria 4147780
970 2821268946 2821268502 Bacteria 3750023
971 2833709838 2833709550 Bacteria 4008291
972 2842736012 2842733646 Bacteria 5716726
973 2842748299 2842747753 Bacteria 5578255
974 2844856047 2844852863 Bacteria 3849151
975 2852632461 2852632344 Bacteria 3463163
976 2852646033 2852643534 Bacteria 3013378
977 2856289875 2856287931 Bacteria 7223934
978 2857363086 2857357740 Bacteria 9937880
979 2857485029 2857481737 Bacteria 4761446
980 2857733987 2857733635 Bacteria 3532004
981 2857739973 2857737099 Bacteria 3104305
982 2867350631 2867346516 Bacteria 7608576
983 2870624288 2870622029 Bacteria 3643329
984 2870629348 2870628048 Bacteria 3696012
985 2883822766 2883821847 Bacteria 5121194
986 2884994977 2884994152 Bacteria 4492978
987 2891969465 2891968417 Bacteria 5821697
988 2904511479 2904509784 Bacteria 3520416
989 2904770803 2904765812 Bacteria 5369154
990 2904776280 2904770941 Bacteria 5580202
991 2906801595 2906799679 Bacteria 4031749
992 2908679805 2908678064 Bacteria 3482747
993 2908812795 2908811453 Bacteria 5478616
994 2919073043 2919069694 Bacteria 3622919
995 2919425140 2919420072 Bacteria 5390363
996 2919437751 2919432681 Bacteria 5390474
997 2919444965 2919443155 Bacteria 4072969
998 2928088324 2928084124 Bacteria 7159212
999 2935413429 2935409751 Bacteria 4179611
1000 2939606909 2939602548 Bacteria 4950493
1001 2939658771 2939657138 Bacteria 3740283
1002 2939661577 2939660829 Bacteria 3784848
1003 2966922289 2966921586 Bacteria 3092803
1004 2974296855 2974294766 Bacteria 3767688
1005 2974316544 2974315732 Bacteria 4602776
1006 2974326910 2974324384 Bacteria 3750535
1007 2977231929 2977228692 Bacteria 3450105
1008 2977267248 2977264416 Bacteria 3750737
1009 2984524718 2984523437 Bacteria 4508481
1010 2984544925 2984542743 Bacteria 3569378
1011 8002791615 8002784119 Bacteria 9788632
1012 8004028520 8004025490 Bacteria 4327753
1013 8016257053 8016254467 Bacteria 3797036
1014 8045832126 8045830549 Bacteria 4444727
1015 8046354329 8046352972 Bacteria 3613806
1016 8056039932 8056037122 Bacteria 3854319
1017 8057348155 8057345674 Bacteria 4160394
1018 Ga0157372_10009038
1019 JGI24752J21851_1001068
1020 JGI24737J22298_10005045
1021 JGI24735J21928_10004087
1022 JGI24735J21928_10032210
1023 rootL2_10009820
1024 Ga0006562J51391_1043750
1025 Ga0055532_1000205
1026 Ga0055527_1005214
1027 Ga0055535_1000157
1028 Ga0055542_1000204
1029 Ga0055529_1000221
1030 Ga0055537_1000010
1031 Ga0055534_1000015
1032 Ga0055528_1000377
1033 Ga0055528_1000708
1034 Ga0065714_10065905
1035 Ga0065714_10072827
1036 Ga0065712_10068604
1037 Ga0070658_10000516
1038 Ga0070658_10015950
1039 Ga0070658_10018666
1040 Ga0070658_10026293
1041 Ga0070683_100163186
1042 Ga0070670_100001088
1043 Ga0070670_100014980
1044 Ga0070670_100021919
1045 Ga0068869_100005134
1046 Ga0068869_100103430
1047 Ga0070680_100031049
1048 Ga0070680_100063279
1049 Ga0070680_100090848
1050 Ga0068868_100019197
1051 Ga0068868_100046942
1052 Ga0070660_100026808
1053 Ga0070689_100008547
1054 Ga0070661_100064697
1055 Ga0070661_100162028
1056 Ga0070669_100057958
1057 Ga0070675_100000033
1058 Ga0070675_100008416
1059 Ga0070675_100017195
1060 Ga0070675_100278204
1061 Ga0070671_100000672
1062 Ga0070671_100005657
1063 Ga0070671_100021970
1064 Ga0070671_100107113
1065 Ga0070674_100042409
1066 Ga0070673_100034183
1067 Ga0070673_100037037
1068 Ga0070688_100047389
1069 Ga0070659_100001097
1070 Ga0070659_100058228
1071 Ga0070667_100015794
1072 Ga0070667_100029014
1073 Ga0070667_100029310
1074 Ga0070667_100161130
1075 Ga0070703_10023137
1076 Ga0070709_10000010
1077 Ga0070709_10007107
1078 Ga0070713_100033375
1079 Ga0070705_100119536
1080 Ga0070700_100009088
1081 Ga0070708_100029818
1082 Ga0070708_100173130
1083 Ga0070663_100015444
1084 Ga0070678_100025353
1085 Ga0070678_100035121
1086 Ga0070681_10137903
1087 Ga0070685_10035102
1088 Ga0070685_10085306
1089 Ga0070706_100016592
1090 Ga0070706_100030298
1091 Ga0070707_100021650
1092 Ga0070707_100114928
1093 Ga0070707_100121660
1094 Ga0070707_100131739
1095 Ga0070698_100000046
1096 Ga0070698_100009850
1097 Ga0070698_100017523
1098 Ga0070698_100062478
1099 Ga0070699_100031885
1100 Ga0070679_100008070
1101 Ga0070697_100063959
1102 Ga0070697_100096796
1103 Ga0068853_100000588
1104 Ga0068853_100006163
1105 Ga0070695_100008107
1106 Ga0070695_100064253
1107 Ga0070696_100004783
1108 Ga0070696_100031371
1109 Ga0070693_100000347
1110 Ga0070665_100000588
1111 Ga0070665_100003830
1112 Ga0070665_100011326
1113 Ga0070665_100027861
1114 Ga0070665_100091726
1115 Ga0070704_100077145
1116 Ga0068855_100019945
1117 Ga0068855_100106798
1118 Ga0070664_100002562
1119 Ga0070664_100047942
1120 Ga0070664_100075945
1121 Ga0070664_100188443
1122 Ga0068857_100004443
1123 Ga0068857_100015477
1124 Ga0068854_100000442
1125 Ga0068856_100009168
1126 Ga0068856_100013645
1127 Ga0068856_100121046
1128 Ga0068856_100146674
1129 Ga0070702_100002009
1130 Ga0068852_100121623
1131 Ga0068852_100123805
1132 Ga0068859_100007129
1133 Ga0068859_100041923
1134 Ga0068859_100112264
1135 Ga0068859_100156040
1136 Ga0068864_100007299
1137 Ga0068864_100024375
1138 Ga0068864_100025849
1139 Ga0068861_100105783
1140 Ga0068861_100120053
1141 Ga0068851_10000001
1142 Ga0068870_10001611
1143 Ga0068863_100000274
1144 Ga0068863_100006310
1145 Ga0068863_100013760
1146 Ga0068858_100000152
1147 Ga0068858_100034281
1148 Ga0068858_100049586
1149 Ga0068858_100226884
1150 Ga0068860_100026060
1151 Ga0068860_100071240
1152 Ga0068860_100326298
1153 Ga0068862_100006939
1154 Ga0068862_100232584
1155 Ga0081455_10003097
1156 Ga0081455_10003346
1157 Ga0081455_10024605
1158 Ga0081455_10030848
1159 Ga0081455_10091126
1160 Ga0081539_10008120
1161 Ga0075365_10001903
1162 Ga0075365_10061280
1163 Ga0075363_100047657
1164 Ga0075364_10003400
1165 Ga0075364_10003412
1166 Ga0075364_10086424
1167 Ga0075364_10103302
1168 Ga0070712_100086171
1169 Ga0075369_10028701
1170 Ga0075369_10041608
1171 Ga0075366_10005131
1172 Ga0075366_10036054
1173 Ga0097621_100004564
1174 Ga0097621_100011172
1175 Ga0075370_10013670
1176 Ga0075428_100147468
1177 Ga0075431_100012785
1178 Ga0075433_10027807
1179 Ga0075433_10212353
1180 Ga0075434_100006513
1181 Ga0075434_100080274
1182 Ga0075434_100126224
1183 Ga0075429_100001639
1184 Ga0068865_100004153
1185 Ga0075436_100001698
1186 Ga0097620_100007129
1187 Ga0097620_100041922
1188 Ga0097620_100112266
1189 Ga0097620_100156038
1190 Ga0099826_10000266
1191 Ga0075435_100027739
1192 Ga0075435_100051864
1193 Ga0105240_10008219
1194 Ga0105240_10069245
1195 Ga0105240_10094668
1196 Ga0105240_10177783
1197 Ga0111539_10009078
1198 Ga0111539_10012573
1199 Ga0111539_10194952
1200 Ga0105245_10000114
1201 Ga0105245_10005792
1202 Ga0105245_10010417
1203 Ga0105245_10036774
1204 Ga0105245_10113852
1205 Ga0105247_10000971
1206 Ga0105247_10003337
1207 Ga0105247_10003762
1208 Ga0105247_10102080
1209 Ga0114129_10002108
1210 Ga0114129_10004443
1211 Ga0114129_10005325
1212 Ga0114129_10011738
1213 Ga0114129_10016634
1214 Ga0114129_10026130
1215 Ga0114129_10031786
1216 Ga0114129_10052270
1217 Ga0114129_10071639
1218 Ga0114129_10181118
1219 Ga0105243_10000498
1220 Ga0105243_10080754
1221 Ga0105241_10024590
1222 Ga0105242_10000795
1223 Ga0105242_10001394
1224 Ga0105248_10000326
1225 Ga0105248_10004206
1226 Ga0105248_10030613
1227 Ga0105248_10042041
1228 Ga0105237_10000341
1229 Ga0105237_10005381
1230 Ga0105237_10088908
1231 Ga0105237_10124178
1232 Ga0105238_10072620
1233 Ga0105249_10003663
1234 Ga0105239_10009254
1235 Ga0105239_10013363
1236 Ga0105239_10082407
1237 Ga0105239_10109131
1238 Ga0105239_10194783
1239 Ga0105239_10359847
1240 Ga0105246_10068410
1241 Ga0157373_10125544
1242 Ga0157371_10075081
1243 Ga0157370_10031815
1244 Ga0157370_10032665
1245 Ga0157370_10040437
1246 Ga0157370_10050894
1247 Ga0157369_10006194
1248 Ga0157369_10191523
1249 Ga0171462_1001
1250 Ga0157374_10015550
1251 Ga0157374_10026275
1252 Ga0157374_10281843
1253 Ga0157378_10003230
1254 Ga0157378_10179453
1255 Ga0163162_10153050
1256 Ga0163162_10389447
1257 Ga0157372_10019524
1258 Ga0157372_10040927
1259 Ga0157375_10179485
1260 Ga0157375_10378108
1261 Ga0163163_10001257
1262 Ga0163163_10005445
1263 Ga0163163_10071778
1264 Ga0163163_10076524
1265 Ga0157380_10023569
1266 Ga0157380_10064715
1267 Ga0182008_10012519
1268 Ga0157377_10010612
1269 Ga0157377_10013934
1270 Ga0157377_10041322
1271 Ga0157379_10001539
1272 Ga0157379_10007727
1273 Ga0157379_10031033
1274 Ga0157376_10024222
1275 Ga0157376_10028472
1276 Ga0157376_10164322
1277 Ga0197907_10064725
1278 Ga0206349_1803513
1279 Ga0206351_10658466
1280 Ga0154015_1452617
1281 Ga0213876_10009730
1282 Ga0228598_1000951
1283 Ga0209672_100044
1284 Ga0209672_100120
1285 Ga0209147_100039
1286 Ga0209258_100062
1287 Ga0209677_100143
1288 Ga0209148_1000075
1289 Ga0209148_1000695
1290 Ga0209565_1000025
1291 Ga0209565_1002453
1292 Ga0209455_1000067
1293 Ga0209673_1000044
1294 Ga0209673_1000077
1295 Ga0209675_1000017
1296 Ga0209025_1024717
1297 Ga0209564_1016007
1298 Ga0207656_10000002
1299 Ga0207692_10009035
1300 Ga0207642_10043156
1301 Ga0207710_10000682
1302 Ga0207710_10000764
1303 Ga0207710_10004037
1304 Ga0207710_10086269
1305 Ga0207688_10000765
1306 Ga0207688_10007019
1307 Ga0207680_10010080
1308 Ga0207680_10047824
1309 Ga0207647_10018243
1310 Ga0207647_10033585
1311 Ga0207699_10104198
1312 Ga0207643_10000049
1313 Ga0207705_10000001
1314 Ga0207705_10017953
1315 Ga0207705_10023382
1316 Ga0207684_10000152
1317 Ga0207684_10060237
1318 Ga0207684_10078287
1319 Ga0207654_10000001
1320 Ga0207654_10028648
1321 Ga0207707_10040010
1322 Ga0207707_10047329
1323 Ga0207695_10009910
1324 Ga0207695_10010927
1325 Ga0207695_10059071
1326 Ga0207671_10000002
1327 Ga0207671_10008858
1328 Ga0207671_10087625
1329 Ga0207693_10014631
1330 Ga0207660_10010527
1331 Ga0207660_10016917
1332 Ga0207660_10042981
1333 Ga0207657_10062750
1334 Ga0207657_10069533
1335 Ga0207649_10021098
1336 Ga0207652_10037094
1337 Ga0207652_10046602
1338 Ga0207646_10000085
1339 Ga0207646_10003404
1340 Ga0207646_10006296
1341 Ga0207646_10041597
1342 Ga0207646_10097144
1343 Ga0207646_10109562
1344 Ga0207646_10117967
1345 Ga0207681_10020887
1346 Ga0207694_10000395
1347 Ga0207650_10004400
1348 Ga0207650_10006096
1349 Ga0207650_10009512
1350 Ga0207659_10000449
1351 Ga0207659_10006153
1352 Ga0207659_10011241
1353 Ga0207659_10069012
1354 Ga0207659_10181389
1355 Ga0207687_10000051
1356 Ga0207687_10005749
1357 Ga0207687_10038434
1358 Ga0207687_10148354
1359 Ga0207644_10000427
1360 Ga0207690_10000753
1361 Ga0207690_10007571
1362 Ga0207706_10010636
1363 Ga0207706_10050638
1364 Ga0207706_10096319
1365 Ga0207706_10111601
1366 Ga0207686_10030649
1367 Ga0207686_10062536
1368 Ga0207709_10001062
1369 Ga0207670_10018852
1370 Ga0207670_10028353
1371 Ga0207704_10052717
1372 Ga0207691_10021623
1373 Ga0207691_10024960
1374 Ga0207711_10001610
1375 Ga0207711_10012790
1376 Ga0207711_10018085
1377 Ga0207711_10023009
1378 Ga0207711_10031750
1379 Ga0207711_10095568
1380 Ga0207689_10000355
1381 Ga0207689_10142869
1382 Ga0207679_10003632
1383 Ga0207667_10000384
1384 Ga0207667_10006444
1385 Ga0207667_10021836
1386 Ga0207667_10069498
1387 Ga0207667_10072433
1388 Ga0207668_10136815
1389 Ga0207640_10000001
1390 Ga0207640_10089369
1391 Ga0207658_10038428
1392 Ga0207677_10009186
1393 Ga0207677_10016480
1394 Ga0207703_10000181
1395 Ga0207703_10006991
1396 Ga0207703_10013734
1397 Ga0207639_10000037
1398 Ga0207639_10010005
1399 Ga0207639_10046216
1400 Ga0207678_10000705
1401 Ga0207678_10011578
1402 Ga0207678_10099639
1403 Ga0207708_10014564
1404 Ga0207708_10016932
1405 Ga0207702_10001520
1406 Ga0207702_10026927
1407 Ga0207641_10000705
1408 Ga0207641_10000772
1409 Ga0207641_10003322
1410 Ga0207641_10053652
1411 Ga0207648_10020715
1412 Ga0207676_10003132
1413 Ga0207676_10035482
1414 Ga0207676_10055520
1415 Ga0207676_10170281
1416 Ga0207674_10003240
1417 Ga0207674_10006786
1418 Ga0207674_10058473
1419 Ga0207675_100027582
1420 Ga0207675_100056126
1421 Ga0207675_100107793
1422 Ga0207675_100135250
1423 Ga0207683_10000155
1424 Ga0207683_10013847
1425 Ga0207683_10186792
1426 Ga0207698_10000297
1427 Ga0207698_10017059
1428 Ga0207698_10101266
1429 Ga0209996_1000822
1430 Ga0209282_1000459
1431 Ga0209974_10027562
1432 Ga0207428_10002981
1433 Ga0207428_10003991
1434 Ga0207428_10010552
1435 Ga0207428_10011501
1436 Ga0207428_10024979
1437 Ga0207428_10088199
1438 Ga0268266_10005631
1439 Ga0268266_10007630
1440 Ga0268266_10012018
1441 Ga0268266_10017715
1442 Ga0268265_10003019
1443 Ga0268264_10030138
1444 Ga0268264_10053645
1445 Ga0307517_10000575
1446 Ga0307517_10104467
1447 Ga0307515_10000090
1448 Ga0307515_10000626
1449 Ga0307515_10016121
1450 Ga0307515_10033949
1451 Ga0307515_10056285
1452 Ga0265338_10023116
1453 Ga0265338_10069851
1454 Ga0265338_10112247
1455 Ga0265332_10009863
1456 Ga0265325_10014158
1457 Ga0265340_10018702
1458 Ga0265339_10017534
1459 Ga0265339_10021423
1460 Ga0265327_10000064
1461 Ga0265327_10002041
1462 Ga0265327_10011063
1463 Ga0265316_10061518
1464 Ga0265316_10063605
1465 Ga0307513_10001842
1466 Ga0307513_10021458
1467 Ga0307509_10001164
1468 Ga0307509_10002081
1469 Ga0307509_10006951
1470 Ga0307509_10013455
1471 Ga0307509_10222611
1472 Ga0307408_100012808
1473 Ga0307408_100028205
1474 Ga0265313_10036958
1475 Ga0265313_10040640
1476 Ga0307508_10000095
1477 Ga0307508_10005281
1478 Ga0307514_10000861
1479 Ga0316575_10041618
1480 Ga0265314_10024057
1481 Ga0265342_10045661
1482 Ga0316576_10002490
1483 Ga0316576_10020271
1484 Ga0316578_10008648
1485 Ga0316578_10021395
1486 Ga0307516_10001905
1487 Ga0307516_10027943
1488 Ga0307405_10043395
1489 Ga0316577_10053381
1490 Ga0307413_10005754
1491 Ga0307413_10007349
1492 Ga0307413_10141204
1493 Ga0307410_10000654
1494 Ga0307410_10063821
1495 Ga0307406_10000232
1496 Ga0307406_10015705
1497 Ga0307406_10087099
1498 Ga0307412_10132894
1499 Ga0307409_100000004
1500 Ga0307409_100001551
1501 Ga0307409_100013285
1502 Ga0307409_100016948
1503 Ga0307409_100190672
1504 Ga0307416_100000126
1505 Ga0307416_100014731
1506 Ga0307416_100021776
1507 Ga0307416_100036062
1508 Ga0307414_10003245
1509 Ga0307411_10021291
1510 Ga0307415_100008261
1511 Ga0316580_10011296
1512 Ga0307507_10053796
1513 Ga0307510_10016948
1514 Ga0373949_0000187
1515 Ga0373936_0000012
1516 Ga0373953_0028810
1517 Ga0373954_0045377
1518 Ga0373955_0114643
1519 Ga0373961_0000156
1520 Ga0316574_0018158
1521 Ga0316574_0180430
1522 Ga0316574_0199888
1523 Ga0373933_0003533
1524 Ga0373933_0109165
1525 Ga0373937_0000294
1526 Ga0373937_0044492
1527 Ga0373925_0048463
1528 Ga0373925_0188655
1529 Ga0395899_0038482
1530 Ga0395900_0003801
1531 Ga0395900_0024723
1532 Ga0395900_0082960
1533 Ga0395900_0155279
1534 Ga0395900_0167521
1535 Ga0395898_0029681
1536 Ga0395898_0154321
1537 Ga0395898_0156183
1538 Ga0395905_0171069
1539 Ga0395901_0090021
1540 Ga0395901_0127413
1541 Ga0400483_044815
1542 Ga0400483_124415
1543 Ga0400483_171783
1544 Ga0400483_215983
1545 Ga0400483_259819
1546 Ga0436365_0681063
1547 Ga0451853_0605618
1548 Ga0439445_0017068
1549 Ga0439448_0018642
1550 Ga0439455_0017323
1551 Ga0439463_001486
1552 Ga0439435_0000833
1553 Ga0439459_0002988
1554 Ga0439464_0005358
1555 Ga0439440_0003945
1556 Ga0466972_0045980
1557 Ga0466972_0051184
1558 Ga0466965_0000016
1559 Ga0466965_0005209
1560 Ga0466965_0017806
1561 Ga0466965_0027522
1562 Ga0466965_0039573
1563 Ga0466966_0021447
1564 Ga0466961_0008445
1565 Ga0466961_0014589
1566 Ga0466961_0018181
1567 Ga0466961_0024175
1568 Ga0466963_0006873
1569 Ga0466963_0014074
1570 Ga0466963_0038573
1571 Ga0466963_0104945
1572 Ga0466964_0001285
1573 Ga0453684_0391720
1574 Ga0466971_0004116
1575 Ga0466971_0024226
1576 Ga0466968_0016601
1577 Ga0466970_0001281
1578 Ga0466970_0013374
1579 Ga0466957_0001021
1580 Ga0466957_0049781
1581 Ga0466960_0004151
1582 Ga0466960_0022402
1583 Ga0466959_0010490
1584 Ga0466959_0117947
1585 Ga0466958_0006072
1586 Ga0466958_0006804
1587 Ga0466958_0013868
1588 Ga0466958_0025466
1589 Ga0466967_0002225
1590 Ga0466967_0006548
1591 Ga0466967_0017392
1592 Ga0466967_0026189
1593 Ga0466967_0075770
1594 Ga0495592_0001098
1595 Ga0495592_0034359
1596 Ga0495590_0000891
1597 Ga0495629_0002724
1598 Ga0495641_0006967
1599 Ga0495651_0000815
1600 Ga0495651_0050577
1601 Ga0495651_0149273
1602 Ga0495653_0001854
1603 Ga0495653_0153839
1604 Ga0495650_0002544
1605 Ga0495650_0003922
1606 Ga0495650_0052305
1607 Ga0495580_0008034
1608 Ga0495580_0008828
1609 Ga0495580_0142444
1610 Ga0495582_0019156
1611 Ga0495594_0012306
1612 Ga0495607_0039906
1613 Ga0495583_0000911
1614 Ga0495608_0000148
1615 Ga0495608_0128812
1616 Ga0495616_0004445
1617 Ga0495618_0002523
1618 Ga0495620_0035382
1619 Ga0495628_0047108
1620 Ga0495630_0024745
1621 Ga0495631_0001172
1622 Ga0495631_0041788
1623 Ga0495644_0036890
1624 Ga0495648_0060755
1625 Ga0495652_0020705
1626 Ga0495640_0003850
1627 Ga0495587_0001638
1628 Ga0495587_0069252
1629 Ga0495645_0004410
1630 Ga0495645_0034952
1631 Ga0495645_0051258
1632 Ga0495667_0010608
1633 Ga0495668_0055772
1634 Ga0495625_0015966
1635 Ga0495657_0005335
1636 Ga0495599_0051117
1637 Ga0495599_0093702
1638 Ga0495623_0003777
1639 Ga0495623_0062771
1640 Ga0495646_0010629
1641 Ga0495647_0001867
1642 Ga0495658_0005410
1643 Ga0495658_0088533
1644 Ga0495670_0036860
1645 Ga0495671_0000976
1646 Ga0495600_0084421
1647 Ga0495581_0129267
1648 Ga0495604_0004509
1649 Ga0495604_0016895
1650 Ga0495674_0000457
1651 Ga0495674_0081050
1652 Ga0495672_0002195
1653 Ga0495672_0002615
1654 Ga0495672_0005993
1655 Ga0495676_0060970
1656 Ga0495680_0000868
1657 Ga0495683_0000677
1658 Ga0495687_017509
1659 Ga0495687_020765
1660 Ga0495687_024200
1661 Ga0495675_0052266
1662 Ga0495681_0043727
1663 Ga0495684_0007437
1664 Ga0495686_0000048
1665 Ga0495686_0021863
1666 Ga0495686_0059698
1667 Ga0495602_0003749
1668 Ga0495602_0048605
1669 Ga0495602_0056601
1670 Ga0495614_0015333
1671 Ga0496100_0107330
1672 Ga0496101_0020991
1673 Ga0496101_0080824
1674 Ga0496102_0000059
1675 Ga0496102_0003569
1676 Ga0496102_0004742
1677 Ga0496102_0005091
1678 Ga0496102_0073462
1679 Ga0496103_0000063
1680 Ga0496103_0139931
1681 Ga0496104_0057728
1682 Ga0496104_0076160
1683 Ga0496105_0006741
1684 Ga0496105_0176699
1685 Ga0496106_0019275
1686 Ga0496106_0126818
1687 Ga0496107_0045962
1688 Ga0496107_0059514
1689 Ga0496108_0026484
1690 Ga0496108_0044659
1691 Ga0496108_0057426
1692 Ga0496108_0097031
1693 Ga0496108_0108718
1694 Ga0496109_0000016
1695 Ga0496109_0004796
1696 Ga0496109_0031854
1697 Ga0496109_0038731
1698 Ga0496109_0066056
1699 Ga0496109_0188087
1700 Ga0496110_0011966
1701 Ga0496110_0017590
1702 Ga0496111_0001803
1703 Ga0496111_0020992
1704 Ga0496111_0049728
1705 Ga0496111_0178983
1706 Ga0496112_0009924
1707 Ga0496112_0029168
1708 Ga0496112_0098558
1709 Ga0496113_0041450
1710 Ga0496113_0219316
1711 Ga0496114_0032778
1712 Ga0496114_0032896
1713 Ga0496114_0040981
1714 Ga0496114_0060374
1715 Ga0496114_0092169
1716 Ga0496115_0038565
1717 Ga0496116_0000371
1718 Ga0496117_0000063
1719 Ga0496117_0003104
1720 Ga0496117_0014490
1721 Ga0496117_0072118
1722 Ga0496118_0005850
1723 Ga0496118_0017172
1724 Ga0496118_0031324
1725 Ga0496118_0066813
1726 Ga0496118_0108852
1727 Ga0496119_0002091
1728 Ga0496119_0002848
1729 Ga0496119_0009813
1730 Ga0496119_0015267
1731 Ga0496119_0017098
1732 Ga0496119_0021931
1733 Ga0496119_0041167
1734 Ga0496120_0000882
1735 Ga0496120_0001936
1736 Ga0496120_0023873
1737 Ga0496120_0051027
1738 Ga0496120_0054044
1739 Ga0496120_0065865
1740 Ga0496121_0000015
1741 Ga0496121_0003574
1742 Ga0496121_0127698
1743 Ga0496122_0001461
1744 Ga0496122_0002058
1745 Ga0496122_0005683
1746 Ga0496122_0007542
1747 Ga0496122_0036490
1748 Ga0496122_0052756
1749 Ga0496122_0083894
1750 Ga0496123_0000179
1751 Ga0496123_0001148
1752 Ga0496123_0002798
1753 Ga0496123_0018712
1754 Ga0496124_0000389
1755 Ga0496124_0001764
1756 Ga0496124_0043977
1757 Ga0496124_0057024
1758 Ga0496124_0097086
1759 Ga0496125_0000350
1760 Ga0496125_0036635
1761 Ga0496126_0000075
1762 Ga0496126_0002220
1763 Ga0496126_0013693
1764 Ga0496126_0014189
1765 Ga0496126_0020829
1766 Ga0496126_0091545
1767 Ga0496126_0110632
1768 Ga0501292_005246
1769 Ga0501031_0032897
1770 Ga0501031_0068127
1771 Ga0501031_0114761
1772 Ga0501032_0027900
1773 Ga0501032_0040062
1774 Ga0501033_0028137
1775 Ga0501034_0002740
1776 Ga0501034_0005401
1777 Ga0501034_0017217
1778 Ga0501034_0019391
1779 Ga0501036_0022611
1780 Ga0501036_0033494
1781 Ga0501036_0201626
1782 Ga0501037_0010590
1783 Ga0501037_0067427
1784 Ga0501038_0012842
1785 Ga0501038_0139850
1786 Ga0501039_0030942
1787 Ga0501039_0185280
1788 Ga0501040_0003183
1789 Ga0501040_0009230
1790 Ga0501041_0004728
1791 Ga0501041_0025461
1792 Ga0501042_0000537
1793 Ga0501042_0000961
1794 Ga0501042_0002550
1795 Ga0501042_0056500
1796 Ga0501042_0112772
1797 Ga0501043_0001112
1798 Ga0501043_0004169
1799 Ga0501046_0008521
1800 Ga0501046_0038238
1801 Ga0501047_0111649
1802 Ga0501048_0005340
1803 Ga0501068_0011142
1804 Ga0501068_0013111
1805 Ga0501069_0016415
1806 Ga0501069_0024119
1807 Ga0501069_0117818
1808 Ga0501070_0000591
1809 Ga0501070_0001615
1810 Ga0501070_0024175
1811 Ga0501070_0033286
1812 Ga0501070_0087988
1813 Ga0501070_0135741
1814 Ga0501070_0139571
1815 Ga0501071_0022236
1816 Ga0501072_0002090
1817 Ga0501072_0241937
1818 Ga0501073_0000028
1819 Ga0501073_0000503
1820 Ga0501073_0009405
1821 Ga0501073_0036644
1822 Ga0501074_0022531
1823 Ga0501074_0063828
1824 Ga0501074_0178776
1825 Ga0501075_0000758
1826 Ga0501075_0021683
1827 Ga0501076_0001402
1828 Ga0501076_0067166
1829 Ga0501077_0032163
1830 Ga0501077_0164389
1831 Ga0501227_002689
1832 Ga0501079_0001374
1833 Ga0501079_0007080
1834 Ga0501080_0001558
1835 Ga0501080_0005011
1836 Ga0501081_0001441
1837 Ga0501081_0008218
1838 Ga0501083_0000028
1839 Ga0501083_0097660
1840 Ga0501083_0135155
1841 Ga0501035_0022879
1842 Ga0501035_0090360
1843 Ga0501035_0179159
1844 Ga0501044_0051779
1845 Ga0501044_0100878
1846 Ga0501045_0002501
1847 Ga0501045_0007779
1848 nmdc:mga03n38_24527_c1
1849 nmdc:mga00v17_22200_c1
1850 nmdc:mga00v17_454_c1
1851 nmdc:mga0yw44_16324_c1
1852 nmdc:mga0k408_6897_c1
1853 nmdc:mga05p37_1039_c1
1854 nmdc:mga05p37_1366_c1
1855 nmdc:mga05p37_1873_c2
1856 nmdc:mga05p37_2544_c2
1857 nmdc:mga05p37_2674_c1
1858 nmdc:mga05p37_27219_c1
1859 nmdc:mga05p37_33965_c1
1860 nmdc:mga05p37_37964_c1
1861 nmdc:mga09592_46707_c1
1862 nmdc:mga06r32_144047_c1
1863 nmdc:mga08y16_112543_c1
1864 nmdc:mga08y16_129531_c1
1865 nmdc:mga08y16_14406_c1
1866 nmdc:mga08y16_22724_c1
1867 nmdc:mga08y16_42598_c1
1868 nmdc:mga08y16_47684_c1
1869 nmdc:mga08y16_61285_c1
1870 nmdc:mga0n895_104833_c1
1871 nmdc:mga0n895_338266_c1
1872 nmdc:mga0n895_7649_c1
1873 nmdc:mga0rr50_7553_c1
1874 nmdc:mga0a205_135132_c1
1875 nmdc:mga0a205_15514_c1
1876 nmdc:mga0a205_48177_c1
1877 nmdc:mga0a205_6370_c1
1878 nmdc:mga0sz30_13563_c1
1879 nmdc:mga0sz30_6527_c1
1880 Ga0495601_0002029
1881 Ga0495612_0009945
1882 Ga0500610_0000935
1883 Ga0495595_0000521
1884 Ga0495619_0000089
1885 Ga0495619_0025913
1886 Ga0495619_0032884
1887 Ga0500643_000072
1888 Ga0500644_0014127
1889 Ga0500651_0000170
1890 Ga0500651_0000254
1891 Ga0500650_0003218
1892 Ga0500555_004172
1893 Ga0500556_0000001
1894 Ga0500556_0000064
1895 Ga0500562_002639
1896 Ga0500571_000075
1897 Ga0500572_001277
1898 Ga0500593_000096
1899 Ga0500593_011783
1900 Ga0500594_0022318
1901 Ga0500607_000146
1902 Ga0500608_012477
1903 Ga0500614_000030
1904 Ga0500642_0034783
1905 Ga0500655_001787
1906 Ga0500655_004546
1907 Ga0500658_0000134
1908 Ga0500658_0000142
1909 Ga0500559_0000043
1910 Ga0500559_0001053
1911 Ga0500559_0001058
1912 Ga0500559_0001135
1913 Ga0500559_0003767
1914 Ga0500568_0000003
1915 Ga0500568_0000071
1916 Ga0500568_0000714
1917 Ga0500568_0002404
1918 Ga0500568_0006419
1919 Ga0500568_0014148
1920 Ga0500568_0015864
1921 Ga0500573_0000001
1922 Ga0500573_0017028
1923 Ga0500573_0029238
1924 Ga0500573_0067896
1925 Ga0500573_0082135
1926 Ga0500590_001605
1927 Ga0500590_002157
1928 Ga0500603_009644
1929 Ga0500616_0000058
1930 Ga0500616_0000864
1931 Ga0500616_0000885
1932 Ga0500616_0005888
1933 Ga0500619_007827
1934 Ga0500620_000035
1935 Ga0500634_0024703
1936 Ga0500634_0036654
1937 Ga0500638_003114
1938 Ga0500636_0063523
1939 Ga0501084_0001798
1940 Ga0501084_0002749
1941 Ga0501082_0001924
1942 Ga0466962_0000651
1943 Ga0466962_0012651
1944 Ga0466962_0056023
1945 Ga0530510_0026832
1946 2501069416
1947 2501408782
1948 2511098494
1949 2511106466
1950 2517762817
1951 2537898681
1952 2552112493
1953 2587861694
1954 2588107917
1955 2643769178
1956 2643847736
1957 2643890968
1958 2643960024
1959 2644034944
1960 2644112639
1961 2644198358
1962 2644278271
1963 2644506654
1964 2644512183
1965 2644526436
1966 2644671102
1967 2645720259
1968 2645723197
1969 2723643766
1970 2738692543
1971 2738868682
1972 2739323631
1973 2739367074
1974 2753037652
1975 2753325520
1976 2758226632
1977 2774381776
1978 2774396763
1979 2774400827
1980 2808628820
1981 2808900336
1982 2809198410
1983 2809226203
1984 2812324453
1985 2812349614
1986 2812365635
1987 2821268946
1988 2833709838
1989 2842736012
1990 2842748299
1991 2844856047
1992 2852632461
1993 2852646033
1994 2856289875
1995 2857363086
1996 2857485029
1997 2857733987
1998 2857739973
1999 2867350631
2000 2870624288
2001 2870629348
2002 2883822766
2003 2884994977
2004 2891969465
2005 2904511479
2006 2904770803
2007 2904776280
2008 2906801595
2009 2908679805
2010 2908812795
2011 2919073043
2012 2919425140
2013 2919437751
2014 2919444965
2015 2928088324
2016 2935413429
2017 2939606909
2018 2939658771
2019 2939661577
2020 2966922289
2021 2974296855
2022 2974316544
2023 2974326910
2024 2977231929
2025 2977267248
2026 2984524718
2027 2984544925
2028 8002791615
2029 8004028520
2030 8016257053
2031 8045832126
2032 8046354329
2033 8056039932
2034 8057348155

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

111

501

0.82

PF07969

Amidohydro_3

Amidohydrolase family

152

501

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sfw-assembly1.cif.gz_A crystal structure of dihydropyrimidinase from brevibacillus agri nchu1002 0.9818 1 461
1k1d-assembly1.cif.gz_A crystal structure of d-hydantoinase 0.9816 1 459
4kqn-assembly1.cif.gz_A 2.8 angstrom resolution crystal structure of d-hydantoinase from bacillus sp. ar9 in c2221 space group 0.9816 3 461
1yny-assembly1.cif.gz_A molecular structure of d-hydantoinase from a bacillus sp. ar9: evidence for mercury inhibition 0.9807 3 461
1yny-assembly2.cif.gz_B molecular structure of d-hydantoinase from a bacillus sp. ar9: evidence for mercury inhibition 0.9801 3 460
ID Description Score Start End Superfamily
4tqtA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9774 1 442 3.20.20.140
1nfgA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9761 54 427 3.20.20.140
4lcrA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9738 2 443 3.20.20.140
1nfgA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9734 54 427 3.20.20.140
af_Q14194_68_440_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9726 54 426 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A6L6CTE9-F1-model_v4 Dihydropyrimidinase (EC 3.5.2.2) 0.9953 57 465 GO:0004157
GO:0005829
AF-A0A656TWC4-F1-model_v4 deleted 0.993 60 464
AF-A0A2V9FJX4-F1-model_v4 Dihydropyrimidinase 0.9927 129 240 GO:0005829
GO:0016812
AF-A0A1I2DZI0-F1-model_v4 Dihydropyrimidinase 0.9921 1 465 GO:0005829
GO:0016812
AF-A0A3D9M8P6-F1-model_v4 deleted 0.9917 69 394

Map