F488299
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1017 | 365 | 1017 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300050513|nmdc:mga0rr50_171652_c1|nmdc:mga0rr50_171652_c1_429_833 |
| Length | 134 |
| Sequence | VLPGDRIIPTDRILNQSTGVEMVQSAVADEVFYALSNATRRKVLEQLSVGPATVSELAAPFDMKLPSFVQHLSVLERSRLVKSKKRGRVRTYVIAPERFKVVEDWLTARRALWEARLDQFDQYVKQLKEKESAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 106 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 201 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 202 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 214 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 215 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 216 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 229 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 230 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 231 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 233 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 234 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 235 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 236 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 237 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 238 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 239 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 240 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 241 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 242 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 243 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 244 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 245 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 246 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 247 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 248 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 249 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 250 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 256 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 257 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 258 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 296 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 297 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 314 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 315 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 316 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 317 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 318 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 320 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 321 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 322 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 323 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 324 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 325 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 326 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 327 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 328 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 329 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 330 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 331 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 333 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 334 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 335 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 336 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 337 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 338 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 339 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 340 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 341 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 354 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 355 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 356 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 357 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 360 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 361 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 362 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 364 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 365 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.01 |
| Nodule | 0 |
| Rhizoplane | 2.75 |
| Rhizosphere | 91.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10236793 | 3300001990 | Unclassified | 539 |
| 2 | JGI24035J26624_1011242 | 3300002126 | Bacteria | 895 |
| 3 | JGI25159J45721_1024851 | 3300002987 | Bacteria | 1058 |
| 4 | JGI25151J46595_10086933 | 3300003187 | Bacteria | 884 |
| 5 | Ga0055526_1012111 | 3300003771 | Bacteria | 3799 |
| 6 | Ga0055524_1000951 | 3300003775 | Bacteria | 18374 |
| 7 | Ga0055524_1001641 | 3300003775 | Bacteria | 12477 |
| 8 | Ga0055536_1014134 | 3300003781 | Bacteria | 2826 |
| 9 | Ga0055534_1008563 | 3300003784 | Bacteria | 2304 |
| 10 | Ga0055528_1036653 | 3300003790 | Bacteria | 1167 |
| 11 | Ga0055530_10005594 | 3300003791 | Bacteria | 5909 |
| 12 | Ga0055531_10001261 | 3300003794 | Bacteria | 19149 |
| 13 | Ga0055531_10002230 | 3300003794 | Bacteria | 13134 |
| 14 | Ga0055531_10003072 | 3300003794 | Bacteria | 10796 |
| 15 | Ga0055531_10010188 | 3300003794 | Bacteria | 4705 |
| 16 | Ga0055531_10030703 | 3300003794 | Bacteria | 1796 |
| 17 | Ga0065704_10294183 | 3300005289 | Bacteria | 894 |
| 18 | Ga0065712_10008022 | 3300005290 | Bacteria | 2498 |
| 19 | Ga0065712_10024919 | 3300005290 | Bacteria | 1196 |
| 20 | Ga0065712_10078049 | 3300005290 | Bacteria | 3403 |
| 21 | Ga0065712_10173609 | 3300005290 | Bacteria | 1230 |
| 22 | Ga0065712_10316965 | 3300005290 | Bacteria | 834 |
| 23 | Ga0065715_10348131 | 3300005293 | Bacteria | 955 |
| 24 | Ga0065715_10393698 | 3300005293 | Bacteria | 891 |
| 25 | Ga0065715_11103161 | 3300005293 | Bacteria | 519 |
| 26 | Ga0065707_10110278 | 3300005295 | Bacteria | 2436 |
| 27 | Ga0065707_10115019 | 3300005295 | Bacteria | 2279 |
| 28 | Ga0065707_10122585 | 3300005295 | Bacteria | 2085 |
| 29 | Ga0065707_10140491 | 3300005295 | Bacteria | 1754 |
| 30 | Ga0065707_10531151 | 3300005295 | Bacteria | 735 |
| 31 | Ga0070658_10033753 | 3300005327 | Bacteria | 4117 |
| 32 | Ga0070658_10219627 | 3300005327 | Bacteria | 1607 |
| 33 | Ga0070658_10708727 | 3300005327 | Bacteria | 874 |
| 34 | Ga0070658_10794943 | 3300005327 | Bacteria | 822 |
| 35 | Ga0070658_10917744 | 3300005327 | Bacteria | 761 |
| 36 | Ga0070676_10047197 | 3300005328 | Bacteria | 2514 |
| 37 | Ga0070676_10552157 | 3300005328 | Bacteria | 825 |
| 38 | Ga0070676_11102439 | 3300005328 | Bacteria | 600 |
| 39 | Ga0070683_100002327 | 3300005329 | Bacteria | 15074 |
| 40 | Ga0070683_100022612 | 3300005329 | Bacteria | 5622 |
| 41 | Ga0070683_100049118 | 3300005329 | Bacteria | 3902 |
| 42 | Ga0070683_100087981 | 3300005329 | Bacteria | 2914 |
| 43 | Ga0070683_100106856 | 3300005329 | Bacteria | 2639 |
| 44 | Ga0070683_100148129 | 3300005329 | Bacteria | 2225 |
| 45 | Ga0070683_100164656 | 3300005329 | Bacteria | 2104 |
| 46 | Ga0070683_100190785 | 3300005329 | Bacteria | 1946 |
| 47 | Ga0070683_100204496 | 3300005329 | Bacteria | 1875 |
| 48 | Ga0070683_100890703 | 3300005329 | Bacteria | 853 |
| 49 | Ga0070683_101207398 | 3300005329 | Bacteria | 727 |
| 50 | Ga0070690_100074756 | 3300005330 | Bacteria | 2207 |
| 51 | Ga0070690_100552771 | 3300005330 | Unclassified | 868 |
| 52 | Ga0070670_100091108 | 3300005331 | Bacteria | 2621 |
| 53 | Ga0070670_100555444 | 3300005331 | Bacteria | 1025 |
| 54 | Ga0070670_100559526 | 3300005331 | Bacteria | 1021 |
| 55 | Ga0070670_100618898 | 3300005331 | Bacteria | 970 |
| 56 | Ga0070670_100664503 | 3300005331 | Bacteria | 935 |
| 57 | Ga0070670_101099977 | 3300005331 | Bacteria | 725 |
| 58 | Ga0070677_10371602 | 3300005333 | Bacteria | 746 |
| 59 | Ga0070677_10737192 | 3300005333 | Unclassified | 558 |
| 60 | Ga0068869_100046521 | 3300005334 | Bacteria | 3129 |
| 61 | Ga0068869_100107791 | 3300005334 | Bacteria | 2116 |
| 62 | Ga0068869_100839218 | 3300005334 | Bacteria | 792 |
| 63 | Ga0068869_100848578 | 3300005334 | Bacteria | 788 |
| 64 | Ga0070666_10269224 | 3300005335 | Bacteria | 1209 |
| 65 | Ga0070666_10335169 | 3300005335 | Bacteria | 1081 |
| 66 | Ga0070680_100008898 | 3300005336 | Bacteria | 7696 |
| 67 | Ga0070680_100060199 | 3300005336 | Bacteria | 3108 |
| 68 | Ga0070680_100485896 | 3300005336 | Bacteria | 1056 |
| 69 | Ga0070680_100630449 | 3300005336 | Bacteria | 921 |
| 70 | Ga0070682_100101276 | 3300005337 | Bacteria | 1902 |
| 71 | Ga0070682_100353796 | 3300005337 | Bacteria | 1096 |
| 72 | Ga0070682_101752956 | 3300005337 | Bacteria | 541 |
| 73 | Ga0068868_100022080 | 3300005338 | Bacteria | 4799 |
| 74 | Ga0070660_100046383 | 3300005339 | Bacteria | 3331 |
| 75 | Ga0070660_100085134 | 3300005339 | Bacteria | 2486 |
| 76 | Ga0070689_100016259 | 3300005340 | Bacteria | 5442 |
| 77 | Ga0070689_100071117 | 3300005340 | Bacteria | 2717 |
| 78 | Ga0070689_101144659 | 3300005340 | Bacteria | 697 |
| 79 | Ga0070687_100010285 | 3300005343 | Bacteria | 4040 |
| 80 | Ga0070687_100095140 | 3300005343 | Bacteria | 1656 |
| 81 | Ga0070687_100391455 | 3300005343 | Bacteria | 909 |
| 82 | Ga0070687_101106785 | 3300005343 | Bacteria | 580 |
| 83 | Ga0070661_100002072 | 3300005344 | Bacteria | 13801 |
| 84 | Ga0070661_100021059 | 3300005344 | Bacteria | 4656 |
| 85 | Ga0070661_100022798 | 3300005344 | Bacteria | 4483 |
| 86 | Ga0070661_100804232 | 3300005344 | Bacteria | 772 |
| 87 | Ga0070661_100823882 | 3300005344 | Bacteria | 762 |
| 88 | Ga0070661_101005954 | 3300005344 | Bacteria | 692 |
| 89 | Ga0070692_10064111 | 3300005345 | Bacteria | 1943 |
| 90 | Ga0070668_100034983 | 3300005347 | Bacteria | 3829 |
| 91 | Ga0070668_100054067 | 3300005347 | Bacteria | 3097 |
| 92 | Ga0070668_100785826 | 3300005347 | Bacteria | 845 |
| 93 | Ga0070669_100001824 | 3300005353 | Bacteria | 15341 |
| 94 | Ga0070669_100089004 | 3300005353 | Bacteria | 2311 |
| 95 | Ga0070675_100001147 | 3300005354 | Bacteria | 19118 |
| 96 | Ga0070675_100033024 | 3300005354 | Bacteria | 4192 |
| 97 | Ga0070675_100143974 | 3300005354 | Unclassified | 2039 |
| 98 | Ga0070675_100221505 | 3300005354 | Bacteria | 1648 |
| 99 | Ga0070675_101260582 | 3300005354 | Bacteria | 681 |
| 100 | Ga0070671_100179082 | 3300005355 | Bacteria | 1794 |
| 101 | Ga0070671_100312256 | 3300005355 | Bacteria | 1339 |
| 102 | Ga0070671_100564838 | 3300005355 | Bacteria | 982 |
| 103 | Ga0070673_100062378 | 3300005364 | Bacteria | 2961 |
| 104 | Ga0070673_100419539 | 3300005364 | Bacteria | 1199 |
| 105 | Ga0070688_100038678 | 3300005365 | Bacteria | 2914 |
| 106 | Ga0070688_100343518 | 3300005365 | Bacteria | 1091 |
| 107 | Ga0070688_100485119 | 3300005365 | Bacteria | 930 |
| 108 | Ga0070688_100550927 | 3300005365 | Bacteria | 877 |
| 109 | Ga0070688_100571762 | 3300005365 | Bacteria | 862 |
| 110 | Ga0070659_100037782 | 3300005366 | Bacteria | 3765 |
| 111 | Ga0070659_100087344 | 3300005366 | Bacteria | 2496 |
| 112 | Ga0070659_100117239 | 3300005366 | Bacteria | 2153 |
| 113 | Ga0070659_100264869 | 3300005366 | Bacteria | 1427 |
| 114 | Ga0070659_100448035 | 3300005366 | Bacteria | 1095 |
| 115 | Ga0070659_100483195 | 3300005366 | Bacteria | 1054 |
| 116 | Ga0070659_100771709 | 3300005366 | Bacteria | 835 |
| 117 | Ga0070659_101284901 | 3300005366 | Bacteria | 649 |
| 118 | Ga0070667_100064211 | 3300005367 | Bacteria | 3114 |
| 119 | Ga0070667_100314189 | 3300005367 | Bacteria | 1413 |
| 120 | Ga0070667_100575319 | 3300005367 | Bacteria | 1037 |
| 121 | Ga0070667_100836368 | 3300005367 | Bacteria | 855 |
| 122 | Ga0070667_101047847 | 3300005367 | Bacteria | 762 |
| 123 | Ga0070667_101710805 | 3300005367 | Bacteria | 592 |
| 124 | Ga0070703_10257965 | 3300005406 | Unclassified | 710 |
| 125 | Ga0070703_10575581 | 3300005406 | Bacteria | 517 |
| 126 | Ga0070701_10023737 | 3300005438 | Bacteria | 2958 |
| 127 | Ga0070701_10333854 | 3300005438 | Bacteria | 942 |
| 128 | Ga0070705_100005429 | 3300005440 | Bacteria | 6211 |
| 129 | Ga0070705_101201364 | 3300005440 | Bacteria | 625 |
| 130 | Ga0070705_101390433 | 3300005440 | Bacteria | 585 |
| 131 | Ga0070700_100028866 | 3300005441 | Bacteria | 3305 |
| 132 | Ga0070700_100125557 | 3300005441 | Bacteria | 1725 |
| 133 | Ga0070700_100262775 | 3300005441 | Bacteria | 1244 |
| 134 | Ga0070694_100046697 | 3300005444 | Bacteria | 2909 |
| 135 | Ga0070694_100467427 | 3300005444 | Bacteria | 999 |
| 136 | Ga0070694_100667087 | 3300005444 | Bacteria | 843 |
| 137 | Ga0070663_100624087 | 3300005455 | Bacteria | 909 |
| 138 | Ga0070663_101055043 | 3300005455 | Bacteria | 709 |
| 139 | Ga0070678_100185328 | 3300005456 | Bacteria | 1707 |
| 140 | Ga0070678_101792386 | 3300005456 | Bacteria | 579 |
| 141 | Ga0070662_100013116 | 3300005457 | Bacteria | 5508 |
| 142 | Ga0070662_100064872 | 3300005457 | Bacteria | 2675 |
| 143 | Ga0070662_100066832 | 3300005457 | Bacteria | 2639 |
| 144 | Ga0070662_100225888 | 3300005457 | Bacteria | 1496 |
| 145 | Ga0070662_100422641 | 3300005457 | Bacteria | 1103 |
| 146 | Ga0070662_101260712 | 3300005457 | Bacteria | 636 |
| 147 | Ga0070662_101713121 | 3300005457 | Bacteria | 543 |
| 148 | Ga0070681_10008511 | 3300005458 | Bacteria | 10045 |
| 149 | Ga0070681_10008667 | 3300005458 | Bacteria | 9975 |
| 150 | Ga0070681_10014161 | 3300005458 | Bacteria | 7938 |
| 151 | Ga0070681_10017926 | 3300005458 | Bacteria | 7077 |
| 152 | Ga0070681_10127822 | 3300005458 | Bacteria | 2474 |
| 153 | Ga0070681_10350335 | 3300005458 | Bacteria | 1387 |
| 154 | Ga0070681_10503191 | 3300005458 | Bacteria | 1125 |
| 155 | Ga0070681_10558475 | 3300005458 | Bacteria | 1059 |
| 156 | Ga0070681_10916527 | 3300005458 | Unclassified | 795 |
| 157 | Ga0070681_11340398 | 3300005458 | Bacteria | 639 |
| 158 | Ga0070681_11384466 | 3300005458 | Bacteria | 627 |
| 159 | Ga0068867_101095795 | 3300005459 | Bacteria | 727 |
| 160 | Ga0068867_102136684 | 3300005459 | Bacteria | 531 |
| 161 | Ga0070685_10014935 | 3300005466 | Bacteria | 4121 |
| 162 | Ga0070685_10061086 | 3300005466 | Bacteria | 2206 |
| 163 | Ga0070685_10291930 | 3300005466 | Bacteria | 1096 |
| 164 | Ga0070699_100551056 | 3300005518 | Bacteria | 1050 |
| 165 | Ga0070679_100001702 | 3300005530 | Bacteria | 19818 |
| 166 | Ga0070679_100117134 | 3300005530 | Bacteria | 2649 |
| 167 | Ga0070679_100196255 | 3300005530 | Bacteria | 1986 |
| 168 | Ga0070679_100281350 | 3300005530 | Bacteria | 1616 |
| 169 | Ga0070679_100465364 | 3300005530 | Bacteria | 1209 |
| 170 | Ga0070679_100821206 | 3300005530 | Bacteria | 873 |
| 171 | Ga0070684_100013783 | 3300005535 | Bacteria | 6526 |
| 172 | Ga0070684_100082361 | 3300005535 | Bacteria | 2849 |
| 173 | Ga0070684_100087732 | 3300005535 | Bacteria | 2763 |
| 174 | Ga0070684_100113100 | 3300005535 | Bacteria | 2436 |
| 175 | Ga0070684_100128544 | 3300005535 | Bacteria | 2284 |
| 176 | Ga0070684_100137105 | 3300005535 | Bacteria | 2211 |
| 177 | Ga0070684_100400221 | 3300005535 | Bacteria | 1266 |
| 178 | Ga0070684_100595088 | 3300005535 | Bacteria | 1028 |
| 179 | Ga0070684_101559255 | 3300005535 | Bacteria | 623 |
| 180 | Ga0068853_100005407 | 3300005539 | Bacteria | 10005 |
| 181 | Ga0068853_100015819 | 3300005539 | Bacteria | 6195 |
| 182 | Ga0068853_101136693 | 3300005539 | Bacteria | 753 |
| 183 | Ga0070672_100080600 | 3300005543 | Bacteria | 2608 |
| 184 | Ga0070672_100153463 | 3300005543 | Bacteria | 1906 |
| 185 | Ga0070672_100293531 | 3300005543 | Bacteria | 1377 |
| 186 | Ga0070672_100295777 | 3300005543 | Bacteria | 1371 |
| 187 | Ga0070672_100621980 | 3300005543 | Bacteria | 942 |
| 188 | Ga0070686_100143250 | 3300005544 | Bacteria | 1666 |
| 189 | Ga0070686_100304681 | 3300005544 | Bacteria | 1183 |
| 190 | Ga0070686_100520786 | 3300005544 | Bacteria | 926 |
| 191 | Ga0070693_100069750 | 3300005547 | Bacteria | 2067 |
| 192 | Ga0070693_100598019 | 3300005547 | Bacteria | 796 |
| 193 | Ga0070693_100934846 | 3300005547 | Bacteria | 652 |
| 194 | Ga0070693_101113568 | 3300005547 | Bacteria | 603 |
| 195 | Ga0070665_100092233 | 3300005548 | Bacteria | 3034 |
| 196 | Ga0070665_100124658 | 3300005548 | Bacteria | 2578 |
| 197 | Ga0070665_100946435 | 3300005548 | Bacteria | 874 |
| 198 | Ga0070704_100822956 | 3300005549 | Bacteria | 831 |
| 199 | Ga0070704_101079369 | 3300005549 | Bacteria | 728 |
| 200 | Ga0068855_100034057 | 3300005563 | Bacteria | 6077 |
| 201 | Ga0068855_101620525 | 3300005563 | Bacteria | 662 |
| 202 | Ga0070664_100020581 | 3300005564 | Bacteria | 5433 |
| 203 | Ga0070664_100088840 | 3300005564 | Bacteria | 2672 |
| 204 | Ga0070664_100094612 | 3300005564 | Bacteria | 2591 |
| 205 | Ga0070664_100141951 | 3300005564 | Bacteria | 2115 |
| 206 | Ga0070664_100149326 | 3300005564 | Bacteria | 2063 |
| 207 | Ga0070664_100171061 | 3300005564 | Bacteria | 1927 |
| 208 | Ga0070664_100175576 | 3300005564 | Bacteria | 1902 |
| 209 | Ga0070664_100375557 | 3300005564 | Bacteria | 1297 |
| 210 | Ga0070664_100419906 | 3300005564 | Bacteria | 1225 |
| 211 | Ga0070664_100617040 | 3300005564 | Bacteria | 1006 |
| 212 | Ga0070664_100675394 | 3300005564 | Bacteria | 961 |
| 213 | Ga0070664_101070841 | 3300005564 | Bacteria | 759 |
| 214 | Ga0068857_100043819 | 3300005577 | Bacteria | 3969 |
| 215 | Ga0068857_100051176 | 3300005577 | Bacteria | 3663 |
| 216 | Ga0068857_100068506 | 3300005577 | Bacteria | 3158 |
| 217 | Ga0068857_100112028 | 3300005577 | Bacteria | 2453 |
| 218 | Ga0068857_100459159 | 3300005577 | Bacteria | 1192 |
| 219 | Ga0068854_100540134 | 3300005578 | Bacteria | 987 |
| 220 | Ga0068854_101611583 | 3300005578 | Bacteria | 592 |
| 221 | Ga0068856_100102001 | 3300005614 | Bacteria | 2862 |
| 222 | Ga0068856_100180514 | 3300005614 | Bacteria | 2124 |
| 223 | Ga0068856_100843215 | 3300005614 | Bacteria | 936 |
| 224 | Ga0070702_100052170 | 3300005615 | Bacteria | 2345 |
| 225 | Ga0070702_100976558 | 3300005615 | Bacteria | 669 |
| 226 | Ga0068852_100009459 | 3300005616 | Bacteria | 7240 |
| 227 | Ga0068852_100092675 | 3300005616 | Bacteria | 2706 |
| 228 | Ga0068852_100150106 | 3300005616 | Bacteria | 2166 |
| 229 | Ga0068852_100678330 | 3300005616 | Bacteria | 1040 |
| 230 | Ga0068852_100920858 | 3300005616 | Bacteria | 892 |
| 231 | Ga0068852_101209822 | 3300005616 | Bacteria | 777 |
| 232 | Ga0068852_101352754 | 3300005616 | Bacteria | 734 |
| 233 | Ga0068859_100020078 | 3300005617 | Bacteria | 6708 |
| 234 | Ga0068859_100184489 | 3300005617 | Bacteria | 2170 |
| 235 | Ga0068859_100264811 | 3300005617 | Bacteria | 1811 |
| 236 | Ga0068864_100068876 | 3300005618 | Bacteria | 3075 |
| 237 | Ga0068864_100218966 | 3300005618 | Bacteria | 1756 |
| 238 | Ga0068864_100306502 | 3300005618 | Bacteria | 1488 |
| 239 | Ga0068864_100559129 | 3300005618 | Bacteria | 1107 |
| 240 | Ga0068864_100893879 | 3300005618 | Bacteria | 877 |
| 241 | Ga0068864_101261451 | 3300005618 | Bacteria | 739 |
| 242 | Ga0068864_101417493 | 3300005618 | Bacteria | 697 |
| 243 | Ga0068861_100004625 | 3300005719 | Bacteria | 9236 |
| 244 | Ga0068861_100066574 | 3300005719 | Bacteria | 2777 |
| 245 | Ga0068861_100143628 | 3300005719 | Unclassified | 1951 |
| 246 | Ga0068861_100624850 | 3300005719 | Bacteria | 992 |
| 247 | Ga0068861_102551930 | 3300005719 | Bacteria | 515 |
| 248 | Ga0068851_10016073 | 3300005834 | Bacteria | 3576 |
| 249 | Ga0068851_10220794 | 3300005834 | Bacteria | 1065 |
| 250 | Ga0068870_10029793 | 3300005840 | Bacteria | 2752 |
| 251 | Ga0068870_10060121 | 3300005840 | Bacteria | 2039 |
| 252 | Ga0068870_10395524 | 3300005840 | Bacteria | 898 |
| 253 | Ga0068863_100003611 | 3300005841 | Bacteria | 15274 |
| 254 | Ga0068863_100075877 | 3300005841 | Bacteria | 3181 |
| 255 | Ga0068863_100317582 | 3300005841 | Bacteria | 1513 |
| 256 | Ga0068863_100452830 | 3300005841 | Bacteria | 1260 |
| 257 | Ga0068863_100605585 | 3300005841 | Bacteria | 1085 |
| 258 | Ga0068863_100812642 | 3300005841 | Bacteria | 933 |
| 259 | Ga0068858_100021630 | 3300005842 | Bacteria | 6012 |
| 260 | Ga0068858_100491077 | 3300005842 | Bacteria | 1185 |
| 261 | Ga0068858_101245288 | 3300005842 | Bacteria | 732 |
| 262 | Ga0068858_101377475 | 3300005842 | Bacteria | 695 |
| 263 | Ga0068860_100028624 | 3300005843 | Bacteria | 5363 |
| 264 | Ga0068860_100510746 | 3300005843 | Bacteria | 1201 |
| 265 | Ga0068860_101010530 | 3300005843 | Bacteria | 850 |
| 266 | Ga0068862_100009967 | 3300005844 | Bacteria | 7850 |
| 267 | Ga0068862_100021217 | 3300005844 | Bacteria | 5429 |
| 268 | Ga0068862_100158957 | 3300005844 | Bacteria | 2016 |
| 269 | Ga0068862_100185733 | 3300005844 | Bacteria | 1868 |
| 270 | Ga0068862_100521507 | 3300005844 | Bacteria | 1131 |
| 271 | Ga0081455_10434191 | 3300005937 | Bacteria | 902 |
| 272 | Ga0075363_100311093 | 3300006048 | Bacteria | 915 |
| 273 | Ga0075432_10066695 | 3300006058 | Bacteria | 1288 |
| 274 | Ga0075432_10297490 | 3300006058 | Bacteria | 669 |
| 275 | Ga0070712_100650094 | 3300006175 | Bacteria | 896 |
| 276 | Ga0070712_101247602 | 3300006175 | Bacteria | 647 |
| 277 | Ga0075427_10021685 | 3300006194 | Bacteria | 1023 |
| 278 | Ga0097621_100066116 | 3300006237 | Bacteria | 2977 |
| 279 | Ga0097621_101162523 | 3300006237 | Bacteria | 726 |
| 280 | Ga0075428_100017080 | 3300006844 | Bacteria | 8017 |
| 281 | Ga0075428_100093041 | 3300006844 | Bacteria | 3287 |
| 282 | Ga0075428_101203021 | 3300006844 | Bacteria | 799 |
| 283 | Ga0075428_101391601 | 3300006844 | Bacteria | 736 |
| 284 | Ga0075430_100428689 | 3300006846 | Bacteria | 1091 |
| 285 | Ga0075430_100772785 | 3300006846 | Bacteria | 792 |
| 286 | Ga0075430_101084695 | 3300006846 | Bacteria | 659 |
| 287 | Ga0075430_101155436 | 3300006846 | Bacteria | 637 |
| 288 | Ga0075431_100148241 | 3300006847 | Bacteria | 2417 |
| 289 | Ga0075431_100615164 | 3300006847 | Bacteria | 1069 |
| 290 | Ga0075433_10025380 | 3300006852 | Bacteria | 5009 |
| 291 | Ga0075433_10074113 | 3300006852 | Bacteria | 2995 |
| 292 | Ga0075433_10144868 | 3300006852 | Bacteria | 2112 |
| 293 | Ga0075434_100006240 | 3300006871 | Bacteria | 10918 |
| 294 | Ga0075434_100105101 | 3300006871 | Bacteria | 2834 |
| 295 | Ga0075434_100353241 | 3300006871 | Bacteria | 1491 |
| 296 | Ga0075429_100074976 | 3300006880 | Bacteria | 2947 |
| 297 | Ga0075429_100198819 | 3300006880 | Bacteria | 1756 |
| 298 | Ga0068865_100004671 | 3300006881 | Bacteria | 8276 |
| 299 | Ga0068865_100004928 | 3300006881 | Bacteria | 8070 |
| 300 | Ga0068865_101050681 | 3300006881 | Bacteria | 715 |
| 301 | Ga0075436_100014918 | 3300006914 | Bacteria | 5324 |
| 302 | Ga0097620_100020078 | 3300006931 | Bacteria | 6708 |
| 303 | Ga0097620_100184490 | 3300006931 | Bacteria | 2170 |
| 304 | Ga0097620_100264810 | 3300006931 | Bacteria | 1811 |
| 305 | Ga0075435_100084960 | 3300007076 | Bacteria | 2605 |
| 306 | Ga0075435_100580976 | 3300007076 | Bacteria | 971 |
| 307 | Ga0075435_101385799 | 3300007076 | Bacteria | 616 |
| 308 | Ga0105240_10032792 | 3300009093 | Bacteria | 6720 |
| 309 | Ga0105240_11165800 | 3300009093 | Bacteria | 817 |
| 310 | Ga0111539_10017919 | 3300009094 | Bacteria | 8773 |
| 311 | Ga0111539_10049836 | 3300009094 | Bacteria | 4990 |
| 312 | Ga0111539_10080853 | 3300009094 | Bacteria | 3822 |
| 313 | Ga0111539_10094070 | 3300009094 | Bacteria | 3521 |
| 314 | Ga0111539_10108588 | 3300009094 | Bacteria | 3256 |
| 315 | Ga0111539_10167917 | 3300009094 | Bacteria | 2564 |
| 316 | Ga0111539_10255592 | 3300009094 | Bacteria | 2040 |
| 317 | Ga0111539_10656679 | 3300009094 | Bacteria | 1221 |
| 318 | Ga0111539_10726126 | 3300009094 | Bacteria | 1156 |
| 319 | Ga0105245_10279297 | 3300009098 | Bacteria | 1632 |
| 320 | Ga0105247_10155745 | 3300009101 | Bacteria | 1509 |
| 321 | Ga0105247_10425335 | 3300009101 | Bacteria | 952 |
| 322 | Ga0114129_10088126 | 3300009147 | Bacteria | 4304 |
| 323 | Ga0114129_10121071 | 3300009147 | Bacteria | 3602 |
| 324 | Ga0114129_10817026 | 3300009147 | Bacteria | 1188 |
| 325 | Ga0114129_12070114 | 3300009147 | Bacteria | 687 |
| 326 | Ga0114129_13222569 | 3300009147 | Bacteria | 530 |
| 327 | Ga0105243_10552403 | 3300009148 | Bacteria | 1101 |
| 328 | Ga0105243_10751262 | 3300009148 | Bacteria | 956 |
| 329 | Ga0105243_11693957 | 3300009148 | Bacteria | 661 |
| 330 | Ga0105241_10048790 | 3300009174 | Bacteria | 3222 |
| 331 | Ga0105241_11216060 | 3300009174 | Bacteria | 714 |
| 332 | Ga0105242_10059694 | 3300009176 | Bacteria | 3130 |
| 333 | Ga0105242_10717467 | 3300009176 | Unclassified | 980 |
| 334 | Ga0105242_10745422 | 3300009176 | Bacteria | 963 |
| 335 | Ga0105242_11209334 | 3300009176 | Bacteria | 775 |
| 336 | Ga0105242_12129757 | 3300009176 | Bacteria | 605 |
| 337 | Ga0105248_10056165 | 3300009177 | Bacteria | 4416 |
| 338 | Ga0105248_10070473 | 3300009177 | Bacteria | 3926 |
| 339 | Ga0105248_10253628 | 3300009177 | Bacteria | 1980 |
| 340 | Ga0105248_10511315 | 3300009177 | Bacteria | 1354 |
| 341 | Ga0105248_11199304 | 3300009177 | Bacteria | 858 |
| 342 | Ga0105248_11439451 | 3300009177 | Bacteria | 780 |
| 343 | Ga0105248_11492275 | 3300009177 | Bacteria | 765 |
| 344 | Ga0105237_10721189 | 3300009545 | Bacteria | 1003 |
| 345 | Ga0105237_10888068 | 3300009545 | Bacteria | 898 |
| 346 | Ga0105238_10096002 | 3300009551 | Bacteria | 2951 |
| 347 | Ga0105238_10247955 | 3300009551 | Unclassified | 1759 |
| 348 | Ga0105238_10695910 | 3300009551 | Bacteria | 1028 |
| 349 | Ga0105238_10716294 | 3300009551 | Bacteria | 1013 |
| 350 | Ga0105238_10730448 | 3300009551 | Bacteria | 1003 |
| 351 | Ga0105249_10029865 | 3300009553 | Bacteria | 4925 |
| 352 | Ga0105249_10041058 | 3300009553 | Bacteria | 4204 |
| 353 | Ga0105249_10151644 | 3300009553 | Bacteria | 2232 |
| 354 | Ga0105249_10158694 | 3300009553 | Bacteria | 2184 |
| 355 | Ga0105249_10524989 | 3300009553 | Bacteria | 1232 |
| 356 | Ga0105249_11917200 | 3300009553 | Bacteria | 665 |
| 357 | Ga0105239_10004359 | 3300010375 | Bacteria | 16957 |
| 358 | Ga0105239_12667774 | 3300010375 | Bacteria | 583 |
| 359 | Ga0157315_1013431 | 3300012508 | Bacteria | 770 |
| 360 | Ga0157327_1003733 | 3300012512 | Bacteria | 1140 |
| 361 | Ga0157373_10053842 | 3300013100 | Bacteria | 2861 |
| 362 | Ga0157373_10067088 | 3300013100 | Bacteria | 2537 |
| 363 | Ga0157373_10253994 | 3300013100 | Bacteria | 1243 |
| 364 | Ga0157373_10294390 | 3300013100 | Bacteria | 1151 |
| 365 | Ga0157373_10438985 | 3300013100 | Bacteria | 938 |
| 366 | Ga0157373_10458019 | 3300013100 | Bacteria | 918 |
| 367 | Ga0157373_10556809 | 3300013100 | Bacteria | 832 |
| 368 | Ga0157373_10591866 | 3300013100 | Bacteria | 807 |
| 369 | Ga0157373_10739503 | 3300013100 | Bacteria | 722 |
| 370 | Ga0157371_10036763 | 3300013102 | Bacteria | 3506 |
| 371 | Ga0157371_10198700 | 3300013102 | Bacteria | 1437 |
| 372 | Ga0157371_10697026 | 3300013102 | Bacteria | 760 |
| 373 | Ga0157371_11437521 | 3300013102 | Bacteria | 536 |
| 374 | Ga0157370_10016751 | 3300013104 | Bacteria | 7415 |
| 375 | Ga0157370_10084953 | 3300013104 | Bacteria | 2973 |
| 376 | Ga0157370_10648767 | 3300013104 | Bacteria | 965 |
| 377 | Ga0157370_10733419 | 3300013104 | Bacteria | 901 |
| 378 | Ga0157370_10843135 | 3300013104 | Bacteria | 833 |
| 379 | Ga0157370_11141415 | 3300013104 | Bacteria | 704 |
| 380 | Ga0157369_10027504 | 3300013105 | Bacteria | 6304 |
| 381 | Ga0157369_10040652 | 3300013105 | Bacteria | 5076 |
| 382 | Ga0157369_11322528 | 3300013105 | Bacteria | 734 |
| 383 | Ga0157374_10110905 | 3300013296 | Bacteria | 2639 |
| 384 | Ga0157374_10159090 | 3300013296 | Bacteria | 2200 |
| 385 | Ga0157374_10786660 | 3300013296 | Bacteria | 967 |
| 386 | Ga0157378_10221099 | 3300013297 | Bacteria | 1800 |
| 387 | Ga0157378_11371948 | 3300013297 | Bacteria | 749 |
| 388 | Ga0157378_11834058 | 3300013297 | Bacteria | 655 |
| 389 | Ga0163162_10012258 | 3300013306 | Bacteria | 8366 |
| 390 | Ga0163162_11625390 | 3300013306 | Bacteria | 737 |
| 391 | Ga0163162_12315488 | 3300013306 | Bacteria | 617 |
| 392 | Ga0163162_12761386 | 3300013306 | Bacteria | 565 |
| 393 | Ga0157372_10018905 | 3300013307 | Bacteria | 7415 |
| 394 | Ga0157372_10030499 | 3300013307 | Bacteria | 5900 |
| 395 | Ga0157372_10094890 | 3300013307 | Bacteria | 3398 |
| 396 | Ga0157372_10099327 | 3300013307 | Bacteria | 3320 |
| 397 | Ga0157372_10157722 | 3300013307 | Bacteria | 2621 |
| 398 | Ga0157372_10196009 | 3300013307 | Bacteria | 2340 |
| 399 | Ga0157372_10281497 | 3300013307 | Bacteria | 1933 |
| 400 | Ga0157372_10292597 | 3300013307 | Bacteria | 1894 |
| 401 | Ga0157372_10383648 | 3300013307 | Bacteria | 1637 |
| 402 | Ga0157372_10691515 | 3300013307 | Bacteria | 1187 |
| 403 | Ga0157372_11648719 | 3300013307 | Bacteria | 738 |
| 404 | Ga0157372_11673898 | 3300013307 | Bacteria | 732 |
| 405 | Ga0157372_12141682 | 3300013307 | Bacteria | 642 |
| 406 | Ga0157375_10014319 | 3300013308 | Bacteria | 7071 |
| 407 | Ga0157375_10045132 | 3300013308 | Bacteria | 4288 |
| 408 | Ga0157375_10047652 | 3300013308 | Bacteria | 4187 |
| 409 | Ga0157375_10069477 | 3300013308 | Bacteria | 3529 |
| 410 | Ga0157375_10167683 | 3300013308 | Bacteria | 2342 |
| 411 | Ga0157375_10822861 | 3300013308 | Bacteria | 1076 |
| 412 | Ga0157375_12375921 | 3300013308 | Bacteria | 632 |
| 413 | Ga0163163_10131822 | 3300014325 | Bacteria | 2540 |
| 414 | Ga0163163_10215355 | 3300014325 | Bacteria | 1970 |
| 415 | Ga0157380_10125160 | 3300014326 | Bacteria | 2183 |
| 416 | Ga0157380_10162324 | 3300014326 | Bacteria | 1944 |
| 417 | Ga0157377_10008532 | 3300014745 | Bacteria | 5002 |
| 418 | Ga0157377_10028605 | 3300014745 | Bacteria | 3001 |
| 419 | Ga0157377_10100295 | 3300014745 | Bacteria | 1724 |
| 420 | Ga0157377_10451901 | 3300014745 | Bacteria | 887 |
| 421 | Ga0157379_10012695 | 3300014968 | Bacteria | 7362 |
| 422 | Ga0157379_10288858 | 3300014968 | Bacteria | 1493 |
| 423 | Ga0157379_10560193 | 3300014968 | Bacteria | 1064 |
| 424 | Ga0157376_10189927 | 3300014969 | Bacteria | 1883 |
| 425 | Ga0157376_11630474 | 3300014969 | Bacteria | 680 |
| 426 | Ga0157376_12371917 | 3300014969 | Bacteria | 570 |
| 427 | Ga0157376_12758708 | 3300014969 | Bacteria | 531 |
| 428 | Ga0182007_10301113 | 3300015262 | Bacteria | 589 |
| 429 | Ga0163161_10018510 | 3300017792 | Bacteria | 4880 |
| 430 | Ga0163161_10602091 | 3300017792 | Bacteria | 906 |
| 431 | Ga0163161_11175931 | 3300017792 | Unclassified | 662 |
| 432 | Ga0206353_10233494 | 3300020082 | Bacteria | 674 |
| 433 | Ga0213876_10003094 | 3300021384 | Bacteria | 9634 |
| 434 | Ga0213876_10011231 | 3300021384 | Bacteria | 4785 |
| 435 | Ga0209673_1004145 | 3300025273 | Bacteria | 7935 |
| 436 | Ga0209130_1007131 | 3300025284 | Bacteria | 3501 |
| 437 | Ga0209675_1006161 | 3300025291 | Bacteria | 4875 |
| 438 | Ga0209675_1012769 | 3300025291 | Bacteria | 2680 |
| 439 | Ga0209676_1000764 | 3300025292 | Bacteria | 43254 |
| 440 | Ga0209676_1001068 | 3300025292 | Bacteria | 31254 |
| 441 | Ga0209025_1001810 | 3300025294 | Bacteria | 25285 |
| 442 | Ga0209025_1024030 | 3300025294 | Bacteria | 3162 |
| 443 | Ga0209025_1075421 | 3300025294 | Bacteria | 1173 |
| 444 | Ga0209564_1005861 | 3300025295 | Bacteria | 6831 |
| 445 | Ga0209564_1016181 | 3300025295 | Bacteria | 2985 |
| 446 | Ga0209758_1040504 | 3300025297 | Bacteria | 1756 |
| 447 | Ga0209050_1005038 | 3300025298 | Bacteria | 8559 |
| 448 | Ga0209050_1017947 | 3300025298 | Bacteria | 2784 |
| 449 | Ga0209256_1000575 | 3300025299 | Bacteria | 52523 |
| 450 | Ga0209256_1002249 | 3300025299 | Bacteria | 16404 |
| 451 | Ga0209051_1006260 | 3300025303 | Bacteria | 6747 |
| 452 | Ga0209257_1000065 | 3300025304 | Bacteria | 353604 |
| 453 | Ga0209257_1000498 | 3300025304 | Bacteria | 70112 |
| 454 | Ga0209257_1000593 | 3300025304 | Bacteria | 60449 |
| 455 | Ga0209257_1001112 | 3300025304 | Bacteria | 34948 |
| 456 | Ga0209257_1003126 | 3300025304 | Bacteria | 14788 |
| 457 | Ga0209257_1004270 | 3300025304 | Bacteria | 11268 |
| 458 | Ga0207697_10009866 | 3300025315 | Bacteria | 4106 |
| 459 | Ga0207697_10183676 | 3300025315 | Bacteria | 917 |
| 460 | Ga0207697_10295155 | 3300025315 | Bacteria | 719 |
| 461 | Ga0207656_10016846 | 3300025321 | Bacteria | 2851 |
| 462 | Ga0207656_10046472 | 3300025321 | Bacteria | 1863 |
| 463 | Ga0207656_10060426 | 3300025321 | Bacteria | 1661 |
| 464 | Ga0207682_10139122 | 3300025893 | Bacteria | 1089 |
| 465 | Ga0207682_10431936 | 3300025893 | Unclassified | 623 |
| 466 | Ga0207642_10625636 | 3300025899 | Bacteria | 672 |
| 467 | Ga0207688_10054461 | 3300025901 | Bacteria | 2244 |
| 468 | Ga0207688_10059278 | 3300025901 | Bacteria | 2156 |
| 469 | Ga0207688_10462002 | 3300025901 | Bacteria | 792 |
| 470 | Ga0207680_10094716 | 3300025903 | Bacteria | 1907 |
| 471 | Ga0207680_10278909 | 3300025903 | Bacteria | 1161 |
| 472 | Ga0207647_10050141 | 3300025904 | Bacteria | 2586 |
| 473 | Ga0207647_10257058 | 3300025904 | Bacteria | 1001 |
| 474 | Ga0207645_10011297 | 3300025907 | Bacteria | 6102 |
| 475 | Ga0207643_10042901 | 3300025908 | Bacteria | 2551 |
| 476 | Ga0207643_10201022 | 3300025908 | Bacteria | 1213 |
| 477 | Ga0207705_10024486 | 3300025909 | Bacteria | 4307 |
| 478 | Ga0207705_10049896 | 3300025909 | Bacteria | 3012 |
| 479 | Ga0207705_10200069 | 3300025909 | Bacteria | 1513 |
| 480 | Ga0207705_10656421 | 3300025909 | Bacteria | 816 |
| 481 | Ga0207705_10887568 | 3300025909 | Bacteria | 691 |
| 482 | Ga0207705_10955775 | 3300025909 | Bacteria | 663 |
| 483 | Ga0207705_11400917 | 3300025909 | Bacteria | 531 |
| 484 | Ga0207684_10065996 | 3300025910 | Bacteria | 3073 |
| 485 | Ga0207654_10017730 | 3300025911 | Bacteria | 3727 |
| 486 | Ga0207654_10585418 | 3300025911 | Bacteria | 795 |
| 487 | Ga0207707_10001539 | 3300025912 | Bacteria | 21229 |
| 488 | Ga0207707_10009253 | 3300025912 | Bacteria | 8548 |
| 489 | Ga0207707_10041123 | 3300025912 | Bacteria | 4037 |
| 490 | Ga0207707_10072921 | 3300025912 | Bacteria | 2993 |
| 491 | Ga0207707_10096763 | 3300025912 | Bacteria | 2579 |
| 492 | Ga0207707_10097980 | 3300025912 | Bacteria | 2563 |
| 493 | Ga0207707_10768404 | 3300025912 | Unclassified | 805 |
| 494 | Ga0207695_10064899 | 3300025913 | Bacteria | 3756 |
| 495 | Ga0207671_10567938 | 3300025914 | Bacteria | 904 |
| 496 | Ga0207663_10286707 | 3300025916 | Bacteria | 1225 |
| 497 | Ga0207660_10007070 | 3300025917 | Bacteria | 7272 |
| 498 | Ga0207660_10012283 | 3300025917 | Bacteria | 5600 |
| 499 | Ga0207660_10372285 | 3300025917 | Bacteria | 1147 |
| 500 | Ga0207660_10663877 | 3300025917 | Bacteria | 850 |
| 501 | Ga0207662_10014013 | 3300025918 | Bacteria | 4491 |
| 502 | Ga0207662_10054696 | 3300025918 | Bacteria | 2381 |
| 503 | Ga0207657_10024845 | 3300025919 | Bacteria | 5538 |
| 504 | Ga0207657_10086708 | 3300025919 | Bacteria | 2620 |
| 505 | Ga0207657_10191899 | 3300025919 | Bacteria | 1647 |
| 506 | Ga0207649_10019705 | 3300025920 | Bacteria | 3860 |
| 507 | Ga0207649_10033784 | 3300025920 | Bacteria | 3059 |
| 508 | Ga0207649_10066165 | 3300025920 | Bacteria | 2290 |
| 509 | Ga0207649_10518634 | 3300025920 | Bacteria | 908 |
| 510 | Ga0207652_10067634 | 3300025921 | Bacteria | 3098 |
| 511 | Ga0207652_10104068 | 3300025921 | Bacteria | 2510 |
| 512 | Ga0207652_10618453 | 3300025921 | Bacteria | 970 |
| 513 | Ga0207652_11362043 | 3300025921 | Bacteria | 613 |
| 514 | Ga0207652_11747936 | 3300025921 | Bacteria | 527 |
| 515 | Ga0207681_10013719 | 3300025923 | Bacteria | 5018 |
| 516 | Ga0207681_10511789 | 3300025923 | Bacteria | 984 |
| 517 | Ga0207694_10249068 | 3300025924 | Unclassified | 1453 |
| 518 | Ga0207694_10742799 | 3300025924 | Bacteria | 828 |
| 519 | Ga0207694_10922372 | 3300025924 | Bacteria | 739 |
| 520 | Ga0207650_10050200 | 3300025925 | Bacteria | 3084 |
| 521 | Ga0207650_10067932 | 3300025925 | Bacteria | 2676 |
| 522 | Ga0207650_10333562 | 3300025925 | Bacteria | 1244 |
| 523 | Ga0207650_11131566 | 3300025925 | Bacteria | 666 |
| 524 | Ga0207650_11271985 | 3300025925 | Bacteria | 626 |
| 525 | Ga0207659_10079982 | 3300025926 | Bacteria | 2413 |
| 526 | Ga0207659_10252219 | 3300025926 | Bacteria | 1432 |
| 527 | Ga0207659_10275502 | 3300025926 | Bacteria | 1374 |
| 528 | Ga0207659_10297605 | 3300025926 | Bacteria | 1324 |
| 529 | Ga0207659_10418239 | 3300025926 | Unclassified | 1124 |
| 530 | Ga0207659_10634140 | 3300025926 | Bacteria | 912 |
| 531 | Ga0207659_10733871 | 3300025926 | Bacteria | 847 |
| 532 | Ga0207664_10364119 | 3300025929 | Bacteria | 1281 |
| 533 | Ga0207644_10262683 | 3300025931 | Bacteria | 1381 |
| 534 | Ga0207644_10308870 | 3300025931 | Bacteria | 1276 |
| 535 | Ga0207644_10385769 | 3300025931 | Bacteria | 1143 |
| 536 | Ga0207644_10641008 | 3300025931 | Bacteria | 884 |
| 537 | Ga0207690_10016598 | 3300025932 | Bacteria | 4484 |
| 538 | Ga0207690_10026685 | 3300025932 | Bacteria | 3639 |
| 539 | Ga0207690_10128824 | 3300025932 | Bacteria | 1849 |
| 540 | Ga0207690_10330085 | 3300025932 | Bacteria | 1201 |
| 541 | Ga0207690_10795058 | 3300025932 | Bacteria | 782 |
| 542 | Ga0207690_10872051 | 3300025932 | Bacteria | 746 |
| 543 | Ga0207706_10002237 | 3300025933 | Bacteria | 18881 |
| 544 | Ga0207706_10081778 | 3300025933 | Bacteria | 2838 |
| 545 | Ga0207686_10037265 | 3300025934 | Bacteria | 2933 |
| 546 | Ga0207686_11306938 | 3300025934 | Bacteria | 595 |
| 547 | Ga0207709_10647032 | 3300025935 | Bacteria | 841 |
| 548 | Ga0207670_10066576 | 3300025936 | Bacteria | 2475 |
| 549 | Ga0207670_10337339 | 3300025936 | Bacteria | 1190 |
| 550 | Ga0207670_10959984 | 3300025936 | Bacteria | 718 |
| 551 | Ga0207670_11932016 | 3300025936 | Bacteria | 502 |
| 552 | Ga0207669_10727829 | 3300025937 | Bacteria | 817 |
| 553 | Ga0207704_10027971 | 3300025938 | Bacteria | 3121 |
| 554 | Ga0207704_10124939 | 3300025938 | Bacteria | 1769 |
| 555 | Ga0207704_11716438 | 3300025938 | Bacteria | 540 |
| 556 | Ga0207691_10046847 | 3300025940 | Bacteria | 3971 |
| 557 | Ga0207691_10097144 | 3300025940 | Bacteria | 2633 |
| 558 | Ga0207691_10099416 | 3300025940 | Bacteria | 2597 |
| 559 | Ga0207691_10125146 | 3300025940 | Bacteria | 2275 |
| 560 | Ga0207691_10222306 | 3300025940 | Bacteria | 1637 |
| 561 | Ga0207711_10041786 | 3300025941 | Bacteria | 3905 |
| 562 | Ga0207711_10473336 | 3300025941 | Bacteria | 1167 |
| 563 | Ga0207689_10037078 | 3300025942 | Bacteria | 4046 |
| 564 | Ga0207689_10201212 | 3300025942 | Bacteria | 1644 |
| 565 | Ga0207689_10546033 | 3300025942 | Unclassified | 973 |
| 566 | Ga0207689_11091049 | 3300025942 | Bacteria | 673 |
| 567 | Ga0207661_10002394 | 3300025944 | Bacteria | 12915 |
| 568 | Ga0207661_10028189 | 3300025944 | Bacteria | 4298 |
| 569 | Ga0207661_10085411 | 3300025944 | Bacteria | 2616 |
| 570 | Ga0207661_10106480 | 3300025944 | Bacteria | 2364 |
| 571 | Ga0207661_10168154 | 3300025944 | Bacteria | 1907 |
| 572 | Ga0207661_10189880 | 3300025944 | Bacteria | 1800 |
| 573 | Ga0207661_10362443 | 3300025944 | Bacteria | 1309 |
| 574 | Ga0207661_10868878 | 3300025944 | Bacteria | 830 |
| 575 | Ga0207661_10876897 | 3300025944 | Bacteria | 826 |
| 576 | Ga0207661_10879246 | 3300025944 | Bacteria | 825 |
| 577 | Ga0207679_10002284 | 3300025945 | Bacteria | 11824 |
| 578 | Ga0207679_10041988 | 3300025945 | Bacteria | 3283 |
| 579 | Ga0207679_10077744 | 3300025945 | Bacteria | 2526 |
| 580 | Ga0207679_10163265 | 3300025945 | Bacteria | 1826 |
| 581 | Ga0207679_10185497 | 3300025945 | Bacteria | 1724 |
| 582 | Ga0207679_10208189 | 3300025945 | Bacteria | 1638 |
| 583 | Ga0207679_10288698 | 3300025945 | Bacteria | 1409 |
| 584 | Ga0207679_10380007 | 3300025945 | Bacteria | 1238 |
| 585 | Ga0207679_10424722 | 3300025945 | Bacteria | 1174 |
| 586 | Ga0207679_10453408 | 3300025945 | Bacteria | 1138 |
| 587 | Ga0207679_10613656 | 3300025945 | Bacteria | 981 |
| 588 | Ga0207679_10977952 | 3300025945 | Bacteria | 775 |
| 589 | Ga0207679_11207135 | 3300025945 | Bacteria | 694 |
| 590 | Ga0207679_11826462 | 3300025945 | Bacteria | 555 |
| 591 | Ga0207667_10231860 | 3300025949 | Bacteria | 1890 |
| 592 | Ga0207667_10605382 | 3300025949 | Bacteria | 1105 |
| 593 | Ga0207667_11039029 | 3300025949 | Bacteria | 805 |
| 594 | Ga0207667_11899658 | 3300025949 | Bacteria | 557 |
| 595 | Ga0207667_12032403 | 3300025949 | Bacteria | 534 |
| 596 | Ga0207651_10025055 | 3300025960 | Bacteria | 3702 |
| 597 | Ga0207651_10045633 | 3300025960 | Bacteria | 2941 |
| 598 | Ga0207712_10013793 | 3300025961 | Bacteria | 5184 |
| 599 | Ga0207712_10015567 | 3300025961 | Bacteria | 4910 |
| 600 | Ga0207712_10032907 | 3300025961 | Bacteria | 3502 |
| 601 | Ga0207712_10288438 | 3300025961 | Bacteria | 1342 |
| 602 | Ga0207668_10009889 | 3300025972 | Bacteria | 5733 |
| 603 | Ga0207668_10021866 | 3300025972 | Bacteria | 4084 |
| 604 | Ga0207640_10308730 | 3300025981 | Bacteria | 1255 |
| 605 | Ga0207640_10483521 | 3300025981 | Bacteria | 1028 |
| 606 | Ga0207640_10726259 | 3300025981 | Bacteria | 854 |
| 607 | Ga0207640_11431750 | 3300025981 | Bacteria | 620 |
| 608 | Ga0207640_11514858 | 3300025981 | Bacteria | 603 |
| 609 | Ga0207658_10052857 | 3300025986 | Bacteria | 2999 |
| 610 | Ga0207658_10147742 | 3300025986 | Bacteria | 1911 |
| 611 | Ga0207658_11305173 | 3300025986 | Bacteria | 664 |
| 612 | Ga0207677_10160633 | 3300026023 | Bacteria | 1745 |
| 613 | Ga0207677_10256424 | 3300026023 | Bacteria | 1423 |
| 614 | Ga0207677_11541778 | 3300026023 | Bacteria | 614 |
| 615 | Ga0207703_10023800 | 3300026035 | Bacteria | 4817 |
| 616 | Ga0207703_10425013 | 3300026035 | Bacteria | 1237 |
| 617 | Ga0207703_11019406 | 3300026035 | Bacteria | 794 |
| 618 | Ga0207703_11743076 | 3300026035 | Bacteria | 599 |
| 619 | Ga0207703_11773075 | 3300026035 | Bacteria | 593 |
| 620 | Ga0207639_10016177 | 3300026041 | Bacteria | 5271 |
| 621 | Ga0207639_10063961 | 3300026041 | Bacteria | 2851 |
| 622 | Ga0207639_10336450 | 3300026041 | Bacteria | 1345 |
| 623 | Ga0207639_10592155 | 3300026041 | Bacteria | 1022 |
| 624 | Ga0207639_10915047 | 3300026041 | Bacteria | 820 |
| 625 | Ga0207639_12046953 | 3300026041 | Bacteria | 534 |
| 626 | Ga0207639_12197742 | 3300026041 | Bacteria | 513 |
| 627 | Ga0207678_10044834 | 3300026067 | Bacteria | 3824 |
| 628 | Ga0207678_10411538 | 3300026067 | Bacteria | 1172 |
| 629 | Ga0207708_10032553 | 3300026075 | Bacteria | 3959 |
| 630 | Ga0207708_10528025 | 3300026075 | Bacteria | 992 |
| 631 | Ga0207702_10184662 | 3300026078 | Bacteria | 1922 |
| 632 | Ga0207702_10694463 | 3300026078 | Bacteria | 1003 |
| 633 | Ga0207702_10893626 | 3300026078 | Bacteria | 880 |
| 634 | Ga0207702_11818375 | 3300026078 | Bacteria | 601 |
| 635 | Ga0207641_10103975 | 3300026088 | Bacteria | 2506 |
| 636 | Ga0207641_10325662 | 3300026088 | Bacteria | 1458 |
| 637 | Ga0207641_10693479 | 3300026088 | Bacteria | 1002 |
| 638 | Ga0207641_10913838 | 3300026088 | Bacteria | 872 |
| 639 | Ga0207641_10926881 | 3300026088 | Bacteria | 866 |
| 640 | Ga0207641_11060259 | 3300026088 | Bacteria | 808 |
| 641 | Ga0207648_10040177 | 3300026089 | Bacteria | 4111 |
| 642 | Ga0207648_10146559 | 3300026089 | Bacteria | 2082 |
| 643 | Ga0207648_11191749 | 3300026089 | Bacteria | 715 |
| 644 | Ga0207676_10247055 | 3300026095 | Bacteria | 1604 |
| 645 | Ga0207676_10568584 | 3300026095 | Bacteria | 1085 |
| 646 | Ga0207676_10689996 | 3300026095 | Bacteria | 988 |
| 647 | Ga0207676_10798897 | 3300026095 | Bacteria | 920 |
| 648 | Ga0207676_11063303 | 3300026095 | Bacteria | 799 |
| 649 | Ga0207676_11442351 | 3300026095 | Bacteria | 685 |
| 650 | Ga0207676_12065615 | 3300026095 | Bacteria | 568 |
| 651 | Ga0207674_10008894 | 3300026116 | Bacteria | 11548 |
| 652 | Ga0207674_10047433 | 3300026116 | Bacteria | 4404 |
| 653 | Ga0207674_10056432 | 3300026116 | Bacteria | 3988 |
| 654 | Ga0207674_10122083 | 3300026116 | Bacteria | 2571 |
| 655 | Ga0207674_10488628 | 3300026116 | Bacteria | 1190 |
| 656 | Ga0207675_100000209 | 3300026118 | Bacteria | 54603 |
| 657 | Ga0207675_100002910 | 3300026118 | Bacteria | 16833 |
| 658 | Ga0207675_100594660 | 3300026118 | Bacteria | 1109 |
| 659 | Ga0207675_100668168 | 3300026118 | Bacteria | 1046 |
| 660 | Ga0207675_100805885 | 3300026118 | Bacteria | 953 |
| 661 | Ga0207675_102189842 | 3300026118 | Bacteria | 568 |
| 662 | Ga0207698_10039806 | 3300026142 | Bacteria | 3486 |
| 663 | Ga0207698_10051296 | 3300026142 | Bacteria | 3153 |
| 664 | Ga0207698_10132867 | 3300026142 | Bacteria | 2130 |
| 665 | Ga0207698_11163174 | 3300026142 | Bacteria | 785 |
| 666 | Ga0207698_11330778 | 3300026142 | Bacteria | 733 |
| 667 | Ga0209995_1062771 | 3300027471 | Bacteria | 633 |
| 668 | Ga0209970_1041146 | 3300027614 | Bacteria | 822 |
| 669 | Ga0209974_10093259 | 3300027876 | Bacteria | 1046 |
| 670 | Ga0207428_10009104 | 3300027907 | Bacteria | 8925 |
| 671 | Ga0207428_10054860 | 3300027907 | Bacteria | 3172 |
| 672 | Ga0207428_10067609 | 3300027907 | Bacteria | 2813 |
| 673 | Ga0207428_10155986 | 3300027907 | Bacteria | 1736 |
| 674 | Ga0207428_10221820 | 3300027907 | Bacteria | 1417 |
| 675 | Ga0268266_10237080 | 3300028379 | Bacteria | 1682 |
| 676 | Ga0268266_10246397 | 3300028379 | Bacteria | 1651 |
| 677 | Ga0268266_10383095 | 3300028379 | Bacteria | 1327 |
| 678 | Ga0268266_10691353 | 3300028379 | Bacteria | 983 |
| 679 | Ga0268266_12008685 | 3300028379 | Bacteria | 552 |
| 680 | Ga0268265_10012226 | 3300028380 | Bacteria | 5813 |
| 681 | Ga0268265_10013128 | 3300028380 | Bacteria | 5626 |
| 682 | Ga0268265_10304984 | 3300028380 | Bacteria | 1435 |
| 683 | Ga0268265_11966241 | 3300028380 | Bacteria | 592 |
| 684 | Ga0268264_10087668 | 3300028381 | Bacteria | 2676 |
| 685 | Ga0307517_10549211 | 3300028786 | Bacteria | 578 |
| 686 | Ga0307515_10707329 | 3300028794 | Bacteria | 624 |
| 687 | Ga0307408_100005765 | 3300031548 | Bacteria | 8251 |
| 688 | Ga0307408_100022310 | 3300031548 | Bacteria | 4300 |
| 689 | Ga0307408_100069266 | 3300031548 | Bacteria | 2601 |
| 690 | Ga0307408_100071711 | 3300031548 | Bacteria | 2562 |
| 691 | Ga0307408_100190589 | 3300031548 | Bacteria | 1651 |
| 692 | Ga0307405_10000431 | 3300031731 | Bacteria | 15673 |
| 693 | Ga0307405_10000467 | 3300031731 | Bacteria | 15176 |
| 694 | Ga0307405_10004308 | 3300031731 | Bacteria | 6700 |
| 695 | Ga0307405_10025988 | 3300031731 | Bacteria | 3370 |
| 696 | Ga0307405_10397022 | 3300031731 | Bacteria | 1078 |
| 697 | Ga0307405_10410594 | 3300031731 | Bacteria | 1062 |
| 698 | Ga0307405_11061527 | 3300031731 | Bacteria | 694 |
| 699 | Ga0307405_11490986 | 3300031731 | Bacteria | 594 |
| 700 | Ga0307413_10000553 | 3300031824 | Bacteria | 12502 |
| 701 | Ga0307413_10000611 | 3300031824 | Bacteria | 12000 |
| 702 | Ga0307413_10046328 | 3300031824 | Bacteria | 2584 |
| 703 | Ga0307413_10065562 | 3300031824 | Bacteria | 2262 |
| 704 | Ga0307413_10086659 | 3300031824 | Bacteria | 2025 |
| 705 | Ga0307413_10256133 | 3300031824 | Bacteria | 1301 |
| 706 | Ga0307413_10348001 | 3300031824 | Bacteria | 1142 |
| 707 | Ga0307413_10431682 | 3300031824 | Bacteria | 1040 |
| 708 | Ga0307413_10645769 | 3300031824 | Bacteria | 872 |
| 709 | Ga0307410_10014163 | 3300031852 | Bacteria | 4681 |
| 710 | Ga0307410_10047568 | 3300031852 | Bacteria | 2867 |
| 711 | Ga0307410_10061960 | 3300031852 | Bacteria | 2561 |
| 712 | Ga0307410_10178373 | 3300031852 | Bacteria | 1606 |
| 713 | Ga0307410_10197290 | 3300031852 | Bacteria | 1534 |
| 714 | Ga0307410_10239074 | 3300031852 | Bacteria | 1406 |
| 715 | Ga0307410_10396720 | 3300031852 | Bacteria | 1114 |
| 716 | Ga0307410_10422915 | 3300031852 | Bacteria | 1081 |
| 717 | Ga0307410_11171109 | 3300031852 | Bacteria | 669 |
| 718 | Ga0307406_10002382 | 3300031901 | Bacteria | 10212 |
| 719 | Ga0307406_10005037 | 3300031901 | Bacteria | 7202 |
| 720 | Ga0307406_10014924 | 3300031901 | Bacteria | 4481 |
| 721 | Ga0307406_10035208 | 3300031901 | Bacteria | 3077 |
| 722 | Ga0307406_10053531 | 3300031901 | Bacteria | 2571 |
| 723 | Ga0307406_10063388 | 3300031901 | Bacteria | 2394 |
| 724 | Ga0307406_10143337 | 3300031901 | Bacteria | 1694 |
| 725 | Ga0307406_10200322 | 3300031901 | Bacteria | 1469 |
| 726 | Ga0307406_10229065 | 3300031901 | Bacteria | 1386 |
| 727 | Ga0307407_10000511 | 3300031903 | Bacteria | 12005 |
| 728 | Ga0307407_10004075 | 3300031903 | Bacteria | 6139 |
| 729 | Ga0307407_10041261 | 3300031903 | Bacteria | 2579 |
| 730 | Ga0307407_10161929 | 3300031903 | Bacteria | 1465 |
| 731 | Ga0307407_10250093 | 3300031903 | Bacteria | 1214 |
| 732 | Ga0307407_10275083 | 3300031903 | Bacteria | 1164 |
| 733 | Ga0307407_10329993 | 3300031903 | Bacteria | 1073 |
| 734 | Ga0307407_10883291 | 3300031903 | Bacteria | 685 |
| 735 | Ga0307407_11094928 | 3300031903 | Bacteria | 619 |
| 736 | Ga0307412_10001715 | 3300031911 | Bacteria | 12127 |
| 737 | Ga0307412_10010522 | 3300031911 | Bacteria | 5330 |
| 738 | Ga0307412_10029005 | 3300031911 | Bacteria | 3469 |
| 739 | Ga0307412_10059476 | 3300031911 | Bacteria | 2561 |
| 740 | Ga0307412_10372344 | 3300031911 | Bacteria | 1154 |
| 741 | Ga0307412_10454780 | 3300031911 | Bacteria | 1056 |
| 742 | Ga0307412_12315555 | 3300031911 | Bacteria | 501 |
| 743 | Ga0307409_100000474 | 3300031995 | Bacteria | 17172 |
| 744 | Ga0307409_100004192 | 3300031995 | Bacteria | 8035 |
| 745 | Ga0307409_100066532 | 3300031995 | Bacteria | 2842 |
| 746 | Ga0307409_100072959 | 3300031995 | Bacteria | 2735 |
| 747 | Ga0307409_100462768 | 3300031995 | Bacteria | 1226 |
| 748 | Ga0307409_100913706 | 3300031995 | Bacteria | 892 |
| 749 | Ga0307409_101398726 | 3300031995 | Bacteria | 726 |
| 750 | Ga0307409_101635213 | 3300031995 | Bacteria | 672 |
| 751 | Ga0307416_100000163 | 3300032002 | Bacteria | 38138 |
| 752 | Ga0307416_100000912 | 3300032002 | Bacteria | 15587 |
| 753 | Ga0307416_100001181 | 3300032002 | Bacteria | 14007 |
| 754 | Ga0307416_100018472 | 3300032002 | Bacteria | 4911 |
| 755 | Ga0307416_100040050 | 3300032002 | Bacteria | 3635 |
| 756 | Ga0307416_100092765 | 3300032002 | Bacteria | 2599 |
| 757 | Ga0307416_100252872 | 3300032002 | Bacteria | 1716 |
| 758 | Ga0307416_100310937 | 3300032002 | Bacteria | 1572 |
| 759 | Ga0307416_100716573 | 3300032002 | Bacteria | 1091 |
| 760 | Ga0307416_100854641 | 3300032002 | Bacteria | 1008 |
| 761 | Ga0307416_101074897 | 3300032002 | Bacteria | 909 |
| 762 | Ga0307416_101810145 | 3300032002 | Bacteria | 714 |
| 763 | Ga0307416_102070073 | 3300032002 | Bacteria | 671 |
| 764 | Ga0307414_10001031 | 3300032004 | Bacteria | 14232 |
| 765 | Ga0307414_10002523 | 3300032004 | Bacteria | 9608 |
| 766 | Ga0307414_10129588 | 3300032004 | Bacteria | 1956 |
| 767 | Ga0307414_10143624 | 3300032004 | Bacteria | 1872 |
| 768 | Ga0307414_10314665 | 3300032004 | Bacteria | 1330 |
| 769 | Ga0307414_10326140 | 3300032004 | Bacteria | 1309 |
| 770 | Ga0307414_10460805 | 3300032004 | Bacteria | 1117 |
| 771 | Ga0307411_10000120 | 3300032005 | Bacteria | 24490 |
| 772 | Ga0307411_10003303 | 3300032005 | Bacteria | 7454 |
| 773 | Ga0307411_10010089 | 3300032005 | Bacteria | 5013 |
| 774 | Ga0307411_10058094 | 3300032005 | Bacteria | 2558 |
| 775 | Ga0307411_10122995 | 3300032005 | Bacteria | 1881 |
| 776 | Ga0307411_10163960 | 3300032005 | Bacteria | 1668 |
| 777 | Ga0307411_10262565 | 3300032005 | Bacteria | 1364 |
| 778 | Ga0307411_10276649 | 3300032005 | Bacteria | 1334 |
| 779 | Ga0307411_10798627 | 3300032005 | Bacteria | 831 |
| 780 | Ga0307411_11181599 | 3300032005 | Bacteria | 693 |
| 781 | Ga0307415_100001591 | 3300032126 | Bacteria | 10958 |
| 782 | Ga0307415_100022540 | 3300032126 | Bacteria | 3888 |
| 783 | Ga0307415_100113318 | 3300032126 | Bacteria | 2016 |
| 784 | Ga0307415_100173143 | 3300032126 | Bacteria | 1685 |
| 785 | Ga0307415_100534568 | 3300032126 | Bacteria | 1031 |
| 786 | Ga0307415_100651072 | 3300032126 | Bacteria | 944 |
| 787 | Ga0307415_101396334 | 3300032126 | Bacteria | 666 |
| 788 | Ga0307510_10000276 | 3300033180 | Bacteria | 47201 |
| 789 | Ga0373952_0058003 | 3300035092 | Bacteria | 940 |
| 790 | Ga0373960_0178499 | 3300035121 | Bacteria | 740 |
| 791 | Ga0373946_0419620 | 3300035171 | Unclassified | 678 |
| 792 | Ga0373961_0129810 | 3300035241 | Bacteria | 843 |
| 793 | Ga0373962_0086014 | 3300035242 | Bacteria | 962 |
| 794 | Ga0395899_0122473 | 3300037312 | Bacteria | 1861 |
| 795 | Ga0395900_0001278 | 3300037418 | Bacteria | 30720 |
| 796 | Ga0395900_0261130 | 3300037418 | Bacteria | 1730 |
| 797 | Ga0395898_0002604 | 3300037466 | Bacteria | 21051 |
| 798 | Ga0395898_0023538 | 3300037466 | Bacteria | 6222 |
| 799 | Ga0395898_0170279 | 3300037466 | Bacteria | 2082 |
| 800 | Ga0395905_0086560 | 3300037471 | Bacteria | 2937 |
| 801 | Ga0395905_0247916 | 3300037471 | Bacteria | 1664 |
| 802 | Ga0395905_1815990 | 3300037471 | Bacteria | 515 |
| 803 | Ga0436364_1168503 | 3300037853 | Bacteria | 1213 |
| 804 | Ga0395901_0000327 | 3300038443 | Bacteria | 58568 |
| 805 | Ga0395901_0020475 | 3300038443 | Bacteria | 6770 |
| 806 | Ga0395901_0028345 | 3300038443 | Bacteria | 5758 |
| 807 | Ga0436365_0137719 | 3300039437 | Bacteria | 9772 |
| 808 | Ga0436365_0173963 | 3300039437 | Bacteria | 7447 |
| 809 | Ga0436365_0223687 | 3300039437 | Bacteria | 4786 |
| 810 | Ga0436362_1069022 | 3300039453 | Bacteria | 584 |
| 811 | Ga0439439_0059749 | 3300041406 | Bacteria | 1011 |
| 812 | Ga0439439_0131204 | 3300041406 | Bacteria | 704 |
| 813 | Ga0439453_0017774 | 3300041408 | Bacteria | 1252 |
| 814 | Ga0439461_0012170 | 3300041410 | Bacteria | 1606 |
| 815 | Ga0451800_0683371 | 3300041459 | Bacteria | 697 |
| 816 | Ga0451847_0370653 | 3300041503 | Bacteria | 742 |
| 817 | Ga0451853_1340511 | 3300041512 | Bacteria | 656 |
| 818 | Ga0439433_0031208 | 3300041999 | Bacteria | 1219 |
| 819 | Ga0439441_023866 | 3300042001 | Bacteria | 1145 |
| 820 | Ga0439443_016136 | 3300042003 | Bacteria | 1139 |
| 821 | Ga0439448_0017521 | 3300042005 | Bacteria | 2188 |
| 822 | Ga0439454_048451 | 3300042011 | Bacteria | 712 |
| 823 | Ga0439456_075124 | 3300042013 | Bacteria | 751 |
| 824 | Ga0439462_0078786 | 3300042015 | Bacteria | 899 |
| 825 | Ga0450917_027856 | 3300042120 | Unclassified | 530 |
| 826 | Ga0450923_000962 | 3300042125 | Bacteria | 3571 |
| 827 | Ga0450923_112777 | 3300042125 | Bacteria | 636 |
| 828 | Ga0439446_0001964 | 3300042156 | Bacteria | 4852 |
| 829 | Ga0450908_037959 | 3300042184 | Bacteria | 835 |
| 830 | Ga0439434_0273614 | 3300042435 | Bacteria | 580 |
| 831 | Ga0439435_0001188 | 3300042436 | Bacteria | 4693 |
| 832 | Ga0439444_0000441 | 3300042437 | Bacteria | 4632 |
| 833 | Ga0439444_0028990 | 3300042437 | Bacteria | 1029 |
| 834 | Ga0439459_0071438 | 3300042438 | Bacteria | 804 |
| 835 | Ga0439464_0085150 | 3300042439 | Bacteria | 948 |
| 836 | Ga0439460_0060340 | 3300042461 | Bacteria | 1157 |
| 837 | Ga0451577_0113739 | 3300042876 | Bacteria | 2422 |
| 838 | Ga0453683_0675118 | 3300044673 | Bacteria | 676 |
| 839 | Ga0466961_0380136 | 3300044693 | Bacteria | 858 |
| 840 | Ga0466963_0571023 | 3300044694 | Unclassified | 799 |
| 841 | Ga0453684_0000939 | 3300044712 | Bacteria | 96146 |
| 842 | Ga0466957_0369214 | 3300044842 | Bacteria | 977 |
| 843 | Ga0466957_1371645 | 3300044842 | Bacteria | 514 |
| 844 | Ga0466960_0712625 | 3300044901 | Bacteria | 603 |
| 845 | Ga0451576_0439473 | 3300045051 | Bacteria | 1369 |
| 846 | Ga0451576_1078838 | 3300045051 | Bacteria | 841 |
| 847 | Ga0495629_0097002 | 3300046459 | Bacteria | 2057 |
| 848 | Ga0495638_0361285 | 3300046460 | Bacteria | 764 |
| 849 | Ga0495641_0014204 | 3300046461 | Bacteria | 4320 |
| 850 | Ga0495650_0000027 | 3300046471 | Bacteria | 475071 |
| 851 | Ga0495639_0124882 | 3300046475 | Bacteria | 1229 |
| 852 | Ga0495639_0347010 | 3300046475 | Bacteria | 745 |
| 853 | Ga0495594_0007137 | 3300046499 | Bacteria | 5750 |
| 854 | Ga0495594_0115875 | 3300046499 | Bacteria | 1513 |
| 855 | Ga0495596_0312922 | 3300046500 | Bacteria | 610 |
| 856 | Ga0495628_0905706 | 3300046516 | Bacteria | 612 |
| 857 | Ga0495632_0317082 | 3300046519 | Unclassified | 689 |
| 858 | Ga0495644_0106856 | 3300046523 | Bacteria | 1061 |
| 859 | Ga0495663_0124817 | 3300046525 | Bacteria | 864 |
| 860 | Ga0495621_0115680 | 3300046539 | Bacteria | 1032 |
| 861 | Ga0495625_0202858 | 3300046660 | Bacteria | 1308 |
| 862 | Ga0495661_0415862 | 3300046665 | Bacteria | 652 |
| 863 | Ga0495599_0360437 | 3300046678 | Bacteria | 871 |
| 864 | Ga0495613_0055044 | 3300046689 | Bacteria | 2924 |
| 865 | Ga0495600_0111263 | 3300046809 | Bacteria | 1783 |
| 866 | Ga0495581_0066351 | 3300047315 | Bacteria | 2087 |
| 867 | Ga0495636_0075448 | 3300047318 | Bacteria | 1445 |
| 868 | Ga0495672_0002532 | 3300047320 | Bacteria | 16670 |
| 869 | Ga0495677_0026657 | 3300047445 | Bacteria | 2096 |
| 870 | Ga0495685_041165 | 3300047447 | Bacteria | 1579 |
| 871 | Ga0495684_0858240 | 3300047471 | Bacteria | 588 |
| 872 | Ga0495615_0228489 | 3300048090 | Bacteria | 583 |
| 873 | Ga0496100_0722153 | 3300048903 | Bacteria | 778 |
| 874 | Ga0496102_1730079 | 3300048905 | Bacteria | 543 |
| 875 | Ga0496104_0204205 | 3300048907 | Bacteria | 1888 |
| 876 | Ga0496104_0637565 | 3300048907 | Bacteria | 975 |
| 877 | Ga0496104_0648612 | 3300048907 | Bacteria | 965 |
| 878 | Ga0496105_0189172 | 3300048908 | Bacteria | 1684 |
| 879 | Ga0496105_1004879 | 3300048908 | Bacteria | 624 |
| 880 | Ga0496106_0082749 | 3300048909 | Bacteria | 2468 |
| 881 | Ga0496106_0087337 | 3300048909 | Bacteria | 2403 |
| 882 | Ga0496107_0219086 | 3300048910 | Bacteria | 1416 |
| 883 | Ga0496107_1183726 | 3300048910 | Bacteria | 550 |
| 884 | Ga0496108_0062246 | 3300048911 | Bacteria | 3142 |
| 885 | Ga0496108_0141866 | 3300048911 | Bacteria | 2070 |
| 886 | Ga0496108_0290330 | 3300048911 | Bacteria | 1424 |
| 887 | Ga0496108_0660724 | 3300048911 | Bacteria | 908 |
| 888 | Ga0496109_0030074 | 3300048912 | Bacteria | 4867 |
| 889 | Ga0496109_0269154 | 3300048912 | Bacteria | 1605 |
| 890 | Ga0496109_0375171 | 3300048912 | Bacteria | 1344 |
| 891 | Ga0496109_1537762 | 3300048912 | Bacteria | 600 |
| 892 | Ga0496109_1897623 | 3300048912 | Bacteria | 528 |
| 893 | Ga0496110_0044322 | 3300048913 | Bacteria | 3885 |
| 894 | Ga0496112_0033600 | 3300048915 | Bacteria | 4987 |
| 895 | Ga0496112_0618920 | 3300048915 | Bacteria | 1014 |
| 896 | Ga0496112_1770096 | 3300048915 | Bacteria | 530 |
| 897 | Ga0496113_0122120 | 3300048916 | Bacteria | 2037 |
| 898 | Ga0496113_0216289 | 3300048916 | Bacteria | 1526 |
| 899 | Ga0496115_0108203 | 3300048918 | Bacteria | 2283 |
| 900 | Ga0501291_014518 | 3300049514 | Bacteria | 1180 |
| 901 | Ga0501291_027040 | 3300049514 | Bacteria | 948 |
| 902 | Ga0501296_020584 | 3300049519 | Bacteria | 841 |
| 903 | Ga0501298_038603 | 3300049521 | Bacteria | 962 |
| 904 | Ga0501298_115275 | 3300049521 | Bacteria | 627 |
| 905 | Ga0501031_0740531 | 3300049568 | Bacteria | 631 |
| 906 | Ga0501033_0025163 | 3300049570 | Unclassified | 4484 |
| 907 | Ga0501036_0047981 | 3300049572 | Unclassified | 3616 |
| 908 | Ga0501043_0704935 | 3300049579 | Bacteria | 737 |
| 909 | Ga0501046_0842413 | 3300049580 | Bacteria | 641 |
| 910 | Ga0501047_0151210 | 3300049581 | Bacteria | 2197 |
| 911 | Ga0501047_0787812 | 3300049581 | Bacteria | 766 |
| 912 | Ga0501048_0334005 | 3300049582 | Bacteria | 1080 |
| 913 | Ga0501067_0099968 | 3300049583 | Bacteria | 1611 |
| 914 | Ga0501067_0711961 | 3300049583 | Bacteria | 564 |
| 915 | Ga0501068_0135929 | 3300049584 | Bacteria | 1539 |
| 916 | Ga0501068_0780134 | 3300049584 | Unclassified | 626 |
| 917 | Ga0501070_0017289 | 3300049586 | Bacteria | 6056 |
| 918 | Ga0501070_0310953 | 3300049586 | Bacteria | 1283 |
| 919 | Ga0501071_0132060 | 3300049587 | Bacteria | 1856 |
| 920 | Ga0501072_0273858 | 3300049588 | Bacteria | 1343 |
| 921 | Ga0501072_0391494 | 3300049588 | Bacteria | 1103 |
| 922 | Ga0501075_0335650 | 3300049591 | Bacteria | 1152 |
| 923 | Ga0501076_0184903 | 3300049592 | Bacteria | 1699 |
| 924 | Ga0501077_0219660 | 3300049593 | Bacteria | 1208 |
| 925 | Ga0501077_0618620 | 3300049593 | Bacteria | 696 |
| 926 | Ga0501198_024717 | 3300049649 | Bacteria | 973 |
| 927 | Ga0501202_053375 | 3300049652 | Bacteria | 900 |
| 928 | Ga0501207_033814 | 3300049654 | Bacteria | 869 |
| 929 | Ga0501216_053647 | 3300049660 | Bacteria | 798 |
| 930 | Ga0501217_084532 | 3300049661 | Bacteria | 883 |
| 931 | Ga0501224_031055 | 3300049664 | Bacteria | 800 |
| 932 | Ga0501233_129944 | 3300049668 | Bacteria | 687 |
| 933 | Ga0501233_178262 | 3300049668 | Bacteria | 607 |
| 934 | Ga0501233_259214 | 3300049668 | Bacteria | 525 |
| 935 | Ga0501238_057025 | 3300049671 | Bacteria | 592 |
| 936 | Ga0501246_018320 | 3300049676 | Bacteria | 705 |
| 937 | Ga0501247_015519 | 3300049677 | Bacteria | 952 |
| 938 | Ga0501247_049607 | 3300049677 | Bacteria | 620 |
| 939 | Ga0501249_024916 | 3300049679 | Bacteria | 1319 |
| 940 | Ga0501249_039494 | 3300049679 | Bacteria | 1067 |
| 941 | Ga0501249_067965 | 3300049679 | Bacteria | 830 |
| 942 | Ga0501249_160061 | 3300049679 | Bacteria | 571 |
| 943 | Ga0501250_093189 | 3300049680 | Bacteria | 527 |
| 944 | Ga0501253_066061 | 3300049683 | Bacteria | 790 |
| 945 | Ga0501253_089612 | 3300049683 | Bacteria | 706 |
| 946 | Ga0501257_058817 | 3300049686 | Bacteria | 969 |
| 947 | Ga0501259_030012 | 3300049688 | Bacteria | 1021 |
| 948 | Ga0501259_135490 | 3300049688 | Bacteria | 598 |
| 949 | Ga0501225_0035821 | 3300049705 | Bacteria | 1367 |
| 950 | Ga0501229_074495 | 3300049706 | Bacteria | 536 |
| 951 | Ga0501245_156005 | 3300049708 | Bacteria | 508 |
| 952 | Ga0501080_0270777 | 3300049742 | Bacteria | 1546 |
| 953 | Ga0501080_0747330 | 3300049742 | Bacteria | 860 |
| 954 | Ga0501241_067917 | 3300049758 | Bacteria | 724 |
| 955 | Ga0501263_089368 | 3300049760 | Bacteria | 518 |
| 956 | Ga0501265_077458 | 3300049762 | Bacteria | 572 |
| 957 | Ga0501266_057431 | 3300049763 | Unclassified | 615 |
| 958 | Ga0501266_083037 | 3300049763 | Bacteria | 546 |
| 959 | Ga0501268_005903 | 3300049765 | Bacteria | 1776 |
| 960 | Ga0501269_063891 | 3300049766 | Bacteria | 525 |
| 961 | Ga0501272_034014 | 3300049769 | Bacteria | 658 |
| 962 | Ga0501272_050608 | 3300049769 | Bacteria | 576 |
| 963 | Ga0501272_068084 | 3300049769 | Bacteria | 517 |
| 964 | Ga0501279_049312 | 3300049775 | Bacteria | 664 |
| 965 | Ga0501283_041000 | 3300049779 | Bacteria | 801 |
| 966 | Ga0501283_100161 | 3300049779 | Bacteria | 563 |
| 967 | Ga0501035_0164990 | 3300049822 | Bacteria | 1916 |
| 968 | Ga0501044_0016350 | 3300049823 | Bacteria | 7966 |
| 969 | Ga0501044_0220011 | 3300049823 | Bacteria | 1850 |
| 970 | nmdc:mga03n38_271498_c1 | 3300050490 | Bacteria | 902 |
| 971 | nmdc:mga05p37_1049884_c1 | 3300050507 | Bacteria | 859 |
| 972 | nmdc:mga05p37_112785_c1 | 3300050507 | Bacteria | 3343 |
| 973 | nmdc:mga05p37_1715128_c1 | 3300050507 | Bacteria | 611 |
| 974 | nmdc:mga09592_129339_c1 | 3300050508 | Bacteria | 2172 |
| 975 | nmdc:mga09592_195702_c1 | 3300050508 | Bacteria | 1750 |
| 976 | nmdc:mga0qj67_482812_c1 | 3300050509 | Bacteria | 997 |
| 977 | nmdc:mga06r32_125035_c1 | 3300050510 | Bacteria | 2539 |
| 978 | nmdc:mga06r32_1380961_c1 | 3300050510 | Bacteria | 647 |
| 979 | nmdc:mga06r32_575707_c1 | 3300050510 | Bacteria | 1098 |
| 980 | nmdc:mga06r32_604928_c1 | 3300050510 | Bacteria | 1067 |
| 981 | nmdc:mga08y16_1008304_c1 | 3300050511 | Bacteria | 812 |
| 982 | nmdc:mga08y16_1128336_c1 | 3300050511 | Bacteria | 758 |
| 983 | nmdc:mga08y16_1219967_c1 | 3300050511 | Unclassified | 722 |
| 984 | nmdc:mga08y16_1601200_c1 | 3300050511 | Bacteria | 609 |
| 985 | nmdc:mga08y16_22712_c2 | 3300050511 | Bacteria | 6419 |
| 986 | nmdc:mga08y16_38177_c1 | 3300050511 | Bacteria | 5044 |
| 987 | nmdc:mga08y16_492206_c1 | 3300050511 | Bacteria | 1247 |
| 988 | nmdc:mga08y16_721655_c1 | 3300050511 | Bacteria | 995 |
| 989 | nmdc:mga08y16_9515_c1 | 3300050511 | Bacteria | 10197 |
| 990 | nmdc:mga0n895_14555_c1 | 3300050512 | Bacteria | 7149 |
| 991 | nmdc:mga0n895_25288_c1 | 3300050512 | Bacteria | 5608 |
| 992 | nmdc:mga0n895_74179_c1 | 3300050512 | Bacteria | 3379 |
| 993 | nmdc:mga0rr50_1061802_c1 | 3300050513 | Bacteria | 689 |
| 994 | nmdc:mga0rr50_145246_c1 | 3300050513 | Bacteria | 1912 |
| 995 | nmdc:mga0rr50_171652_c1 | 3300050513 | Bacteria | 1767 |
| 996 | nmdc:mga08x19_22079_c1 | 3300050514 | Bacteria | 3937 |
| 997 | nmdc:mga08x19_6811_c1 | 3300050514 | Bacteria | 6787 |
| 998 | nmdc:mga0a205_171250_c1 | 3300050515 | Bacteria | 2067 |
| 999 | nmdc:mga0a205_26159_c1 | 3300050515 | Bacteria | 5560 |
| 1000 | nmdc:mga0a205_428254_c1 | 3300050515 | Bacteria | 1185 |
| 1001 | nmdc:mga0a205_723661_c1 | 3300050515 | Bacteria | 844 |
| 1002 | Ga0500646_0004679 | 3300053090 | Bacteria | 3458 |
| 1003 | Ga0500646_0101629 | 3300053090 | Bacteria | 903 |
| 1004 | Ga0500554_042253 | 3300053102 | Bacteria | 1404 |
| 1005 | Ga0500628_000202 | 3300053129 | Bacteria | 11575 |
| 1006 | Ga0500652_302633 | 3300053131 | Bacteria | 618 |
| 1007 | Ga0500658_0074588 | 3300053134 | Bacteria | 1439 |
| 1008 | Ga0500568_0033398 | 3300053139 | Bacteria | 2111 |
| 1009 | Ga0500616_0000575 | 3300053153 | Bacteria | 44655 |
| 1010 | Ga0500616_0096194 | 3300053153 | Bacteria | 1456 |
| 1011 | Ga0500622_0006275 | 3300053156 | Bacteria | 6947 |
| 1012 | Ga0500622_0007430 | 3300053156 | Bacteria | 6223 |
| 1013 | Ga0500633_0323998 | 3300053160 | Bacteria | 564 |
| 1014 | Ga0501084_1086663 | 3300054114 | Bacteria | 672 |
| 1015 | Ga0590071_037169 | 3300059421 | Bacteria | 1168 |
| 1016 | Ga0590074_009280 | 3300059423 | Bacteria | 1639 |
| 1017 | Ga0530510_1128322 | 3300061734 | Unclassified | 601 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031731 | Ga0307405_11490986 | Ga0307405_114909861 | 108 |
| 2 | 3300031901 | Ga0307406_10143337 | Ga0307406_101433371 | 108 |
| 3 | 3300031911 | Ga0307412_10372344 | Ga0307412_103723441 | 108 |
| 4 | 3300032002 | Ga0307416_100854641 | Ga0307416_1008546411 | 108 |
| 5 | 3300005328 | Ga0070676_10552157 | Ga0070676_105521571 | 110 |
| 6 | 3300005336 | Ga0070680_100060199 | Ga0070680_1000601992 | 110 |
| 7 | 3300005336 | Ga0070680_100630449 | Ga0070680_1006304492 | 110 |
| 8 | 3300005406 | Ga0070703_10575581 | Ga0070703_105755811 | 110 |
| 9 | 3300005458 | Ga0070681_10014161 | Ga0070681_100141614 | 110 |
| 10 | 3300005530 | Ga0070679_100196255 | Ga0070679_1001962553 | 110 |
| 11 | 3300006844 | Ga0075428_100017080 | Ga0075428_1000170805 | 110 |
| 12 | 3300009094 | Ga0111539_10255592 | Ga0111539_102555922 | 110 |
| 13 | 3300009147 | Ga0114129_10121071 | Ga0114129_101210712 | 110 |
| 14 | 3300012512 | Ga0157327_1003733 | Ga0157327_10037331 | 110 |
| 15 | 3300013297 | Ga0157378_10221099 | Ga0157378_102210992 | 110 |
| 16 | 3300017792 | Ga0163161_11175931 | Ga0163161_111759311 | 110 |
| 17 | 3300025899 | Ga0207642_10625636 | Ga0207642_106256361 | 110 |
| 18 | 3300025910 | Ga0207684_10065996 | Ga0207684_100659961 | 110 |
| 19 | 3300025912 | Ga0207707_10041123 | Ga0207707_100411236 | 110 |
| 20 | 3300025931 | Ga0207644_10308870 | Ga0207644_103088703 | 110 |
| 21 | 3300025937 | Ga0207669_10727829 | Ga0207669_107278292 | 110 |
| 22 | 3300025940 | Ga0207691_10097144 | Ga0207691_100971444 | 110 |
| 23 | 3300025981 | Ga0207640_10726259 | Ga0207640_107262591 | 110 |
| 24 | 3300026089 | Ga0207648_10040177 | Ga0207648_100401775 | 110 |
| 25 | 3300031901 | Ga0307406_10035208 | Ga0307406_100352083 | 110 |
| 26 | 3300032002 | Ga0307416_100092765 | Ga0307416_1000927652 | 110 |
| 27 | 3300042876 | Ga0451577_0113739 | Ga0451577_0113739_417_749 | 110 |
| 28 | 3300044712 | Ga0453684_0000939 | Ga0453684_0000939_10932_11264 | 110 |
| 29 | 3300046461 | Ga0495641_0014204 | Ga0495641_0014204_1561_1911 | 110 |
| 30 | 3300049519 | Ga0501296_020584 | Ga0501296_020584_396_740 | 110 |
| 31 | 3300049679 | Ga0501249_067965 | Ga0501249_067965_10_342 | 110 |
| 32 | 3300049680 | Ga0501250_093189 | Ga0501250_093189_46_390 | 110 |
| 33 | 3300049758 | Ga0501241_067917 | Ga0501241_067917_192_536 | 110 |
| 34 | 3300006194 | Ga0075427_10021685 | Ga0075427_100216852 | 111 |
| 35 | 3300014745 | Ga0157377_10451901 | Ga0157377_104519012 | 111 |
| 36 | 3300025945 | Ga0207679_11826462 | Ga0207679_118264621 | 111 |
| 37 | 3300026089 | Ga0207648_10146559 | Ga0207648_101465591 | 111 |
| 38 | 3300032005 | Ga0307411_11181599 | Ga0307411_111815992 | 111 |
| 39 | 3300033180 | Ga0307510_10000276 | Ga0307510_1000027629 | 111 |
| 40 | 3300041503 | Ga0451847_0370653 | Ga0451847_0370653_70_405 | 111 |
| 41 | 3300044842 | Ga0466957_0369214 | Ga0466957_0369214_304_639 | 111 |
| 42 | 3300046471 | Ga0495650_0000027 | Ga0495650_0000027_299846_300181 | 111 |
| 43 | 3300049568 | Ga0501031_0740531 | Ga0501031_0740531_249_584 | 111 |
| 44 | 3300049570 | Ga0501033_0025163 | Ga0501033_0025163_1233_1568 | 111 |
| 45 | 3300049572 | Ga0501036_0047981 | Ga0501036_0047981_3067_3402 | 111 |
| 46 | 3300049581 | Ga0501047_0787812 | Ga0501047_0787812_359_694 | 111 |
| 47 | 3300049586 | Ga0501070_0310953 | Ga0501070_0310953_100_435 | 111 |
| 48 | 3300049822 | Ga0501035_0164990 | Ga0501035_0164990_769_1104 | 111 |
| 49 | 3300049823 | Ga0501044_0016350 | Ga0501044_0016350_1528_1863 | 111 |
| 50 | 3300005290 | Ga0065712_10008022 | Ga0065712_100080224 | 112 |
| 51 | 3300005293 | Ga0065715_10393698 | Ga0065715_103936982 | 112 |
| 52 | 3300005327 | Ga0070658_10794943 | Ga0070658_107949432 | 112 |
| 53 | 3300005329 | Ga0070683_100890703 | Ga0070683_1008907032 | 112 |
| 54 | 3300005330 | Ga0070690_100074756 | Ga0070690_1000747562 | 112 |
| 55 | 3300005331 | Ga0070670_100664503 | Ga0070670_1006645031 | 112 |
| 56 | 3300005340 | Ga0070689_100071117 | Ga0070689_1000711174 | 112 |
| 57 | 3300005343 | Ga0070687_100095140 | Ga0070687_1000951402 | 112 |
| 58 | 3300005344 | Ga0070661_101005954 | Ga0070661_1010059542 | 112 |
| 59 | 3300005353 | Ga0070669_100089004 | Ga0070669_1000890045 | 112 |
| 60 | 3300005354 | Ga0070675_100033024 | Ga0070675_1000330242 | 112 |
| 61 | 3300005355 | Ga0070671_100179082 | Ga0070671_1001790821 | 112 |
| 62 | 3300005364 | Ga0070673_100419539 | Ga0070673_1004195392 | 112 |
| 63 | 3300005365 | Ga0070688_100485119 | Ga0070688_1004851192 | 112 |
| 64 | 3300005366 | Ga0070659_100771709 | Ga0070659_1007717091 | 112 |
| 65 | 3300005367 | Ga0070667_100064211 | Ga0070667_1000642112 | 112 |
| 66 | 3300005438 | Ga0070701_10333854 | Ga0070701_103338542 | 112 |
| 67 | 3300005455 | Ga0070663_101055043 | Ga0070663_1010550432 | 112 |
| 68 | 3300005457 | Ga0070662_100225888 | Ga0070662_1002258882 | 112 |
| 69 | 3300005458 | Ga0070681_10558475 | Ga0070681_105584751 | 112 |
| 70 | 3300005466 | Ga0070685_10061086 | Ga0070685_100610865 | 112 |
| 71 | 3300005530 | Ga0070679_100281350 | Ga0070679_1002813502 | 112 |
| 72 | 3300005543 | Ga0070672_100080600 | Ga0070672_1000806003 | 112 |
| 73 | 3300005544 | Ga0070686_100520786 | Ga0070686_1005207862 | 112 |
| 74 | 3300005564 | Ga0070664_100141951 | Ga0070664_1001419513 | 112 |
| 75 | 3300005577 | Ga0068857_100051176 | Ga0068857_1000511765 | 112 |
| 76 | 3300005616 | Ga0068852_100920858 | Ga0068852_1009208582 | 112 |
| 77 | 3300005617 | Ga0068859_100020078 | Ga0068859_1000200783 | 112 |
| 78 | 3300005840 | Ga0068870_10029793 | Ga0068870_100297934 | 112 |
| 79 | 3300005842 | Ga0068858_100491077 | Ga0068858_1004910772 | 112 |
| 80 | 3300005844 | Ga0068862_100158957 | Ga0068862_1001589574 | 112 |
| 81 | 3300006931 | Ga0097620_100020078 | Ga0097620_1000200783 | 112 |
| 82 | 3300009094 | Ga0111539_10656679 | Ga0111539_106566792 | 112 |
| 83 | 3300009177 | Ga0105248_11492275 | Ga0105248_114922752 | 112 |
| 84 | 3300009551 | Ga0105238_10247955 | Ga0105238_102479552 | 112 |
| 85 | 3300013308 | Ga0157375_10069477 | Ga0157375_100694776 | 112 |
| 86 | 3300014745 | Ga0157377_10100295 | Ga0157377_101002952 | 112 |
| 87 | 3300014969 | Ga0157376_12371917 | Ga0157376_123719171 | 112 |
| 88 | 3300020082 | Ga0206353_10233494 | Ga0206353_102334941 | 112 |
| 89 | 3300025315 | Ga0207697_10183676 | Ga0207697_101836762 | 112 |
| 90 | 3300025901 | Ga0207688_10059278 | Ga0207688_100592782 | 112 |
| 91 | 3300025903 | Ga0207680_10278909 | Ga0207680_102789092 | 112 |
| 92 | 3300025904 | Ga0207647_10257058 | Ga0207647_102570582 | 112 |
| 93 | 3300025908 | Ga0207643_10042901 | Ga0207643_100429014 | 112 |
| 94 | 3300025909 | Ga0207705_10887568 | Ga0207705_108875682 | 112 |
| 95 | 3300025909 | Ga0207705_10955775 | Ga0207705_109557752 | 112 |
| 96 | 3300025918 | Ga0207662_10054696 | Ga0207662_100546962 | 112 |
| 97 | 3300025921 | Ga0207652_11747936 | Ga0207652_117479362 | 112 |
| 98 | 3300025924 | Ga0207694_10249068 | Ga0207694_102490683 | 112 |
| 99 | 3300025925 | Ga0207650_10050200 | Ga0207650_100502002 | 112 |
| 100 | 3300025926 | Ga0207659_10079982 | Ga0207659_100799824 | 112 |
| 101 | 3300025931 | Ga0207644_10262683 | Ga0207644_102626832 | 112 |
| 102 | 3300025932 | Ga0207690_10872051 | Ga0207690_108720511 | 112 |
| 103 | 3300025936 | Ga0207670_10337339 | Ga0207670_103373392 | 112 |
| 104 | 3300025940 | Ga0207691_10099416 | Ga0207691_100994162 | 112 |
| 105 | 3300025945 | Ga0207679_10613656 | Ga0207679_106136562 | 112 |
| 106 | 3300025986 | Ga0207658_10147742 | Ga0207658_101477422 | 112 |
| 107 | 3300026035 | Ga0207703_10425013 | Ga0207703_104250132 | 112 |
| 108 | 3300026067 | Ga0207678_10411538 | Ga0207678_104115382 | 112 |
| 109 | 3300026116 | Ga0207674_10122083 | Ga0207674_101220832 | 112 |
| 110 | 3300026142 | Ga0207698_11163174 | Ga0207698_111631741 | 112 |
| 111 | 3300037471 | Ga0395905_1815990 | Ga0395905_1815990_97_447 | 112 |
| 112 | 3300042005 | Ga0439448_0017521 | Ga0439448_0017521_42_380 | 112 |
| 113 | 3300042184 | Ga0450908_037959 | Ga0450908_037959_472_810 | 112 |
| 114 | 3300046525 | Ga0495663_0124817 | Ga0495663_0124817_402_740 | 112 |
| 115 | 3300046539 | Ga0495621_0115680 | Ga0495621_0115680_208_546 | 112 |
| 116 | 3300046678 | Ga0495599_0360437 | Ga0495599_0360437_236_574 | 112 |
| 117 | 3300047447 | Ga0495685_041165 | Ga0495685_041165_188_526 | 112 |
| 118 | 3300049583 | Ga0501067_0099968 | Ga0501067_0099968_647_985 | 112 |
| 119 | 3300049584 | Ga0501068_0780134 | Ga0501068_0780134_151_489 | 112 |
| 120 | 3300050511 | nmdc:mga08y16_1008304_c1 | nmdc:mga08y16_1008304_c1_252_590 | 112 |
| 121 | 3300061734 | Ga0530510_1128322 | Ga0530510_1128322_244_582 | 112 |
| 122 | 3300001990 | JGI24737J22298_10236793 | JGI24737J22298_102367931 | 113 |
| 123 | 3300002126 | JGI24035J26624_1011242 | JGI24035J26624_10112422 | 113 |
| 124 | 3300002987 | JGI25159J45721_1024851 | JGI25159J45721_10248512 | 113 |
| 125 | 3300003187 | JGI25151J46595_10086933 | JGI25151J46595_100869331 | 113 |
| 126 | 3300003771 | Ga0055526_1012111 | Ga0055526_10121112 | 113 |
| 127 | 3300003775 | Ga0055524_1000951 | Ga0055524_100095110 | 113 |
| 128 | 3300003775 | Ga0055524_1001641 | Ga0055524_10016417 | 113 |
| 129 | 3300003781 | Ga0055536_1014134 | Ga0055536_10141344 | 113 |
| 130 | 3300003784 | Ga0055534_1008563 | Ga0055534_10085634 | 113 |
| 131 | 3300003790 | Ga0055528_1036653 | Ga0055528_10366531 | 113 |
| 132 | 3300003791 | Ga0055530_10005594 | Ga0055530_100055949 | 113 |
| 133 | 3300003794 | Ga0055531_10001261 | Ga0055531_100012614 | 113 |
| 134 | 3300003794 | Ga0055531_10002230 | Ga0055531_100022309 | 113 |
| 135 | 3300003794 | Ga0055531_10003072 | Ga0055531_1000307211 | 113 |
| 136 | 3300003794 | Ga0055531_10010188 | Ga0055531_100101886 | 113 |
| 137 | 3300003794 | Ga0055531_10030703 | Ga0055531_100307034 | 113 |
| 138 | 3300005289 | Ga0065704_10294183 | Ga0065704_102941832 | 113 |
| 139 | 3300005290 | Ga0065712_10024919 | Ga0065712_100249192 | 113 |
| 140 | 3300005290 | Ga0065712_10078049 | Ga0065712_100780492 | 113 |
| 141 | 3300005290 | Ga0065712_10173609 | Ga0065712_101736093 | 113 |
| 142 | 3300005290 | Ga0065712_10316965 | Ga0065712_103169651 | 113 |
| 143 | 3300005293 | Ga0065715_10348131 | Ga0065715_103481311 | 113 |
| 144 | 3300005293 | Ga0065715_11103161 | Ga0065715_111031611 | 113 |
| 145 | 3300005295 | Ga0065707_10110278 | Ga0065707_101102783 | 113 |
| 146 | 3300005295 | Ga0065707_10115019 | Ga0065707_101150193 | 113 |
| 147 | 3300005295 | Ga0065707_10122585 | Ga0065707_101225854 | 113 |
| 148 | 3300005295 | Ga0065707_10140491 | Ga0065707_101404912 | 113 |
| 149 | 3300005295 | Ga0065707_10531151 | Ga0065707_105311511 | 113 |
| 150 | 3300005327 | Ga0070658_10033753 | Ga0070658_100337532 | 113 |
| 151 | 3300005327 | Ga0070658_10219627 | Ga0070658_102196272 | 113 |
| 152 | 3300005327 | Ga0070658_10708727 | Ga0070658_107087272 | 113 |
| 153 | 3300005327 | Ga0070658_10917744 | Ga0070658_109177442 | 113 |
| 154 | 3300005328 | Ga0070676_10047197 | Ga0070676_100471973 | 113 |
| 155 | 3300005328 | Ga0070676_11102439 | Ga0070676_111024391 | 113 |
| 156 | 3300005329 | Ga0070683_100002327 | Ga0070683_1000023275 | 113 |
| 157 | 3300005329 | Ga0070683_100022612 | Ga0070683_1000226125 | 113 |
| 158 | 3300005329 | Ga0070683_100049118 | Ga0070683_1000491184 | 113 |
| 159 | 3300005329 | Ga0070683_100087981 | Ga0070683_1000879813 | 113 |
| 160 | 3300005329 | Ga0070683_100106856 | Ga0070683_1001068565 | 113 |
| 161 | 3300005329 | Ga0070683_100148129 | Ga0070683_1001481291 | 113 |
| 162 | 3300005329 | Ga0070683_100164656 | Ga0070683_1001646564 | 113 |
| 163 | 3300005329 | Ga0070683_100190785 | Ga0070683_1001907852 | 113 |
| 164 | 3300005329 | Ga0070683_100204496 | Ga0070683_1002044961 | 113 |
| 165 | 3300005329 | Ga0070683_101207398 | Ga0070683_1012073982 | 113 |
| 166 | 3300005330 | Ga0070690_100552771 | Ga0070690_1005527711 | 113 |
| 167 | 3300005331 | Ga0070670_100091108 | Ga0070670_1000911083 | 113 |
| 168 | 3300005331 | Ga0070670_100555444 | Ga0070670_1005554441 | 113 |
| 169 | 3300005331 | Ga0070670_100559526 | Ga0070670_1005595261 | 113 |
| 170 | 3300005331 | Ga0070670_100618898 | Ga0070670_1006188981 | 113 |
| 171 | 3300005331 | Ga0070670_101099977 | Ga0070670_1010999772 | 113 |
| 172 | 3300005333 | Ga0070677_10371602 | Ga0070677_103716022 | 113 |
| 173 | 3300005333 | Ga0070677_10737192 | Ga0070677_107371921 | 113 |
| 174 | 3300005334 | Ga0068869_100046521 | Ga0068869_1000465215 | 113 |
| 175 | 3300005334 | Ga0068869_100107791 | Ga0068869_1001077913 | 113 |
| 176 | 3300005334 | Ga0068869_100839218 | Ga0068869_1008392182 | 113 |
| 177 | 3300005334 | Ga0068869_100848578 | Ga0068869_1008485782 | 113 |
| 178 | 3300005335 | Ga0070666_10269224 | Ga0070666_102692243 | 113 |
| 179 | 3300005335 | Ga0070666_10335169 | Ga0070666_103351692 | 113 |
| 180 | 3300005336 | Ga0070680_100008898 | Ga0070680_1000088984 | 113 |
| 181 | 3300005336 | Ga0070680_100485896 | Ga0070680_1004858962 | 113 |
| 182 | 3300005337 | Ga0070682_100101276 | Ga0070682_1001012761 | 113 |
| 183 | 3300005337 | Ga0070682_100353796 | Ga0070682_1003537963 | 113 |
| 184 | 3300005337 | Ga0070682_101752956 | Ga0070682_1017529561 | 113 |
| 185 | 3300005338 | Ga0068868_100022080 | Ga0068868_1000220807 | 113 |
| 186 | 3300005339 | Ga0070660_100046383 | Ga0070660_1000463836 | 113 |
| 187 | 3300005339 | Ga0070660_100085134 | Ga0070660_1000851343 | 113 |
| 188 | 3300005340 | Ga0070689_100016259 | Ga0070689_1000162595 | 113 |
| 189 | 3300005340 | Ga0070689_101144659 | Ga0070689_1011446591 | 113 |
| 190 | 3300005343 | Ga0070687_100010285 | Ga0070687_1000102853 | 113 |
| 191 | 3300005343 | Ga0070687_100391455 | Ga0070687_1003914552 | 113 |
| 192 | 3300005343 | Ga0070687_101106785 | Ga0070687_1011067851 | 113 |
| 193 | 3300005344 | Ga0070661_100002072 | Ga0070661_1000020728 | 113 |
| 194 | 3300005344 | Ga0070661_100021059 | Ga0070661_1000210594 | 113 |
| 195 | 3300005344 | Ga0070661_100022798 | Ga0070661_1000227983 | 113 |
| 196 | 3300005344 | Ga0070661_100804232 | Ga0070661_1008042322 | 113 |
| 197 | 3300005344 | Ga0070661_100823882 | Ga0070661_1008238822 | 113 |
| 198 | 3300005345 | Ga0070692_10064111 | Ga0070692_100641113 | 113 |
| 199 | 3300005347 | Ga0070668_100034983 | Ga0070668_1000349834 | 113 |
| 200 | 3300005347 | Ga0070668_100054067 | Ga0070668_1000540673 | 113 |
| 201 | 3300005347 | Ga0070668_100785826 | Ga0070668_1007858262 | 113 |
| 202 | 3300005353 | Ga0070669_100001824 | Ga0070669_10000182412 | 113 |
| 203 | 3300005354 | Ga0070675_100001147 | Ga0070675_10000114714 | 113 |
| 204 | 3300005354 | Ga0070675_100143974 | Ga0070675_1001439746 | 113 |
| 205 | 3300005354 | Ga0070675_100221505 | Ga0070675_1002215052 | 113 |
| 206 | 3300005354 | Ga0070675_101260582 | Ga0070675_1012605821 | 113 |
| 207 | 3300005355 | Ga0070671_100312256 | Ga0070671_1003122562 | 113 |
| 208 | 3300005355 | Ga0070671_100564838 | Ga0070671_1005648382 | 113 |
| 209 | 3300005364 | Ga0070673_100062378 | Ga0070673_1000623786 | 113 |
| 210 | 3300005365 | Ga0070688_100038678 | Ga0070688_1000386782 | 113 |
| 211 | 3300005365 | Ga0070688_100343518 | Ga0070688_1003435182 | 113 |
| 212 | 3300005365 | Ga0070688_100550927 | Ga0070688_1005509271 | 113 |
| 213 | 3300005365 | Ga0070688_100571762 | Ga0070688_1005717621 | 113 |
| 214 | 3300005366 | Ga0070659_100037782 | Ga0070659_1000377824 | 113 |
| 215 | 3300005366 | Ga0070659_100087344 | Ga0070659_1000873442 | 113 |
| 216 | 3300005366 | Ga0070659_100117239 | Ga0070659_1001172393 | 113 |
| 217 | 3300005366 | Ga0070659_100264869 | Ga0070659_1002648692 | 113 |
| 218 | 3300005366 | Ga0070659_100448035 | Ga0070659_1004480352 | 113 |
| 219 | 3300005366 | Ga0070659_100483195 | Ga0070659_1004831952 | 113 |
| 220 | 3300005366 | Ga0070659_101284901 | Ga0070659_1012849012 | 113 |
| 221 | 3300005367 | Ga0070667_100314189 | Ga0070667_1003141893 | 113 |
| 222 | 3300005367 | Ga0070667_100575319 | Ga0070667_1005753192 | 113 |
| 223 | 3300005367 | Ga0070667_100836368 | Ga0070667_1008363682 | 113 |
| 224 | 3300005367 | Ga0070667_101047847 | Ga0070667_1010478472 | 113 |
| 225 | 3300005367 | Ga0070667_101710805 | Ga0070667_1017108052 | 113 |
| 226 | 3300005406 | Ga0070703_10257965 | Ga0070703_102579652 | 113 |
| 227 | 3300005438 | Ga0070701_10023737 | Ga0070701_100237374 | 113 |
| 228 | 3300005440 | Ga0070705_100005429 | Ga0070705_1000054291 | 113 |
| 229 | 3300005440 | Ga0070705_101201364 | Ga0070705_1012013642 | 113 |
| 230 | 3300005440 | Ga0070705_101390433 | Ga0070705_1013904332 | 113 |
| 231 | 3300005441 | Ga0070700_100028866 | Ga0070700_1000288662 | 113 |
| 232 | 3300005441 | Ga0070700_100125557 | Ga0070700_1001255572 | 113 |
| 233 | 3300005441 | Ga0070700_100262775 | Ga0070700_1002627751 | 113 |
| 234 | 3300005444 | Ga0070694_100046697 | Ga0070694_1000466972 | 113 |
| 235 | 3300005444 | Ga0070694_100467427 | Ga0070694_1004674272 | 113 |
| 236 | 3300005444 | Ga0070694_100667087 | Ga0070694_1006670871 | 113 |
| 237 | 3300005455 | Ga0070663_100624087 | Ga0070663_1006240872 | 113 |
| 238 | 3300005456 | Ga0070678_100185328 | Ga0070678_1001853282 | 113 |
| 239 | 3300005456 | Ga0070678_101792386 | Ga0070678_1017923861 | 113 |
| 240 | 3300005457 | Ga0070662_100013116 | Ga0070662_1000131166 | 113 |
| 241 | 3300005457 | Ga0070662_100064872 | Ga0070662_1000648725 | 113 |
| 242 | 3300005457 | Ga0070662_100066832 | Ga0070662_1000668323 | 113 |
| 243 | 3300005457 | Ga0070662_100422641 | Ga0070662_1004226412 | 113 |
| 244 | 3300005457 | Ga0070662_101260712 | Ga0070662_1012607122 | 113 |
| 245 | 3300005457 | Ga0070662_101713121 | Ga0070662_1017131212 | 113 |
| 246 | 3300005458 | Ga0070681_10008511 | Ga0070681_100085117 | 113 |
| 247 | 3300005458 | Ga0070681_10008667 | Ga0070681_100086679 | 113 |
| 248 | 3300005458 | Ga0070681_10017926 | Ga0070681_100179263 | 113 |
| 249 | 3300005458 | Ga0070681_10127822 | Ga0070681_101278223 | 113 |
| 250 | 3300005458 | Ga0070681_10350335 | Ga0070681_103503353 | 113 |
| 251 | 3300005458 | Ga0070681_10503191 | Ga0070681_105031912 | 113 |
| 252 | 3300005458 | Ga0070681_10916527 | Ga0070681_109165271 | 113 |
| 253 | 3300005458 | Ga0070681_11340398 | Ga0070681_113403982 | 113 |
| 254 | 3300005458 | Ga0070681_11384466 | Ga0070681_113844662 | 113 |
| 255 | 3300005459 | Ga0068867_101095795 | Ga0068867_1010957951 | 113 |
| 256 | 3300005459 | Ga0068867_102136684 | Ga0068867_1021366841 | 113 |
| 257 | 3300005466 | Ga0070685_10014935 | Ga0070685_100149353 | 113 |
| 258 | 3300005466 | Ga0070685_10291930 | Ga0070685_102919302 | 113 |
| 259 | 3300005518 | Ga0070699_100551056 | Ga0070699_1005510562 | 113 |
| 260 | 3300005530 | Ga0070679_100001702 | Ga0070679_10000170211 | 113 |
| 261 | 3300005530 | Ga0070679_100117134 | Ga0070679_1001171343 | 113 |
| 262 | 3300005530 | Ga0070679_100465364 | Ga0070679_1004653642 | 113 |
| 263 | 3300005530 | Ga0070679_100821206 | Ga0070679_1008212062 | 113 |
| 264 | 3300005535 | Ga0070684_100013783 | Ga0070684_1000137835 | 113 |
| 265 | 3300005535 | Ga0070684_100082361 | Ga0070684_1000823614 | 113 |
| 266 | 3300005535 | Ga0070684_100087732 | Ga0070684_1000877324 | 113 |
| 267 | 3300005535 | Ga0070684_100113100 | Ga0070684_1001131002 | 113 |
| 268 | 3300005535 | Ga0070684_100128544 | Ga0070684_1001285444 | 113 |
| 269 | 3300005535 | Ga0070684_100137105 | Ga0070684_1001371052 | 113 |
| 270 | 3300005535 | Ga0070684_100400221 | Ga0070684_1004002213 | 113 |
| 271 | 3300005535 | Ga0070684_100595088 | Ga0070684_1005950881 | 113 |
| 272 | 3300005535 | Ga0070684_101559255 | Ga0070684_1015592552 | 113 |
| 273 | 3300005539 | Ga0068853_100005407 | Ga0068853_1000054077 | 113 |
| 274 | 3300005539 | Ga0068853_100015819 | Ga0068853_1000158193 | 113 |
| 275 | 3300005539 | Ga0068853_101136693 | Ga0068853_1011366932 | 113 |
| 276 | 3300005543 | Ga0070672_100153463 | Ga0070672_1001534633 | 113 |
| 277 | 3300005543 | Ga0070672_100293531 | Ga0070672_1002935313 | 113 |
| 278 | 3300005543 | Ga0070672_100295777 | Ga0070672_1002957772 | 113 |
| 279 | 3300005543 | Ga0070672_100621980 | Ga0070672_1006219802 | 113 |
| 280 | 3300005544 | Ga0070686_100143250 | Ga0070686_1001432501 | 113 |
| 281 | 3300005544 | Ga0070686_100304681 | Ga0070686_1003046812 | 113 |
| 282 | 3300005547 | Ga0070693_100069750 | Ga0070693_1000697501 | 113 |
| 283 | 3300005547 | Ga0070693_100598019 | Ga0070693_1005980191 | 113 |
| 284 | 3300005547 | Ga0070693_100934846 | Ga0070693_1009348461 | 113 |
| 285 | 3300005547 | Ga0070693_101113568 | Ga0070693_1011135682 | 113 |
| 286 | 3300005548 | Ga0070665_100092233 | Ga0070665_1000922333 | 113 |
| 287 | 3300005548 | Ga0070665_100124658 | Ga0070665_1001246582 | 113 |
| 288 | 3300005548 | Ga0070665_100946435 | Ga0070665_1009464351 | 113 |
| 289 | 3300005549 | Ga0070704_100822956 | Ga0070704_1008229562 | 113 |
| 290 | 3300005549 | Ga0070704_101079369 | Ga0070704_1010793691 | 113 |
| 291 | 3300005563 | Ga0068855_100034057 | Ga0068855_1000340575 | 113 |
| 292 | 3300005563 | Ga0068855_101620525 | Ga0068855_1016205251 | 113 |
| 293 | 3300005564 | Ga0070664_100020581 | Ga0070664_1000205815 | 113 |
| 294 | 3300005564 | Ga0070664_100088840 | Ga0070664_1000888404 | 113 |
| 295 | 3300005564 | Ga0070664_100094612 | Ga0070664_1000946124 | 113 |
| 296 | 3300005564 | Ga0070664_100149326 | Ga0070664_1001493262 | 113 |
| 297 | 3300005564 | Ga0070664_100171061 | Ga0070664_1001710614 | 113 |
| 298 | 3300005564 | Ga0070664_100175576 | Ga0070664_1001755762 | 113 |
| 299 | 3300005564 | Ga0070664_100375557 | Ga0070664_1003755573 | 113 |
| 300 | 3300005564 | Ga0070664_100419906 | Ga0070664_1004199062 | 113 |
| 301 | 3300005564 | Ga0070664_100617040 | Ga0070664_1006170402 | 113 |
| 302 | 3300005564 | Ga0070664_100675394 | Ga0070664_1006753942 | 113 |
| 303 | 3300005564 | Ga0070664_101070841 | Ga0070664_1010708412 | 113 |
| 304 | 3300005577 | Ga0068857_100043819 | Ga0068857_1000438194 | 113 |
| 305 | 3300005577 | Ga0068857_100068506 | Ga0068857_1000685064 | 113 |
| 306 | 3300005577 | Ga0068857_100112028 | Ga0068857_1001120283 | 113 |
| 307 | 3300005577 | Ga0068857_100459159 | Ga0068857_1004591592 | 113 |
| 308 | 3300005578 | Ga0068854_100540134 | Ga0068854_1005401342 | 113 |
| 309 | 3300005578 | Ga0068854_101611583 | Ga0068854_1016115831 | 113 |
| 310 | 3300005614 | Ga0068856_100102001 | Ga0068856_1001020014 | 113 |
| 311 | 3300005614 | Ga0068856_100180514 | Ga0068856_1001805143 | 113 |
| 312 | 3300005614 | Ga0068856_100843215 | Ga0068856_1008432152 | 113 |
| 313 | 3300005615 | Ga0070702_100052170 | Ga0070702_1000521704 | 113 |
| 314 | 3300005615 | Ga0070702_100976558 | Ga0070702_1009765581 | 113 |
| 315 | 3300005616 | Ga0068852_100009459 | Ga0068852_1000094594 | 113 |
| 316 | 3300005616 | Ga0068852_100092675 | Ga0068852_1000926754 | 113 |
| 317 | 3300005616 | Ga0068852_100150106 | Ga0068852_1001501062 | 113 |
| 318 | 3300005616 | Ga0068852_100678330 | Ga0068852_1006783302 | 113 |
| 319 | 3300005616 | Ga0068852_101209822 | Ga0068852_1012098222 | 113 |
| 320 | 3300005616 | Ga0068852_101352754 | Ga0068852_1013527542 | 113 |
| 321 | 3300005617 | Ga0068859_100184489 | Ga0068859_1001844892 | 113 |
| 322 | 3300005617 | Ga0068859_100264811 | Ga0068859_1002648112 | 113 |
| 323 | 3300005618 | Ga0068864_100068876 | Ga0068864_1000688762 | 113 |
| 324 | 3300005618 | Ga0068864_100218966 | Ga0068864_1002189663 | 113 |
| 325 | 3300005618 | Ga0068864_100306502 | Ga0068864_1003065022 | 113 |
| 326 | 3300005618 | Ga0068864_100559129 | Ga0068864_1005591293 | 113 |
| 327 | 3300005618 | Ga0068864_100893879 | Ga0068864_1008938792 | 113 |
| 328 | 3300005618 | Ga0068864_101261451 | Ga0068864_1012614512 | 113 |
| 329 | 3300005618 | Ga0068864_101417493 | Ga0068864_1014174932 | 113 |
| 330 | 3300005719 | Ga0068861_100004625 | Ga0068861_1000046253 | 113 |
| 331 | 3300005719 | Ga0068861_100066574 | Ga0068861_1000665745 | 113 |
| 332 | 3300005719 | Ga0068861_100143628 | Ga0068861_1001436284 | 113 |
| 333 | 3300005719 | Ga0068861_100624850 | Ga0068861_1006248501 | 113 |
| 334 | 3300005719 | Ga0068861_102551930 | Ga0068861_1025519301 | 113 |
| 335 | 3300005834 | Ga0068851_10016073 | Ga0068851_100160735 | 113 |
| 336 | 3300005834 | Ga0068851_10220794 | Ga0068851_102207942 | 113 |
| 337 | 3300005840 | Ga0068870_10060121 | Ga0068870_100601212 | 113 |
| 338 | 3300005840 | Ga0068870_10395524 | Ga0068870_103955242 | 113 |
| 339 | 3300005841 | Ga0068863_100003611 | Ga0068863_10000361112 | 113 |
| 340 | 3300005841 | Ga0068863_100075877 | Ga0068863_1000758774 | 113 |
| 341 | 3300005841 | Ga0068863_100317582 | Ga0068863_1003175823 | 113 |
| 342 | 3300005841 | Ga0068863_100452830 | Ga0068863_1004528303 | 113 |
| 343 | 3300005841 | Ga0068863_100605585 | Ga0068863_1006055852 | 113 |
| 344 | 3300005841 | Ga0068863_100812642 | Ga0068863_1008126422 | 113 |
| 345 | 3300005842 | Ga0068858_100021630 | Ga0068858_1000216305 | 113 |
| 346 | 3300005842 | Ga0068858_101245288 | Ga0068858_1012452882 | 113 |
| 347 | 3300005842 | Ga0068858_101377475 | Ga0068858_1013774752 | 113 |
| 348 | 3300005843 | Ga0068860_100028624 | Ga0068860_1000286243 | 113 |
| 349 | 3300005843 | Ga0068860_100510746 | Ga0068860_1005107462 | 113 |
| 350 | 3300005843 | Ga0068860_101010530 | Ga0068860_1010105302 | 113 |
| 351 | 3300005844 | Ga0068862_100009967 | Ga0068862_1000099675 | 113 |
| 352 | 3300005844 | Ga0068862_100021217 | Ga0068862_1000212176 | 113 |
| 353 | 3300005844 | Ga0068862_100185733 | Ga0068862_1001857332 | 113 |
| 354 | 3300005844 | Ga0068862_100521507 | Ga0068862_1005215073 | 113 |
| 355 | 3300005937 | Ga0081455_10434191 | Ga0081455_104341912 | 113 |
| 356 | 3300006048 | Ga0075363_100311093 | Ga0075363_1003110932 | 113 |
| 357 | 3300006058 | Ga0075432_10066695 | Ga0075432_100666953 | 113 |
| 358 | 3300006058 | Ga0075432_10297490 | Ga0075432_102974902 | 113 |
| 359 | 3300006175 | Ga0070712_100650094 | Ga0070712_1006500942 | 113 |
| 360 | 3300006175 | Ga0070712_101247602 | Ga0070712_1012476022 | 113 |
| 361 | 3300006237 | Ga0097621_100066116 | Ga0097621_1000661162 | 113 |
| 362 | 3300006237 | Ga0097621_101162523 | Ga0097621_1011625231 | 113 |
| 363 | 3300006844 | Ga0075428_100093041 | Ga0075428_1000930412 | 113 |
| 364 | 3300006844 | Ga0075428_101203021 | Ga0075428_1012030212 | 113 |
| 365 | 3300006844 | Ga0075428_101391601 | Ga0075428_1013916012 | 113 |
| 366 | 3300006846 | Ga0075430_100428689 | Ga0075430_1004286892 | 113 |
| 367 | 3300006846 | Ga0075430_100772785 | Ga0075430_1007727852 | 113 |
| 368 | 3300006846 | Ga0075430_101084695 | Ga0075430_1010846951 | 113 |
| 369 | 3300006846 | Ga0075430_101155436 | Ga0075430_1011554362 | 113 |
| 370 | 3300006847 | Ga0075431_100148241 | Ga0075431_1001482413 | 113 |
| 371 | 3300006847 | Ga0075431_100615164 | Ga0075431_1006151642 | 113 |
| 372 | 3300006852 | Ga0075433_10025380 | Ga0075433_100253806 | 113 |
| 373 | 3300006852 | Ga0075433_10074113 | Ga0075433_100741132 | 113 |
| 374 | 3300006852 | Ga0075433_10144868 | Ga0075433_101448681 | 113 |
| 375 | 3300006871 | Ga0075434_100006240 | Ga0075434_10000624013 | 113 |
| 376 | 3300006871 | Ga0075434_100105101 | Ga0075434_1001051012 | 113 |
| 377 | 3300006871 | Ga0075434_100353241 | Ga0075434_1003532411 | 113 |
| 378 | 3300006880 | Ga0075429_100074976 | Ga0075429_1000749762 | 113 |
| 379 | 3300006880 | Ga0075429_100198819 | Ga0075429_1001988192 | 113 |
| 380 | 3300006881 | Ga0068865_100004671 | Ga0068865_1000046718 | 113 |
| 381 | 3300006881 | Ga0068865_100004928 | Ga0068865_1000049286 | 113 |
| 382 | 3300006881 | Ga0068865_101050681 | Ga0068865_1010506811 | 113 |
| 383 | 3300006914 | Ga0075436_100014918 | Ga0075436_1000149185 | 113 |
| 384 | 3300006931 | Ga0097620_100184490 | Ga0097620_1001844902 | 113 |
| 385 | 3300006931 | Ga0097620_100264810 | Ga0097620_1002648102 | 113 |
| 386 | 3300007076 | Ga0075435_100084960 | Ga0075435_1000849604 | 113 |
| 387 | 3300007076 | Ga0075435_100580976 | Ga0075435_1005809762 | 113 |
| 388 | 3300007076 | Ga0075435_101385799 | Ga0075435_1013857992 | 113 |
| 389 | 3300009093 | Ga0105240_10032792 | Ga0105240_100327925 | 113 |
| 390 | 3300009093 | Ga0105240_11165800 | Ga0105240_111658001 | 113 |
| 391 | 3300009094 | Ga0111539_10017919 | Ga0111539_100179199 | 113 |
| 392 | 3300009094 | Ga0111539_10049836 | Ga0111539_100498364 | 113 |
| 393 | 3300009094 | Ga0111539_10080853 | Ga0111539_100808532 | 113 |
| 394 | 3300009094 | Ga0111539_10094070 | Ga0111539_100940702 | 113 |
| 395 | 3300009094 | Ga0111539_10108588 | Ga0111539_101085882 | 113 |
| 396 | 3300009094 | Ga0111539_10167917 | Ga0111539_101679172 | 113 |
| 397 | 3300009094 | Ga0111539_10726126 | Ga0111539_107261263 | 113 |
| 398 | 3300009098 | Ga0105245_10279297 | Ga0105245_102792972 | 113 |
| 399 | 3300009101 | Ga0105247_10155745 | Ga0105247_101557453 | 113 |
| 400 | 3300009101 | Ga0105247_10425335 | Ga0105247_104253352 | 113 |
| 401 | 3300009147 | Ga0114129_10088126 | Ga0114129_100881263 | 113 |
| 402 | 3300009147 | Ga0114129_10817026 | Ga0114129_108170262 | 113 |
| 403 | 3300009147 | Ga0114129_12070114 | Ga0114129_120701142 | 113 |
| 404 | 3300009147 | Ga0114129_13222569 | Ga0114129_132225691 | 113 |
| 405 | 3300009148 | Ga0105243_10552403 | Ga0105243_105524032 | 113 |
| 406 | 3300009148 | Ga0105243_10751262 | Ga0105243_107512622 | 113 |
| 407 | 3300009148 | Ga0105243_11693957 | Ga0105243_116939572 | 113 |
| 408 | 3300009174 | Ga0105241_10048790 | Ga0105241_100487904 | 113 |
| 409 | 3300009174 | Ga0105241_11216060 | Ga0105241_112160601 | 113 |
| 410 | 3300009176 | Ga0105242_10059694 | Ga0105242_100596943 | 113 |
| 411 | 3300009176 | Ga0105242_10717467 | Ga0105242_107174672 | 113 |
| 412 | 3300009176 | Ga0105242_10745422 | Ga0105242_107454222 | 113 |
| 413 | 3300009176 | Ga0105242_11209334 | Ga0105242_112093341 | 113 |
| 414 | 3300009176 | Ga0105242_12129757 | Ga0105242_121297571 | 113 |
| 415 | 3300009177 | Ga0105248_10056165 | Ga0105248_100561654 | 113 |
| 416 | 3300009177 | Ga0105248_10070473 | Ga0105248_100704736 | 113 |
| 417 | 3300009177 | Ga0105248_10253628 | Ga0105248_102536281 | 113 |
| 418 | 3300009177 | Ga0105248_10511315 | Ga0105248_105113151 | 113 |
| 419 | 3300009177 | Ga0105248_11199304 | Ga0105248_111993042 | 113 |
| 420 | 3300009177 | Ga0105248_11439451 | Ga0105248_114394512 | 113 |
| 421 | 3300009545 | Ga0105237_10721189 | Ga0105237_107211892 | 113 |
| 422 | 3300009545 | Ga0105237_10888068 | Ga0105237_108880682 | 113 |
| 423 | 3300009551 | Ga0105238_10096002 | Ga0105238_100960023 | 113 |
| 424 | 3300009551 | Ga0105238_10695910 | Ga0105238_106959101 | 113 |
| 425 | 3300009551 | Ga0105238_10716294 | Ga0105238_107162942 | 113 |
| 426 | 3300009551 | Ga0105238_10730448 | Ga0105238_107304482 | 113 |
| 427 | 3300009553 | Ga0105249_10029865 | Ga0105249_100298654 | 113 |
| 428 | 3300009553 | Ga0105249_10041058 | Ga0105249_100410585 | 113 |
| 429 | 3300009553 | Ga0105249_10151644 | Ga0105249_101516441 | 113 |
| 430 | 3300009553 | Ga0105249_10158694 | Ga0105249_101586941 | 113 |
| 431 | 3300009553 | Ga0105249_10524989 | Ga0105249_105249891 | 113 |
| 432 | 3300009553 | Ga0105249_11917200 | Ga0105249_119172002 | 113 |
| 433 | 3300010375 | Ga0105239_10004359 | Ga0105239_1000435913 | 113 |
| 434 | 3300010375 | Ga0105239_12667774 | Ga0105239_126677742 | 113 |
| 435 | 3300012508 | Ga0157315_1013431 | Ga0157315_10134311 | 113 |
| 436 | 3300013100 | Ga0157373_10053842 | Ga0157373_100538421 | 113 |
| 437 | 3300013100 | Ga0157373_10067088 | Ga0157373_100670883 | 113 |
| 438 | 3300013100 | Ga0157373_10253994 | Ga0157373_102539941 | 113 |
| 439 | 3300013100 | Ga0157373_10294390 | Ga0157373_102943901 | 113 |
| 440 | 3300013100 | Ga0157373_10438985 | Ga0157373_104389852 | 113 |
| 441 | 3300013100 | Ga0157373_10458019 | Ga0157373_104580191 | 113 |
| 442 | 3300013100 | Ga0157373_10556809 | Ga0157373_105568091 | 113 |
| 443 | 3300013100 | Ga0157373_10591866 | Ga0157373_105918661 | 113 |
| 444 | 3300013100 | Ga0157373_10739503 | Ga0157373_107395031 | 113 |
| 445 | 3300013102 | Ga0157371_10036763 | Ga0157371_100367633 | 113 |
| 446 | 3300013102 | Ga0157371_10198700 | Ga0157371_101987003 | 113 |
| 447 | 3300013102 | Ga0157371_10697026 | Ga0157371_106970262 | 113 |
| 448 | 3300013102 | Ga0157371_11437521 | Ga0157371_114375212 | 113 |
| 449 | 3300013104 | Ga0157370_10016751 | Ga0157370_100167516 | 113 |
| 450 | 3300013104 | Ga0157370_10084953 | Ga0157370_100849534 | 113 |
| 451 | 3300013104 | Ga0157370_10648767 | Ga0157370_106487672 | 113 |
| 452 | 3300013104 | Ga0157370_10733419 | Ga0157370_107334191 | 113 |
| 453 | 3300013104 | Ga0157370_10843135 | Ga0157370_108431352 | 113 |
| 454 | 3300013104 | Ga0157370_11141415 | Ga0157370_111414151 | 113 |
| 455 | 3300013105 | Ga0157369_10027504 | Ga0157369_100275046 | 113 |
| 456 | 3300013105 | Ga0157369_10040652 | Ga0157369_100406526 | 113 |
| 457 | 3300013105 | Ga0157369_11322528 | Ga0157369_113225282 | 113 |
| 458 | 3300013296 | Ga0157374_10110905 | Ga0157374_101109054 | 113 |
| 459 | 3300013296 | Ga0157374_10159090 | Ga0157374_101590903 | 113 |
| 460 | 3300013296 | Ga0157374_10786660 | Ga0157374_107866602 | 113 |
| 461 | 3300013297 | Ga0157378_11371948 | Ga0157378_113719482 | 113 |
| 462 | 3300013297 | Ga0157378_11834058 | Ga0157378_118340582 | 113 |
| 463 | 3300013306 | Ga0163162_10012258 | Ga0163162_100122587 | 113 |
| 464 | 3300013306 | Ga0163162_11625390 | Ga0163162_116253901 | 113 |
| 465 | 3300013306 | Ga0163162_12315488 | Ga0163162_123154881 | 113 |
| 466 | 3300013306 | Ga0163162_12761386 | Ga0163162_127613862 | 113 |
| 467 | 3300013307 | Ga0157372_10018905 | Ga0157372_100189058 | 113 |
| 468 | 3300013307 | Ga0157372_10030499 | Ga0157372_100304996 | 113 |
| 469 | 3300013307 | Ga0157372_10094890 | Ga0157372_100948905 | 113 |
| 470 | 3300013307 | Ga0157372_10099327 | Ga0157372_100993272 | 113 |
| 471 | 3300013307 | Ga0157372_10157722 | Ga0157372_101577222 | 113 |
| 472 | 3300013307 | Ga0157372_10196009 | Ga0157372_101960094 | 113 |
| 473 | 3300013307 | Ga0157372_10281497 | Ga0157372_102814973 | 113 |
| 474 | 3300013307 | Ga0157372_10292597 | Ga0157372_102925973 | 113 |
| 475 | 3300013307 | Ga0157372_10383648 | Ga0157372_103836482 | 113 |
| 476 | 3300013307 | Ga0157372_10691515 | Ga0157372_106915152 | 113 |
| 477 | 3300013307 | Ga0157372_11648719 | Ga0157372_116487192 | 113 |
| 478 | 3300013307 | Ga0157372_11673898 | Ga0157372_116738981 | 113 |
| 479 | 3300013307 | Ga0157372_12141682 | Ga0157372_121416822 | 113 |
| 480 | 3300013308 | Ga0157375_10014319 | Ga0157375_100143192 | 113 |
| 481 | 3300013308 | Ga0157375_10045132 | Ga0157375_100451324 | 113 |
| 482 | 3300013308 | Ga0157375_10047652 | Ga0157375_100476524 | 113 |
| 483 | 3300013308 | Ga0157375_10167683 | Ga0157375_101676833 | 113 |
| 484 | 3300013308 | Ga0157375_10822861 | Ga0157375_108228611 | 113 |
| 485 | 3300013308 | Ga0157375_12375921 | Ga0157375_123759211 | 113 |
| 486 | 3300014325 | Ga0163163_10131822 | Ga0163163_101318222 | 113 |
| 487 | 3300014325 | Ga0163163_10215355 | Ga0163163_102153553 | 113 |
| 488 | 3300014326 | Ga0157380_10125160 | Ga0157380_101251602 | 113 |
| 489 | 3300014326 | Ga0157380_10162324 | Ga0157380_101623241 | 113 |
| 490 | 3300014745 | Ga0157377_10008532 | Ga0157377_100085324 | 113 |
| 491 | 3300014745 | Ga0157377_10028605 | Ga0157377_100286053 | 113 |
| 492 | 3300014968 | Ga0157379_10012695 | Ga0157379_100126955 | 113 |
| 493 | 3300014968 | Ga0157379_10288858 | Ga0157379_102888583 | 113 |
| 494 | 3300014968 | Ga0157379_10560193 | Ga0157379_105601931 | 113 |
| 495 | 3300014969 | Ga0157376_10189927 | Ga0157376_101899273 | 113 |
| 496 | 3300014969 | Ga0157376_11630474 | Ga0157376_116304741 | 113 |
| 497 | 3300014969 | Ga0157376_12758708 | Ga0157376_127587082 | 113 |
| 498 | 3300015262 | Ga0182007_10301113 | Ga0182007_103011132 | 113 |
| 499 | 3300017792 | Ga0163161_10018510 | Ga0163161_100185103 | 113 |
| 500 | 3300017792 | Ga0163161_10602091 | Ga0163161_106020911 | 113 |
| 501 | 3300021384 | Ga0213876_10003094 | Ga0213876_100030945 | 113 |
| 502 | 3300021384 | Ga0213876_10011231 | Ga0213876_100112314 | 113 |
| 503 | 3300025273 | Ga0209673_1004145 | Ga0209673_10041456 | 113 |
| 504 | 3300025284 | Ga0209130_1007131 | Ga0209130_10071313 | 113 |
| 505 | 3300025291 | Ga0209675_1006161 | Ga0209675_10061615 | 113 |
| 506 | 3300025291 | Ga0209675_1012769 | Ga0209675_10127694 | 113 |
| 507 | 3300025292 | Ga0209676_1000764 | Ga0209676_100076412 | 113 |
| 508 | 3300025292 | Ga0209676_1001068 | Ga0209676_10010683 | 113 |
| 509 | 3300025294 | Ga0209025_1001810 | Ga0209025_10018106 | 113 |
| 510 | 3300025294 | Ga0209025_1024030 | Ga0209025_10240303 | 113 |
| 511 | 3300025294 | Ga0209025_1075421 | Ga0209025_10754213 | 113 |
| 512 | 3300025295 | Ga0209564_1005861 | Ga0209564_10058617 | 113 |
| 513 | 3300025295 | Ga0209564_1016181 | Ga0209564_10161812 | 113 |
| 514 | 3300025297 | Ga0209758_1040504 | Ga0209758_10405043 | 113 |
| 515 | 3300025298 | Ga0209050_1005038 | Ga0209050_10050388 | 113 |
| 516 | 3300025298 | Ga0209050_1017947 | Ga0209050_10179474 | 113 |
| 517 | 3300025299 | Ga0209256_1000575 | Ga0209256_100057527 | 113 |
| 518 | 3300025299 | Ga0209256_1002249 | Ga0209256_100224911 | 113 |
| 519 | 3300025303 | Ga0209051_1006260 | Ga0209051_10062601 | 113 |
| 520 | 3300025304 | Ga0209257_1000065 | Ga0209257_100006552 | 113 |
| 521 | 3300025304 | Ga0209257_1000498 | Ga0209257_100049868 | 113 |
| 522 | 3300025304 | Ga0209257_1000593 | Ga0209257_100059337 | 113 |
| 523 | 3300025304 | Ga0209257_1001112 | Ga0209257_100111218 | 113 |
| 524 | 3300025304 | Ga0209257_1003126 | Ga0209257_100312618 | 113 |
| 525 | 3300025304 | Ga0209257_1004270 | Ga0209257_10042704 | 113 |
| 526 | 3300025315 | Ga0207697_10009866 | Ga0207697_100098662 | 113 |
| 527 | 3300025315 | Ga0207697_10295155 | Ga0207697_102951552 | 113 |
| 528 | 3300025321 | Ga0207656_10016846 | Ga0207656_100168463 | 113 |
| 529 | 3300025321 | Ga0207656_10046472 | Ga0207656_100464723 | 113 |
| 530 | 3300025321 | Ga0207656_10060426 | Ga0207656_100604262 | 113 |
| 531 | 3300025893 | Ga0207682_10139122 | Ga0207682_101391222 | 113 |
| 532 | 3300025893 | Ga0207682_10431936 | Ga0207682_104319362 | 113 |
| 533 | 3300025901 | Ga0207688_10054461 | Ga0207688_100544612 | 113 |
| 534 | 3300025901 | Ga0207688_10462002 | Ga0207688_104620021 | 113 |
| 535 | 3300025903 | Ga0207680_10094716 | Ga0207680_100947163 | 113 |
| 536 | 3300025904 | Ga0207647_10050141 | Ga0207647_100501414 | 113 |
| 537 | 3300025907 | Ga0207645_10011297 | Ga0207645_100112974 | 113 |
| 538 | 3300025908 | Ga0207643_10201022 | Ga0207643_102010222 | 113 |
| 539 | 3300025909 | Ga0207705_10024486 | Ga0207705_100244863 | 113 |
| 540 | 3300025909 | Ga0207705_10049896 | Ga0207705_100498963 | 113 |
| 541 | 3300025909 | Ga0207705_10200069 | Ga0207705_102000691 | 113 |
| 542 | 3300025909 | Ga0207705_10656421 | Ga0207705_106564211 | 113 |
| 543 | 3300025909 | Ga0207705_11400917 | Ga0207705_114009171 | 113 |
| 544 | 3300025911 | Ga0207654_10017730 | Ga0207654_100177302 | 113 |
| 545 | 3300025911 | Ga0207654_10585418 | Ga0207654_105854182 | 113 |
| 546 | 3300025912 | Ga0207707_10001539 | Ga0207707_1000153912 | 113 |
| 547 | 3300025912 | Ga0207707_10009253 | Ga0207707_100092535 | 113 |
| 548 | 3300025912 | Ga0207707_10072921 | Ga0207707_100729214 | 113 |
| 549 | 3300025912 | Ga0207707_10096763 | Ga0207707_100967633 | 113 |
| 550 | 3300025912 | Ga0207707_10097980 | Ga0207707_100979801 | 113 |
| 551 | 3300025912 | Ga0207707_10768404 | Ga0207707_107684042 | 113 |
| 552 | 3300025913 | Ga0207695_10064899 | Ga0207695_100648992 | 113 |
| 553 | 3300025914 | Ga0207671_10567938 | Ga0207671_105679382 | 113 |
| 554 | 3300025916 | Ga0207663_10286707 | Ga0207663_102867071 | 113 |
| 555 | 3300025917 | Ga0207660_10007070 | Ga0207660_100070703 | 113 |
| 556 | 3300025917 | Ga0207660_10012283 | Ga0207660_100122835 | 113 |
| 557 | 3300025917 | Ga0207660_10372285 | Ga0207660_103722853 | 113 |
| 558 | 3300025917 | Ga0207660_10663877 | Ga0207660_106638772 | 113 |
| 559 | 3300025918 | Ga0207662_10014013 | Ga0207662_100140133 | 113 |
| 560 | 3300025919 | Ga0207657_10024845 | Ga0207657_100248455 | 113 |
| 561 | 3300025919 | Ga0207657_10086708 | Ga0207657_100867083 | 113 |
| 562 | 3300025919 | Ga0207657_10191899 | Ga0207657_101918992 | 113 |
| 563 | 3300025920 | Ga0207649_10019705 | Ga0207649_100197056 | 113 |
| 564 | 3300025920 | Ga0207649_10033784 | Ga0207649_100337845 | 113 |
| 565 | 3300025920 | Ga0207649_10066165 | Ga0207649_100661653 | 113 |
| 566 | 3300025920 | Ga0207649_10518634 | Ga0207649_105186342 | 113 |
| 567 | 3300025921 | Ga0207652_10067634 | Ga0207652_100676344 | 113 |
| 568 | 3300025921 | Ga0207652_10104068 | Ga0207652_101040682 | 113 |
| 569 | 3300025921 | Ga0207652_10618453 | Ga0207652_106184532 | 113 |
| 570 | 3300025921 | Ga0207652_11362043 | Ga0207652_113620432 | 113 |
| 571 | 3300025923 | Ga0207681_10013719 | Ga0207681_100137195 | 113 |
| 572 | 3300025923 | Ga0207681_10511789 | Ga0207681_105117891 | 113 |
| 573 | 3300025924 | Ga0207694_10742799 | Ga0207694_107427991 | 113 |
| 574 | 3300025924 | Ga0207694_10922372 | Ga0207694_109223722 | 113 |
| 575 | 3300025925 | Ga0207650_10067932 | Ga0207650_100679323 | 113 |
| 576 | 3300025925 | Ga0207650_10333562 | Ga0207650_103335622 | 113 |
| 577 | 3300025925 | Ga0207650_11131566 | Ga0207650_111315661 | 113 |
| 578 | 3300025925 | Ga0207650_11271985 | Ga0207650_112719851 | 113 |
| 579 | 3300025926 | Ga0207659_10252219 | Ga0207659_102522192 | 113 |
| 580 | 3300025926 | Ga0207659_10275502 | Ga0207659_102755022 | 113 |
| 581 | 3300025926 | Ga0207659_10297605 | Ga0207659_102976052 | 113 |
| 582 | 3300025926 | Ga0207659_10418239 | Ga0207659_104182391 | 113 |
| 583 | 3300025926 | Ga0207659_10634140 | Ga0207659_106341402 | 113 |
| 584 | 3300025926 | Ga0207659_10733871 | Ga0207659_107338711 | 113 |
| 585 | 3300025929 | Ga0207664_10364119 | Ga0207664_103641192 | 113 |
| 586 | 3300025931 | Ga0207644_10385769 | Ga0207644_103857692 | 113 |
| 587 | 3300025931 | Ga0207644_10641008 | Ga0207644_106410081 | 113 |
| 588 | 3300025932 | Ga0207690_10016598 | Ga0207690_100165984 | 113 |
| 589 | 3300025932 | Ga0207690_10026685 | Ga0207690_100266854 | 113 |
| 590 | 3300025932 | Ga0207690_10128824 | Ga0207690_101288242 | 113 |
| 591 | 3300025932 | Ga0207690_10330085 | Ga0207690_103300852 | 113 |
| 592 | 3300025932 | Ga0207690_10795058 | Ga0207690_107950582 | 113 |
| 593 | 3300025933 | Ga0207706_10002237 | Ga0207706_1000223713 | 113 |
| 594 | 3300025933 | Ga0207706_10081778 | Ga0207706_100817783 | 113 |
| 595 | 3300025934 | Ga0207686_10037265 | Ga0207686_100372653 | 113 |
| 596 | 3300025934 | Ga0207686_11306938 | Ga0207686_113069381 | 113 |
| 597 | 3300025935 | Ga0207709_10647032 | Ga0207709_106470322 | 113 |
| 598 | 3300025936 | Ga0207670_10066576 | Ga0207670_100665762 | 113 |
| 599 | 3300025936 | Ga0207670_10959984 | Ga0207670_109599842 | 113 |
| 600 | 3300025936 | Ga0207670_11932016 | Ga0207670_119320161 | 113 |
| 601 | 3300025938 | Ga0207704_10027971 | Ga0207704_100279714 | 113 |
| 602 | 3300025938 | Ga0207704_10124939 | Ga0207704_101249393 | 113 |
| 603 | 3300025938 | Ga0207704_11716438 | Ga0207704_117164382 | 113 |
| 604 | 3300025940 | Ga0207691_10046847 | Ga0207691_100468473 | 113 |
| 605 | 3300025940 | Ga0207691_10125146 | Ga0207691_101251464 | 113 |
| 606 | 3300025940 | Ga0207691_10222306 | Ga0207691_102223062 | 113 |
| 607 | 3300025941 | Ga0207711_10041786 | Ga0207711_100417863 | 113 |
| 608 | 3300025941 | Ga0207711_10473336 | Ga0207711_104733362 | 113 |
| 609 | 3300025942 | Ga0207689_10037078 | Ga0207689_100370783 | 113 |
| 610 | 3300025942 | Ga0207689_10201212 | Ga0207689_102012122 | 113 |
| 611 | 3300025942 | Ga0207689_10546033 | Ga0207689_105460331 | 113 |
| 612 | 3300025942 | Ga0207689_11091049 | Ga0207689_110910491 | 113 |
| 613 | 3300025944 | Ga0207661_10002394 | Ga0207661_100023942 | 113 |
| 614 | 3300025944 | Ga0207661_10028189 | Ga0207661_100281894 | 113 |
| 615 | 3300025944 | Ga0207661_10085411 | Ga0207661_100854112 | 113 |
| 616 | 3300025944 | Ga0207661_10106480 | Ga0207661_101064802 | 113 |
| 617 | 3300025944 | Ga0207661_10168154 | Ga0207661_101681541 | 113 |
| 618 | 3300025944 | Ga0207661_10189880 | Ga0207661_101898802 | 113 |
| 619 | 3300025944 | Ga0207661_10362443 | Ga0207661_103624433 | 113 |
| 620 | 3300025944 | Ga0207661_10868878 | Ga0207661_108688782 | 113 |
| 621 | 3300025944 | Ga0207661_10876897 | Ga0207661_108768971 | 113 |
| 622 | 3300025944 | Ga0207661_10879246 | Ga0207661_108792462 | 113 |
| 623 | 3300025945 | Ga0207679_10002284 | Ga0207679_1000228411 | 113 |
| 624 | 3300025945 | Ga0207679_10041988 | Ga0207679_100419885 | 113 |
| 625 | 3300025945 | Ga0207679_10077744 | Ga0207679_100777442 | 113 |
| 626 | 3300025945 | Ga0207679_10163265 | Ga0207679_101632652 | 113 |
| 627 | 3300025945 | Ga0207679_10185497 | Ga0207679_101854973 | 113 |
| 628 | 3300025945 | Ga0207679_10208189 | Ga0207679_102081892 | 113 |
| 629 | 3300025945 | Ga0207679_10288698 | Ga0207679_102886982 | 113 |
| 630 | 3300025945 | Ga0207679_10380007 | Ga0207679_103800072 | 113 |
| 631 | 3300025945 | Ga0207679_10424722 | Ga0207679_104247222 | 113 |
| 632 | 3300025945 | Ga0207679_10453408 | Ga0207679_104534082 | 113 |
| 633 | 3300025945 | Ga0207679_10977952 | Ga0207679_109779521 | 113 |
| 634 | 3300025945 | Ga0207679_11207135 | Ga0207679_112071351 | 113 |
| 635 | 3300025949 | Ga0207667_10231860 | Ga0207667_102318603 | 113 |
| 636 | 3300025949 | Ga0207667_10605382 | Ga0207667_106053822 | 113 |
| 637 | 3300025949 | Ga0207667_11039029 | Ga0207667_110390291 | 113 |
| 638 | 3300025949 | Ga0207667_11899658 | Ga0207667_118996581 | 113 |
| 639 | 3300025949 | Ga0207667_12032403 | Ga0207667_120324032 | 113 |
| 640 | 3300025960 | Ga0207651_10025055 | Ga0207651_100250551 | 113 |
| 641 | 3300025960 | Ga0207651_10045633 | Ga0207651_100456334 | 113 |
| 642 | 3300025961 | Ga0207712_10013793 | Ga0207712_100137935 | 113 |
| 643 | 3300025961 | Ga0207712_10015567 | Ga0207712_100155674 | 113 |
| 644 | 3300025961 | Ga0207712_10032907 | Ga0207712_100329074 | 113 |
| 645 | 3300025961 | Ga0207712_10288438 | Ga0207712_102884381 | 113 |
| 646 | 3300025972 | Ga0207668_10009889 | Ga0207668_100098892 | 113 |
| 647 | 3300025972 | Ga0207668_10021866 | Ga0207668_100218665 | 113 |
| 648 | 3300025981 | Ga0207640_10308730 | Ga0207640_103087303 | 113 |
| 649 | 3300025981 | Ga0207640_10483521 | Ga0207640_104835212 | 113 |
| 650 | 3300025981 | Ga0207640_11431750 | Ga0207640_114317502 | 113 |
| 651 | 3300025981 | Ga0207640_11514858 | Ga0207640_115148582 | 113 |
| 652 | 3300025986 | Ga0207658_10052857 | Ga0207658_100528574 | 113 |
| 653 | 3300025986 | Ga0207658_11305173 | Ga0207658_113051731 | 113 |
| 654 | 3300026023 | Ga0207677_10160633 | Ga0207677_101606334 | 113 |
| 655 | 3300026023 | Ga0207677_10256424 | Ga0207677_102564242 | 113 |
| 656 | 3300026023 | Ga0207677_11541778 | Ga0207677_115417781 | 113 |
| 657 | 3300026035 | Ga0207703_10023800 | Ga0207703_100238005 | 113 |
| 658 | 3300026035 | Ga0207703_11019406 | Ga0207703_110194062 | 113 |
| 659 | 3300026035 | Ga0207703_11743076 | Ga0207703_117430762 | 113 |
| 660 | 3300026035 | Ga0207703_11773075 | Ga0207703_117730752 | 113 |
| 661 | 3300026041 | Ga0207639_10016177 | Ga0207639_100161775 | 113 |
| 662 | 3300026041 | Ga0207639_10063961 | Ga0207639_100639614 | 113 |
| 663 | 3300026041 | Ga0207639_10336450 | Ga0207639_103364502 | 113 |
| 664 | 3300026041 | Ga0207639_10592155 | Ga0207639_105921552 | 113 |
| 665 | 3300026041 | Ga0207639_10915047 | Ga0207639_109150471 | 113 |
| 666 | 3300026041 | Ga0207639_12046953 | Ga0207639_120469532 | 113 |
| 667 | 3300026041 | Ga0207639_12197742 | Ga0207639_121977422 | 113 |
| 668 | 3300026067 | Ga0207678_10044834 | Ga0207678_100448346 | 113 |
| 669 | 3300026075 | Ga0207708_10032553 | Ga0207708_100325535 | 113 |
| 670 | 3300026075 | Ga0207708_10528025 | Ga0207708_105280252 | 113 |
| 671 | 3300026078 | Ga0207702_10184662 | Ga0207702_101846623 | 113 |
| 672 | 3300026078 | Ga0207702_10694463 | Ga0207702_106944632 | 113 |
| 673 | 3300026078 | Ga0207702_10893626 | Ga0207702_108936262 | 113 |
| 674 | 3300026078 | Ga0207702_11818375 | Ga0207702_118183752 | 113 |
| 675 | 3300026088 | Ga0207641_10103975 | Ga0207641_101039753 | 113 |
| 676 | 3300026088 | Ga0207641_10325662 | Ga0207641_103256621 | 113 |
| 677 | 3300026088 | Ga0207641_10693479 | Ga0207641_106934791 | 113 |
| 678 | 3300026088 | Ga0207641_10913838 | Ga0207641_109138382 | 113 |
| 679 | 3300026088 | Ga0207641_10926881 | Ga0207641_109268812 | 113 |
| 680 | 3300026088 | Ga0207641_11060259 | Ga0207641_110602591 | 113 |
| 681 | 3300026089 | Ga0207648_11191749 | Ga0207648_111917491 | 113 |
| 682 | 3300026095 | Ga0207676_10247055 | Ga0207676_102470552 | 113 |
| 683 | 3300026095 | Ga0207676_10568584 | Ga0207676_105685842 | 113 |
| 684 | 3300026095 | Ga0207676_10689996 | Ga0207676_106899961 | 113 |
| 685 | 3300026095 | Ga0207676_10798897 | Ga0207676_107988972 | 113 |
| 686 | 3300026095 | Ga0207676_11063303 | Ga0207676_110633032 | 113 |
| 687 | 3300026095 | Ga0207676_11442351 | Ga0207676_114423511 | 113 |
| 688 | 3300026095 | Ga0207676_12065615 | Ga0207676_120656151 | 113 |
| 689 | 3300026116 | Ga0207674_10008894 | Ga0207674_100088944 | 113 |
| 690 | 3300026116 | Ga0207674_10047433 | Ga0207674_100474333 | 113 |
| 691 | 3300026116 | Ga0207674_10056432 | Ga0207674_100564324 | 113 |
| 692 | 3300026116 | Ga0207674_10488628 | Ga0207674_104886282 | 113 |
| 693 | 3300026118 | Ga0207675_100000209 | Ga0207675_10000020912 | 113 |
| 694 | 3300026118 | Ga0207675_100002910 | Ga0207675_1000029106 | 113 |
| 695 | 3300026118 | Ga0207675_100594660 | Ga0207675_1005946602 | 113 |
| 696 | 3300026118 | Ga0207675_100668168 | Ga0207675_1006681683 | 113 |
| 697 | 3300026118 | Ga0207675_100805885 | Ga0207675_1008058851 | 113 |
| 698 | 3300026118 | Ga0207675_102189842 | Ga0207675_1021898421 | 113 |
| 699 | 3300026142 | Ga0207698_10039806 | Ga0207698_100398063 | 113 |
| 700 | 3300026142 | Ga0207698_10051296 | Ga0207698_100512962 | 113 |
| 701 | 3300026142 | Ga0207698_10132867 | Ga0207698_101328672 | 113 |
| 702 | 3300026142 | Ga0207698_11330778 | Ga0207698_113307782 | 113 |
| 703 | 3300027471 | Ga0209995_1062771 | Ga0209995_10627712 | 113 |
| 704 | 3300027614 | Ga0209970_1041146 | Ga0209970_10411462 | 113 |
| 705 | 3300027876 | Ga0209974_10093259 | Ga0209974_100932592 | 113 |
| 706 | 3300027907 | Ga0207428_10009104 | Ga0207428_1000910411 | 113 |
| 707 | 3300027907 | Ga0207428_10054860 | Ga0207428_100548603 | 113 |
| 708 | 3300027907 | Ga0207428_10067609 | Ga0207428_100676093 | 113 |
| 709 | 3300027907 | Ga0207428_10155986 | Ga0207428_101559863 | 113 |
| 710 | 3300027907 | Ga0207428_10221820 | Ga0207428_102218202 | 113 |
| 711 | 3300028379 | Ga0268266_10237080 | Ga0268266_102370803 | 113 |
| 712 | 3300028379 | Ga0268266_10246397 | Ga0268266_102463971 | 113 |
| 713 | 3300028379 | Ga0268266_10383095 | Ga0268266_103830953 | 113 |
| 714 | 3300028379 | Ga0268266_10691353 | Ga0268266_106913531 | 113 |
| 715 | 3300028379 | Ga0268266_12008685 | Ga0268266_120086852 | 113 |
| 716 | 3300028380 | Ga0268265_10012226 | Ga0268265_100122265 | 113 |
| 717 | 3300028380 | Ga0268265_10013128 | Ga0268265_100131283 | 113 |
| 718 | 3300028380 | Ga0268265_10304984 | Ga0268265_103049842 | 113 |
| 719 | 3300028380 | Ga0268265_11966241 | Ga0268265_119662411 | 113 |
| 720 | 3300028381 | Ga0268264_10087668 | Ga0268264_100876683 | 113 |
| 721 | 3300028786 | Ga0307517_10549211 | Ga0307517_105492111 | 113 |
| 722 | 3300028794 | Ga0307515_10707329 | Ga0307515_107073291 | 113 |
| 723 | 3300031548 | Ga0307408_100005765 | Ga0307408_1000057651 | 113 |
| 724 | 3300031548 | Ga0307408_100022310 | Ga0307408_1000223104 | 113 |
| 725 | 3300031548 | Ga0307408_100069266 | Ga0307408_1000692662 | 113 |
| 726 | 3300031548 | Ga0307408_100071711 | Ga0307408_1000717112 | 113 |
| 727 | 3300031548 | Ga0307408_100190589 | Ga0307408_1001905891 | 113 |
| 728 | 3300031731 | Ga0307405_10000431 | Ga0307405_1000043112 | 113 |
| 729 | 3300031731 | Ga0307405_10000467 | Ga0307405_1000046712 | 113 |
| 730 | 3300031731 | Ga0307405_10004308 | Ga0307405_100043085 | 113 |
| 731 | 3300031731 | Ga0307405_10025988 | Ga0307405_100259884 | 113 |
| 732 | 3300031731 | Ga0307405_10397022 | Ga0307405_103970222 | 113 |
| 733 | 3300031731 | Ga0307405_10410594 | Ga0307405_104105941 | 113 |
| 734 | 3300031731 | Ga0307405_11061527 | Ga0307405_110615272 | 113 |
| 735 | 3300031824 | Ga0307413_10000553 | Ga0307413_1000055312 | 113 |
| 736 | 3300031824 | Ga0307413_10000611 | Ga0307413_100006114 | 113 |
| 737 | 3300031824 | Ga0307413_10046328 | Ga0307413_100463285 | 113 |
| 738 | 3300031824 | Ga0307413_10065562 | Ga0307413_100655621 | 113 |
| 739 | 3300031824 | Ga0307413_10086659 | Ga0307413_100866591 | 113 |
| 740 | 3300031824 | Ga0307413_10256133 | Ga0307413_102561332 | 113 |
| 741 | 3300031824 | Ga0307413_10348001 | Ga0307413_103480012 | 113 |
| 742 | 3300031824 | Ga0307413_10431682 | Ga0307413_104316823 | 113 |
| 743 | 3300031824 | Ga0307413_10645769 | Ga0307413_106457692 | 113 |
| 744 | 3300031852 | Ga0307410_10014163 | Ga0307410_100141632 | 113 |
| 745 | 3300031852 | Ga0307410_10047568 | Ga0307410_100475683 | 113 |
| 746 | 3300031852 | Ga0307410_10061960 | Ga0307410_100619602 | 113 |
| 747 | 3300031852 | Ga0307410_10178373 | Ga0307410_101783731 | 113 |
| 748 | 3300031852 | Ga0307410_10197290 | Ga0307410_101972901 | 113 |
| 749 | 3300031852 | Ga0307410_10239074 | Ga0307410_102390744 | 113 |
| 750 | 3300031852 | Ga0307410_10396720 | Ga0307410_103967202 | 113 |
| 751 | 3300031852 | Ga0307410_10422915 | Ga0307410_104229152 | 113 |
| 752 | 3300031852 | Ga0307410_11171109 | Ga0307410_111711091 | 113 |
| 753 | 3300031901 | Ga0307406_10002382 | Ga0307406_1000238217 | 113 |
| 754 | 3300031901 | Ga0307406_10005037 | Ga0307406_100050375 | 113 |
| 755 | 3300031901 | Ga0307406_10014924 | Ga0307406_100149243 | 113 |
| 756 | 3300031901 | Ga0307406_10053531 | Ga0307406_100535313 | 113 |
| 757 | 3300031901 | Ga0307406_10063388 | Ga0307406_100633884 | 113 |
| 758 | 3300031901 | Ga0307406_10200322 | Ga0307406_102003223 | 113 |
| 759 | 3300031901 | Ga0307406_10229065 | Ga0307406_102290652 | 113 |
| 760 | 3300031903 | Ga0307407_10000511 | Ga0307407_1000051114 | 113 |
| 761 | 3300031903 | Ga0307407_10004075 | Ga0307407_100040753 | 113 |
| 762 | 3300031903 | Ga0307407_10041261 | Ga0307407_100412612 | 113 |
| 763 | 3300031903 | Ga0307407_10161929 | Ga0307407_101619294 | 113 |
| 764 | 3300031903 | Ga0307407_10250093 | Ga0307407_102500931 | 113 |
| 765 | 3300031903 | Ga0307407_10275083 | Ga0307407_102750832 | 113 |
| 766 | 3300031903 | Ga0307407_10329993 | Ga0307407_103299931 | 113 |
| 767 | 3300031903 | Ga0307407_10883291 | Ga0307407_108832911 | 113 |
| 768 | 3300031903 | Ga0307407_11094928 | Ga0307407_110949282 | 113 |
| 769 | 3300031911 | Ga0307412_10001715 | Ga0307412_100017156 | 113 |
| 770 | 3300031911 | Ga0307412_10010522 | Ga0307412_100105226 | 113 |
| 771 | 3300031911 | Ga0307412_10029005 | Ga0307412_100290052 | 113 |
| 772 | 3300031911 | Ga0307412_10059476 | Ga0307412_100594762 | 113 |
| 773 | 3300031911 | Ga0307412_10454780 | Ga0307412_104547802 | 113 |
| 774 | 3300031911 | Ga0307412_12315555 | Ga0307412_123155551 | 113 |
| 775 | 3300031995 | Ga0307409_100000474 | Ga0307409_10000047413 | 113 |
| 776 | 3300031995 | Ga0307409_100004192 | Ga0307409_1000041921 | 113 |
| 777 | 3300031995 | Ga0307409_100066532 | Ga0307409_1000665322 | 113 |
| 778 | 3300031995 | Ga0307409_100072959 | Ga0307409_1000729593 | 113 |
| 779 | 3300031995 | Ga0307409_100462768 | Ga0307409_1004627681 | 113 |
| 780 | 3300031995 | Ga0307409_100913706 | Ga0307409_1009137061 | 113 |
| 781 | 3300031995 | Ga0307409_101398726 | Ga0307409_1013987262 | 113 |
| 782 | 3300031995 | Ga0307409_101635213 | Ga0307409_1016352132 | 113 |
| 783 | 3300032002 | Ga0307416_100000163 | Ga0307416_10000016330 | 113 |
| 784 | 3300032002 | Ga0307416_100000912 | Ga0307416_10000091217 | 113 |
| 785 | 3300032002 | Ga0307416_100001181 | Ga0307416_1000011813 | 113 |
| 786 | 3300032002 | Ga0307416_100018472 | Ga0307416_1000184726 | 113 |
| 787 | 3300032002 | Ga0307416_100040050 | Ga0307416_1000400502 | 113 |
| 788 | 3300032002 | Ga0307416_100252872 | Ga0307416_1002528722 | 113 |
| 789 | 3300032002 | Ga0307416_100310937 | Ga0307416_1003109372 | 113 |
| 790 | 3300032002 | Ga0307416_100716573 | Ga0307416_1007165732 | 113 |
| 791 | 3300032002 | Ga0307416_101074897 | Ga0307416_1010748972 | 113 |
| 792 | 3300032002 | Ga0307416_101810145 | Ga0307416_1018101452 | 113 |
| 793 | 3300032002 | Ga0307416_102070073 | Ga0307416_1020700732 | 113 |
| 794 | 3300032004 | Ga0307414_10001031 | Ga0307414_1000103112 | 113 |
| 795 | 3300032004 | Ga0307414_10002523 | Ga0307414_100025239 | 113 |
| 796 | 3300032004 | Ga0307414_10129588 | Ga0307414_101295884 | 113 |
| 797 | 3300032004 | Ga0307414_10143624 | Ga0307414_101436242 | 113 |
| 798 | 3300032004 | Ga0307414_10314665 | Ga0307414_103146651 | 113 |
| 799 | 3300032004 | Ga0307414_10326140 | Ga0307414_103261402 | 113 |
| 800 | 3300032004 | Ga0307414_10460805 | Ga0307414_104608052 | 113 |
| 801 | 3300032005 | Ga0307411_10000120 | Ga0307411_1000012023 | 113 |
| 802 | 3300032005 | Ga0307411_10003303 | Ga0307411_100033032 | 113 |
| 803 | 3300032005 | Ga0307411_10010089 | Ga0307411_100100892 | 113 |
| 804 | 3300032005 | Ga0307411_10058094 | Ga0307411_100580944 | 113 |
| 805 | 3300032005 | Ga0307411_10122995 | Ga0307411_101229952 | 113 |
| 806 | 3300032005 | Ga0307411_10163960 | Ga0307411_101639603 | 113 |
| 807 | 3300032005 | Ga0307411_10262565 | Ga0307411_102625653 | 113 |
| 808 | 3300032005 | Ga0307411_10276649 | Ga0307411_102766494 | 113 |
| 809 | 3300032005 | Ga0307411_10798627 | Ga0307411_107986272 | 113 |
| 810 | 3300032126 | Ga0307415_100001591 | Ga0307415_10000159119 | 113 |
| 811 | 3300032126 | Ga0307415_100022540 | Ga0307415_1000225404 | 113 |
| 812 | 3300032126 | Ga0307415_100113318 | Ga0307415_1001133182 | 113 |
| 813 | 3300032126 | Ga0307415_100173143 | Ga0307415_1001731432 | 113 |
| 814 | 3300032126 | Ga0307415_100534568 | Ga0307415_1005345682 | 113 |
| 815 | 3300032126 | Ga0307415_100651072 | Ga0307415_1006510722 | 113 |
| 816 | 3300032126 | Ga0307415_101396334 | Ga0307415_1013963341 | 113 |
| 817 | 3300035092 | Ga0373952_0058003 | Ga0373952_0058003_239_580 | 113 |
| 818 | 3300035121 | Ga0373960_0178499 | Ga0373960_0178499_356_697 | 113 |
| 819 | 3300035171 | Ga0373946_0419620 | Ga0373946_0419620_303_644 | 113 |
| 820 | 3300035241 | Ga0373961_0129810 | Ga0373961_0129810_150_491 | 113 |
| 821 | 3300035242 | Ga0373962_0086014 | Ga0373962_0086014_91_444 | 113 |
| 822 | 3300037312 | Ga0395899_0122473 | Ga0395899_0122473_111_467 | 113 |
| 823 | 3300037418 | Ga0395900_0001278 | Ga0395900_0001278_16189_16545 | 113 |
| 824 | 3300037418 | Ga0395900_0261130 | Ga0395900_0261130_10_357 | 113 |
| 825 | 3300037466 | Ga0395898_0002604 | Ga0395898_0002604_16774_17121 | 113 |
| 826 | 3300037466 | Ga0395898_0023538 | Ga0395898_0023538_5553_5909 | 113 |
| 827 | 3300037466 | Ga0395898_0170279 | Ga0395898_0170279_1363_1722 | 113 |
| 828 | 3300037471 | Ga0395905_0086560 | Ga0395905_0086560_234_593 | 113 |
| 829 | 3300037471 | Ga0395905_0247916 | Ga0395905_0247916_78_422 | 113 |
| 830 | 3300037853 | Ga0436364_1168503 | Ga0436364_1168503_580_921 | 113 |
| 831 | 3300038443 | Ga0395901_0000327 | Ga0395901_0000327_38524_38880 | 113 |
| 832 | 3300038443 | Ga0395901_0020475 | Ga0395901_0020475_6149_6496 | 113 |
| 833 | 3300038443 | Ga0395901_0028345 | Ga0395901_0028345_1763_2122 | 113 |
| 834 | 3300039437 | Ga0436365_0137719 | Ga0436365_0137719_6809_7159 | 113 |
| 835 | 3300039437 | Ga0436365_0173963 | Ga0436365_0173963_2415_2756 | 113 |
| 836 | 3300039437 | Ga0436365_0223687 | Ga0436365_0223687_762_1103 | 113 |
| 837 | 3300039453 | Ga0436362_1069022 | Ga0436362_1069022_201_542 | 113 |
| 838 | 3300041406 | Ga0439439_0059749 | Ga0439439_0059749_70_423 | 113 |
| 839 | 3300041406 | Ga0439439_0131204 | Ga0439439_0131204_86_427 | 113 |
| 840 | 3300041408 | Ga0439453_0017774 | Ga0439453_0017774_301_642 | 113 |
| 841 | 3300041410 | Ga0439461_0012170 | Ga0439461_0012170_1217_1558 | 113 |
| 842 | 3300041459 | Ga0451800_0683371 | Ga0451800_0683371_322_675 | 113 |
| 843 | 3300041512 | Ga0451853_1340511 | Ga0451853_1340511_43_396 | 113 |
| 844 | 3300041999 | Ga0439433_0031208 | Ga0439433_0031208_344_685 | 113 |
| 845 | 3300042001 | Ga0439441_023866 | Ga0439441_023866_279_620 | 113 |
| 846 | 3300042003 | Ga0439443_016136 | Ga0439443_016136_462_803 | 113 |
| 847 | 3300042011 | Ga0439454_048451 | Ga0439454_048451_71_412 | 113 |
| 848 | 3300042013 | Ga0439456_075124 | Ga0439456_075124_343_684 | 113 |
| 849 | 3300042015 | Ga0439462_0078786 | Ga0439462_0078786_87_428 | 113 |
| 850 | 3300042120 | Ga0450917_027856 | Ga0450917_027856_57_398 | 113 |
| 851 | 3300042125 | Ga0450923_000962 | Ga0450923_000962_3117_3458 | 113 |
| 852 | 3300042125 | Ga0450923_112777 | Ga0450923_112777_80_421 | 113 |
| 853 | 3300042156 | Ga0439446_0001964 | Ga0439446_0001964_617_958 | 113 |
| 854 | 3300042435 | Ga0439434_0273614 | Ga0439434_0273614_221_562 | 113 |
| 855 | 3300042436 | Ga0439435_0001188 | Ga0439435_0001188_3247_3588 | 113 |
| 856 | 3300042437 | Ga0439444_0000441 | Ga0439444_0000441_1764_2105 | 113 |
| 857 | 3300042437 | Ga0439444_0028990 | Ga0439444_0028990_275_628 | 113 |
| 858 | 3300042438 | Ga0439459_0071438 | Ga0439459_0071438_127_480 | 113 |
| 859 | 3300042439 | Ga0439464_0085150 | Ga0439464_0085150_65_406 | 113 |
| 860 | 3300042461 | Ga0439460_0060340 | Ga0439460_0060340_520_873 | 113 |
| 861 | 3300044673 | Ga0453683_0675118 | Ga0453683_0675118_76_417 | 113 |
| 862 | 3300044693 | Ga0466961_0380136 | Ga0466961_0380136_399_740 | 113 |
| 863 | 3300044694 | Ga0466963_0571023 | Ga0466963_0571023_52_393 | 113 |
| 864 | 3300044842 | Ga0466957_1371645 | Ga0466957_1371645_148_489 | 113 |
| 865 | 3300044901 | Ga0466960_0712625 | Ga0466960_0712625_145_498 | 113 |
| 866 | 3300045051 | Ga0451576_0439473 | Ga0451576_0439473_171_512 | 113 |
| 867 | 3300045051 | Ga0451576_1078838 | Ga0451576_1078838_292_633 | 113 |
| 868 | 3300046459 | Ga0495629_0097002 | Ga0495629_0097002_449_790 | 113 |
| 869 | 3300046460 | Ga0495638_0361285 | Ga0495638_0361285_173_514 | 113 |
| 870 | 3300046475 | Ga0495639_0124882 | Ga0495639_0124882_416_757 | 113 |
| 871 | 3300046475 | Ga0495639_0347010 | Ga0495639_0347010_16_357 | 113 |
| 872 | 3300046499 | Ga0495594_0007137 | Ga0495594_0007137_4203_4556 | 113 |
| 873 | 3300046499 | Ga0495594_0115875 | Ga0495594_0115875_519_860 | 113 |
| 874 | 3300046500 | Ga0495596_0312922 | Ga0495596_0312922_95_436 | 113 |
| 875 | 3300046516 | Ga0495628_0905706 | Ga0495628_0905706_227_568 | 113 |
| 876 | 3300046519 | Ga0495632_0317082 | Ga0495632_0317082_306_647 | 113 |
| 877 | 3300046523 | Ga0495644_0106856 | Ga0495644_0106856_512_865 | 113 |
| 878 | 3300046660 | Ga0495625_0202858 | Ga0495625_0202858_464_805 | 113 |
| 879 | 3300046665 | Ga0495661_0415862 | Ga0495661_0415862_63_404 | 113 |
| 880 | 3300046689 | Ga0495613_0055044 | Ga0495613_0055044_2125_2466 | 113 |
| 881 | 3300046809 | Ga0495600_0111263 | Ga0495600_0111263_779_1120 | 113 |
| 882 | 3300047315 | Ga0495581_0066351 | Ga0495581_0066351_602_943 | 113 |
| 883 | 3300047318 | Ga0495636_0075448 | Ga0495636_0075448_112_453 | 113 |
| 884 | 3300047320 | Ga0495672_0002532 | Ga0495672_0002532_9971_10324 | 113 |
| 885 | 3300047445 | Ga0495677_0026657 | Ga0495677_0026657_1745_2086 | 113 |
| 886 | 3300047471 | Ga0495684_0858240 | Ga0495684_0858240_195_536 | 113 |
| 887 | 3300048090 | Ga0495615_0228489 | Ga0495615_0228489_172_525 | 113 |
| 888 | 3300048903 | Ga0496100_0722153 | Ga0496100_0722153_140_481 | 113 |
| 889 | 3300048905 | Ga0496102_1730079 | Ga0496102_1730079_118_459 | 113 |
| 890 | 3300048907 | Ga0496104_0204205 | Ga0496104_0204205_1482_1823 | 113 |
| 891 | 3300048907 | Ga0496104_0637565 | Ga0496104_0637565_565_906 | 113 |
| 892 | 3300048907 | Ga0496104_0648612 | Ga0496104_0648612_104_445 | 113 |
| 893 | 3300048908 | Ga0496105_0189172 | Ga0496105_0189172_885_1226 | 113 |
| 894 | 3300048908 | Ga0496105_1004879 | Ga0496105_1004879_151_492 | 113 |
| 895 | 3300048909 | Ga0496106_0082749 | Ga0496106_0082749_41_382 | 113 |
| 896 | 3300048909 | Ga0496106_0087337 | Ga0496106_0087337_207_548 | 113 |
| 897 | 3300048910 | Ga0496107_0219086 | Ga0496107_0219086_401_742 | 113 |
| 898 | 3300048910 | Ga0496107_1183726 | Ga0496107_1183726_12_353 | 113 |
| 899 | 3300048911 | Ga0496108_0062246 | Ga0496108_0062246_1793_2134 | 113 |
| 900 | 3300048911 | Ga0496108_0141866 | Ga0496108_0141866_799_1140 | 113 |
| 901 | 3300048911 | Ga0496108_0290330 | Ga0496108_0290330_554_895 | 113 |
| 902 | 3300048911 | Ga0496108_0660724 | Ga0496108_0660724_214_555 | 113 |
| 903 | 3300048912 | Ga0496109_0030074 | Ga0496109_0030074_2046_2387 | 113 |
| 904 | 3300048912 | Ga0496109_0269154 | Ga0496109_0269154_100_441 | 113 |
| 905 | 3300048912 | Ga0496109_0375171 | Ga0496109_0375171_920_1261 | 113 |
| 906 | 3300048912 | Ga0496109_1537762 | Ga0496109_1537762_104_445 | 113 |
| 907 | 3300048912 | Ga0496109_1897623 | Ga0496109_1897623_119_460 | 113 |
| 908 | 3300048913 | Ga0496110_0044322 | Ga0496110_0044322_2175_2516 | 113 |
| 909 | 3300048915 | Ga0496112_0033600 | Ga0496112_0033600_2048_2389 | 113 |
| 910 | 3300048915 | Ga0496112_0618920 | Ga0496112_0618920_318_659 | 113 |
| 911 | 3300048915 | Ga0496112_1770096 | Ga0496112_1770096_80_421 | 113 |
| 912 | 3300048916 | Ga0496113_0122120 | Ga0496113_0122120_1458_1799 | 113 |
| 913 | 3300048916 | Ga0496113_0216289 | Ga0496113_0216289_797_1138 | 113 |
| 914 | 3300048918 | Ga0496115_0108203 | Ga0496115_0108203_229_570 | 113 |
| 915 | 3300049514 | Ga0501291_014518 | Ga0501291_014518_194_535 | 113 |
| 916 | 3300049514 | Ga0501291_027040 | Ga0501291_027040_555_896 | 113 |
| 917 | 3300049521 | Ga0501298_038603 | Ga0501298_038603_27_368 | 113 |
| 918 | 3300049521 | Ga0501298_115275 | Ga0501298_115275_155_508 | 113 |
| 919 | 3300049579 | Ga0501043_0704935 | Ga0501043_0704935_236_577 | 113 |
| 920 | 3300049580 | Ga0501046_0842413 | Ga0501046_0842413_137_478 | 113 |
| 921 | 3300049581 | Ga0501047_0151210 | Ga0501047_0151210_441_782 | 113 |
| 922 | 3300049582 | Ga0501048_0334005 | Ga0501048_0334005_99_440 | 113 |
| 923 | 3300049583 | Ga0501067_0711961 | Ga0501067_0711961_60_413 | 113 |
| 924 | 3300049584 | Ga0501068_0135929 | Ga0501068_0135929_943_1284 | 113 |
| 925 | 3300049586 | Ga0501070_0017289 | Ga0501070_0017289_2470_2811 | 113 |
| 926 | 3300049587 | Ga0501071_0132060 | Ga0501071_0132060_1193_1546 | 113 |
| 927 | 3300049588 | Ga0501072_0273858 | Ga0501072_0273858_592_939 | 113 |
| 928 | 3300049588 | Ga0501072_0391494 | Ga0501072_0391494_403_744 | 113 |
| 929 | 3300049591 | Ga0501075_0335650 | Ga0501075_0335650_201_548 | 113 |
| 930 | 3300049592 | Ga0501076_0184903 | Ga0501076_0184903_911_1258 | 113 |
| 931 | 3300049593 | Ga0501077_0219660 | Ga0501077_0219660_745_1086 | 113 |
| 932 | 3300049593 | Ga0501077_0618620 | Ga0501077_0618620_224_571 | 113 |
| 933 | 3300049649 | Ga0501198_024717 | Ga0501198_024717_507_848 | 113 |
| 934 | 3300049652 | Ga0501202_053375 | Ga0501202_053375_259_600 | 113 |
| 935 | 3300049654 | Ga0501207_033814 | Ga0501207_033814_137_478 | 113 |
| 936 | 3300049660 | Ga0501216_053647 | Ga0501216_053647_290_643 | 113 |
| 937 | 3300049661 | Ga0501217_084532 | Ga0501217_084532_453_794 | 113 |
| 938 | 3300049664 | Ga0501224_031055 | Ga0501224_031055_61_414 | 113 |
| 939 | 3300049668 | Ga0501233_129944 | Ga0501233_129944_104_445 | 113 |
| 940 | 3300049668 | Ga0501233_178262 | Ga0501233_178262_10_351 | 113 |
| 941 | 3300049668 | Ga0501233_259214 | Ga0501233_259214_28_369 | 113 |
| 942 | 3300049671 | Ga0501238_057025 | Ga0501238_057025_218_571 | 113 |
| 943 | 3300049676 | Ga0501246_018320 | Ga0501246_018320_291_644 | 113 |
| 944 | 3300049677 | Ga0501247_015519 | Ga0501247_015519_554_907 | 113 |
| 945 | 3300049677 | Ga0501247_049607 | Ga0501247_049607_194_535 | 113 |
| 946 | 3300049679 | Ga0501249_024916 | Ga0501249_024916_605_946 | 113 |
| 947 | 3300049679 | Ga0501249_039494 | Ga0501249_039494_523_876 | 113 |
| 948 | 3300049679 | Ga0501249_160061 | Ga0501249_160061_107_448 | 113 |
| 949 | 3300049683 | Ga0501253_066061 | Ga0501253_066061_121_462 | 113 |
| 950 | 3300049683 | Ga0501253_089612 | Ga0501253_089612_245_598 | 113 |
| 951 | 3300049686 | Ga0501257_058817 | Ga0501257_058817_521_862 | 113 |
| 952 | 3300049688 | Ga0501259_030012 | Ga0501259_030012_284_625 | 113 |
| 953 | 3300049688 | Ga0501259_135490 | Ga0501259_135490_56_397 | 113 |
| 954 | 3300049705 | Ga0501225_0035821 | Ga0501225_0035821_617_970 | 113 |
| 955 | 3300049706 | Ga0501229_074495 | Ga0501229_074495_78_419 | 113 |
| 956 | 3300049708 | Ga0501245_156005 | Ga0501245_156005_102_455 | 113 |
| 957 | 3300049742 | Ga0501080_0270777 | Ga0501080_0270777_233_574 | 113 |
| 958 | 3300049742 | Ga0501080_0747330 | Ga0501080_0747330_51_398 | 113 |
| 959 | 3300049760 | Ga0501263_089368 | Ga0501263_089368_69_410 | 113 |
| 960 | 3300049762 | Ga0501265_077458 | Ga0501265_077458_115_456 | 113 |
| 961 | 3300049763 | Ga0501266_057431 | Ga0501266_057431_160_501 | 113 |
| 962 | 3300049763 | Ga0501266_083037 | Ga0501266_083037_67_420 | 113 |
| 963 | 3300049765 | Ga0501268_005903 | Ga0501268_005903_1283_1624 | 113 |
| 964 | 3300049766 | Ga0501269_063891 | Ga0501269_063891_105_446 | 113 |
| 965 | 3300049769 | Ga0501272_034014 | Ga0501272_034014_56_409 | 113 |
| 966 | 3300049769 | Ga0501272_050608 | Ga0501272_050608_115_468 | 113 |
| 967 | 3300049769 | Ga0501272_068084 | Ga0501272_068084_87_440 | 113 |
| 968 | 3300049775 | Ga0501279_049312 | Ga0501279_049312_96_437 | 113 |
| 969 | 3300049779 | Ga0501283_041000 | Ga0501283_041000_226_579 | 113 |
| 970 | 3300049779 | Ga0501283_100161 | Ga0501283_100161_197_538 | 113 |
| 971 | 3300049823 | Ga0501044_0220011 | Ga0501044_0220011_1008_1349 | 113 |
| 972 | 3300050490 | nmdc:mga03n38_271498_c1 | nmdc:mga03n38_271498_c1_200_541 | 113 |
| 973 | 3300050507 | nmdc:mga05p37_1049884_c1 | nmdc:mga05p37_1049884_c1_122_463 | 113 |
| 974 | 3300050507 | nmdc:mga05p37_112785_c1 | nmdc:mga05p37_112785_c1_879_1220 | 113 |
| 975 | 3300050507 | nmdc:mga05p37_1715128_c1 | nmdc:mga05p37_1715128_c1_107_460 | 113 |
| 976 | 3300050508 | nmdc:mga09592_129339_c1 | nmdc:mga09592_129339_c1_1462_1803 | 113 |
| 977 | 3300050508 | nmdc:mga09592_195702_c1 | nmdc:mga09592_195702_c1_1058_1399 | 113 |
| 978 | 3300050509 | nmdc:mga0qj67_482812_c1 | nmdc:mga0qj67_482812_c1_79_432 | 113 |
| 979 | 3300050510 | nmdc:mga06r32_125035_c1 | nmdc:mga06r32_125035_c1_1035_1376 | 113 |
| 980 | 3300050510 | nmdc:mga06r32_1380961_c1 | nmdc:mga06r32_1380961_c1_100_453 | 113 |
| 981 | 3300050510 | nmdc:mga06r32_575707_c1 | nmdc:mga06r32_575707_c1_79_432 | 113 |
| 982 | 3300050510 | nmdc:mga06r32_604928_c1 | nmdc:mga06r32_604928_c1_117_470 | 113 |
| 983 | 3300050511 | nmdc:mga08y16_1128336_c1 | nmdc:mga08y16_1128336_c1_125_466 | 113 |
| 984 | 3300050511 | nmdc:mga08y16_1219967_c1 | nmdc:mga08y16_1219967_c1_347_688 | 113 |
| 985 | 3300050511 | nmdc:mga08y16_1601200_c1 | nmdc:mga08y16_1601200_c1_156_497 | 113 |
| 986 | 3300050511 | nmdc:mga08y16_22712_c2 | nmdc:mga08y16_22712_c2_972_1313 | 113 |
| 987 | 3300050511 | nmdc:mga08y16_38177_c1 | nmdc:mga08y16_38177_c1_966_1307 | 113 |
| 988 | 3300050511 | nmdc:mga08y16_492206_c1 | nmdc:mga08y16_492206_c1_46_387 | 113 |
| 989 | 3300050511 | nmdc:mga08y16_721655_c1 | nmdc:mga08y16_721655_c1_208_549 | 113 |
| 990 | 3300050511 | nmdc:mga08y16_9515_c1 | nmdc:mga08y16_9515_c1_8164_8505 | 113 |
| 991 | 3300050512 | nmdc:mga0n895_14555_c1 | nmdc:mga0n895_14555_c1_5719_6060 | 113 |
| 992 | 3300050512 | nmdc:mga0n895_25288_c1 | nmdc:mga0n895_25288_c1_5022_5363 | 113 |
| 993 | 3300050512 | nmdc:mga0n895_74179_c1 | nmdc:mga0n895_74179_c1_1031_1372 | 113 |
| 994 | 3300050513 | nmdc:mga0rr50_1061802_c1 | nmdc:mga0rr50_1061802_c1_167_508 | 113 |
| 995 | 3300050513 | nmdc:mga0rr50_145246_c1 | nmdc:mga0rr50_145246_c1_1054_1395 | 113 |
| 996 | 3300050513 | nmdc:mga0rr50_171652_c1 | nmdc:mga0rr50_171652_c1_429_833 | 113 |
| 997 | 3300050514 | nmdc:mga08x19_22079_c1 | nmdc:mga08x19_22079_c1_988_1329 | 113 |
| 998 | 3300050514 | nmdc:mga08x19_6811_c1 | nmdc:mga08x19_6811_c1_2467_2808 | 113 |
| 999 | 3300050515 | nmdc:mga0a205_171250_c1 | nmdc:mga0a205_171250_c1_1653_1994 | 113 |
| 1000 | 3300050515 | nmdc:mga0a205_26159_c1 | nmdc:mga0a205_26159_c1_5199_5540 | 113 |
| 1001 | 3300050515 | nmdc:mga0a205_428254_c1 | nmdc:mga0a205_428254_c1_180_521 | 113 |
| 1002 | 3300050515 | nmdc:mga0a205_723661_c1 | nmdc:mga0a205_723661_c1_142_495 | 113 |
| 1003 | 3300053090 | Ga0500646_0004679 | Ga0500646_0004679_2088_2441 | 113 |
| 1004 | 3300053090 | Ga0500646_0101629 | Ga0500646_0101629_531_872 | 113 |
| 1005 | 3300053102 | Ga0500554_042253 | Ga0500554_042253_515_856 | 113 |
| 1006 | 3300053129 | Ga0500628_000202 | Ga0500628_000202_10619_10960 | 113 |
| 1007 | 3300053131 | Ga0500652_302633 | Ga0500652_302633_249_602 | 113 |
| 1008 | 3300053134 | Ga0500658_0074588 | Ga0500658_0074588_393_734 | 113 |
| 1009 | 3300053139 | Ga0500568_0033398 | Ga0500568_0033398_384_725 | 113 |
| 1010 | 3300053153 | Ga0500616_0000575 | Ga0500616_0000575_4492_4833 | 113 |
| 1011 | 3300053153 | Ga0500616_0096194 | Ga0500616_0096194_13_354 | 113 |
| 1012 | 3300053156 | Ga0500622_0006275 | Ga0500622_0006275_3602_3943 | 113 |
| 1013 | 3300053156 | Ga0500622_0007430 | Ga0500622_0007430_423_764 | 113 |
| 1014 | 3300053160 | Ga0500633_0323998 | Ga0500633_0323998_129_470 | 113 |
| 1015 | 3300054114 | Ga0501084_1086663 | Ga0501084_1086663_272_619 | 113 |
| 1016 | 3300059421 | Ga0590071_037169 | Ga0590071_037169_404_745 | 113 |
| 1017 | 3300059423 | Ga0590074_009280 | Ga0590074_009280_553_894 | 113 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f6v-assembly1.cif.gz_A-2 | crystal structure of possible transcriptional regulator for arsenical resistance | 0.9119 | 9 | 87 |
| 7p6f-assembly2.cif.gz_CCC-2 | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9101 | 4 | 87 |
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9082 | 4 | 87 |
| 1wq2-assembly1.cif.gz_A | neutron crystal structure of dissimilatory sulfite reductase d (dsrd) | 0.908 | 16 | 75 |
| 3lmm-assembly4.cif.gz_D | crystal structure of the dip2311 protein from corynebacterium diphtheriae, northeast structural genomics consortium target cdr35 | 0.8972 | 18 | 74 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vxzA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9334 | 18 | 73 | 1.10.10.10 |
| af_P71941_17_120_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9169 | 3 | 83 | 1.10.10.10 |
| af_Q2FXF7_1_94_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9129 | 6 | 86 | 1.10.10.10 |
| 3f6vA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9119 | 9 | 87 | 1.10.10.10 |
| 1wq2A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.908 | 16 | 75 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W7CAE8-F1-model_v4 | deleted | 0.9704 | 6 | 79 |
|
| AF-A0A3M0T2P4-F1-model_v4 | ArsR family transcriptional regulator | 0.9675 | 3 | 73 |
GO:0003700
|
| AF-A0A7V5WPP1-F1-model_v4 | ArsR family transcriptional regulator | 0.9541 | 6 | 79 |
GO:0003700
|
| AF-A0A2S9G3J3-F1-model_v4 | Transcriptional regulator | 0.947 | 1 | 84 |
GO:0003700
|
| AF-A0A432EPW3-F1-model_v4 | Transcriptional regulator | 0.9393 | 6 | 85 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar