F488292

General Info

Members Datasets Scaffolds Average Seq Length
1017 402 2034 262

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0502355|Ga0436365_0502355_1174_2151
Length 310
Sequence MIDSSRVPQVFAQAQPAAALPGLPDGAKVGFYEKGNVRIRYAEIGSGFPLLATPGGGLNSCMAVWARAVINIPQEFRGDFRVITMDQRNATGGESTGPVAVDDPWGAFADDQLGVMDHLGIDKFFFFGNCIGGPFAMKLMERAPQRVTAAILSQPVGHNPAKPDYMYDAGKTVWAKELRERRSDVSMETIEQYLHNLYRVQPDFVYSVSRDFAKACERPMLVLPDDVDAHPLVTSIDVASLCPNAEITVFPWKDPPELKARTINRARTFLKRYQAVSEAAGDHRHCCCRQEHAPDQCRGAEACWRAYLAT

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
210 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
211 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
212 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
213 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
214 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
220 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
239 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
240 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
247 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
248 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
249 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
250 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
253 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
254 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
266 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
267 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
268 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
269 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
290 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
324 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
325 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
346 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
370 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
377 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
378 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
390 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
391 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
392 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
393 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
394 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
402 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.13
Metatranscriptomes 1.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.56
Nodule 0
Rhizoplane 6.29
Rhizosphere 87.71
Stem 0
Stem Tuber 0
Unclassified 3.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0502355 3300039437 Bacteria 2696
2 JGI25153J46596_10000660 3300003215 Bacteria 21135
3 JGI25153J46596_10000980 3300003215 Bacteria 17315
4 JGI25404J52841_10004319 3300003659 Bacteria 2872
5 JGI25405J52794_10000579 3300003911 Bacteria 5391
6 JGI25405J52794_10000642 3300003911 Bacteria 5239
7 Ga0058860_10061687 3300004801 Bacteria 901
8 Ga0058860_12023695 3300004801 Bacteria 847
9 Ga0058860_12080127 3300004801 Bacteria 1774
10 Ga0065712_10116098 3300005290 Bacteria 1741
11 Ga0065707_10052887 3300005295 Bacteria 941
12 Ga0070683_100076228 3300005329 Bacteria 3134
13 Ga0070683_100188352 3300005329 Bacteria 1959
14 Ga0070683_100304232 3300005329 Unclassified 1517
15 Ga0068869_100149941 3300005334 Bacteria 1808
16 Ga0070680_100012393 3300005336 Bacteria 6622
17 Ga0070680_100281796 3300005336 Bacteria 1408
18 Ga0070682_100130458 3300005337 Bacteria 1700
19 Ga0070689_100001712 3300005340 Bacteria 14020
20 Ga0070691_10095973 3300005341 Bacteria 1468
21 Ga0070687_100012756 3300005343 Bacteria 3721
22 Ga0070661_100049691 3300005344 Bacteria 3070
23 Ga0070668_100264719 3300005347 Bacteria 1431
24 Ga0070668_100592314 3300005347 Bacteria 969
25 Ga0070669_100024245 3300005353 Bacteria 4349
26 Ga0070669_100052634 3300005353 Bacteria 2979
27 Ga0070675_100354128 3300005354 Bacteria 1302
28 Ga0070671_100198355 3300005355 Bacteria 1702
29 Ga0070671_100227976 3300005355 Bacteria 1581
30 Ga0070671_100421928 3300005355 Bacteria 1143
31 Ga0070674_100069463 3300005356 Bacteria 2485
32 Ga0070674_100092455 3300005356 Bacteria 2187
33 Ga0070674_100184044 3300005356 Bacteria 1602
34 Ga0070688_100022506 3300005365 Bacteria 3695
35 Ga0070659_100205046 3300005366 Unclassified 1624
36 Ga0070703_10062311 3300005406 Bacteria 1224
37 Ga0070709_10027715 3300005434 Bacteria 3371
38 Ga0070709_10028128 3300005434 Bacteria 3350
39 Ga0070709_10273446 3300005434 Bacteria 1225
40 Ga0070709_10354792 3300005434 Bacteria 1084
41 Ga0070709_10406250 3300005434 Bacteria 1018
42 Ga0070714_100269103 3300005435 Bacteria 1580
43 Ga0070714_100369054 3300005435 Bacteria 1351
44 Ga0070713_100001818 3300005436 Bacteria 13769
45 Ga0070713_100245791 3300005436 Bacteria 1630
46 Ga0070713_100447612 3300005436 Bacteria 1212
47 Ga0070710_10005916 3300005437 Bacteria 5844
48 Ga0070710_10071614 3300005437 Unclassified 1999
49 Ga0070710_10151469 3300005437 Bacteria 1431
50 Ga0070710_10224710 3300005437 Bacteria 1196
51 Ga0070701_10123940 3300005438 Bacteria 1460
52 Ga0070711_100012791 3300005439 Bacteria 5255
53 Ga0070711_100197101 3300005439 Bacteria 1551
54 Ga0070711_100285425 3300005439 Bacteria 1307
55 Ga0070711_100374934 3300005439 Bacteria 1149
56 Ga0070705_100228448 3300005440 Bacteria 1293
57 Ga0070705_100238846 3300005440 Bacteria 1269
58 Ga0070694_100375942 3300005444 Bacteria 1107
59 Ga0070694_100423221 3300005444 Bacteria 1047
60 Ga0070708_100023270 3300005445 Bacteria 5266
61 Ga0070708_100037899 3300005445 Bacteria 4208
62 Ga0070708_100041980 3300005445 Bacteria 4012
63 Ga0070708_100079289 3300005445 Bacteria 2970
64 Ga0070708_100162362 3300005445 Bacteria 2082
65 Ga0070663_100003746 3300005455 Bacteria 8820
66 Ga0070663_100131359 3300005455 Bacteria 1902
67 Ga0070663_100171937 3300005455 Bacteria 1675
68 Ga0070678_100026011 3300005456 Bacteria 3950
69 Ga0070678_100065791 3300005456 Bacteria 2693
70 Ga0070681_10014225 3300005458 Bacteria 7919
71 Ga0070681_10015634 3300005458 Bacteria 7558
72 Ga0070681_10067759 3300005458 Bacteria 3537
73 Ga0070681_10085961 3300005458 Bacteria 3098
74 Ga0070685_10156714 3300005466 Bacteria 1448
75 Ga0070706_100041310 3300005467 Bacteria 4258
76 Ga0070706_100082271 3300005467 Bacteria 2982
77 Ga0070706_100150633 3300005467 Bacteria 2171
78 Ga0070706_100291570 3300005467 Bacteria 1522
79 Ga0070706_100456100 3300005467 Bacteria 1189
80 Ga0070706_100562057 3300005467 Bacteria 1061
81 Ga0070707_100016720 3300005468 Bacteria 6886
82 Ga0070707_100091058 3300005468 Bacteria 2952
83 Ga0070707_100092187 3300005468 Bacteria 2933
84 Ga0070707_100146059 3300005468 Bacteria 2302
85 Ga0070698_100042952 3300005471 Bacteria 4636
86 Ga0070698_100160045 3300005471 Bacteria 2196
87 Ga0070698_100176052 3300005471 Bacteria 2079
88 Ga0070698_100209625 3300005471 Bacteria 1884
89 Ga0070699_100152525 3300005518 Bacteria 2044
90 Ga0070699_100245674 3300005518 Bacteria 1598
91 Ga0070679_100101735 3300005530 Bacteria 2860
92 Ga0070679_100446100 3300005530 Bacteria 1239
93 Ga0070684_100079407 3300005535 Bacteria 2901
94 Ga0070684_100151539 3300005535 Bacteria 2101
95 Ga0070684_100174935 3300005535 Bacteria 1951
96 Ga0068853_100009933 3300005539 Bacteria 7684
97 Ga0068853_100814216 3300005539 Bacteria 895
98 Ga0070686_100259615 3300005544 Bacteria 1273
99 Ga0070695_100032790 3300005545 Bacteria 3247
100 Ga0070695_100364046 3300005545 Bacteria 1087
101 Ga0070693_100046413 3300005547 Bacteria 2467
102 Ga0070693_100213790 3300005547 Bacteria 1260
103 Ga0070665_100023942 3300005548 Bacteria 6149
104 Ga0070665_100049009 3300005548 Bacteria 4239
105 Ga0070665_100074587 3300005548 Bacteria 3398
106 Ga0070704_100411765 3300005549 Bacteria 1156
107 Ga0068855_100124391 3300005563 Bacteria 2950
108 Ga0068855_100148869 3300005563 Bacteria 2662
109 Ga0068855_100345913 3300005563 Bacteria 1639
110 Ga0068855_100735858 3300005563 Bacteria 1053
111 Ga0070664_100271514 3300005564 Unclassified 1527
112 Ga0070664_100766953 3300005564 Bacteria 901
113 Ga0068857_100021961 3300005577 Bacteria 5617
114 Ga0068857_100165748 3300005577 Bacteria 2007
115 Ga0068854_100167695 3300005578 Bacteria 1706
116 Ga0068856_100019721 3300005614 Bacteria 6544
117 Ga0068856_100066265 3300005614 Unclassified 3569
118 Ga0068856_100222275 3300005614 Bacteria 1904
119 Ga0068856_100488644 3300005614 Bacteria 1252
120 Ga0068852_100240551 3300005616 Bacteria 1729
121 Ga0068852_100406863 3300005616 Bacteria 1340
122 Ga0068852_100426777 3300005616 Bacteria 1308
123 Ga0068859_100046003 3300005617 Bacteria 4384
124 Ga0068859_100279634 3300005617 Bacteria 1761
125 Ga0068859_100548623 3300005617 Bacteria 1250
126 Ga0068864_100038231 3300005618 Bacteria 4097
127 Ga0068864_100196892 3300005618 Bacteria 1849
128 Ga0068866_10108439 3300005718 Bacteria 1544
129 Ga0068861_100345905 3300005719 Bacteria 1303
130 Ga0068863_100077315 3300005841 Bacteria 3150
131 Ga0068858_100250949 3300005842 Bacteria 1681
132 Ga0068860_100019692 3300005843 Bacteria 6542
133 Ga0068862_100182770 3300005844 Bacteria 1883
134 Ga0081455_10000418 3300005937 Bacteria 55929
135 Ga0081455_10001315 3300005937 Bacteria 30785
136 Ga0081455_10002053 3300005937 Bacteria 24074
137 Ga0081455_10006568 3300005937 Bacteria 12443
138 Ga0081455_10041502 3300005937 Bacteria 4045
139 Ga0081455_10096981 3300005937 Bacteria 2376
140 Ga0081455_10200913 3300005937 Unclassified 1493
141 Ga0081538_10146066 3300005981 Bacteria 1081
142 Ga0081540_1003181 3300005983 Bacteria 13089
143 Ga0081540_1005915 3300005983 Bacteria 9026
144 Ga0081540_1009489 3300005983 Bacteria 6702
145 Ga0081540_1023383 3300005983 Bacteria 3616
146 Ga0081540_1051182 3300005983 Bacteria 2044
147 Ga0081540_1072176 3300005983 Bacteria 1591
148 Ga0081539_10049231 3300005985 Bacteria 2393
149 Ga0081539_10174064 3300005985 Bacteria 1015
150 Ga0070717_10000508 3300006028 Bacteria 24700
151 Ga0070717_10159065 3300006028 Bacteria 1959
152 Ga0070717_10285474 3300006028 Bacteria 1465
153 Ga0070717_10403909 3300006028 Bacteria 1227
154 Ga0070717_10616178 3300006028 Bacteria 985
155 Ga0075365_10007763 3300006038 Bacteria 6041
156 Ga0075365_10029750 3300006038 Bacteria 3494
157 Ga0075365_10232165 3300006038 Bacteria 1295
158 Ga0075368_10018756 3300006042 Bacteria 2604
159 Ga0075363_100002080 3300006048 Bacteria 8010
160 Ga0075364_10039545 3300006051 Bacteria 3058
161 Ga0070715_10072632 3300006163 Unclassified 1541
162 Ga0070716_100013860 3300006173 Bacteria 4118
163 Ga0070716_100066344 3300006173 Bacteria 2105
164 Ga0070716_100343610 3300006173 Bacteria 1054
165 Ga0070716_100543921 3300006173 Unclassified 864
166 Ga0070712_100004011 3300006175 Bacteria 9046
167 Ga0070712_100017121 3300006175 Bacteria 4687
168 Ga0070712_100131478 3300006175 Bacteria 1897
169 Ga0070712_100266166 3300006175 Unclassified 1375
170 Ga0070712_100380414 3300006175 Bacteria 1162
171 Ga0070712_100441496 3300006175 Bacteria 1082
172 Ga0075362_10051383 3300006177 Bacteria 1845
173 Ga0075367_10045916 3300006178 Bacteria 2565
174 Ga0075427_10005724 3300006194 Bacteria 1779
175 Ga0075366_10080388 3300006195 Bacteria 1947
176 Ga0075370_10065259 3300006353 Bacteria 2076
177 Ga0068871_100239522 3300006358 Bacteria 1577
178 Ga0075428_100010863 3300006844 Bacteria 10122
179 Ga0075428_100032851 3300006844 Bacteria 5730
180 Ga0075428_100066107 3300006844 Unclassified 3960
181 Ga0075428_100075095 3300006844 Bacteria 3692
182 Ga0075428_100150368 3300006844 Bacteria 2529
183 Ga0075428_100184999 3300006844 Bacteria 2254
184 Ga0075428_100207317 3300006844 Bacteria 2118
185 Ga0075428_100251285 3300006844 Bacteria 1906
186 Ga0075428_100267326 3300006844 Bacteria 1840
187 Ga0075428_100333364 3300006844 Bacteria 1630
188 Ga0075428_100625157 3300006844 Bacteria 1149
189 Ga0075428_100644001 3300006844 Bacteria 1130
190 Ga0075430_100002737 3300006846 Bacteria 14720
191 Ga0075430_100004372 3300006846 Bacteria 11930
192 Ga0075430_100029545 3300006846 Bacteria 4652
193 Ga0075430_100035787 3300006846 Bacteria 4211
194 Ga0075430_100357510 3300006846 Bacteria 1206
195 Ga0075431_100010541 3300006847 Bacteria 9291
196 Ga0075431_100038421 3300006847 Bacteria 4929
197 Ga0075431_100059560 3300006847 Bacteria 3940
198 Ga0075431_100086499 3300006847 Bacteria 3234
199 Ga0075431_100093943 3300006847 Bacteria 3095
200 Ga0075431_100103518 3300006847 Bacteria 2938
201 Ga0075431_100180513 3300006847 Bacteria 2166
202 Ga0075431_100183018 3300006847 Bacteria 2150
203 Ga0075431_100506636 3300006847 Bacteria 1198
204 Ga0075433_10021818 3300006852 Bacteria 5372
205 Ga0075433_10095949 3300006852 Bacteria 2624
206 Ga0075433_10233632 3300006852 Bacteria 1632
207 Ga0075433_10239031 3300006852 Bacteria 1612
208 Ga0075433_10243633 3300006852 Unclassified 1596
209 Ga0075433_10394652 3300006852 Bacteria 1221
210 Ga0075433_10621321 3300006852 Bacteria 948
211 Ga0075434_100003432 3300006871 Bacteria 14172
212 Ga0075434_100031726 3300006871 Bacteria 5209
213 Ga0075434_100079291 3300006871 Bacteria 3280
214 Ga0075434_100142922 3300006871 Bacteria 2413
215 Ga0075434_100179083 3300006871 Bacteria 2139
216 Ga0075434_100287264 3300006871 Bacteria 1665
217 Ga0075434_100305621 3300006871 Bacteria 1611
218 Ga0075434_100376443 3300006871 Bacteria 1441
219 Ga0075429_100017090 3300006880 Bacteria 6273
220 Ga0075429_100017929 3300006880 Bacteria 6121
221 Ga0075429_100022663 3300006880 Bacteria 5444
222 Ga0075429_100059942 3300006880 Unclassified 3316
223 Ga0075429_100075368 3300006880 Bacteria 2939
224 Ga0075429_100274146 3300006880 Bacteria 1477
225 Ga0075429_100292310 3300006880 Unclassified 1427
226 Ga0075429_100407619 3300006880 Bacteria 1191
227 Ga0068865_100109719 3300006881 Bacteria 2034
228 Ga0068865_100299010 3300006881 Bacteria 1287
229 Ga0075436_100245266 3300006914 Bacteria 1275
230 Ga0075436_100273145 3300006914 Bacteria 1207
231 Ga0097620_100046004 3300006931 Bacteria 4384
232 Ga0097620_100279624 3300006931 Bacteria 1761
233 Ga0097620_100548622 3300006931 Bacteria 1250
234 Ga0075435_100475383 3300007076 Bacteria 1079
235 Ga0099794_10004782 3300007265 Bacteria 5372
236 Ga0099795_10016588 3300007788 Bacteria 2332
237 Ga0099795_10132238 3300007788 Bacteria 1008
238 Ga0105240_10077293 3300009093 Bacteria 4101
239 Ga0105240_10437551 3300009093 Bacteria 1466
240 Ga0111539_10032319 3300009094 Bacteria 6355
241 Ga0111539_10073530 3300009094 Bacteria 4030
242 Ga0111539_10252629 3300009094 Bacteria 2053
243 Ga0111539_10330986 3300009094 Bacteria 1773
244 Ga0111539_10344374 3300009094 Bacteria 1735
245 Ga0111539_10427569 3300009094 Bacteria 1542
246 Ga0111539_10677395 3300009094 Bacteria 1201
247 Ga0111539_10736348 3300009094 Bacteria 1148
248 Ga0105245_10279932 3300009098 Bacteria 1630
249 Ga0105247_10253644 3300009101 Bacteria 1203
250 Ga0114129_10006147 3300009147 Bacteria 17031
251 Ga0114129_10071358 3300009147 Bacteria 4842
252 Ga0114129_10075599 3300009147 Bacteria 4690
253 Ga0114129_10111234 3300009147 Unclassified 3780
254 Ga0114129_10115567 3300009147 Bacteria 3698
255 Ga0114129_10209081 3300009147 Bacteria 2639
256 Ga0114129_10405755 3300009147 Bacteria 1795
257 Ga0114129_10450159 3300009147 Bacteria 1689
258 Ga0114129_10597890 3300009147 Bacteria 1430
259 Ga0114129_11528689 3300009147 Bacteria 819
260 Ga0105243_10365124 3300009148 Bacteria 1330
261 Ga0105242_10062722 3300009176 Bacteria 3059
262 Ga0105242_10239275 3300009176 Bacteria 1631
263 Ga0105248_10042634 3300009177 Bacteria 5089
264 Ga0105248_10045067 3300009177 Bacteria 4945
265 Ga0105248_10377773 3300009177 Bacteria 1595
266 Ga0105248_10526754 3300009177 Bacteria 1333
267 Ga0105237_10129363 3300009545 Bacteria 2519
268 Ga0105237_10274718 3300009545 Bacteria 1688
269 Ga0105237_10633181 3300009545 Bacteria 1076
270 Ga0105238_10070875 3300009551 Bacteria 3484
271 Ga0105238_10190186 3300009551 Bacteria 2029
272 Ga0105238_10195703 3300009551 Bacteria 1997
273 Ga0105238_10362786 3300009551 Bacteria 1438
274 Ga0105249_10182709 3300009553 Bacteria 2041
275 Ga0105249_10294679 3300009553 Bacteria 1625
276 Ga0105249_10876774 3300009553 Bacteria 964
277 Ga0099796_10001978 3300010159 Bacteria 4357
278 Ga0099796_10032242 3300010159 Bacteria 1715
279 Ga0099796_10052250 3300010159 Bacteria 1422
280 Ga0105239_10256496 3300010375 Bacteria 1965
281 Ga0105246_10022952 3300011119 Bacteria 4033
282 Ga0105246_10091653 3300011119 Bacteria 2192
283 Ga0157373_10157606 3300013100 Bacteria 1597
284 Ga0157370_10149127 3300013104 Bacteria 2177
285 Ga0157370_10560401 3300013104 Bacteria 1047
286 Ga0157369_10859717 3300013105 Bacteria 931
287 Ga0157374_10023559 3300013296 Bacteria 5509
288 Ga0157374_10171265 3300013296 Bacteria 2118
289 Ga0157378_10001940 3300013297 Bacteria 18554
290 Ga0157378_10092125 3300013297 Bacteria 2757
291 Ga0157378_10177848 3300013297 Bacteria 2000
292 Ga0163162_10053689 3300013306 Bacteria 4051
293 Ga0163162_10213580 3300013306 Bacteria 2059
294 Ga0163162_10250062 3300013306 Bacteria 1905
295 Ga0163162_10330755 3300013306 Bacteria 1656
296 Ga0157372_10110431 3300013307 Bacteria 3150
297 Ga0157375_10051102 3300013308 Bacteria 4058
298 Ga0157375_10307361 3300013308 Bacteria 1750
299 Ga0163163_10005361 3300014325 Bacteria 11079
300 Ga0163163_10042646 3300014325 Bacteria 4445
301 Ga0163163_10053277 3300014325 Bacteria 3993
302 Ga0163163_10063883 3300014325 Bacteria 3652
303 Ga0163163_10407568 3300014325 Bacteria 1418
304 Ga0163163_10474655 3300014325 Bacteria 1312
305 Ga0182008_10076783 3300014497 Bacteria 1643
306 Ga0182008_10154516 3300014497 Bacteria 1152
307 Ga0157379_10006693 3300014968 Bacteria 9953
308 Ga0157379_10011648 3300014968 Bacteria 7678
309 Ga0157379_10209695 3300014968 Bacteria 1763
310 Ga0157379_10220305 3300014968 Bacteria 1719
311 Ga0157379_10252556 3300014968 Bacteria 1601
312 Ga0157376_10061010 3300014969 Bacteria 3169
313 Ga0157376_10342880 3300014969 Bacteria 1427
314 Ga0163161_10543954 3300017792 Bacteria 951
315 Ga0206352_10676952 3300020078 Bacteria 2326
316 Ga0206350_10268593 3300020080 Bacteria 1718
317 Ga0206353_10378285 3300020082 Bacteria 2845
318 Ga0213876_10034704 3300021384 Bacteria 2661
319 Ga0213875_10000009 3300021388 Bacteria 451129
320 Ga0213875_10000498 3300021388 Bacteria 32954
321 Ga0213875_10002698 3300021388 Bacteria 10477
322 Ga0213875_10033177 3300021388 Bacteria 2438
323 Ga0224712_10004135 3300022467 Bacteria 3880
324 Ga0207673_1018854 3300025290 Bacteria 925
325 Ga0209758_1000523 3300025297 Bacteria 61460
326 Ga0209758_1000772 3300025297 Bacteria 45993
327 Ga0207426_1060373 3300025302 Bacteria 1093
328 Ga0207656_10043114 3300025321 Bacteria 1923
329 Ga0207653_10039405 3300025885 Bacteria 1547
330 Ga0207682_10099526 3300025893 Bacteria 1270
331 Ga0207692_10133398 3300025898 Bacteria 1405
332 Ga0207692_10147891 3300025898 Bacteria 1343
333 Ga0207692_10178917 3300025898 Bacteria 1234
334 Ga0207692_10183182 3300025898 Bacteria 1221
335 Ga0207692_10223781 3300025898 Bacteria 1117
336 Ga0207710_10167639 3300025900 Bacteria 1073
337 Ga0207688_10159357 3300025901 Bacteria 1337
338 Ga0207685_10008557 3300025905 Bacteria 2922
339 Ga0207685_10065834 3300025905 Bacteria 1452
340 Ga0207699_10032557 3300025906 Unclassified 2938
341 Ga0207699_10047550 3300025906 Bacteria 2516
342 Ga0207699_10205470 3300025906 Bacteria 1337
343 Ga0207699_10345308 3300025906 Bacteria 1049
344 Ga0207643_10236080 3300025908 Bacteria 1123
345 Ga0207684_10038926 3300025910 Bacteria 4035
346 Ga0207684_10040262 3300025910 Bacteria 3962
347 Ga0207684_10040850 3300025910 Bacteria 3932
348 Ga0207684_10076272 3300025910 Bacteria 2849
349 Ga0207684_10142507 3300025910 Bacteria 2061
350 Ga0207654_10237492 3300025911 Bacteria 1216
351 Ga0207707_10000826 3300025912 Bacteria 30384
352 Ga0207707_10055373 3300025912 Bacteria 3450
353 Ga0207707_10191248 3300025912 Bacteria 1785
354 Ga0207695_10108109 3300025913 Bacteria 2766
355 Ga0207671_10239926 3300025914 Bacteria 1424
356 Ga0207693_10015489 3300025915 Bacteria 6117
357 Ga0207693_10017116 3300025915 Bacteria 5784
358 Ga0207693_10017417 3300025915 Bacteria 5731
359 Ga0207693_10030988 3300025915 Bacteria 4225
360 Ga0207693_10035034 3300025915 Bacteria 3959
361 Ga0207693_10097559 3300025915 Bacteria 2304
362 Ga0207693_10185034 3300025915 Bacteria 1640
363 Ga0207693_10273489 3300025915 Bacteria 1324
364 Ga0207663_10106228 3300025916 Bacteria 1897
365 Ga0207663_10127861 3300025916 Bacteria 1751
366 Ga0207663_10264211 3300025916 Bacteria 1272
367 Ga0207663_10390693 3300025916 Bacteria 1062
368 Ga0207663_10398163 3300025916 Bacteria 1052
369 Ga0207660_10006793 3300025917 Bacteria 7411
370 Ga0207660_10399309 3300025917 Bacteria 1107
371 Ga0207649_10034408 3300025920 Bacteria 3036
372 Ga0207652_10103988 3300025921 Bacteria 2511
373 Ga0207652_10139669 3300025921 Bacteria 2166
374 Ga0207652_10230292 3300025921 Bacteria 1670
375 Ga0207646_10028109 3300025922 Bacteria 5123
376 Ga0207646_10079635 3300025922 Bacteria 2929
377 Ga0207646_10126681 3300025922 Bacteria 2296
378 Ga0207646_10215507 3300025922 Bacteria 1734
379 Ga0207646_10461763 3300025922 Bacteria 1145
380 Ga0207694_10159623 3300025924 Bacteria 1820
381 Ga0207650_10223482 3300025925 Bacteria 1516
382 Ga0207659_10129719 3300025926 Bacteria 1944
383 Ga0207700_10057126 3300025928 Bacteria 2941
384 Ga0207700_10134359 3300025928 Bacteria 2024
385 Ga0207700_10306219 3300025928 Bacteria 1373
386 Ga0207700_10761585 3300025928 Bacteria 865
387 Ga0207664_10040534 3300025929 Bacteria 3623
388 Ga0207664_10120292 3300025929 Bacteria 2196
389 Ga0207664_10127460 3300025929 Bacteria 2138
390 Ga0207664_10241747 3300025929 Bacteria 1572
391 Ga0207664_10531251 3300025929 Bacteria 1055
392 Ga0207644_10116157 3300025931 Bacteria 2030
393 Ga0207644_10247275 3300025931 Bacteria 1422
394 Ga0207644_10407824 3300025931 Bacteria 1112
395 Ga0207690_10162705 3300025932 Unclassified 1665
396 Ga0207686_10218201 3300025934 Bacteria 1375
397 Ga0207686_10268353 3300025934 Bacteria 1254
398 Ga0207670_10001158 3300025936 Bacteria 13899
399 Ga0207670_10239140 3300025936 Bacteria 1398
400 Ga0207669_10295440 3300025937 Bacteria 1229
401 Ga0207704_10030866 3300025938 Bacteria 3011
402 Ga0207704_10068732 3300025938 Bacteria 2234
403 Ga0207665_10041256 3300025939 Bacteria 3081
404 Ga0207691_10148033 3300025940 Bacteria 2066
405 Ga0207691_10153588 3300025940 Bacteria 2023
406 Ga0207711_10020274 3300025941 Bacteria 5540
407 Ga0207711_10452869 3300025941 Bacteria 1195
408 Ga0207689_10065447 3300025942 Bacteria 2989
409 Ga0207689_10278216 3300025942 Bacteria 1386
410 Ga0207661_10054190 3300025944 Bacteria 3212
411 Ga0207661_10100788 3300025944 Bacteria 2425
412 Ga0207661_10171817 3300025944 Bacteria 1887
413 Ga0207661_10519340 3300025944 Unclassified 1089
414 Ga0207679_10377168 3300025945 Bacteria 1242
415 Ga0207667_10183269 3300025949 Bacteria 2150
416 Ga0207667_10389928 3300025949 Bacteria 1418
417 Ga0207712_10074195 3300025961 Bacteria 2456
418 Ga0207712_10223864 3300025961 Bacteria 1506
419 Ga0207668_10159755 3300025972 Bacteria 1755
420 Ga0207668_10570888 3300025972 Bacteria 982
421 Ga0207658_10191795 3300025986 Bacteria 1699
422 Ga0207677_10082806 3300026023 Bacteria 2307
423 Ga0207703_10059696 3300026035 Bacteria 3116
424 Ga0207703_10066404 3300026035 Bacteria 2967
425 Ga0207639_10013284 3300026041 Bacteria 5759
426 Ga0207678_10022356 3300026067 Bacteria 5540
427 Ga0207678_10023373 3300026067 Bacteria 5405
428 Ga0207678_10061720 3300026067 Bacteria 3224
429 Ga0207678_10141966 3300026067 Bacteria 2050
430 Ga0207708_10059185 3300026075 Bacteria 2924
431 Ga0207708_10080554 3300026075 Bacteria 2502
432 Ga0207708_10106677 3300026075 Bacteria 2172
433 Ga0207708_10179578 3300026075 Bacteria 1680
434 Ga0207702_10296923 3300026078 Bacteria 1532
435 Ga0207702_10323983 3300026078 Bacteria 1468
436 Ga0207641_10058449 3300026088 Bacteria 3282
437 Ga0207676_10021432 3300026095 Bacteria 4740
438 Ga0207676_10241401 3300026095 Bacteria 1621
439 Ga0207674_10029348 3300026116 Bacteria 5790
440 Ga0207675_100174232 3300026118 Bacteria 2057
441 Ga0207675_100358227 3300026118 Bacteria 1431
442 Ga0207675_100491048 3300026118 Bacteria 1221
443 Ga0207683_10011965 3300026121 Bacteria 7406
444 Ga0207683_10089105 3300026121 Bacteria 2746
445 Ga0207698_10025424 3300026142 Bacteria 4172
446 Ga0207698_10025926 3300026142 Bacteria 4140
447 Ga0207698_10218050 3300026142 Bacteria 1722
448 Ga0207698_10239002 3300026142 Bacteria 1654
449 Ga0209995_1001114 3300027471 Bacteria 4126
450 Ga0209179_1005644 3300027512 Bacteria 1972
451 Ga0209179_1017893 3300027512 Bacteria 1348
452 Ga0209588_1010243 3300027671 Bacteria 2815
453 Ga0209588_1014115 3300027671 Bacteria 2443
454 Ga0209813_10037515 3300027866 Bacteria 1461
455 Ga0207428_10017007 3300027907 Bacteria 6248
456 Ga0207428_10185093 3300027907 Bacteria 1572
457 Ga0207428_10569867 3300027907 Bacteria 818
458 Ga0268266_10008924 3300028379 Bacteria 8871
459 Ga0268266_10055963 3300028379 Bacteria 3392
460 Ga0268266_10093765 3300028379 Bacteria 2634
461 Ga0268266_10386239 3300028379 Bacteria 1321
462 Ga0268266_10551608 3300028379 Bacteria 1104
463 Ga0268265_10651112 3300028380 Bacteria 1013
464 Ga0268264_10216680 3300028381 Bacteria 1760
465 Ga0265334_10052047 3300028573 Bacteria 1568
466 Ga0265338_10005513 3300028800 Bacteria 16493
467 Ga0265763_1000743 3300030763 Bacteria 2125
468 Ga0265773_1000831 3300031018 Bacteria 1448
469 Ga0265325_10001561 3300031241 Bacteria 15970
470 Ga0265325_10041154 3300031241 Bacteria 2422
471 Ga0265325_10092934 3300031241 Bacteria 1485
472 Ga0265340_10002096 3300031247 Bacteria 11429
473 Ga0265340_10024688 3300031247 Bacteria 3051
474 Ga0265340_10059854 3300031247 Bacteria 1826
475 Ga0265340_10159963 3300031247 Bacteria 1023
476 Ga0265339_10000126 3300031249 Bacteria 63942
477 Ga0265339_10001221 3300031249 Bacteria 19322
478 Ga0265339_10032717 3300031249 Bacteria 2932
479 Ga0265331_10110721 3300031250 Bacteria 1259
480 Ga0307509_10071890 3300031507 Bacteria 3606
481 Ga0265313_10000844 3300031595 Bacteria 30856
482 Ga0265313_10073133 3300031595 Bacteria 1574
483 Ga0265314_10191221 3300031711 Bacteria 1218
484 Ga0265342_10000035 3300031712 Bacteria 142886
485 Ga0265342_10011621 3300031712 Bacteria 6010
486 Ga0307405_10405273 3300031731 Bacteria 1069
487 Ga0307410_10328407 3300031852 Bacteria 1216
488 Ga0307406_10295878 3300031901 Bacteria 1241
489 Ga0307406_10325776 3300031901 Bacteria 1190
490 Ga0307406_10737456 3300031901 Bacteria 826
491 Ga0307412_10201176 3300031911 Bacteria 1513
492 Ga0307409_100306152 3300031995 Bacteria 1481
493 Ga0307416_100211485 3300032002 Bacteria 1851
494 Ga0307416_100786288 3300032002 Bacteria 1046
495 Ga0307414_10284462 3300032004 Bacteria 1391
496 Ga0307510_10030926 3300033180 Bacteria 6060
497 Ga0373930_0009760 3300034816 Bacteria 1705
498 Ga0373958_0014116 3300034819 Bacteria 1393
499 Ga0373959_0002069 3300034820 Bacteria 3200
500 Ga0373959_0010829 3300034820 Bacteria 1600
501 Ga0373938_0002389 3300034957 Bacteria 3023
502 Ga0373938_0003206 3300034957 Bacteria 2661
503 Ga0373938_0017284 3300034957 Bacteria 1419
504 Ga0373926_0023452 3300035083 Bacteria 2144
505 Ga0373934_0045836 3300035086 Bacteria 1729
506 Ga0373940_0024313 3300035088 Bacteria 1570
507 Ga0373940_0044257 3300035088 Bacteria 1233
508 Ga0373944_0091453 3300035089 Bacteria 1017
509 Ga0373951_0036107 3300035091 Bacteria 1179
510 Ga0373952_0003300 3300035092 Bacteria 2910
511 Ga0373952_0016312 3300035092 Bacteria 1509
512 Ga0373923_0008125 3300035111 Bacteria 3725
513 Ga0373923_0060800 3300035111 Bacteria 1604
514 Ga0373923_0221424 3300035111 Unclassified 879
515 Ga0373936_0000543 3300035113 Bacteria 12919
516 Ga0373936_0047359 3300035113 Bacteria 1734
517 Ga0373941_0083401 3300035115 Bacteria 1083
518 Ga0373945_0075529 3300035116 Bacteria 1283
519 Ga0373945_0105445 3300035116 Bacteria 1107
520 Ga0373953_0002974 3300035117 Bacteria 5184
521 Ga0373953_0028233 3300035117 Bacteria 2162
522 Ga0373953_0075244 3300035117 Bacteria 1398
523 Ga0373954_0001388 3300035118 Bacteria 9806
524 Ga0373954_0006655 3300035118 Bacteria 5043
525 Ga0373956_0025815 3300035119 Bacteria 2541
526 Ga0373956_0042926 3300035119 Bacteria 2012
527 Ga0373956_0044968 3300035119 Bacteria 1969
528 Ga0373957_0001852 3300035120 Bacteria 5861
529 Ga0373960_0006938 3300035121 Bacteria 2670
530 Ga0373960_0028381 3300035121 Bacteria 1544
531 Ga0373960_0049121 3300035121 Bacteria 1247
532 Ga0373960_0050417 3300035121 Bacteria 1234
533 Ga0373943_0006448 3300035170 Bacteria 5270
534 Ga0373943_0206150 3300035170 Bacteria 1090
535 Ga0373946_0012654 3300035171 Bacteria 3162
536 Ga0373946_0057326 3300035171 Bacteria 1648
537 Ga0373946_0191560 3300035171 Bacteria 975
538 Ga0373955_0001296 3300035172 Bacteria 10657
539 Ga0373955_0003427 3300035172 Bacteria 6967
540 Ga0373955_0068572 3300035172 Bacteria 1977
541 Ga0373955_0420628 3300035172 Bacteria 813
542 Ga0373961_0014464 3300035241 Bacteria 2005
543 Ga0373924_0002032 3300035410 Bacteria 6746
544 Ga0373924_0033584 3300035410 Bacteria 2072
545 Ga0373924_0037176 3300035410 Bacteria 1981
546 Ga0373924_0040683 3300035410 Bacteria 1903
547 Ga0373931_0009119 3300035691 Bacteria 4734
548 Ga0373931_0160678 3300035691 Bacteria 1317
549 Ga0373935_0000053 3300035692 Bacteria 46838
550 Ga0373935_0012176 3300035692 Bacteria 5174
551 Ga0373935_0037806 3300035692 Bacteria 3021
552 Ga0373935_0058415 3300035692 Bacteria 2464
553 Ga0373935_0114102 3300035692 Bacteria 1797
554 Ga0373935_0569430 3300035692 Bacteria 827
555 Ga0373927_0003990 3300035695 Bacteria 10440
556 Ga0373927_0006706 3300035695 Bacteria 7832
557 Ga0373927_0054934 3300035695 Unclassified 2576
558 Ga0373927_0168063 3300035695 Bacteria 1437
559 Ga0373927_0188718 3300035695 Bacteria 1352
560 Ga0373927_0363302 3300035695 Bacteria 954
561 Ga0373933_0001972 3300035724 Bacteria 11822
562 Ga0373933_0006420 3300035724 Bacteria 6400
563 Ga0373933_0015184 3300035724 Bacteria 4292
564 Ga0373933_0177325 3300035724 Bacteria 1358
565 Ga0373947_0000259 3300035725 Bacteria 29909
566 Ga0373947_0007231 3300035725 Bacteria 6433
567 Ga0373947_0022302 3300035725 Bacteria 3671
568 Ga0373947_0045158 3300035725 Bacteria 2636
569 Ga0373947_0078493 3300035725 Bacteria 2038
570 Ga0373947_0099192 3300035725 Bacteria 1828
571 Ga0373947_0108107 3300035725 Bacteria 1754
572 Ga0373937_0000030 3300036401 Bacteria 122176
573 Ga0373937_0002031 3300036401 Bacteria 16910
574 Ga0373937_0011822 3300036401 Bacteria 7664
575 Ga0373937_0051982 3300036401 Bacteria 3756
576 Ga0373937_0053663 3300036401 Bacteria 3697
577 Ga0373937_0091262 3300036401 Bacteria 2822
578 Ga0373937_0102344 3300036401 Bacteria 2659
579 Ga0373937_0165925 3300036401 Bacteria 2071
580 Ga0373937_0244830 3300036401 Bacteria 1690
581 Ga0373937_0714988 3300036401 Bacteria 949
582 Ga0372808_016532 3300036459 Bacteria 1057
583 Ga0373925_0000002 3300037068 Bacteria 368879
584 Ga0373925_0013015 3300037068 Bacteria 6025
585 Ga0373925_0044707 3300037068 Bacteria 3289
586 Ga0373925_0200374 3300037068 Bacteria 1587
587 Ga0373925_0216552 3300037068 Bacteria 1527
588 Ga0373925_0246128 3300037068 Unclassified 1433
589 Ga0373925_0334062 3300037068 Bacteria 1228
590 Ga0395899_0124497 3300037312 Bacteria 1844
591 Ga0395900_0024386 3300037418 Bacteria 6194
592 Ga0395900_0803020 3300037418 Bacteria 869
593 Ga0436364_0116063 3300037853 Bacteria 34499
594 Ga0436364_0174146 3300037853 Bacteria 60383
595 Ga0436364_0518856 3300037853 Bacteria 4142
596 Ga0436364_0790051 3300037853 Bacteria 7354
597 Ga0436364_1167573 3300037853 Bacteria 1842
598 Ga0436364_1414712 3300037853 Bacteria 14633
599 Ga0395901_0009263 3300038443 Bacteria 9984
600 Ga0395901_0544387 3300038443 Unclassified 1177
601 Ga0395901_0684383 3300038443 Bacteria 1025
602 Ga0395901_0767182 3300038443 Bacteria 956
603 Ga0436365_0297513 3300039437 Bacteria 1297
604 Ga0436365_0316468 3300039437 Bacteria 3400
605 Ga0436365_0536902 3300039437 Bacteria 5780
606 Ga0436365_1057670 3300039437 Bacteria 2070
607 Ga0436365_1534158 3300039437 Bacteria 1930
608 Ga0436360_0521374 3300039438 Bacteria 992
609 Ga0436360_0736047 3300039438 Bacteria 1241
610 Ga0436360_1043436 3300039438 Bacteria 1358
611 Ga0436361_0261761 3300039447 Bacteria 1407
612 Ga0436361_0724946 3300039447 Bacteria 1227
613 Ga0436361_1073850 3300039447 Bacteria 1843
614 Ga0436363_0651762 3300039450 Bacteria 2465
615 Ga0436363_0833932 3300039450 Unclassified 1451
616 Ga0436363_1260906 3300039450 Bacteria 932
617 Ga0436363_1557386 3300039450 Unclassified 3146
618 Ga0436362_0220226 3300039453 Bacteria 4248
619 Ga0436362_0976859 3300039453 Bacteria 1575
620 Ga0451791_1395462 3300041451 Bacteria 924
621 Ga0451853_0295340 3300041512 Bacteria 984
622 Ga0439460_0027138 3300042461 Bacteria 1606
623 Ga0439440_0068646 3300042993 Bacteria 918
624 Ga0453683_0017377 3300044673 Bacteria 4630
625 Ga0453683_0210344 3300044673 Bacteria 1236
626 Ga0466963_0137965 3300044694 Bacteria 1688
627 Ga0466959_0276615 3300045049 Bacteria 1153
628 Ga0451576_0162542 3300045051 Bacteria 2330
629 Ga0466967_0025189 3300045976 Bacteria 4903
630 Ga0466967_0199815 3300045976 Unclassified 1893
631 Ga0495627_050764 3300046453 Bacteria 1249
632 Ga0495592_0000046 3300046454 Bacteria 117345
633 Ga0495592_0063065 3300046454 Bacteria 2719
634 Ga0495592_0191067 3300046454 Bacteria 1388
635 Ga0495592_0383981 3300046454 Unclassified 893
636 Ga0495603_0026171 3300046455 Bacteria 3525
637 Ga0495603_0165408 3300046455 Bacteria 1282
638 Ga0495629_0145069 3300046459 Bacteria 1651
639 Ga0495629_0190112 3300046459 Bacteria 1421
640 Ga0495651_0000822 3300046462 Bacteria 24113
641 Ga0495651_0016074 3300046462 Bacteria 5796
642 Ga0495653_0000006 3300046463 Bacteria 363285
643 Ga0495653_0090986 3300046463 Bacteria 2231
644 Ga0495650_0089444 3300046471 Bacteria 1174
645 Ga0495580_0379804 3300046472 Bacteria 954
646 Ga0495582_0064649 3300046473 Bacteria 2020
647 Ga0495582_0082452 3300046473 Bacteria 1787
648 Ga0495582_0136768 3300046473 Bacteria 1387
649 Ga0495605_0032275 3300046474 Bacteria 2667
650 Ga0495605_0154621 3300046474 Bacteria 1021
651 Ga0495639_0027441 3300046475 Bacteria 2520
652 Ga0495639_0061050 3300046475 Unclassified 1728
653 Ga0495639_0112738 3300046475 Bacteria 1292
654 Ga0495664_0000002 3300046477 Bacteria 625183
655 Ga0495664_0099885 3300046477 Bacteria 1747
656 Ga0495585_0031747 3300046492 Bacteria 2997
657 Ga0495585_0141051 3300046492 Bacteria 1262
658 Ga0495594_0201253 3300046499 Bacteria 1135
659 Ga0495594_0207085 3300046499 Bacteria 1118
660 Ga0495596_0042107 3300046500 Bacteria 1800
661 Ga0495606_0076311 3300046507 Bacteria 2095
662 Ga0495608_0000006 3300046511 Bacteria 324334
663 Ga0495608_0136303 3300046511 Bacteria 1568
664 Ga0495608_0296983 3300046511 Bacteria 1000
665 Ga0495616_0104194 3300046513 Bacteria 1326
666 Ga0495618_0000034 3300046514 Bacteria 104335
667 Ga0495618_0029155 3300046514 Bacteria 3442
668 Ga0495618_0042664 3300046514 Bacteria 2860
669 Ga0495628_0000002 3300046516 Bacteria 589399
670 Ga0495630_0000662 3300046517 Bacteria 24856
671 Ga0495630_0052129 3300046517 Bacteria 3063
672 Ga0495630_0164878 3300046517 Bacteria 1687
673 Ga0495630_0446629 3300046517 Bacteria 991
674 Ga0495630_0470612 3300046517 Bacteria 963
675 Ga0495632_0092412 3300046519 Bacteria 1433
676 Ga0495632_0122309 3300046519 Bacteria 1216
677 Ga0495637_0110886 3300046520 Bacteria 1063
678 Ga0495666_0121148 3300046526 Bacteria 1225
679 Ga0495652_0000004 3300046529 Bacteria 588877
680 Ga0495652_0107711 3300046529 Bacteria 2248
681 Ga0495654_0148259 3300046530 Bacteria 1040
682 Ga0495665_0031706 3300046531 Bacteria 2829
683 Ga0495640_0000007 3300046533 Bacteria 265481
684 Ga0495640_0021159 3300046533 Bacteria 4778
685 Ga0495640_0079911 3300046533 Bacteria 2176
686 Ga0495640_0118297 3300046533 Bacteria 1724
687 Ga0495640_0142197 3300046533 Bacteria 1546
688 Ga0495640_0283651 3300046533 Bacteria 1031
689 Ga0495586_0276195 3300046535 Bacteria 961
690 Ga0495587_0000031 3300046536 Bacteria 126721
691 Ga0495587_0023239 3300046536 Bacteria 3811
692 Ga0495587_0105693 3300046536 Bacteria 1619
693 Ga0495598_0006275 3300046537 Bacteria 2680
694 Ga0495598_0040224 3300046537 Bacteria 1362
695 Ga0495621_0014292 3300046539 Bacteria 2510
696 Ga0495621_0089291 3300046539 Bacteria 1160
697 Ga0495645_0000003 3300046543 Bacteria 570133
698 Ga0495633_0141254 3300046558 Bacteria 1113
699 Ga0495667_0000002 3300046559 Bacteria 437535
700 Ga0495667_0032557 3300046559 Bacteria 3493
701 Ga0495667_0049591 3300046559 Bacteria 2771
702 Ga0495667_0143668 3300046559 Bacteria 1537
703 Ga0495667_0171686 3300046559 Bacteria 1393
704 Ga0495668_0228320 3300046616 Bacteria 1019
705 Ga0495634_0048400 3300046642 Bacteria 2862
706 Ga0495634_0176246 3300046642 Bacteria 1341
707 Ga0495634_0222471 3300046642 Bacteria 1164
708 Ga0495634_0234240 3300046642 Unclassified 1129
709 Ga0495635_0000022 3300046663 Bacteria 160907
710 Ga0495635_0030518 3300046663 Bacteria 3746
711 Ga0495635_0047055 3300046663 Bacteria 2976
712 Ga0495635_0048550 3300046663 Bacteria 2926
713 Ga0495635_0094506 3300046663 Bacteria 2044
714 Ga0495635_0113006 3300046663 Bacteria 1855
715 Ga0495635_0352268 3300046663 Bacteria 982
716 Ga0495659_0008947 3300046664 Bacteria 3189
717 Ga0495659_0144296 3300046664 Bacteria 952
718 Ga0495588_0008543 3300046674 Bacteria 4705
719 Ga0495657_0000276 3300046675 Bacteria 46295
720 Ga0495657_0177179 3300046675 Bacteria 1310
721 Ga0495599_0000001 3300046678 Bacteria 537563
722 Ga0495599_0032207 3300046678 Bacteria 3291
723 Ga0495599_0142819 3300046678 Bacteria 1484
724 Ga0495599_0231768 3300046678 Bacteria 1127
725 Ga0495623_0000094 3300046679 Bacteria 53328
726 Ga0495646_0000007 3300046680 Bacteria 236764
727 Ga0495646_0311863 3300046680 Unclassified 830
728 Ga0495658_0018990 3300046683 Unclassified 3582
729 Ga0495658_0308146 3300046683 Bacteria 1002
730 Ga0495669_0030566 3300046684 Bacteria 2364
731 Ga0495613_0005203 3300046689 Bacteria 9769
732 Ga0495613_0099585 3300046689 Bacteria 2100
733 Ga0495613_0110784 3300046689 Bacteria 1978
734 Ga0495613_0317316 3300046689 Bacteria 1076
735 Ga0495624_0084366 3300046690 Bacteria 1963
736 Ga0495624_0377068 3300046690 Bacteria 852
737 Ga0495670_0223965 3300046691 Bacteria 999
738 Ga0495671_0099852 3300046692 Bacteria 1419
739 Ga0495589_0166944 3300046794 Bacteria 1047
740 Ga0495600_0000033 3300046809 Bacteria 83590
741 Ga0495600_0080882 3300046809 Bacteria 2121
742 Ga0495600_0196539 3300046809 Bacteria 1296
743 Ga0495604_0000005 3300047317 Bacteria 424516
744 Ga0495604_0076491 3300047317 Bacteria 2518
745 Ga0495604_0225285 3300047317 Bacteria 1289
746 Ga0495604_0240144 3300047317 Bacteria 1239
747 Ga0495636_0025653 3300047318 Bacteria 2394
748 Ga0495674_0000003 3300047319 Bacteria 562126
749 Ga0495674_0092387 3300047319 Bacteria 2583
750 Ga0495674_0458762 3300047319 Bacteria 1023
751 Ga0495672_0137765 3300047320 Unclassified 1278
752 Ga0495676_0297060 3300047321 Bacteria 1090
753 Ga0495680_0000091 3300047322 Bacteria 81622
754 Ga0495680_0074954 3300047322 Bacteria 2568
755 Ga0495680_0357576 3300047322 Bacteria 1015
756 Ga0495683_0078567 3300047323 Bacteria 1612
757 Ga0495675_0000064 3300047444 Bacteria 74132
758 Ga0495677_0045265 3300047445 Bacteria 1614
759 Ga0495684_0000035 3300047471 Bacteria 107768
760 Ga0495684_0056398 3300047471 Bacteria 2995
761 Ga0495684_0139669 3300047471 Bacteria 1817
762 Ga0495684_0421958 3300047471 Unclassified 932
763 Ga0495593_0044108 3300047673 Bacteria 2387
764 Ga0495602_0000029 3300048088 Bacteria 142344
765 Ga0495602_0004741 3300048088 Bacteria 14214
766 Ga0495614_0129833 3300048089 Bacteria 1115
767 Ga0495615_0019320 3300048090 Bacteria 1512
768 Ga0495626_0146195 3300048091 Bacteria 999
769 Ga0496100_0005415 3300048903 Bacteria 6873
770 Ga0496100_0016994 3300048903 Bacteria 4283
771 Ga0496100_0517799 3300048903 Bacteria 920
772 Ga0496101_0002908 3300048904 Bacteria 10544
773 Ga0496101_0457919 3300048904 Bacteria 1006
774 Ga0496102_0034692 3300048905 Bacteria 4539
775 Ga0496102_0176027 3300048905 Bacteria 2014
776 Ga0496102_0288922 3300048905 Bacteria 1545
777 Ga0496102_0491735 3300048905 Bacteria 1148
778 Ga0496103_0097114 3300048906 Bacteria 1862
779 Ga0496103_0104527 3300048906 Bacteria 1795
780 Ga0496104_0000406 3300048907 Bacteria 37705
781 Ga0496104_0011780 3300048907 Bacteria 7846
782 Ga0496104_0018833 3300048907 Bacteria 6306
783 Ga0496104_0046997 3300048907 Bacteria 4067
784 Ga0496104_0118048 3300048907 Bacteria 2546
785 Ga0496104_0152806 3300048907 Bacteria 2215
786 Ga0496104_0713763 3300048907 Unclassified 910
787 Ga0496105_0003838 3300048908 Bacteria 11215
788 Ga0496105_0006511 3300048908 Bacteria 8981
789 Ga0496105_0026574 3300048908 Bacteria 4724
790 Ga0496105_0045525 3300048908 Bacteria 3620
791 Ga0496105_0153463 3300048908 Bacteria 1892
792 Ga0496105_0269211 3300048908 Bacteria 1376
793 Ga0496106_0009563 3300048909 Bacteria 7159
794 Ga0496106_0025869 3300048909 Bacteria 4367
795 Ga0496106_0033663 3300048909 Bacteria 3824
796 Ga0496106_0060627 3300048909 Bacteria 2868
797 Ga0496107_0025460 3300048910 Bacteria 4189
798 Ga0496107_0065981 3300048910 Bacteria 2624
799 Ga0496107_0069604 3300048910 Bacteria 2554
800 Ga0496107_0198228 3300048910 Bacteria 1492
801 Ga0496108_0023370 3300048911 Bacteria 5086
802 Ga0496108_0121307 3300048911 Bacteria 2242
803 Ga0496108_0266269 3300048911 Bacteria 1491
804 Ga0496108_0545867 3300048911 Bacteria 1011
805 Ga0496109_0028898 3300048912 Bacteria 4963
806 Ga0496109_0116590 3300048912 Bacteria 2486
807 Ga0496109_0386913 3300048912 Bacteria 1321
808 Ga0496110_0011457 3300048913 Bacteria 7258
809 Ga0496110_0017500 3300048913 Bacteria 5997
810 Ga0496110_0017778 3300048913 Bacteria 5950
811 Ga0496110_0043652 3300048913 Bacteria 3915
812 Ga0496111_0093464 3300048914 Bacteria 2205
813 Ga0496111_0188218 3300048914 Bacteria 1534
814 Ga0496112_0018293 3300048915 Bacteria 6596
815 Ga0496112_0086701 3300048915 Bacteria 3097
816 Ga0496112_0218245 3300048915 Bacteria 1863
817 Ga0496112_0239272 3300048915 Bacteria 1768
818 Ga0496112_0567934 3300048915 Bacteria 1067
819 Ga0496113_0080132 3300048916 Bacteria 2500
820 Ga0496113_0141939 3300048916 Bacteria 1890
821 Ga0496114_0002985 3300048917 Bacteria 12975
822 Ga0496114_0044873 3300048917 Bacteria 3669
823 Ga0496114_0060123 3300048917 Bacteria 3175
824 Ga0496114_0091496 3300048917 Bacteria 2584
825 Ga0496114_0568657 3300048917 Bacteria 1001
826 Ga0496115_0019674 3300048918 Bacteria 5197
827 Ga0496115_0032525 3300048918 Bacteria 4115
828 Ga0496115_0078034 3300048918 Bacteria 2694
829 Ga0496115_0082880 3300048918 Bacteria 2613
830 Ga0496115_0087655 3300048918 Bacteria 2540
831 Ga0496115_0244727 3300048918 Bacteria 1478
832 Ga0496118_0242857 3300048921 Bacteria 1030
833 Ga0496121_0023126 3300048924 Bacteria 6000
834 Ga0496121_0051252 3300048924 Bacteria 3478
835 Ga0496126_0017149 3300048929 Bacteria 7221
836 Ga0496126_0039939 3300048929 Bacteria 4351
837 Ga0496126_0109813 3300048929 Bacteria 2403
838 Ga0496126_0120611 3300048929 Bacteria 2275
839 Ga0495678_025380 3300049459 Bacteria 2546
840 Ga0501311_014377 3300049527 Bacteria 1009
841 Ga0501317_008493 3300049533 Bacteria 1184
842 Ga0501318_011075 3300049534 Bacteria 1013
843 Ga0501321_005571 3300049537 Bacteria 1250
844 Ga0501034_0138934 3300049571 Bacteria 2410
845 Ga0501036_0011679 3300049572 Bacteria 7279
846 Ga0501036_0127330 3300049572 Bacteria 2151
847 Ga0501038_0109451 3300049574 Unclassified 2289
848 Ga0501039_0021841 3300049575 Bacteria 4911
849 Ga0501039_0034004 3300049575 Bacteria 3933
850 Ga0501039_0315379 3300049575 Bacteria 1229
851 Ga0501040_0000995 3300049576 Bacteria 17916
852 Ga0501040_0015514 3300049576 Bacteria 5034
853 Ga0501040_0074209 3300049576 Bacteria 2351
854 Ga0501040_0242757 3300049576 Bacteria 1284
855 Ga0501041_0017617 3300049577 Bacteria 4250
856 Ga0501041_0058187 3300049577 Bacteria 2364
857 Ga0501041_0130470 3300049577 Bacteria 1565
858 Ga0501042_0011394 3300049578 Bacteria 6001
859 Ga0501042_0118816 3300049578 Bacteria 1903
860 Ga0501042_0340267 3300049578 Bacteria 1085
861 Ga0501046_0049382 3300049580 Bacteria 3328
862 Ga0501046_0114167 3300049580 Bacteria 2061
863 Ga0501046_0271644 3300049580 Bacteria 1243
864 Ga0501048_0011738 3300049582 Bacteria 6531
865 Ga0501048_0032626 3300049582 Bacteria 3763
866 Ga0501048_0137931 3300049582 Bacteria 1724
867 Ga0501048_0328501 3300049582 Bacteria 1090
868 Ga0501068_0095855 3300049584 Bacteria 1835
869 Ga0501070_0111390 3300049586 Bacteria 2262
870 Ga0501071_0180918 3300049587 Bacteria 1580
871 Ga0501071_0306412 3300049587 Bacteria 1205
872 Ga0501072_0011150 3300049588 Bacteria 6860
873 Ga0501072_0041410 3300049588 Bacteria 3618
874 Ga0501073_0246179 3300049589 Bacteria 1234
875 Ga0501073_0290283 3300049589 Bacteria 1129
876 Ga0501075_0000059 3300049591 Bacteria 46955
877 Ga0501075_0002900 3300049591 Bacteria 11504
878 Ga0501075_0016035 3300049591 Bacteria 5391
879 Ga0501075_0571537 3300049591 Bacteria 862
880 Ga0501076_0000302 3300049592 Bacteria 30790
881 Ga0501076_0013335 3300049592 Bacteria 6163
882 Ga0501076_0109490 3300049592 Bacteria 2232
883 Ga0501077_0020718 3300049593 Bacteria 4163
884 Ga0501077_0043474 3300049593 Bacteria 2855
885 Ga0501079_0007487 3300049741 Bacteria 8257
886 Ga0501079_0251304 3300049741 Bacteria 1382
887 Ga0501079_0286054 3300049741 Bacteria 1289
888 Ga0501080_0022370 3300049742 Bacteria 5857
889 Ga0501080_0062421 3300049742 Bacteria 3468
890 Ga0501080_0129125 3300049742 Bacteria 2340
891 Ga0501080_0350061 3300049742 Bacteria 1334
892 Ga0501081_0002714 3300049743 Bacteria 11204
893 Ga0501081_0111241 3300049743 Bacteria 1944
894 Ga0501081_0294897 3300049743 Bacteria 1189
895 Ga0501081_0455651 3300049743 Bacteria 951
896 Ga0501083_0149014 3300049744 Bacteria 1532
897 Ga0501035_0120363 3300049822 Unclassified 2296
898 Ga0501044_0174924 3300049823 Bacteria 2116
899 nmdc:mga03683_849_c1 3300050489 Bacteria 6172
900 nmdc:mga03n38_870_c1 3300050490 Bacteria 8105
901 nmdc:mga00v17_47431_c1 3300050491 Bacteria 2602
902 nmdc:mga0yw44_16746_c1 3300050492 Bacteria 3969
903 nmdc:mga0yw44_23402_c1 3300050492 Bacteria 3480
904 nmdc:mga0k408_18460_c1 3300050493 Bacteria 3894
905 nmdc:mga06z11_18660_c1 3300050494 Bacteria 3173
906 nmdc:mga05p37_163993_c1 3300050507 Bacteria 2713
907 nmdc:mga05p37_16858_c1 3300050507 Bacteria 8808
908 nmdc:mga05p37_17862_c1 3300050507 Bacteria 8562
909 nmdc:mga05p37_231768_c1 3300050507 Bacteria 2224
910 nmdc:mga05p37_287343_c1 3300050507 Bacteria 1959
911 nmdc:mga05p37_40389_c1 3300050507 Bacteria 5730
912 nmdc:mga05p37_578_c1 3300050507 Bacteria 40238
913 nmdc:mga05p37_59858_c1 3300050507 Unclassified 4690
914 nmdc:mga09592_103701_c1 3300050508 Bacteria 2437
915 nmdc:mga09592_1636_c1 3300050508 Bacteria 18036
916 nmdc:mga09592_201363_c1 3300050508 Bacteria 1724
917 nmdc:mga09592_213560_c1 3300050508 Bacteria 1672
918 nmdc:mga09592_274253_c1 3300050508 Unclassified 1463
919 nmdc:mga09592_3930_c1 3300050508 Bacteria 11973
920 nmdc:mga09592_529_c1 3300050508 Bacteria 28853
921 nmdc:mga09592_5368_c1 3300050508 Bacteria 10419
922 nmdc:mga09592_54535_c1 3300050508 Unclassified 3377
923 nmdc:mga09592_82205_c1 3300050508 Bacteria 2745
924 nmdc:mga09592_93745_c1 3300050508 Bacteria 2568
925 nmdc:mga0qj67_1023_c1 3300050509 Bacteria 19334
926 nmdc:mga0qj67_163453_c1 3300050509 Bacteria 1807
927 nmdc:mga0qj67_171275_c1 3300050509 Bacteria 1763
928 nmdc:mga0qj67_171_c1 3300050509 Bacteria 43599
929 nmdc:mga0qj67_391859_c1 3300050509 Bacteria 1121
930 nmdc:mga06r32_104218_c1 3300050510 Bacteria 2785
931 nmdc:mga06r32_134128_c1 3300050510 Unclassified 2450
932 nmdc:mga06r32_157949_c1 3300050510 Bacteria 2250
933 nmdc:mga06r32_231940_c1 3300050510 Bacteria 1834
934 nmdc:mga06r32_274536_c1 3300050510 Bacteria 1673
935 nmdc:mga06r32_308_c1 3300050510 Bacteria 40566
936 nmdc:mga06r32_32719_c1 3300050510 Bacteria 4895
937 nmdc:mga06r32_457_c1 3300050510 Bacteria 34863
938 nmdc:mga06r32_642505_c1 3300050510 Bacteria 1030
939 nmdc:mga06r32_652918_c1 3300050510 Bacteria 1020
940 nmdc:mga06r32_6565_c1 3300050510 Bacteria 10451
941 nmdc:mga06r32_673_c1 3300050510 Bacteria 29768
942 nmdc:mga06r32_706290_c1 3300050510 Bacteria 974
943 nmdc:mga06r32_85194_c1 3300050510 Bacteria 3081
944 nmdc:mga06r32_92225_c1 3300050510 Bacteria 2961
945 nmdc:mga08y16_24463_c1 3300050511 Bacteria 6374
946 nmdc:mga08y16_26204_c1 3300050511 Bacteria 6148
947 nmdc:mga08y16_275912_c1 3300050511 Bacteria 1735
948 nmdc:mga08y16_304808_c1 3300050511 Bacteria 1641
949 nmdc:mga08y16_307815_c1 3300050511 Bacteria 1632
950 nmdc:mga08y16_334302_c1 3300050511 Bacteria 1558
951 nmdc:mga08y16_345251_c1 3300050511 Bacteria 1530
952 nmdc:mga08y16_36541_c1 3300050511 Bacteria 5159
953 nmdc:mga08y16_402576_c1 3300050511 Bacteria 1400
954 nmdc:mga08y16_482921_c1 3300050511 Bacteria 1261
955 nmdc:mga0n895_11714_c1 3300050512 Bacteria 7837
956 nmdc:mga0n895_145088_c1 3300050512 Bacteria 2403
957 nmdc:mga0n895_157936_c1 3300050512 Bacteria 2299
958 nmdc:mga0n895_247331_c1 3300050512 Bacteria 1810
959 nmdc:mga0n895_258275_c1 3300050512 Bacteria 1768
960 nmdc:mga0n895_284502_c1 3300050512 Bacteria 1676
961 nmdc:mga0n895_37143_c1 3300050512 Bacteria 4710
962 nmdc:mga0n895_395792_c1 3300050512 Bacteria 1397
963 nmdc:mga0n895_60709_c1 3300050512 Bacteria 3731
964 nmdc:mga0n895_890131_c1 3300050512 Bacteria 876
965 nmdc:mga0n895_97954_c1 3300050512 Bacteria 2939
966 nmdc:mga0rr50_223668_c1 3300050513 Bacteria 1555
967 nmdc:mga08x19_409287_c1 3300050514 Bacteria 952
968 nmdc:mga0a205_133457_c1 3300050515 Bacteria 2383
969 nmdc:mga0a205_195351_c1 3300050515 Bacteria 1914
970 nmdc:mga0a205_246756_c1 3300050515 Bacteria 1666
971 nmdc:mga0a205_358959_c1 3300050515 Bacteria 1324
972 nmdc:mga0a205_365456_c1 3300050515 Bacteria 1309
973 nmdc:mga0a205_478035_c1 3300050515 Bacteria 1104
974 nmdc:mga0a205_52331_c1 3300050515 Bacteria 3941
975 nmdc:mga0a205_59046_c1 3300050515 Bacteria 3706
976 nmdc:mga0a205_61195_c1 3300050515 Bacteria 3636
977 Ga0495601_0000008 3300053077 Bacteria 362152
978 Ga0495601_0001559 3300053077 Bacteria 12672
979 Ga0495601_0008686 3300053077 Bacteria 5994
980 Ga0495601_0010988 3300053077 Bacteria 5407
981 Ga0495601_0085827 3300053077 Bacteria 2023
982 Ga0495601_0161501 3300053077 Bacteria 1464
983 Ga0495601_0186008 3300053077 Bacteria 1358
984 Ga0495601_0272536 3300053077 Bacteria 1104
985 Ga0495612_0000026 3300053078 Bacteria 111627
986 Ga0495612_0005642 3300053078 Bacteria 5171
987 Ga0495595_0000024 3300053084 Bacteria 108008
988 Ga0495595_0004562 3300053084 Bacteria 5570
989 Ga0495595_0057640 3300053084 Bacteria 1812
990 Ga0495619_0000002 3300053085 Bacteria 530226
991 Ga0495619_0001277 3300053085 Bacteria 16520
992 Ga0495619_0006262 3300053085 Bacteria 7546
993 Ga0495619_0039945 3300053085 Bacteria 3065
994 Ga0495619_0078338 3300053085 Unclassified 2222
995 Ga0495619_0266546 3300053085 Bacteria 1187
996 Ga0500651_0117561 3300053093 Bacteria 1617
997 Ga0500641_0047437 3300053096 Bacteria 1756
998 Ga0500616_0096090 3300053153 Bacteria 1457
999 Ga0501084_0002329 3300054114 Bacteria 15261
1000 Ga0501084_0150306 3300054114 Bacteria 1963
1001 Ga0501084_0189071 3300054114 Bacteria 1737
1002 Ga0587093_001576 3300059478 Bacteria 1960
1003 Ga0587066_000440 3300059490 Bacteria 3334
1004 Ga0587075_000381 3300059644 Bacteria 3396
1005 Ga0587078_002060 3300059646 Bacteria 1908
1006 Ga0587111_0000520 3300060346 Bacteria 3744
1007 Ga0501082_0004557 3300060353 Bacteria 12097
1008 Ga0501082_0091037 3300060353 Bacteria 2634
1009 Ga0501082_0161732 3300060353 Bacteria 1946
1010 Ga0501082_0294225 3300060353 Bacteria 1414
1011 Ga0501082_0328814 3300060353 Bacteria 1332
1012 Ga0501082_0342397 3300060353 Bacteria 1303
1013 Ga0501082_0497413 3300060353 Bacteria 1066
1014 Ga0530510_0000001 3300061734 Bacteria 285623
1015 Ga0530510_0004611 3300061734 Bacteria 9532
1016 Ga0530510_0011725 3300061734 Bacteria 6152
1017 Ga0530510_0088355 3300061734 Bacteria 2259
1018 Ga0436365_0502355
1019 JGI25153J46596_10000660
1020 JGI25153J46596_10000980
1021 JGI25404J52841_10004319
1022 JGI25405J52794_10000579
1023 JGI25405J52794_10000642
1024 Ga0058860_10061687
1025 Ga0058860_12023695
1026 Ga0058860_12080127
1027 Ga0065712_10116098
1028 Ga0065707_10052887
1029 Ga0070683_100076228
1030 Ga0070683_100188352
1031 Ga0070683_100304232
1032 Ga0068869_100149941
1033 Ga0070680_100012393
1034 Ga0070680_100281796
1035 Ga0070682_100130458
1036 Ga0070689_100001712
1037 Ga0070691_10095973
1038 Ga0070687_100012756
1039 Ga0070661_100049691
1040 Ga0070668_100264719
1041 Ga0070668_100592314
1042 Ga0070669_100024245
1043 Ga0070669_100052634
1044 Ga0070675_100354128
1045 Ga0070671_100198355
1046 Ga0070671_100227976
1047 Ga0070671_100421928
1048 Ga0070674_100069463
1049 Ga0070674_100092455
1050 Ga0070674_100184044
1051 Ga0070688_100022506
1052 Ga0070659_100205046
1053 Ga0070703_10062311
1054 Ga0070709_10027715
1055 Ga0070709_10028128
1056 Ga0070709_10273446
1057 Ga0070709_10354792
1058 Ga0070709_10406250
1059 Ga0070714_100269103
1060 Ga0070714_100369054
1061 Ga0070713_100001818
1062 Ga0070713_100245791
1063 Ga0070713_100447612
1064 Ga0070710_10005916
1065 Ga0070710_10071614
1066 Ga0070710_10151469
1067 Ga0070710_10224710
1068 Ga0070701_10123940
1069 Ga0070711_100012791
1070 Ga0070711_100197101
1071 Ga0070711_100285425
1072 Ga0070711_100374934
1073 Ga0070705_100228448
1074 Ga0070705_100238846
1075 Ga0070694_100375942
1076 Ga0070694_100423221
1077 Ga0070708_100023270
1078 Ga0070708_100037899
1079 Ga0070708_100041980
1080 Ga0070708_100079289
1081 Ga0070708_100162362
1082 Ga0070663_100003746
1083 Ga0070663_100131359
1084 Ga0070663_100171937
1085 Ga0070678_100026011
1086 Ga0070678_100065791
1087 Ga0070681_10014225
1088 Ga0070681_10015634
1089 Ga0070681_10067759
1090 Ga0070681_10085961
1091 Ga0070685_10156714
1092 Ga0070706_100041310
1093 Ga0070706_100082271
1094 Ga0070706_100150633
1095 Ga0070706_100291570
1096 Ga0070706_100456100
1097 Ga0070706_100562057
1098 Ga0070707_100016720
1099 Ga0070707_100091058
1100 Ga0070707_100092187
1101 Ga0070707_100146059
1102 Ga0070698_100042952
1103 Ga0070698_100160045
1104 Ga0070698_100176052
1105 Ga0070698_100209625
1106 Ga0070699_100152525
1107 Ga0070699_100245674
1108 Ga0070679_100101735
1109 Ga0070679_100446100
1110 Ga0070684_100079407
1111 Ga0070684_100151539
1112 Ga0070684_100174935
1113 Ga0068853_100009933
1114 Ga0068853_100814216
1115 Ga0070686_100259615
1116 Ga0070695_100032790
1117 Ga0070695_100364046
1118 Ga0070693_100046413
1119 Ga0070693_100213790
1120 Ga0070665_100023942
1121 Ga0070665_100049009
1122 Ga0070665_100074587
1123 Ga0070704_100411765
1124 Ga0068855_100124391
1125 Ga0068855_100148869
1126 Ga0068855_100345913
1127 Ga0068855_100735858
1128 Ga0070664_100271514
1129 Ga0070664_100766953
1130 Ga0068857_100021961
1131 Ga0068857_100165748
1132 Ga0068854_100167695
1133 Ga0068856_100019721
1134 Ga0068856_100066265
1135 Ga0068856_100222275
1136 Ga0068856_100488644
1137 Ga0068852_100240551
1138 Ga0068852_100406863
1139 Ga0068852_100426777
1140 Ga0068859_100046003
1141 Ga0068859_100279634
1142 Ga0068859_100548623
1143 Ga0068864_100038231
1144 Ga0068864_100196892
1145 Ga0068866_10108439
1146 Ga0068861_100345905
1147 Ga0068863_100077315
1148 Ga0068858_100250949
1149 Ga0068860_100019692
1150 Ga0068862_100182770
1151 Ga0081455_10000418
1152 Ga0081455_10001315
1153 Ga0081455_10002053
1154 Ga0081455_10006568
1155 Ga0081455_10041502
1156 Ga0081455_10096981
1157 Ga0081455_10200913
1158 Ga0081538_10146066
1159 Ga0081540_1003181
1160 Ga0081540_1005915
1161 Ga0081540_1009489
1162 Ga0081540_1023383
1163 Ga0081540_1051182
1164 Ga0081540_1072176
1165 Ga0081539_10049231
1166 Ga0081539_10174064
1167 Ga0070717_10000508
1168 Ga0070717_10159065
1169 Ga0070717_10285474
1170 Ga0070717_10403909
1171 Ga0070717_10616178
1172 Ga0075365_10007763
1173 Ga0075365_10029750
1174 Ga0075365_10232165
1175 Ga0075368_10018756
1176 Ga0075363_100002080
1177 Ga0075364_10039545
1178 Ga0070715_10072632
1179 Ga0070716_100013860
1180 Ga0070716_100066344
1181 Ga0070716_100343610
1182 Ga0070716_100543921
1183 Ga0070712_100004011
1184 Ga0070712_100017121
1185 Ga0070712_100131478
1186 Ga0070712_100266166
1187 Ga0070712_100380414
1188 Ga0070712_100441496
1189 Ga0075362_10051383
1190 Ga0075367_10045916
1191 Ga0075427_10005724
1192 Ga0075366_10080388
1193 Ga0075370_10065259
1194 Ga0068871_100239522
1195 Ga0075428_100010863
1196 Ga0075428_100032851
1197 Ga0075428_100066107
1198 Ga0075428_100075095
1199 Ga0075428_100150368
1200 Ga0075428_100184999
1201 Ga0075428_100207317
1202 Ga0075428_100251285
1203 Ga0075428_100267326
1204 Ga0075428_100333364
1205 Ga0075428_100625157
1206 Ga0075428_100644001
1207 Ga0075430_100002737
1208 Ga0075430_100004372
1209 Ga0075430_100029545
1210 Ga0075430_100035787
1211 Ga0075430_100357510
1212 Ga0075431_100010541
1213 Ga0075431_100038421
1214 Ga0075431_100059560
1215 Ga0075431_100086499
1216 Ga0075431_100093943
1217 Ga0075431_100103518
1218 Ga0075431_100180513
1219 Ga0075431_100183018
1220 Ga0075431_100506636
1221 Ga0075433_10021818
1222 Ga0075433_10095949
1223 Ga0075433_10233632
1224 Ga0075433_10239031
1225 Ga0075433_10243633
1226 Ga0075433_10394652
1227 Ga0075433_10621321
1228 Ga0075434_100003432
1229 Ga0075434_100031726
1230 Ga0075434_100079291
1231 Ga0075434_100142922
1232 Ga0075434_100179083
1233 Ga0075434_100287264
1234 Ga0075434_100305621
1235 Ga0075434_100376443
1236 Ga0075429_100017090
1237 Ga0075429_100017929
1238 Ga0075429_100022663
1239 Ga0075429_100059942
1240 Ga0075429_100075368
1241 Ga0075429_100274146
1242 Ga0075429_100292310
1243 Ga0075429_100407619
1244 Ga0068865_100109719
1245 Ga0068865_100299010
1246 Ga0075436_100245266
1247 Ga0075436_100273145
1248 Ga0097620_100046004
1249 Ga0097620_100279624
1250 Ga0097620_100548622
1251 Ga0075435_100475383
1252 Ga0099794_10004782
1253 Ga0099795_10016588
1254 Ga0099795_10132238
1255 Ga0105240_10077293
1256 Ga0105240_10437551
1257 Ga0111539_10032319
1258 Ga0111539_10073530
1259 Ga0111539_10252629
1260 Ga0111539_10330986
1261 Ga0111539_10344374
1262 Ga0111539_10427569
1263 Ga0111539_10677395
1264 Ga0111539_10736348
1265 Ga0105245_10279932
1266 Ga0105247_10253644
1267 Ga0114129_10006147
1268 Ga0114129_10071358
1269 Ga0114129_10075599
1270 Ga0114129_10111234
1271 Ga0114129_10115567
1272 Ga0114129_10209081
1273 Ga0114129_10405755
1274 Ga0114129_10450159
1275 Ga0114129_10597890
1276 Ga0114129_11528689
1277 Ga0105243_10365124
1278 Ga0105242_10062722
1279 Ga0105242_10239275
1280 Ga0105248_10042634
1281 Ga0105248_10045067
1282 Ga0105248_10377773
1283 Ga0105248_10526754
1284 Ga0105237_10129363
1285 Ga0105237_10274718
1286 Ga0105237_10633181
1287 Ga0105238_10070875
1288 Ga0105238_10190186
1289 Ga0105238_10195703
1290 Ga0105238_10362786
1291 Ga0105249_10182709
1292 Ga0105249_10294679
1293 Ga0105249_10876774
1294 Ga0099796_10001978
1295 Ga0099796_10032242
1296 Ga0099796_10052250
1297 Ga0105239_10256496
1298 Ga0105246_10022952
1299 Ga0105246_10091653
1300 Ga0157373_10157606
1301 Ga0157370_10149127
1302 Ga0157370_10560401
1303 Ga0157369_10859717
1304 Ga0157374_10023559
1305 Ga0157374_10171265
1306 Ga0157378_10001940
1307 Ga0157378_10092125
1308 Ga0157378_10177848
1309 Ga0163162_10053689
1310 Ga0163162_10213580
1311 Ga0163162_10250062
1312 Ga0163162_10330755
1313 Ga0157372_10110431
1314 Ga0157375_10051102
1315 Ga0157375_10307361
1316 Ga0163163_10005361
1317 Ga0163163_10042646
1318 Ga0163163_10053277
1319 Ga0163163_10063883
1320 Ga0163163_10407568
1321 Ga0163163_10474655
1322 Ga0182008_10076783
1323 Ga0182008_10154516
1324 Ga0157379_10006693
1325 Ga0157379_10011648
1326 Ga0157379_10209695
1327 Ga0157379_10220305
1328 Ga0157379_10252556
1329 Ga0157376_10061010
1330 Ga0157376_10342880
1331 Ga0163161_10543954
1332 Ga0206352_10676952
1333 Ga0206350_10268593
1334 Ga0206353_10378285
1335 Ga0213876_10034704
1336 Ga0213875_10000009
1337 Ga0213875_10000498
1338 Ga0213875_10002698
1339 Ga0213875_10033177
1340 Ga0224712_10004135
1341 Ga0207673_1018854
1342 Ga0209758_1000523
1343 Ga0209758_1000772
1344 Ga0207426_1060373
1345 Ga0207656_10043114
1346 Ga0207653_10039405
1347 Ga0207682_10099526
1348 Ga0207692_10133398
1349 Ga0207692_10147891
1350 Ga0207692_10178917
1351 Ga0207692_10183182
1352 Ga0207692_10223781
1353 Ga0207710_10167639
1354 Ga0207688_10159357
1355 Ga0207685_10008557
1356 Ga0207685_10065834
1357 Ga0207699_10032557
1358 Ga0207699_10047550
1359 Ga0207699_10205470
1360 Ga0207699_10345308
1361 Ga0207643_10236080
1362 Ga0207684_10038926
1363 Ga0207684_10040262
1364 Ga0207684_10040850
1365 Ga0207684_10076272
1366 Ga0207684_10142507
1367 Ga0207654_10237492
1368 Ga0207707_10000826
1369 Ga0207707_10055373
1370 Ga0207707_10191248
1371 Ga0207695_10108109
1372 Ga0207671_10239926
1373 Ga0207693_10015489
1374 Ga0207693_10017116
1375 Ga0207693_10017417
1376 Ga0207693_10030988
1377 Ga0207693_10035034
1378 Ga0207693_10097559
1379 Ga0207693_10185034
1380 Ga0207693_10273489
1381 Ga0207663_10106228
1382 Ga0207663_10127861
1383 Ga0207663_10264211
1384 Ga0207663_10390693
1385 Ga0207663_10398163
1386 Ga0207660_10006793
1387 Ga0207660_10399309
1388 Ga0207649_10034408
1389 Ga0207652_10103988
1390 Ga0207652_10139669
1391 Ga0207652_10230292
1392 Ga0207646_10028109
1393 Ga0207646_10079635
1394 Ga0207646_10126681
1395 Ga0207646_10215507
1396 Ga0207646_10461763
1397 Ga0207694_10159623
1398 Ga0207650_10223482
1399 Ga0207659_10129719
1400 Ga0207700_10057126
1401 Ga0207700_10134359
1402 Ga0207700_10306219
1403 Ga0207700_10761585
1404 Ga0207664_10040534
1405 Ga0207664_10120292
1406 Ga0207664_10127460
1407 Ga0207664_10241747
1408 Ga0207664_10531251
1409 Ga0207644_10116157
1410 Ga0207644_10247275
1411 Ga0207644_10407824
1412 Ga0207690_10162705
1413 Ga0207686_10218201
1414 Ga0207686_10268353
1415 Ga0207670_10001158
1416 Ga0207670_10239140
1417 Ga0207669_10295440
1418 Ga0207704_10030866
1419 Ga0207704_10068732
1420 Ga0207665_10041256
1421 Ga0207691_10148033
1422 Ga0207691_10153588
1423 Ga0207711_10020274
1424 Ga0207711_10452869
1425 Ga0207689_10065447
1426 Ga0207689_10278216
1427 Ga0207661_10054190
1428 Ga0207661_10100788
1429 Ga0207661_10171817
1430 Ga0207661_10519340
1431 Ga0207679_10377168
1432 Ga0207667_10183269
1433 Ga0207667_10389928
1434 Ga0207712_10074195
1435 Ga0207712_10223864
1436 Ga0207668_10159755
1437 Ga0207668_10570888
1438 Ga0207658_10191795
1439 Ga0207677_10082806
1440 Ga0207703_10059696
1441 Ga0207703_10066404
1442 Ga0207639_10013284
1443 Ga0207678_10022356
1444 Ga0207678_10023373
1445 Ga0207678_10061720
1446 Ga0207678_10141966
1447 Ga0207708_10059185
1448 Ga0207708_10080554
1449 Ga0207708_10106677
1450 Ga0207708_10179578
1451 Ga0207702_10296923
1452 Ga0207702_10323983
1453 Ga0207641_10058449
1454 Ga0207676_10021432
1455 Ga0207676_10241401
1456 Ga0207674_10029348
1457 Ga0207675_100174232
1458 Ga0207675_100358227
1459 Ga0207675_100491048
1460 Ga0207683_10011965
1461 Ga0207683_10089105
1462 Ga0207698_10025424
1463 Ga0207698_10025926
1464 Ga0207698_10218050
1465 Ga0207698_10239002
1466 Ga0209995_1001114
1467 Ga0209179_1005644
1468 Ga0209179_1017893
1469 Ga0209588_1010243
1470 Ga0209588_1014115
1471 Ga0209813_10037515
1472 Ga0207428_10017007
1473 Ga0207428_10185093
1474 Ga0207428_10569867
1475 Ga0268266_10008924
1476 Ga0268266_10055963
1477 Ga0268266_10093765
1478 Ga0268266_10386239
1479 Ga0268266_10551608
1480 Ga0268265_10651112
1481 Ga0268264_10216680
1482 Ga0265334_10052047
1483 Ga0265338_10005513
1484 Ga0265763_1000743
1485 Ga0265773_1000831
1486 Ga0265325_10001561
1487 Ga0265325_10041154
1488 Ga0265325_10092934
1489 Ga0265340_10002096
1490 Ga0265340_10024688
1491 Ga0265340_10059854
1492 Ga0265340_10159963
1493 Ga0265339_10000126
1494 Ga0265339_10001221
1495 Ga0265339_10032717
1496 Ga0265331_10110721
1497 Ga0307509_10071890
1498 Ga0265313_10000844
1499 Ga0265313_10073133
1500 Ga0265314_10191221
1501 Ga0265342_10000035
1502 Ga0265342_10011621
1503 Ga0307405_10405273
1504 Ga0307410_10328407
1505 Ga0307406_10295878
1506 Ga0307406_10325776
1507 Ga0307406_10737456
1508 Ga0307412_10201176
1509 Ga0307409_100306152
1510 Ga0307416_100211485
1511 Ga0307416_100786288
1512 Ga0307414_10284462
1513 Ga0307510_10030926
1514 Ga0373930_0009760
1515 Ga0373958_0014116
1516 Ga0373959_0002069
1517 Ga0373959_0010829
1518 Ga0373938_0002389
1519 Ga0373938_0003206
1520 Ga0373938_0017284
1521 Ga0373926_0023452
1522 Ga0373934_0045836
1523 Ga0373940_0024313
1524 Ga0373940_0044257
1525 Ga0373944_0091453
1526 Ga0373951_0036107
1527 Ga0373952_0003300
1528 Ga0373952_0016312
1529 Ga0373923_0008125
1530 Ga0373923_0060800
1531 Ga0373923_0221424
1532 Ga0373936_0000543
1533 Ga0373936_0047359
1534 Ga0373941_0083401
1535 Ga0373945_0075529
1536 Ga0373945_0105445
1537 Ga0373953_0002974
1538 Ga0373953_0028233
1539 Ga0373953_0075244
1540 Ga0373954_0001388
1541 Ga0373954_0006655
1542 Ga0373956_0025815
1543 Ga0373956_0042926
1544 Ga0373956_0044968
1545 Ga0373957_0001852
1546 Ga0373960_0006938
1547 Ga0373960_0028381
1548 Ga0373960_0049121
1549 Ga0373960_0050417
1550 Ga0373943_0006448
1551 Ga0373943_0206150
1552 Ga0373946_0012654
1553 Ga0373946_0057326
1554 Ga0373946_0191560
1555 Ga0373955_0001296
1556 Ga0373955_0003427
1557 Ga0373955_0068572
1558 Ga0373955_0420628
1559 Ga0373961_0014464
1560 Ga0373924_0002032
1561 Ga0373924_0033584
1562 Ga0373924_0037176
1563 Ga0373924_0040683
1564 Ga0373931_0009119
1565 Ga0373931_0160678
1566 Ga0373935_0000053
1567 Ga0373935_0012176
1568 Ga0373935_0037806
1569 Ga0373935_0058415
1570 Ga0373935_0114102
1571 Ga0373935_0569430
1572 Ga0373927_0003990
1573 Ga0373927_0006706
1574 Ga0373927_0054934
1575 Ga0373927_0168063
1576 Ga0373927_0188718
1577 Ga0373927_0363302
1578 Ga0373933_0001972
1579 Ga0373933_0006420
1580 Ga0373933_0015184
1581 Ga0373933_0177325
1582 Ga0373947_0000259
1583 Ga0373947_0007231
1584 Ga0373947_0022302
1585 Ga0373947_0045158
1586 Ga0373947_0078493
1587 Ga0373947_0099192
1588 Ga0373947_0108107
1589 Ga0373937_0000030
1590 Ga0373937_0002031
1591 Ga0373937_0011822
1592 Ga0373937_0051982
1593 Ga0373937_0053663
1594 Ga0373937_0091262
1595 Ga0373937_0102344
1596 Ga0373937_0165925
1597 Ga0373937_0244830
1598 Ga0373937_0714988
1599 Ga0372808_016532
1600 Ga0373925_0000002
1601 Ga0373925_0013015
1602 Ga0373925_0044707
1603 Ga0373925_0200374
1604 Ga0373925_0216552
1605 Ga0373925_0246128
1606 Ga0373925_0334062
1607 Ga0395899_0124497
1608 Ga0395900_0024386
1609 Ga0395900_0803020
1610 Ga0436364_0116063
1611 Ga0436364_0174146
1612 Ga0436364_0518856
1613 Ga0436364_0790051
1614 Ga0436364_1167573
1615 Ga0436364_1414712
1616 Ga0395901_0009263
1617 Ga0395901_0544387
1618 Ga0395901_0684383
1619 Ga0395901_0767182
1620 Ga0436365_0297513
1621 Ga0436365_0316468
1622 Ga0436365_0536902
1623 Ga0436365_1057670
1624 Ga0436365_1534158
1625 Ga0436360_0521374
1626 Ga0436360_0736047
1627 Ga0436360_1043436
1628 Ga0436361_0261761
1629 Ga0436361_0724946
1630 Ga0436361_1073850
1631 Ga0436363_0651762
1632 Ga0436363_0833932
1633 Ga0436363_1260906
1634 Ga0436363_1557386
1635 Ga0436362_0220226
1636 Ga0436362_0976859
1637 Ga0451791_1395462
1638 Ga0451853_0295340
1639 Ga0439460_0027138
1640 Ga0439440_0068646
1641 Ga0453683_0017377
1642 Ga0453683_0210344
1643 Ga0466963_0137965
1644 Ga0466959_0276615
1645 Ga0451576_0162542
1646 Ga0466967_0025189
1647 Ga0466967_0199815
1648 Ga0495627_050764
1649 Ga0495592_0000046
1650 Ga0495592_0063065
1651 Ga0495592_0191067
1652 Ga0495592_0383981
1653 Ga0495603_0026171
1654 Ga0495603_0165408
1655 Ga0495629_0145069
1656 Ga0495629_0190112
1657 Ga0495651_0000822
1658 Ga0495651_0016074
1659 Ga0495653_0000006
1660 Ga0495653_0090986
1661 Ga0495650_0089444
1662 Ga0495580_0379804
1663 Ga0495582_0064649
1664 Ga0495582_0082452
1665 Ga0495582_0136768
1666 Ga0495605_0032275
1667 Ga0495605_0154621
1668 Ga0495639_0027441
1669 Ga0495639_0061050
1670 Ga0495639_0112738
1671 Ga0495664_0000002
1672 Ga0495664_0099885
1673 Ga0495585_0031747
1674 Ga0495585_0141051
1675 Ga0495594_0201253
1676 Ga0495594_0207085
1677 Ga0495596_0042107
1678 Ga0495606_0076311
1679 Ga0495608_0000006
1680 Ga0495608_0136303
1681 Ga0495608_0296983
1682 Ga0495616_0104194
1683 Ga0495618_0000034
1684 Ga0495618_0029155
1685 Ga0495618_0042664
1686 Ga0495628_0000002
1687 Ga0495630_0000662
1688 Ga0495630_0052129
1689 Ga0495630_0164878
1690 Ga0495630_0446629
1691 Ga0495630_0470612
1692 Ga0495632_0092412
1693 Ga0495632_0122309
1694 Ga0495637_0110886
1695 Ga0495666_0121148
1696 Ga0495652_0000004
1697 Ga0495652_0107711
1698 Ga0495654_0148259
1699 Ga0495665_0031706
1700 Ga0495640_0000007
1701 Ga0495640_0021159
1702 Ga0495640_0079911
1703 Ga0495640_0118297
1704 Ga0495640_0142197
1705 Ga0495640_0283651
1706 Ga0495586_0276195
1707 Ga0495587_0000031
1708 Ga0495587_0023239
1709 Ga0495587_0105693
1710 Ga0495598_0006275
1711 Ga0495598_0040224
1712 Ga0495621_0014292
1713 Ga0495621_0089291
1714 Ga0495645_0000003
1715 Ga0495633_0141254
1716 Ga0495667_0000002
1717 Ga0495667_0032557
1718 Ga0495667_0049591
1719 Ga0495667_0143668
1720 Ga0495667_0171686
1721 Ga0495668_0228320
1722 Ga0495634_0048400
1723 Ga0495634_0176246
1724 Ga0495634_0222471
1725 Ga0495634_0234240
1726 Ga0495635_0000022
1727 Ga0495635_0030518
1728 Ga0495635_0047055
1729 Ga0495635_0048550
1730 Ga0495635_0094506
1731 Ga0495635_0113006
1732 Ga0495635_0352268
1733 Ga0495659_0008947
1734 Ga0495659_0144296
1735 Ga0495588_0008543
1736 Ga0495657_0000276
1737 Ga0495657_0177179
1738 Ga0495599_0000001
1739 Ga0495599_0032207
1740 Ga0495599_0142819
1741 Ga0495599_0231768
1742 Ga0495623_0000094
1743 Ga0495646_0000007
1744 Ga0495646_0311863
1745 Ga0495658_0018990
1746 Ga0495658_0308146
1747 Ga0495669_0030566
1748 Ga0495613_0005203
1749 Ga0495613_0099585
1750 Ga0495613_0110784
1751 Ga0495613_0317316
1752 Ga0495624_0084366
1753 Ga0495624_0377068
1754 Ga0495670_0223965
1755 Ga0495671_0099852
1756 Ga0495589_0166944
1757 Ga0495600_0000033
1758 Ga0495600_0080882
1759 Ga0495600_0196539
1760 Ga0495604_0000005
1761 Ga0495604_0076491
1762 Ga0495604_0225285
1763 Ga0495604_0240144
1764 Ga0495636_0025653
1765 Ga0495674_0000003
1766 Ga0495674_0092387
1767 Ga0495674_0458762
1768 Ga0495672_0137765
1769 Ga0495676_0297060
1770 Ga0495680_0000091
1771 Ga0495680_0074954
1772 Ga0495680_0357576
1773 Ga0495683_0078567
1774 Ga0495675_0000064
1775 Ga0495677_0045265
1776 Ga0495684_0000035
1777 Ga0495684_0056398
1778 Ga0495684_0139669
1779 Ga0495684_0421958
1780 Ga0495593_0044108
1781 Ga0495602_0000029
1782 Ga0495602_0004741
1783 Ga0495614_0129833
1784 Ga0495615_0019320
1785 Ga0495626_0146195
1786 Ga0496100_0005415
1787 Ga0496100_0016994
1788 Ga0496100_0517799
1789 Ga0496101_0002908
1790 Ga0496101_0457919
1791 Ga0496102_0034692
1792 Ga0496102_0176027
1793 Ga0496102_0288922
1794 Ga0496102_0491735
1795 Ga0496103_0097114
1796 Ga0496103_0104527
1797 Ga0496104_0000406
1798 Ga0496104_0011780
1799 Ga0496104_0018833
1800 Ga0496104_0046997
1801 Ga0496104_0118048
1802 Ga0496104_0152806
1803 Ga0496104_0713763
1804 Ga0496105_0003838
1805 Ga0496105_0006511
1806 Ga0496105_0026574
1807 Ga0496105_0045525
1808 Ga0496105_0153463
1809 Ga0496105_0269211
1810 Ga0496106_0009563
1811 Ga0496106_0025869
1812 Ga0496106_0033663
1813 Ga0496106_0060627
1814 Ga0496107_0025460
1815 Ga0496107_0065981
1816 Ga0496107_0069604
1817 Ga0496107_0198228
1818 Ga0496108_0023370
1819 Ga0496108_0121307
1820 Ga0496108_0266269
1821 Ga0496108_0545867
1822 Ga0496109_0028898
1823 Ga0496109_0116590
1824 Ga0496109_0386913
1825 Ga0496110_0011457
1826 Ga0496110_0017500
1827 Ga0496110_0017778
1828 Ga0496110_0043652
1829 Ga0496111_0093464
1830 Ga0496111_0188218
1831 Ga0496112_0018293
1832 Ga0496112_0086701
1833 Ga0496112_0218245
1834 Ga0496112_0239272
1835 Ga0496112_0567934
1836 Ga0496113_0080132
1837 Ga0496113_0141939
1838 Ga0496114_0002985
1839 Ga0496114_0044873
1840 Ga0496114_0060123
1841 Ga0496114_0091496
1842 Ga0496114_0568657
1843 Ga0496115_0019674
1844 Ga0496115_0032525
1845 Ga0496115_0078034
1846 Ga0496115_0082880
1847 Ga0496115_0087655
1848 Ga0496115_0244727
1849 Ga0496118_0242857
1850 Ga0496121_0023126
1851 Ga0496121_0051252
1852 Ga0496126_0017149
1853 Ga0496126_0039939
1854 Ga0496126_0109813
1855 Ga0496126_0120611
1856 Ga0495678_025380
1857 Ga0501311_014377
1858 Ga0501317_008493
1859 Ga0501318_011075
1860 Ga0501321_005571
1861 Ga0501034_0138934
1862 Ga0501036_0011679
1863 Ga0501036_0127330
1864 Ga0501038_0109451
1865 Ga0501039_0021841
1866 Ga0501039_0034004
1867 Ga0501039_0315379
1868 Ga0501040_0000995
1869 Ga0501040_0015514
1870 Ga0501040_0074209
1871 Ga0501040_0242757
1872 Ga0501041_0017617
1873 Ga0501041_0058187
1874 Ga0501041_0130470
1875 Ga0501042_0011394
1876 Ga0501042_0118816
1877 Ga0501042_0340267
1878 Ga0501046_0049382
1879 Ga0501046_0114167
1880 Ga0501046_0271644
1881 Ga0501048_0011738
1882 Ga0501048_0032626
1883 Ga0501048_0137931
1884 Ga0501048_0328501
1885 Ga0501068_0095855
1886 Ga0501070_0111390
1887 Ga0501071_0180918
1888 Ga0501071_0306412
1889 Ga0501072_0011150
1890 Ga0501072_0041410
1891 Ga0501073_0246179
1892 Ga0501073_0290283
1893 Ga0501075_0000059
1894 Ga0501075_0002900
1895 Ga0501075_0016035
1896 Ga0501075_0571537
1897 Ga0501076_0000302
1898 Ga0501076_0013335
1899 Ga0501076_0109490
1900 Ga0501077_0020718
1901 Ga0501077_0043474
1902 Ga0501079_0007487
1903 Ga0501079_0251304
1904 Ga0501079_0286054
1905 Ga0501080_0022370
1906 Ga0501080_0062421
1907 Ga0501080_0129125
1908 Ga0501080_0350061
1909 Ga0501081_0002714
1910 Ga0501081_0111241
1911 Ga0501081_0294897
1912 Ga0501081_0455651
1913 Ga0501083_0149014
1914 Ga0501035_0120363
1915 Ga0501044_0174924
1916 nmdc:mga03683_849_c1
1917 nmdc:mga03n38_870_c1
1918 nmdc:mga00v17_47431_c1
1919 nmdc:mga0yw44_16746_c1
1920 nmdc:mga0yw44_23402_c1
1921 nmdc:mga0k408_18460_c1
1922 nmdc:mga06z11_18660_c1
1923 nmdc:mga05p37_163993_c1
1924 nmdc:mga05p37_16858_c1
1925 nmdc:mga05p37_17862_c1
1926 nmdc:mga05p37_231768_c1
1927 nmdc:mga05p37_287343_c1
1928 nmdc:mga05p37_40389_c1
1929 nmdc:mga05p37_578_c1
1930 nmdc:mga05p37_59858_c1
1931 nmdc:mga09592_103701_c1
1932 nmdc:mga09592_1636_c1
1933 nmdc:mga09592_201363_c1
1934 nmdc:mga09592_213560_c1
1935 nmdc:mga09592_274253_c1
1936 nmdc:mga09592_3930_c1
1937 nmdc:mga09592_529_c1
1938 nmdc:mga09592_5368_c1
1939 nmdc:mga09592_54535_c1
1940 nmdc:mga09592_82205_c1
1941 nmdc:mga09592_93745_c1
1942 nmdc:mga0qj67_1023_c1
1943 nmdc:mga0qj67_163453_c1
1944 nmdc:mga0qj67_171275_c1
1945 nmdc:mga0qj67_171_c1
1946 nmdc:mga0qj67_391859_c1
1947 nmdc:mga06r32_104218_c1
1948 nmdc:mga06r32_134128_c1
1949 nmdc:mga06r32_157949_c1
1950 nmdc:mga06r32_231940_c1
1951 nmdc:mga06r32_274536_c1
1952 nmdc:mga06r32_308_c1
1953 nmdc:mga06r32_32719_c1
1954 nmdc:mga06r32_457_c1
1955 nmdc:mga06r32_642505_c1
1956 nmdc:mga06r32_652918_c1
1957 nmdc:mga06r32_6565_c1
1958 nmdc:mga06r32_673_c1
1959 nmdc:mga06r32_706290_c1
1960 nmdc:mga06r32_85194_c1
1961 nmdc:mga06r32_92225_c1
1962 nmdc:mga08y16_24463_c1
1963 nmdc:mga08y16_26204_c1
1964 nmdc:mga08y16_275912_c1
1965 nmdc:mga08y16_304808_c1
1966 nmdc:mga08y16_307815_c1
1967 nmdc:mga08y16_334302_c1
1968 nmdc:mga08y16_345251_c1
1969 nmdc:mga08y16_36541_c1
1970 nmdc:mga08y16_402576_c1
1971 nmdc:mga08y16_482921_c1
1972 nmdc:mga0n895_11714_c1
1973 nmdc:mga0n895_145088_c1
1974 nmdc:mga0n895_157936_c1
1975 nmdc:mga0n895_247331_c1
1976 nmdc:mga0n895_258275_c1
1977 nmdc:mga0n895_284502_c1
1978 nmdc:mga0n895_37143_c1
1979 nmdc:mga0n895_395792_c1
1980 nmdc:mga0n895_60709_c1
1981 nmdc:mga0n895_890131_c1
1982 nmdc:mga0n895_97954_c1
1983 nmdc:mga0rr50_223668_c1
1984 nmdc:mga08x19_409287_c1
1985 nmdc:mga0a205_133457_c1
1986 nmdc:mga0a205_195351_c1
1987 nmdc:mga0a205_246756_c1
1988 nmdc:mga0a205_358959_c1
1989 nmdc:mga0a205_365456_c1
1990 nmdc:mga0a205_478035_c1
1991 nmdc:mga0a205_52331_c1
1992 nmdc:mga0a205_59046_c1
1993 nmdc:mga0a205_61195_c1
1994 Ga0495601_0000008
1995 Ga0495601_0001559
1996 Ga0495601_0008686
1997 Ga0495601_0010988
1998 Ga0495601_0085827
1999 Ga0495601_0161501
2000 Ga0495601_0186008
2001 Ga0495601_0272536
2002 Ga0495612_0000026
2003 Ga0495612_0005642
2004 Ga0495595_0000024
2005 Ga0495595_0004562
2006 Ga0495595_0057640
2007 Ga0495619_0000002
2008 Ga0495619_0001277
2009 Ga0495619_0006262
2010 Ga0495619_0039945
2011 Ga0495619_0078338
2012 Ga0495619_0266546
2013 Ga0500651_0117561
2014 Ga0500641_0047437
2015 Ga0500616_0096090
2016 Ga0501084_0002329
2017 Ga0501084_0150306
2018 Ga0501084_0189071
2019 Ga0587093_001576
2020 Ga0587066_000440
2021 Ga0587075_000381
2022 Ga0587078_002060
2023 Ga0587111_0000520
2024 Ga0501082_0004557
2025 Ga0501082_0091037
2026 Ga0501082_0161732
2027 Ga0501082_0294225
2028 Ga0501082_0328814
2029 Ga0501082_0342397
2030 Ga0501082_0497413
2031 Ga0530510_0000001
2032 Ga0530510_0004611
2033 Ga0530510_0011725
2034 Ga0530510_0088355

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

49

230

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.8096 6 133
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.744 4 246
8b6q-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 with an insertion of calmodulin-m13 fusion at position 154-156 that mimic the structure of caprola, an calcium gated protein labeling technology 0.7359 4 150
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.7311 4 246
1c4x-assembly1.cif.gz_A 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (bphd) from rhodococcus sp. strain rha1 0.7307 5 243
ID Description Score Start End Superfamily
2dstB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7637 6 130 3.40.50.12270
af_K7LW21_1_105_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7622 4 119 3.40.50.12270
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7321 19 133 3.40.50.1820
1c4xA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7307 5 243 3.40.50.1820
2yysB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7283 5 252 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A2V6ZPU4-F1-model_v4 Alpha/beta hydrolase 0.9986 8 253 GO:0016787
AF-A0A533ITP0-F1-model_v4 deleted 0.9983 1 253
AF-A0A537TW24-F1-model_v4 Alpha/beta hydrolase 0.9969 2 197 GO:0016787
AF-A0A537NFW6-F1-model_v4 Alpha/beta hydrolase 0.9961 3 190 GO:0016787
AF-A0A6N9BDZ1-F1-model_v4 Alpha/beta hydrolase 0.996 8 254 GO:0016787

Map