F488299

General Info

Members Datasets Scaffolds Average Seq Length
1017 365 1017 114

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_171652_c1|nmdc:mga0rr50_171652_c1_429_833
Length 134
Sequence VLPGDRIIPTDRILNQSTGVEMVQSAVADEVFYALSNATRRKVLEQLSVGPATVSELAAPFDMKLPSFVQHLSVLERSRLVKSKKRGRVRTYVIAPERFKVVEDWLTARRALWEARLDQFDQYVKQLKEKESAS

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
106 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
201 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
229 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
230 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
231 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
232 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
235 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
236 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
239 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
242 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
243 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
244 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
245 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
246 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
247 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
248 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
249 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
250 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
270 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
280 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
296 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
297 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
306 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
314 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
315 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
316 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
317 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
318 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
319 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
320 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
321 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
322 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
323 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
324 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
325 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
326 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
327 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
328 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
329 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
330 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
331 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
332 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
333 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
334 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
335 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
336 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
337 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
338 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
339 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
340 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
341 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
343 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
354 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
355 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
356 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
357 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
358 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
364 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
365 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.01
Nodule 0
Rhizoplane 2.75
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10236793 3300001990 Unclassified 539
2 JGI24035J26624_1011242 3300002126 Bacteria 895
3 JGI25159J45721_1024851 3300002987 Bacteria 1058
4 JGI25151J46595_10086933 3300003187 Bacteria 884
5 Ga0055526_1012111 3300003771 Bacteria 3799
6 Ga0055524_1000951 3300003775 Bacteria 18374
7 Ga0055524_1001641 3300003775 Bacteria 12477
8 Ga0055536_1014134 3300003781 Bacteria 2826
9 Ga0055534_1008563 3300003784 Bacteria 2304
10 Ga0055528_1036653 3300003790 Bacteria 1167
11 Ga0055530_10005594 3300003791 Bacteria 5909
12 Ga0055531_10001261 3300003794 Bacteria 19149
13 Ga0055531_10002230 3300003794 Bacteria 13134
14 Ga0055531_10003072 3300003794 Bacteria 10796
15 Ga0055531_10010188 3300003794 Bacteria 4705
16 Ga0055531_10030703 3300003794 Bacteria 1796
17 Ga0065704_10294183 3300005289 Bacteria 894
18 Ga0065712_10008022 3300005290 Bacteria 2498
19 Ga0065712_10024919 3300005290 Bacteria 1196
20 Ga0065712_10078049 3300005290 Bacteria 3403
21 Ga0065712_10173609 3300005290 Bacteria 1230
22 Ga0065712_10316965 3300005290 Bacteria 834
23 Ga0065715_10348131 3300005293 Bacteria 955
24 Ga0065715_10393698 3300005293 Bacteria 891
25 Ga0065715_11103161 3300005293 Bacteria 519
26 Ga0065707_10110278 3300005295 Bacteria 2436
27 Ga0065707_10115019 3300005295 Bacteria 2279
28 Ga0065707_10122585 3300005295 Bacteria 2085
29 Ga0065707_10140491 3300005295 Bacteria 1754
30 Ga0065707_10531151 3300005295 Bacteria 735
31 Ga0070658_10033753 3300005327 Bacteria 4117
32 Ga0070658_10219627 3300005327 Bacteria 1607
33 Ga0070658_10708727 3300005327 Bacteria 874
34 Ga0070658_10794943 3300005327 Bacteria 822
35 Ga0070658_10917744 3300005327 Bacteria 761
36 Ga0070676_10047197 3300005328 Bacteria 2514
37 Ga0070676_10552157 3300005328 Bacteria 825
38 Ga0070676_11102439 3300005328 Bacteria 600
39 Ga0070683_100002327 3300005329 Bacteria 15074
40 Ga0070683_100022612 3300005329 Bacteria 5622
41 Ga0070683_100049118 3300005329 Bacteria 3902
42 Ga0070683_100087981 3300005329 Bacteria 2914
43 Ga0070683_100106856 3300005329 Bacteria 2639
44 Ga0070683_100148129 3300005329 Bacteria 2225
45 Ga0070683_100164656 3300005329 Bacteria 2104
46 Ga0070683_100190785 3300005329 Bacteria 1946
47 Ga0070683_100204496 3300005329 Bacteria 1875
48 Ga0070683_100890703 3300005329 Bacteria 853
49 Ga0070683_101207398 3300005329 Bacteria 727
50 Ga0070690_100074756 3300005330 Bacteria 2207
51 Ga0070690_100552771 3300005330 Unclassified 868
52 Ga0070670_100091108 3300005331 Bacteria 2621
53 Ga0070670_100555444 3300005331 Bacteria 1025
54 Ga0070670_100559526 3300005331 Bacteria 1021
55 Ga0070670_100618898 3300005331 Bacteria 970
56 Ga0070670_100664503 3300005331 Bacteria 935
57 Ga0070670_101099977 3300005331 Bacteria 725
58 Ga0070677_10371602 3300005333 Bacteria 746
59 Ga0070677_10737192 3300005333 Unclassified 558
60 Ga0068869_100046521 3300005334 Bacteria 3129
61 Ga0068869_100107791 3300005334 Bacteria 2116
62 Ga0068869_100839218 3300005334 Bacteria 792
63 Ga0068869_100848578 3300005334 Bacteria 788
64 Ga0070666_10269224 3300005335 Bacteria 1209
65 Ga0070666_10335169 3300005335 Bacteria 1081
66 Ga0070680_100008898 3300005336 Bacteria 7696
67 Ga0070680_100060199 3300005336 Bacteria 3108
68 Ga0070680_100485896 3300005336 Bacteria 1056
69 Ga0070680_100630449 3300005336 Bacteria 921
70 Ga0070682_100101276 3300005337 Bacteria 1902
71 Ga0070682_100353796 3300005337 Bacteria 1096
72 Ga0070682_101752956 3300005337 Bacteria 541
73 Ga0068868_100022080 3300005338 Bacteria 4799
74 Ga0070660_100046383 3300005339 Bacteria 3331
75 Ga0070660_100085134 3300005339 Bacteria 2486
76 Ga0070689_100016259 3300005340 Bacteria 5442
77 Ga0070689_100071117 3300005340 Bacteria 2717
78 Ga0070689_101144659 3300005340 Bacteria 697
79 Ga0070687_100010285 3300005343 Bacteria 4040
80 Ga0070687_100095140 3300005343 Bacteria 1656
81 Ga0070687_100391455 3300005343 Bacteria 909
82 Ga0070687_101106785 3300005343 Bacteria 580
83 Ga0070661_100002072 3300005344 Bacteria 13801
84 Ga0070661_100021059 3300005344 Bacteria 4656
85 Ga0070661_100022798 3300005344 Bacteria 4483
86 Ga0070661_100804232 3300005344 Bacteria 772
87 Ga0070661_100823882 3300005344 Bacteria 762
88 Ga0070661_101005954 3300005344 Bacteria 692
89 Ga0070692_10064111 3300005345 Bacteria 1943
90 Ga0070668_100034983 3300005347 Bacteria 3829
91 Ga0070668_100054067 3300005347 Bacteria 3097
92 Ga0070668_100785826 3300005347 Bacteria 845
93 Ga0070669_100001824 3300005353 Bacteria 15341
94 Ga0070669_100089004 3300005353 Bacteria 2311
95 Ga0070675_100001147 3300005354 Bacteria 19118
96 Ga0070675_100033024 3300005354 Bacteria 4192
97 Ga0070675_100143974 3300005354 Unclassified 2039
98 Ga0070675_100221505 3300005354 Bacteria 1648
99 Ga0070675_101260582 3300005354 Bacteria 681
100 Ga0070671_100179082 3300005355 Bacteria 1794
101 Ga0070671_100312256 3300005355 Bacteria 1339
102 Ga0070671_100564838 3300005355 Bacteria 982
103 Ga0070673_100062378 3300005364 Bacteria 2961
104 Ga0070673_100419539 3300005364 Bacteria 1199
105 Ga0070688_100038678 3300005365 Bacteria 2914
106 Ga0070688_100343518 3300005365 Bacteria 1091
107 Ga0070688_100485119 3300005365 Bacteria 930
108 Ga0070688_100550927 3300005365 Bacteria 877
109 Ga0070688_100571762 3300005365 Bacteria 862
110 Ga0070659_100037782 3300005366 Bacteria 3765
111 Ga0070659_100087344 3300005366 Bacteria 2496
112 Ga0070659_100117239 3300005366 Bacteria 2153
113 Ga0070659_100264869 3300005366 Bacteria 1427
114 Ga0070659_100448035 3300005366 Bacteria 1095
115 Ga0070659_100483195 3300005366 Bacteria 1054
116 Ga0070659_100771709 3300005366 Bacteria 835
117 Ga0070659_101284901 3300005366 Bacteria 649
118 Ga0070667_100064211 3300005367 Bacteria 3114
119 Ga0070667_100314189 3300005367 Bacteria 1413
120 Ga0070667_100575319 3300005367 Bacteria 1037
121 Ga0070667_100836368 3300005367 Bacteria 855
122 Ga0070667_101047847 3300005367 Bacteria 762
123 Ga0070667_101710805 3300005367 Bacteria 592
124 Ga0070703_10257965 3300005406 Unclassified 710
125 Ga0070703_10575581 3300005406 Bacteria 517
126 Ga0070701_10023737 3300005438 Bacteria 2958
127 Ga0070701_10333854 3300005438 Bacteria 942
128 Ga0070705_100005429 3300005440 Bacteria 6211
129 Ga0070705_101201364 3300005440 Bacteria 625
130 Ga0070705_101390433 3300005440 Bacteria 585
131 Ga0070700_100028866 3300005441 Bacteria 3305
132 Ga0070700_100125557 3300005441 Bacteria 1725
133 Ga0070700_100262775 3300005441 Bacteria 1244
134 Ga0070694_100046697 3300005444 Bacteria 2909
135 Ga0070694_100467427 3300005444 Bacteria 999
136 Ga0070694_100667087 3300005444 Bacteria 843
137 Ga0070663_100624087 3300005455 Bacteria 909
138 Ga0070663_101055043 3300005455 Bacteria 709
139 Ga0070678_100185328 3300005456 Bacteria 1707
140 Ga0070678_101792386 3300005456 Bacteria 579
141 Ga0070662_100013116 3300005457 Bacteria 5508
142 Ga0070662_100064872 3300005457 Bacteria 2675
143 Ga0070662_100066832 3300005457 Bacteria 2639
144 Ga0070662_100225888 3300005457 Bacteria 1496
145 Ga0070662_100422641 3300005457 Bacteria 1103
146 Ga0070662_101260712 3300005457 Bacteria 636
147 Ga0070662_101713121 3300005457 Bacteria 543
148 Ga0070681_10008511 3300005458 Bacteria 10045
149 Ga0070681_10008667 3300005458 Bacteria 9975
150 Ga0070681_10014161 3300005458 Bacteria 7938
151 Ga0070681_10017926 3300005458 Bacteria 7077
152 Ga0070681_10127822 3300005458 Bacteria 2474
153 Ga0070681_10350335 3300005458 Bacteria 1387
154 Ga0070681_10503191 3300005458 Bacteria 1125
155 Ga0070681_10558475 3300005458 Bacteria 1059
156 Ga0070681_10916527 3300005458 Unclassified 795
157 Ga0070681_11340398 3300005458 Bacteria 639
158 Ga0070681_11384466 3300005458 Bacteria 627
159 Ga0068867_101095795 3300005459 Bacteria 727
160 Ga0068867_102136684 3300005459 Bacteria 531
161 Ga0070685_10014935 3300005466 Bacteria 4121
162 Ga0070685_10061086 3300005466 Bacteria 2206
163 Ga0070685_10291930 3300005466 Bacteria 1096
164 Ga0070699_100551056 3300005518 Bacteria 1050
165 Ga0070679_100001702 3300005530 Bacteria 19818
166 Ga0070679_100117134 3300005530 Bacteria 2649
167 Ga0070679_100196255 3300005530 Bacteria 1986
168 Ga0070679_100281350 3300005530 Bacteria 1616
169 Ga0070679_100465364 3300005530 Bacteria 1209
170 Ga0070679_100821206 3300005530 Bacteria 873
171 Ga0070684_100013783 3300005535 Bacteria 6526
172 Ga0070684_100082361 3300005535 Bacteria 2849
173 Ga0070684_100087732 3300005535 Bacteria 2763
174 Ga0070684_100113100 3300005535 Bacteria 2436
175 Ga0070684_100128544 3300005535 Bacteria 2284
176 Ga0070684_100137105 3300005535 Bacteria 2211
177 Ga0070684_100400221 3300005535 Bacteria 1266
178 Ga0070684_100595088 3300005535 Bacteria 1028
179 Ga0070684_101559255 3300005535 Bacteria 623
180 Ga0068853_100005407 3300005539 Bacteria 10005
181 Ga0068853_100015819 3300005539 Bacteria 6195
182 Ga0068853_101136693 3300005539 Bacteria 753
183 Ga0070672_100080600 3300005543 Bacteria 2608
184 Ga0070672_100153463 3300005543 Bacteria 1906
185 Ga0070672_100293531 3300005543 Bacteria 1377
186 Ga0070672_100295777 3300005543 Bacteria 1371
187 Ga0070672_100621980 3300005543 Bacteria 942
188 Ga0070686_100143250 3300005544 Bacteria 1666
189 Ga0070686_100304681 3300005544 Bacteria 1183
190 Ga0070686_100520786 3300005544 Bacteria 926
191 Ga0070693_100069750 3300005547 Bacteria 2067
192 Ga0070693_100598019 3300005547 Bacteria 796
193 Ga0070693_100934846 3300005547 Bacteria 652
194 Ga0070693_101113568 3300005547 Bacteria 603
195 Ga0070665_100092233 3300005548 Bacteria 3034
196 Ga0070665_100124658 3300005548 Bacteria 2578
197 Ga0070665_100946435 3300005548 Bacteria 874
198 Ga0070704_100822956 3300005549 Bacteria 831
199 Ga0070704_101079369 3300005549 Bacteria 728
200 Ga0068855_100034057 3300005563 Bacteria 6077
201 Ga0068855_101620525 3300005563 Bacteria 662
202 Ga0070664_100020581 3300005564 Bacteria 5433
203 Ga0070664_100088840 3300005564 Bacteria 2672
204 Ga0070664_100094612 3300005564 Bacteria 2591
205 Ga0070664_100141951 3300005564 Bacteria 2115
206 Ga0070664_100149326 3300005564 Bacteria 2063
207 Ga0070664_100171061 3300005564 Bacteria 1927
208 Ga0070664_100175576 3300005564 Bacteria 1902
209 Ga0070664_100375557 3300005564 Bacteria 1297
210 Ga0070664_100419906 3300005564 Bacteria 1225
211 Ga0070664_100617040 3300005564 Bacteria 1006
212 Ga0070664_100675394 3300005564 Bacteria 961
213 Ga0070664_101070841 3300005564 Bacteria 759
214 Ga0068857_100043819 3300005577 Bacteria 3969
215 Ga0068857_100051176 3300005577 Bacteria 3663
216 Ga0068857_100068506 3300005577 Bacteria 3158
217 Ga0068857_100112028 3300005577 Bacteria 2453
218 Ga0068857_100459159 3300005577 Bacteria 1192
219 Ga0068854_100540134 3300005578 Bacteria 987
220 Ga0068854_101611583 3300005578 Bacteria 592
221 Ga0068856_100102001 3300005614 Bacteria 2862
222 Ga0068856_100180514 3300005614 Bacteria 2124
223 Ga0068856_100843215 3300005614 Bacteria 936
224 Ga0070702_100052170 3300005615 Bacteria 2345
225 Ga0070702_100976558 3300005615 Bacteria 669
226 Ga0068852_100009459 3300005616 Bacteria 7240
227 Ga0068852_100092675 3300005616 Bacteria 2706
228 Ga0068852_100150106 3300005616 Bacteria 2166
229 Ga0068852_100678330 3300005616 Bacteria 1040
230 Ga0068852_100920858 3300005616 Bacteria 892
231 Ga0068852_101209822 3300005616 Bacteria 777
232 Ga0068852_101352754 3300005616 Bacteria 734
233 Ga0068859_100020078 3300005617 Bacteria 6708
234 Ga0068859_100184489 3300005617 Bacteria 2170
235 Ga0068859_100264811 3300005617 Bacteria 1811
236 Ga0068864_100068876 3300005618 Bacteria 3075
237 Ga0068864_100218966 3300005618 Bacteria 1756
238 Ga0068864_100306502 3300005618 Bacteria 1488
239 Ga0068864_100559129 3300005618 Bacteria 1107
240 Ga0068864_100893879 3300005618 Bacteria 877
241 Ga0068864_101261451 3300005618 Bacteria 739
242 Ga0068864_101417493 3300005618 Bacteria 697
243 Ga0068861_100004625 3300005719 Bacteria 9236
244 Ga0068861_100066574 3300005719 Bacteria 2777
245 Ga0068861_100143628 3300005719 Unclassified 1951
246 Ga0068861_100624850 3300005719 Bacteria 992
247 Ga0068861_102551930 3300005719 Bacteria 515
248 Ga0068851_10016073 3300005834 Bacteria 3576
249 Ga0068851_10220794 3300005834 Bacteria 1065
250 Ga0068870_10029793 3300005840 Bacteria 2752
251 Ga0068870_10060121 3300005840 Bacteria 2039
252 Ga0068870_10395524 3300005840 Bacteria 898
253 Ga0068863_100003611 3300005841 Bacteria 15274
254 Ga0068863_100075877 3300005841 Bacteria 3181
255 Ga0068863_100317582 3300005841 Bacteria 1513
256 Ga0068863_100452830 3300005841 Bacteria 1260
257 Ga0068863_100605585 3300005841 Bacteria 1085
258 Ga0068863_100812642 3300005841 Bacteria 933
259 Ga0068858_100021630 3300005842 Bacteria 6012
260 Ga0068858_100491077 3300005842 Bacteria 1185
261 Ga0068858_101245288 3300005842 Bacteria 732
262 Ga0068858_101377475 3300005842 Bacteria 695
263 Ga0068860_100028624 3300005843 Bacteria 5363
264 Ga0068860_100510746 3300005843 Bacteria 1201
265 Ga0068860_101010530 3300005843 Bacteria 850
266 Ga0068862_100009967 3300005844 Bacteria 7850
267 Ga0068862_100021217 3300005844 Bacteria 5429
268 Ga0068862_100158957 3300005844 Bacteria 2016
269 Ga0068862_100185733 3300005844 Bacteria 1868
270 Ga0068862_100521507 3300005844 Bacteria 1131
271 Ga0081455_10434191 3300005937 Bacteria 902
272 Ga0075363_100311093 3300006048 Bacteria 915
273 Ga0075432_10066695 3300006058 Bacteria 1288
274 Ga0075432_10297490 3300006058 Bacteria 669
275 Ga0070712_100650094 3300006175 Bacteria 896
276 Ga0070712_101247602 3300006175 Bacteria 647
277 Ga0075427_10021685 3300006194 Bacteria 1023
278 Ga0097621_100066116 3300006237 Bacteria 2977
279 Ga0097621_101162523 3300006237 Bacteria 726
280 Ga0075428_100017080 3300006844 Bacteria 8017
281 Ga0075428_100093041 3300006844 Bacteria 3287
282 Ga0075428_101203021 3300006844 Bacteria 799
283 Ga0075428_101391601 3300006844 Bacteria 736
284 Ga0075430_100428689 3300006846 Bacteria 1091
285 Ga0075430_100772785 3300006846 Bacteria 792
286 Ga0075430_101084695 3300006846 Bacteria 659
287 Ga0075430_101155436 3300006846 Bacteria 637
288 Ga0075431_100148241 3300006847 Bacteria 2417
289 Ga0075431_100615164 3300006847 Bacteria 1069
290 Ga0075433_10025380 3300006852 Bacteria 5009
291 Ga0075433_10074113 3300006852 Bacteria 2995
292 Ga0075433_10144868 3300006852 Bacteria 2112
293 Ga0075434_100006240 3300006871 Bacteria 10918
294 Ga0075434_100105101 3300006871 Bacteria 2834
295 Ga0075434_100353241 3300006871 Bacteria 1491
296 Ga0075429_100074976 3300006880 Bacteria 2947
297 Ga0075429_100198819 3300006880 Bacteria 1756
298 Ga0068865_100004671 3300006881 Bacteria 8276
299 Ga0068865_100004928 3300006881 Bacteria 8070
300 Ga0068865_101050681 3300006881 Bacteria 715
301 Ga0075436_100014918 3300006914 Bacteria 5324
302 Ga0097620_100020078 3300006931 Bacteria 6708
303 Ga0097620_100184490 3300006931 Bacteria 2170
304 Ga0097620_100264810 3300006931 Bacteria 1811
305 Ga0075435_100084960 3300007076 Bacteria 2605
306 Ga0075435_100580976 3300007076 Bacteria 971
307 Ga0075435_101385799 3300007076 Bacteria 616
308 Ga0105240_10032792 3300009093 Bacteria 6720
309 Ga0105240_11165800 3300009093 Bacteria 817
310 Ga0111539_10017919 3300009094 Bacteria 8773
311 Ga0111539_10049836 3300009094 Bacteria 4990
312 Ga0111539_10080853 3300009094 Bacteria 3822
313 Ga0111539_10094070 3300009094 Bacteria 3521
314 Ga0111539_10108588 3300009094 Bacteria 3256
315 Ga0111539_10167917 3300009094 Bacteria 2564
316 Ga0111539_10255592 3300009094 Bacteria 2040
317 Ga0111539_10656679 3300009094 Bacteria 1221
318 Ga0111539_10726126 3300009094 Bacteria 1156
319 Ga0105245_10279297 3300009098 Bacteria 1632
320 Ga0105247_10155745 3300009101 Bacteria 1509
321 Ga0105247_10425335 3300009101 Bacteria 952
322 Ga0114129_10088126 3300009147 Bacteria 4304
323 Ga0114129_10121071 3300009147 Bacteria 3602
324 Ga0114129_10817026 3300009147 Bacteria 1188
325 Ga0114129_12070114 3300009147 Bacteria 687
326 Ga0114129_13222569 3300009147 Bacteria 530
327 Ga0105243_10552403 3300009148 Bacteria 1101
328 Ga0105243_10751262 3300009148 Bacteria 956
329 Ga0105243_11693957 3300009148 Bacteria 661
330 Ga0105241_10048790 3300009174 Bacteria 3222
331 Ga0105241_11216060 3300009174 Bacteria 714
332 Ga0105242_10059694 3300009176 Bacteria 3130
333 Ga0105242_10717467 3300009176 Unclassified 980
334 Ga0105242_10745422 3300009176 Bacteria 963
335 Ga0105242_11209334 3300009176 Bacteria 775
336 Ga0105242_12129757 3300009176 Bacteria 605
337 Ga0105248_10056165 3300009177 Bacteria 4416
338 Ga0105248_10070473 3300009177 Bacteria 3926
339 Ga0105248_10253628 3300009177 Bacteria 1980
340 Ga0105248_10511315 3300009177 Bacteria 1354
341 Ga0105248_11199304 3300009177 Bacteria 858
342 Ga0105248_11439451 3300009177 Bacteria 780
343 Ga0105248_11492275 3300009177 Bacteria 765
344 Ga0105237_10721189 3300009545 Bacteria 1003
345 Ga0105237_10888068 3300009545 Bacteria 898
346 Ga0105238_10096002 3300009551 Bacteria 2951
347 Ga0105238_10247955 3300009551 Unclassified 1759
348 Ga0105238_10695910 3300009551 Bacteria 1028
349 Ga0105238_10716294 3300009551 Bacteria 1013
350 Ga0105238_10730448 3300009551 Bacteria 1003
351 Ga0105249_10029865 3300009553 Bacteria 4925
352 Ga0105249_10041058 3300009553 Bacteria 4204
353 Ga0105249_10151644 3300009553 Bacteria 2232
354 Ga0105249_10158694 3300009553 Bacteria 2184
355 Ga0105249_10524989 3300009553 Bacteria 1232
356 Ga0105249_11917200 3300009553 Bacteria 665
357 Ga0105239_10004359 3300010375 Bacteria 16957
358 Ga0105239_12667774 3300010375 Bacteria 583
359 Ga0157315_1013431 3300012508 Bacteria 770
360 Ga0157327_1003733 3300012512 Bacteria 1140
361 Ga0157373_10053842 3300013100 Bacteria 2861
362 Ga0157373_10067088 3300013100 Bacteria 2537
363 Ga0157373_10253994 3300013100 Bacteria 1243
364 Ga0157373_10294390 3300013100 Bacteria 1151
365 Ga0157373_10438985 3300013100 Bacteria 938
366 Ga0157373_10458019 3300013100 Bacteria 918
367 Ga0157373_10556809 3300013100 Bacteria 832
368 Ga0157373_10591866 3300013100 Bacteria 807
369 Ga0157373_10739503 3300013100 Bacteria 722
370 Ga0157371_10036763 3300013102 Bacteria 3506
371 Ga0157371_10198700 3300013102 Bacteria 1437
372 Ga0157371_10697026 3300013102 Bacteria 760
373 Ga0157371_11437521 3300013102 Bacteria 536
374 Ga0157370_10016751 3300013104 Bacteria 7415
375 Ga0157370_10084953 3300013104 Bacteria 2973
376 Ga0157370_10648767 3300013104 Bacteria 965
377 Ga0157370_10733419 3300013104 Bacteria 901
378 Ga0157370_10843135 3300013104 Bacteria 833
379 Ga0157370_11141415 3300013104 Bacteria 704
380 Ga0157369_10027504 3300013105 Bacteria 6304
381 Ga0157369_10040652 3300013105 Bacteria 5076
382 Ga0157369_11322528 3300013105 Bacteria 734
383 Ga0157374_10110905 3300013296 Bacteria 2639
384 Ga0157374_10159090 3300013296 Bacteria 2200
385 Ga0157374_10786660 3300013296 Bacteria 967
386 Ga0157378_10221099 3300013297 Bacteria 1800
387 Ga0157378_11371948 3300013297 Bacteria 749
388 Ga0157378_11834058 3300013297 Bacteria 655
389 Ga0163162_10012258 3300013306 Bacteria 8366
390 Ga0163162_11625390 3300013306 Bacteria 737
391 Ga0163162_12315488 3300013306 Bacteria 617
392 Ga0163162_12761386 3300013306 Bacteria 565
393 Ga0157372_10018905 3300013307 Bacteria 7415
394 Ga0157372_10030499 3300013307 Bacteria 5900
395 Ga0157372_10094890 3300013307 Bacteria 3398
396 Ga0157372_10099327 3300013307 Bacteria 3320
397 Ga0157372_10157722 3300013307 Bacteria 2621
398 Ga0157372_10196009 3300013307 Bacteria 2340
399 Ga0157372_10281497 3300013307 Bacteria 1933
400 Ga0157372_10292597 3300013307 Bacteria 1894
401 Ga0157372_10383648 3300013307 Bacteria 1637
402 Ga0157372_10691515 3300013307 Bacteria 1187
403 Ga0157372_11648719 3300013307 Bacteria 738
404 Ga0157372_11673898 3300013307 Bacteria 732
405 Ga0157372_12141682 3300013307 Bacteria 642
406 Ga0157375_10014319 3300013308 Bacteria 7071
407 Ga0157375_10045132 3300013308 Bacteria 4288
408 Ga0157375_10047652 3300013308 Bacteria 4187
409 Ga0157375_10069477 3300013308 Bacteria 3529
410 Ga0157375_10167683 3300013308 Bacteria 2342
411 Ga0157375_10822861 3300013308 Bacteria 1076
412 Ga0157375_12375921 3300013308 Bacteria 632
413 Ga0163163_10131822 3300014325 Bacteria 2540
414 Ga0163163_10215355 3300014325 Bacteria 1970
415 Ga0157380_10125160 3300014326 Bacteria 2183
416 Ga0157380_10162324 3300014326 Bacteria 1944
417 Ga0157377_10008532 3300014745 Bacteria 5002
418 Ga0157377_10028605 3300014745 Bacteria 3001
419 Ga0157377_10100295 3300014745 Bacteria 1724
420 Ga0157377_10451901 3300014745 Bacteria 887
421 Ga0157379_10012695 3300014968 Bacteria 7362
422 Ga0157379_10288858 3300014968 Bacteria 1493
423 Ga0157379_10560193 3300014968 Bacteria 1064
424 Ga0157376_10189927 3300014969 Bacteria 1883
425 Ga0157376_11630474 3300014969 Bacteria 680
426 Ga0157376_12371917 3300014969 Bacteria 570
427 Ga0157376_12758708 3300014969 Bacteria 531
428 Ga0182007_10301113 3300015262 Bacteria 589
429 Ga0163161_10018510 3300017792 Bacteria 4880
430 Ga0163161_10602091 3300017792 Bacteria 906
431 Ga0163161_11175931 3300017792 Unclassified 662
432 Ga0206353_10233494 3300020082 Bacteria 674
433 Ga0213876_10003094 3300021384 Bacteria 9634
434 Ga0213876_10011231 3300021384 Bacteria 4785
435 Ga0209673_1004145 3300025273 Bacteria 7935
436 Ga0209130_1007131 3300025284 Bacteria 3501
437 Ga0209675_1006161 3300025291 Bacteria 4875
438 Ga0209675_1012769 3300025291 Bacteria 2680
439 Ga0209676_1000764 3300025292 Bacteria 43254
440 Ga0209676_1001068 3300025292 Bacteria 31254
441 Ga0209025_1001810 3300025294 Bacteria 25285
442 Ga0209025_1024030 3300025294 Bacteria 3162
443 Ga0209025_1075421 3300025294 Bacteria 1173
444 Ga0209564_1005861 3300025295 Bacteria 6831
445 Ga0209564_1016181 3300025295 Bacteria 2985
446 Ga0209758_1040504 3300025297 Bacteria 1756
447 Ga0209050_1005038 3300025298 Bacteria 8559
448 Ga0209050_1017947 3300025298 Bacteria 2784
449 Ga0209256_1000575 3300025299 Bacteria 52523
450 Ga0209256_1002249 3300025299 Bacteria 16404
451 Ga0209051_1006260 3300025303 Bacteria 6747
452 Ga0209257_1000065 3300025304 Bacteria 353604
453 Ga0209257_1000498 3300025304 Bacteria 70112
454 Ga0209257_1000593 3300025304 Bacteria 60449
455 Ga0209257_1001112 3300025304 Bacteria 34948
456 Ga0209257_1003126 3300025304 Bacteria 14788
457 Ga0209257_1004270 3300025304 Bacteria 11268
458 Ga0207697_10009866 3300025315 Bacteria 4106
459 Ga0207697_10183676 3300025315 Bacteria 917
460 Ga0207697_10295155 3300025315 Bacteria 719
461 Ga0207656_10016846 3300025321 Bacteria 2851
462 Ga0207656_10046472 3300025321 Bacteria 1863
463 Ga0207656_10060426 3300025321 Bacteria 1661
464 Ga0207682_10139122 3300025893 Bacteria 1089
465 Ga0207682_10431936 3300025893 Unclassified 623
466 Ga0207642_10625636 3300025899 Bacteria 672
467 Ga0207688_10054461 3300025901 Bacteria 2244
468 Ga0207688_10059278 3300025901 Bacteria 2156
469 Ga0207688_10462002 3300025901 Bacteria 792
470 Ga0207680_10094716 3300025903 Bacteria 1907
471 Ga0207680_10278909 3300025903 Bacteria 1161
472 Ga0207647_10050141 3300025904 Bacteria 2586
473 Ga0207647_10257058 3300025904 Bacteria 1001
474 Ga0207645_10011297 3300025907 Bacteria 6102
475 Ga0207643_10042901 3300025908 Bacteria 2551
476 Ga0207643_10201022 3300025908 Bacteria 1213
477 Ga0207705_10024486 3300025909 Bacteria 4307
478 Ga0207705_10049896 3300025909 Bacteria 3012
479 Ga0207705_10200069 3300025909 Bacteria 1513
480 Ga0207705_10656421 3300025909 Bacteria 816
481 Ga0207705_10887568 3300025909 Bacteria 691
482 Ga0207705_10955775 3300025909 Bacteria 663
483 Ga0207705_11400917 3300025909 Bacteria 531
484 Ga0207684_10065996 3300025910 Bacteria 3073
485 Ga0207654_10017730 3300025911 Bacteria 3727
486 Ga0207654_10585418 3300025911 Bacteria 795
487 Ga0207707_10001539 3300025912 Bacteria 21229
488 Ga0207707_10009253 3300025912 Bacteria 8548
489 Ga0207707_10041123 3300025912 Bacteria 4037
490 Ga0207707_10072921 3300025912 Bacteria 2993
491 Ga0207707_10096763 3300025912 Bacteria 2579
492 Ga0207707_10097980 3300025912 Bacteria 2563
493 Ga0207707_10768404 3300025912 Unclassified 805
494 Ga0207695_10064899 3300025913 Bacteria 3756
495 Ga0207671_10567938 3300025914 Bacteria 904
496 Ga0207663_10286707 3300025916 Bacteria 1225
497 Ga0207660_10007070 3300025917 Bacteria 7272
498 Ga0207660_10012283 3300025917 Bacteria 5600
499 Ga0207660_10372285 3300025917 Bacteria 1147
500 Ga0207660_10663877 3300025917 Bacteria 850
501 Ga0207662_10014013 3300025918 Bacteria 4491
502 Ga0207662_10054696 3300025918 Bacteria 2381
503 Ga0207657_10024845 3300025919 Bacteria 5538
504 Ga0207657_10086708 3300025919 Bacteria 2620
505 Ga0207657_10191899 3300025919 Bacteria 1647
506 Ga0207649_10019705 3300025920 Bacteria 3860
507 Ga0207649_10033784 3300025920 Bacteria 3059
508 Ga0207649_10066165 3300025920 Bacteria 2290
509 Ga0207649_10518634 3300025920 Bacteria 908
510 Ga0207652_10067634 3300025921 Bacteria 3098
511 Ga0207652_10104068 3300025921 Bacteria 2510
512 Ga0207652_10618453 3300025921 Bacteria 970
513 Ga0207652_11362043 3300025921 Bacteria 613
514 Ga0207652_11747936 3300025921 Bacteria 527
515 Ga0207681_10013719 3300025923 Bacteria 5018
516 Ga0207681_10511789 3300025923 Bacteria 984
517 Ga0207694_10249068 3300025924 Unclassified 1453
518 Ga0207694_10742799 3300025924 Bacteria 828
519 Ga0207694_10922372 3300025924 Bacteria 739
520 Ga0207650_10050200 3300025925 Bacteria 3084
521 Ga0207650_10067932 3300025925 Bacteria 2676
522 Ga0207650_10333562 3300025925 Bacteria 1244
523 Ga0207650_11131566 3300025925 Bacteria 666
524 Ga0207650_11271985 3300025925 Bacteria 626
525 Ga0207659_10079982 3300025926 Bacteria 2413
526 Ga0207659_10252219 3300025926 Bacteria 1432
527 Ga0207659_10275502 3300025926 Bacteria 1374
528 Ga0207659_10297605 3300025926 Bacteria 1324
529 Ga0207659_10418239 3300025926 Unclassified 1124
530 Ga0207659_10634140 3300025926 Bacteria 912
531 Ga0207659_10733871 3300025926 Bacteria 847
532 Ga0207664_10364119 3300025929 Bacteria 1281
533 Ga0207644_10262683 3300025931 Bacteria 1381
534 Ga0207644_10308870 3300025931 Bacteria 1276
535 Ga0207644_10385769 3300025931 Bacteria 1143
536 Ga0207644_10641008 3300025931 Bacteria 884
537 Ga0207690_10016598 3300025932 Bacteria 4484
538 Ga0207690_10026685 3300025932 Bacteria 3639
539 Ga0207690_10128824 3300025932 Bacteria 1849
540 Ga0207690_10330085 3300025932 Bacteria 1201
541 Ga0207690_10795058 3300025932 Bacteria 782
542 Ga0207690_10872051 3300025932 Bacteria 746
543 Ga0207706_10002237 3300025933 Bacteria 18881
544 Ga0207706_10081778 3300025933 Bacteria 2838
545 Ga0207686_10037265 3300025934 Bacteria 2933
546 Ga0207686_11306938 3300025934 Bacteria 595
547 Ga0207709_10647032 3300025935 Bacteria 841
548 Ga0207670_10066576 3300025936 Bacteria 2475
549 Ga0207670_10337339 3300025936 Bacteria 1190
550 Ga0207670_10959984 3300025936 Bacteria 718
551 Ga0207670_11932016 3300025936 Bacteria 502
552 Ga0207669_10727829 3300025937 Bacteria 817
553 Ga0207704_10027971 3300025938 Bacteria 3121
554 Ga0207704_10124939 3300025938 Bacteria 1769
555 Ga0207704_11716438 3300025938 Bacteria 540
556 Ga0207691_10046847 3300025940 Bacteria 3971
557 Ga0207691_10097144 3300025940 Bacteria 2633
558 Ga0207691_10099416 3300025940 Bacteria 2597
559 Ga0207691_10125146 3300025940 Bacteria 2275
560 Ga0207691_10222306 3300025940 Bacteria 1637
561 Ga0207711_10041786 3300025941 Bacteria 3905
562 Ga0207711_10473336 3300025941 Bacteria 1167
563 Ga0207689_10037078 3300025942 Bacteria 4046
564 Ga0207689_10201212 3300025942 Bacteria 1644
565 Ga0207689_10546033 3300025942 Unclassified 973
566 Ga0207689_11091049 3300025942 Bacteria 673
567 Ga0207661_10002394 3300025944 Bacteria 12915
568 Ga0207661_10028189 3300025944 Bacteria 4298
569 Ga0207661_10085411 3300025944 Bacteria 2616
570 Ga0207661_10106480 3300025944 Bacteria 2364
571 Ga0207661_10168154 3300025944 Bacteria 1907
572 Ga0207661_10189880 3300025944 Bacteria 1800
573 Ga0207661_10362443 3300025944 Bacteria 1309
574 Ga0207661_10868878 3300025944 Bacteria 830
575 Ga0207661_10876897 3300025944 Bacteria 826
576 Ga0207661_10879246 3300025944 Bacteria 825
577 Ga0207679_10002284 3300025945 Bacteria 11824
578 Ga0207679_10041988 3300025945 Bacteria 3283
579 Ga0207679_10077744 3300025945 Bacteria 2526
580 Ga0207679_10163265 3300025945 Bacteria 1826
581 Ga0207679_10185497 3300025945 Bacteria 1724
582 Ga0207679_10208189 3300025945 Bacteria 1638
583 Ga0207679_10288698 3300025945 Bacteria 1409
584 Ga0207679_10380007 3300025945 Bacteria 1238
585 Ga0207679_10424722 3300025945 Bacteria 1174
586 Ga0207679_10453408 3300025945 Bacteria 1138
587 Ga0207679_10613656 3300025945 Bacteria 981
588 Ga0207679_10977952 3300025945 Bacteria 775
589 Ga0207679_11207135 3300025945 Bacteria 694
590 Ga0207679_11826462 3300025945 Bacteria 555
591 Ga0207667_10231860 3300025949 Bacteria 1890
592 Ga0207667_10605382 3300025949 Bacteria 1105
593 Ga0207667_11039029 3300025949 Bacteria 805
594 Ga0207667_11899658 3300025949 Bacteria 557
595 Ga0207667_12032403 3300025949 Bacteria 534
596 Ga0207651_10025055 3300025960 Bacteria 3702
597 Ga0207651_10045633 3300025960 Bacteria 2941
598 Ga0207712_10013793 3300025961 Bacteria 5184
599 Ga0207712_10015567 3300025961 Bacteria 4910
600 Ga0207712_10032907 3300025961 Bacteria 3502
601 Ga0207712_10288438 3300025961 Bacteria 1342
602 Ga0207668_10009889 3300025972 Bacteria 5733
603 Ga0207668_10021866 3300025972 Bacteria 4084
604 Ga0207640_10308730 3300025981 Bacteria 1255
605 Ga0207640_10483521 3300025981 Bacteria 1028
606 Ga0207640_10726259 3300025981 Bacteria 854
607 Ga0207640_11431750 3300025981 Bacteria 620
608 Ga0207640_11514858 3300025981 Bacteria 603
609 Ga0207658_10052857 3300025986 Bacteria 2999
610 Ga0207658_10147742 3300025986 Bacteria 1911
611 Ga0207658_11305173 3300025986 Bacteria 664
612 Ga0207677_10160633 3300026023 Bacteria 1745
613 Ga0207677_10256424 3300026023 Bacteria 1423
614 Ga0207677_11541778 3300026023 Bacteria 614
615 Ga0207703_10023800 3300026035 Bacteria 4817
616 Ga0207703_10425013 3300026035 Bacteria 1237
617 Ga0207703_11019406 3300026035 Bacteria 794
618 Ga0207703_11743076 3300026035 Bacteria 599
619 Ga0207703_11773075 3300026035 Bacteria 593
620 Ga0207639_10016177 3300026041 Bacteria 5271
621 Ga0207639_10063961 3300026041 Bacteria 2851
622 Ga0207639_10336450 3300026041 Bacteria 1345
623 Ga0207639_10592155 3300026041 Bacteria 1022
624 Ga0207639_10915047 3300026041 Bacteria 820
625 Ga0207639_12046953 3300026041 Bacteria 534
626 Ga0207639_12197742 3300026041 Bacteria 513
627 Ga0207678_10044834 3300026067 Bacteria 3824
628 Ga0207678_10411538 3300026067 Bacteria 1172
629 Ga0207708_10032553 3300026075 Bacteria 3959
630 Ga0207708_10528025 3300026075 Bacteria 992
631 Ga0207702_10184662 3300026078 Bacteria 1922
632 Ga0207702_10694463 3300026078 Bacteria 1003
633 Ga0207702_10893626 3300026078 Bacteria 880
634 Ga0207702_11818375 3300026078 Bacteria 601
635 Ga0207641_10103975 3300026088 Bacteria 2506
636 Ga0207641_10325662 3300026088 Bacteria 1458
637 Ga0207641_10693479 3300026088 Bacteria 1002
638 Ga0207641_10913838 3300026088 Bacteria 872
639 Ga0207641_10926881 3300026088 Bacteria 866
640 Ga0207641_11060259 3300026088 Bacteria 808
641 Ga0207648_10040177 3300026089 Bacteria 4111
642 Ga0207648_10146559 3300026089 Bacteria 2082
643 Ga0207648_11191749 3300026089 Bacteria 715
644 Ga0207676_10247055 3300026095 Bacteria 1604
645 Ga0207676_10568584 3300026095 Bacteria 1085
646 Ga0207676_10689996 3300026095 Bacteria 988
647 Ga0207676_10798897 3300026095 Bacteria 920
648 Ga0207676_11063303 3300026095 Bacteria 799
649 Ga0207676_11442351 3300026095 Bacteria 685
650 Ga0207676_12065615 3300026095 Bacteria 568
651 Ga0207674_10008894 3300026116 Bacteria 11548
652 Ga0207674_10047433 3300026116 Bacteria 4404
653 Ga0207674_10056432 3300026116 Bacteria 3988
654 Ga0207674_10122083 3300026116 Bacteria 2571
655 Ga0207674_10488628 3300026116 Bacteria 1190
656 Ga0207675_100000209 3300026118 Bacteria 54603
657 Ga0207675_100002910 3300026118 Bacteria 16833
658 Ga0207675_100594660 3300026118 Bacteria 1109
659 Ga0207675_100668168 3300026118 Bacteria 1046
660 Ga0207675_100805885 3300026118 Bacteria 953
661 Ga0207675_102189842 3300026118 Bacteria 568
662 Ga0207698_10039806 3300026142 Bacteria 3486
663 Ga0207698_10051296 3300026142 Bacteria 3153
664 Ga0207698_10132867 3300026142 Bacteria 2130
665 Ga0207698_11163174 3300026142 Bacteria 785
666 Ga0207698_11330778 3300026142 Bacteria 733
667 Ga0209995_1062771 3300027471 Bacteria 633
668 Ga0209970_1041146 3300027614 Bacteria 822
669 Ga0209974_10093259 3300027876 Bacteria 1046
670 Ga0207428_10009104 3300027907 Bacteria 8925
671 Ga0207428_10054860 3300027907 Bacteria 3172
672 Ga0207428_10067609 3300027907 Bacteria 2813
673 Ga0207428_10155986 3300027907 Bacteria 1736
674 Ga0207428_10221820 3300027907 Bacteria 1417
675 Ga0268266_10237080 3300028379 Bacteria 1682
676 Ga0268266_10246397 3300028379 Bacteria 1651
677 Ga0268266_10383095 3300028379 Bacteria 1327
678 Ga0268266_10691353 3300028379 Bacteria 983
679 Ga0268266_12008685 3300028379 Bacteria 552
680 Ga0268265_10012226 3300028380 Bacteria 5813
681 Ga0268265_10013128 3300028380 Bacteria 5626
682 Ga0268265_10304984 3300028380 Bacteria 1435
683 Ga0268265_11966241 3300028380 Bacteria 592
684 Ga0268264_10087668 3300028381 Bacteria 2676
685 Ga0307517_10549211 3300028786 Bacteria 578
686 Ga0307515_10707329 3300028794 Bacteria 624
687 Ga0307408_100005765 3300031548 Bacteria 8251
688 Ga0307408_100022310 3300031548 Bacteria 4300
689 Ga0307408_100069266 3300031548 Bacteria 2601
690 Ga0307408_100071711 3300031548 Bacteria 2562
691 Ga0307408_100190589 3300031548 Bacteria 1651
692 Ga0307405_10000431 3300031731 Bacteria 15673
693 Ga0307405_10000467 3300031731 Bacteria 15176
694 Ga0307405_10004308 3300031731 Bacteria 6700
695 Ga0307405_10025988 3300031731 Bacteria 3370
696 Ga0307405_10397022 3300031731 Bacteria 1078
697 Ga0307405_10410594 3300031731 Bacteria 1062
698 Ga0307405_11061527 3300031731 Bacteria 694
699 Ga0307405_11490986 3300031731 Bacteria 594
700 Ga0307413_10000553 3300031824 Bacteria 12502
701 Ga0307413_10000611 3300031824 Bacteria 12000
702 Ga0307413_10046328 3300031824 Bacteria 2584
703 Ga0307413_10065562 3300031824 Bacteria 2262
704 Ga0307413_10086659 3300031824 Bacteria 2025
705 Ga0307413_10256133 3300031824 Bacteria 1301
706 Ga0307413_10348001 3300031824 Bacteria 1142
707 Ga0307413_10431682 3300031824 Bacteria 1040
708 Ga0307413_10645769 3300031824 Bacteria 872
709 Ga0307410_10014163 3300031852 Bacteria 4681
710 Ga0307410_10047568 3300031852 Bacteria 2867
711 Ga0307410_10061960 3300031852 Bacteria 2561
712 Ga0307410_10178373 3300031852 Bacteria 1606
713 Ga0307410_10197290 3300031852 Bacteria 1534
714 Ga0307410_10239074 3300031852 Bacteria 1406
715 Ga0307410_10396720 3300031852 Bacteria 1114
716 Ga0307410_10422915 3300031852 Bacteria 1081
717 Ga0307410_11171109 3300031852 Bacteria 669
718 Ga0307406_10002382 3300031901 Bacteria 10212
719 Ga0307406_10005037 3300031901 Bacteria 7202
720 Ga0307406_10014924 3300031901 Bacteria 4481
721 Ga0307406_10035208 3300031901 Bacteria 3077
722 Ga0307406_10053531 3300031901 Bacteria 2571
723 Ga0307406_10063388 3300031901 Bacteria 2394
724 Ga0307406_10143337 3300031901 Bacteria 1694
725 Ga0307406_10200322 3300031901 Bacteria 1469
726 Ga0307406_10229065 3300031901 Bacteria 1386
727 Ga0307407_10000511 3300031903 Bacteria 12005
728 Ga0307407_10004075 3300031903 Bacteria 6139
729 Ga0307407_10041261 3300031903 Bacteria 2579
730 Ga0307407_10161929 3300031903 Bacteria 1465
731 Ga0307407_10250093 3300031903 Bacteria 1214
732 Ga0307407_10275083 3300031903 Bacteria 1164
733 Ga0307407_10329993 3300031903 Bacteria 1073
734 Ga0307407_10883291 3300031903 Bacteria 685
735 Ga0307407_11094928 3300031903 Bacteria 619
736 Ga0307412_10001715 3300031911 Bacteria 12127
737 Ga0307412_10010522 3300031911 Bacteria 5330
738 Ga0307412_10029005 3300031911 Bacteria 3469
739 Ga0307412_10059476 3300031911 Bacteria 2561
740 Ga0307412_10372344 3300031911 Bacteria 1154
741 Ga0307412_10454780 3300031911 Bacteria 1056
742 Ga0307412_12315555 3300031911 Bacteria 501
743 Ga0307409_100000474 3300031995 Bacteria 17172
744 Ga0307409_100004192 3300031995 Bacteria 8035
745 Ga0307409_100066532 3300031995 Bacteria 2842
746 Ga0307409_100072959 3300031995 Bacteria 2735
747 Ga0307409_100462768 3300031995 Bacteria 1226
748 Ga0307409_100913706 3300031995 Bacteria 892
749 Ga0307409_101398726 3300031995 Bacteria 726
750 Ga0307409_101635213 3300031995 Bacteria 672
751 Ga0307416_100000163 3300032002 Bacteria 38138
752 Ga0307416_100000912 3300032002 Bacteria 15587
753 Ga0307416_100001181 3300032002 Bacteria 14007
754 Ga0307416_100018472 3300032002 Bacteria 4911
755 Ga0307416_100040050 3300032002 Bacteria 3635
756 Ga0307416_100092765 3300032002 Bacteria 2599
757 Ga0307416_100252872 3300032002 Bacteria 1716
758 Ga0307416_100310937 3300032002 Bacteria 1572
759 Ga0307416_100716573 3300032002 Bacteria 1091
760 Ga0307416_100854641 3300032002 Bacteria 1008
761 Ga0307416_101074897 3300032002 Bacteria 909
762 Ga0307416_101810145 3300032002 Bacteria 714
763 Ga0307416_102070073 3300032002 Bacteria 671
764 Ga0307414_10001031 3300032004 Bacteria 14232
765 Ga0307414_10002523 3300032004 Bacteria 9608
766 Ga0307414_10129588 3300032004 Bacteria 1956
767 Ga0307414_10143624 3300032004 Bacteria 1872
768 Ga0307414_10314665 3300032004 Bacteria 1330
769 Ga0307414_10326140 3300032004 Bacteria 1309
770 Ga0307414_10460805 3300032004 Bacteria 1117
771 Ga0307411_10000120 3300032005 Bacteria 24490
772 Ga0307411_10003303 3300032005 Bacteria 7454
773 Ga0307411_10010089 3300032005 Bacteria 5013
774 Ga0307411_10058094 3300032005 Bacteria 2558
775 Ga0307411_10122995 3300032005 Bacteria 1881
776 Ga0307411_10163960 3300032005 Bacteria 1668
777 Ga0307411_10262565 3300032005 Bacteria 1364
778 Ga0307411_10276649 3300032005 Bacteria 1334
779 Ga0307411_10798627 3300032005 Bacteria 831
780 Ga0307411_11181599 3300032005 Bacteria 693
781 Ga0307415_100001591 3300032126 Bacteria 10958
782 Ga0307415_100022540 3300032126 Bacteria 3888
783 Ga0307415_100113318 3300032126 Bacteria 2016
784 Ga0307415_100173143 3300032126 Bacteria 1685
785 Ga0307415_100534568 3300032126 Bacteria 1031
786 Ga0307415_100651072 3300032126 Bacteria 944
787 Ga0307415_101396334 3300032126 Bacteria 666
788 Ga0307510_10000276 3300033180 Bacteria 47201
789 Ga0373952_0058003 3300035092 Bacteria 940
790 Ga0373960_0178499 3300035121 Bacteria 740
791 Ga0373946_0419620 3300035171 Unclassified 678
792 Ga0373961_0129810 3300035241 Bacteria 843
793 Ga0373962_0086014 3300035242 Bacteria 962
794 Ga0395899_0122473 3300037312 Bacteria 1861
795 Ga0395900_0001278 3300037418 Bacteria 30720
796 Ga0395900_0261130 3300037418 Bacteria 1730
797 Ga0395898_0002604 3300037466 Bacteria 21051
798 Ga0395898_0023538 3300037466 Bacteria 6222
799 Ga0395898_0170279 3300037466 Bacteria 2082
800 Ga0395905_0086560 3300037471 Bacteria 2937
801 Ga0395905_0247916 3300037471 Bacteria 1664
802 Ga0395905_1815990 3300037471 Bacteria 515
803 Ga0436364_1168503 3300037853 Bacteria 1213
804 Ga0395901_0000327 3300038443 Bacteria 58568
805 Ga0395901_0020475 3300038443 Bacteria 6770
806 Ga0395901_0028345 3300038443 Bacteria 5758
807 Ga0436365_0137719 3300039437 Bacteria 9772
808 Ga0436365_0173963 3300039437 Bacteria 7447
809 Ga0436365_0223687 3300039437 Bacteria 4786
810 Ga0436362_1069022 3300039453 Bacteria 584
811 Ga0439439_0059749 3300041406 Bacteria 1011
812 Ga0439439_0131204 3300041406 Bacteria 704
813 Ga0439453_0017774 3300041408 Bacteria 1252
814 Ga0439461_0012170 3300041410 Bacteria 1606
815 Ga0451800_0683371 3300041459 Bacteria 697
816 Ga0451847_0370653 3300041503 Bacteria 742
817 Ga0451853_1340511 3300041512 Bacteria 656
818 Ga0439433_0031208 3300041999 Bacteria 1219
819 Ga0439441_023866 3300042001 Bacteria 1145
820 Ga0439443_016136 3300042003 Bacteria 1139
821 Ga0439448_0017521 3300042005 Bacteria 2188
822 Ga0439454_048451 3300042011 Bacteria 712
823 Ga0439456_075124 3300042013 Bacteria 751
824 Ga0439462_0078786 3300042015 Bacteria 899
825 Ga0450917_027856 3300042120 Unclassified 530
826 Ga0450923_000962 3300042125 Bacteria 3571
827 Ga0450923_112777 3300042125 Bacteria 636
828 Ga0439446_0001964 3300042156 Bacteria 4852
829 Ga0450908_037959 3300042184 Bacteria 835
830 Ga0439434_0273614 3300042435 Bacteria 580
831 Ga0439435_0001188 3300042436 Bacteria 4693
832 Ga0439444_0000441 3300042437 Bacteria 4632
833 Ga0439444_0028990 3300042437 Bacteria 1029
834 Ga0439459_0071438 3300042438 Bacteria 804
835 Ga0439464_0085150 3300042439 Bacteria 948
836 Ga0439460_0060340 3300042461 Bacteria 1157
837 Ga0451577_0113739 3300042876 Bacteria 2422
838 Ga0453683_0675118 3300044673 Bacteria 676
839 Ga0466961_0380136 3300044693 Bacteria 858
840 Ga0466963_0571023 3300044694 Unclassified 799
841 Ga0453684_0000939 3300044712 Bacteria 96146
842 Ga0466957_0369214 3300044842 Bacteria 977
843 Ga0466957_1371645 3300044842 Bacteria 514
844 Ga0466960_0712625 3300044901 Bacteria 603
845 Ga0451576_0439473 3300045051 Bacteria 1369
846 Ga0451576_1078838 3300045051 Bacteria 841
847 Ga0495629_0097002 3300046459 Bacteria 2057
848 Ga0495638_0361285 3300046460 Bacteria 764
849 Ga0495641_0014204 3300046461 Bacteria 4320
850 Ga0495650_0000027 3300046471 Bacteria 475071
851 Ga0495639_0124882 3300046475 Bacteria 1229
852 Ga0495639_0347010 3300046475 Bacteria 745
853 Ga0495594_0007137 3300046499 Bacteria 5750
854 Ga0495594_0115875 3300046499 Bacteria 1513
855 Ga0495596_0312922 3300046500 Bacteria 610
856 Ga0495628_0905706 3300046516 Bacteria 612
857 Ga0495632_0317082 3300046519 Unclassified 689
858 Ga0495644_0106856 3300046523 Bacteria 1061
859 Ga0495663_0124817 3300046525 Bacteria 864
860 Ga0495621_0115680 3300046539 Bacteria 1032
861 Ga0495625_0202858 3300046660 Bacteria 1308
862 Ga0495661_0415862 3300046665 Bacteria 652
863 Ga0495599_0360437 3300046678 Bacteria 871
864 Ga0495613_0055044 3300046689 Bacteria 2924
865 Ga0495600_0111263 3300046809 Bacteria 1783
866 Ga0495581_0066351 3300047315 Bacteria 2087
867 Ga0495636_0075448 3300047318 Bacteria 1445
868 Ga0495672_0002532 3300047320 Bacteria 16670
869 Ga0495677_0026657 3300047445 Bacteria 2096
870 Ga0495685_041165 3300047447 Bacteria 1579
871 Ga0495684_0858240 3300047471 Bacteria 588
872 Ga0495615_0228489 3300048090 Bacteria 583
873 Ga0496100_0722153 3300048903 Bacteria 778
874 Ga0496102_1730079 3300048905 Bacteria 543
875 Ga0496104_0204205 3300048907 Bacteria 1888
876 Ga0496104_0637565 3300048907 Bacteria 975
877 Ga0496104_0648612 3300048907 Bacteria 965
878 Ga0496105_0189172 3300048908 Bacteria 1684
879 Ga0496105_1004879 3300048908 Bacteria 624
880 Ga0496106_0082749 3300048909 Bacteria 2468
881 Ga0496106_0087337 3300048909 Bacteria 2403
882 Ga0496107_0219086 3300048910 Bacteria 1416
883 Ga0496107_1183726 3300048910 Bacteria 550
884 Ga0496108_0062246 3300048911 Bacteria 3142
885 Ga0496108_0141866 3300048911 Bacteria 2070
886 Ga0496108_0290330 3300048911 Bacteria 1424
887 Ga0496108_0660724 3300048911 Bacteria 908
888 Ga0496109_0030074 3300048912 Bacteria 4867
889 Ga0496109_0269154 3300048912 Bacteria 1605
890 Ga0496109_0375171 3300048912 Bacteria 1344
891 Ga0496109_1537762 3300048912 Bacteria 600
892 Ga0496109_1897623 3300048912 Bacteria 528
893 Ga0496110_0044322 3300048913 Bacteria 3885
894 Ga0496112_0033600 3300048915 Bacteria 4987
895 Ga0496112_0618920 3300048915 Bacteria 1014
896 Ga0496112_1770096 3300048915 Bacteria 530
897 Ga0496113_0122120 3300048916 Bacteria 2037
898 Ga0496113_0216289 3300048916 Bacteria 1526
899 Ga0496115_0108203 3300048918 Bacteria 2283
900 Ga0501291_014518 3300049514 Bacteria 1180
901 Ga0501291_027040 3300049514 Bacteria 948
902 Ga0501296_020584 3300049519 Bacteria 841
903 Ga0501298_038603 3300049521 Bacteria 962
904 Ga0501298_115275 3300049521 Bacteria 627
905 Ga0501031_0740531 3300049568 Bacteria 631
906 Ga0501033_0025163 3300049570 Unclassified 4484
907 Ga0501036_0047981 3300049572 Unclassified 3616
908 Ga0501043_0704935 3300049579 Bacteria 737
909 Ga0501046_0842413 3300049580 Bacteria 641
910 Ga0501047_0151210 3300049581 Bacteria 2197
911 Ga0501047_0787812 3300049581 Bacteria 766
912 Ga0501048_0334005 3300049582 Bacteria 1080
913 Ga0501067_0099968 3300049583 Bacteria 1611
914 Ga0501067_0711961 3300049583 Bacteria 564
915 Ga0501068_0135929 3300049584 Bacteria 1539
916 Ga0501068_0780134 3300049584 Unclassified 626
917 Ga0501070_0017289 3300049586 Bacteria 6056
918 Ga0501070_0310953 3300049586 Bacteria 1283
919 Ga0501071_0132060 3300049587 Bacteria 1856
920 Ga0501072_0273858 3300049588 Bacteria 1343
921 Ga0501072_0391494 3300049588 Bacteria 1103
922 Ga0501075_0335650 3300049591 Bacteria 1152
923 Ga0501076_0184903 3300049592 Bacteria 1699
924 Ga0501077_0219660 3300049593 Bacteria 1208
925 Ga0501077_0618620 3300049593 Bacteria 696
926 Ga0501198_024717 3300049649 Bacteria 973
927 Ga0501202_053375 3300049652 Bacteria 900
928 Ga0501207_033814 3300049654 Bacteria 869
929 Ga0501216_053647 3300049660 Bacteria 798
930 Ga0501217_084532 3300049661 Bacteria 883
931 Ga0501224_031055 3300049664 Bacteria 800
932 Ga0501233_129944 3300049668 Bacteria 687
933 Ga0501233_178262 3300049668 Bacteria 607
934 Ga0501233_259214 3300049668 Bacteria 525
935 Ga0501238_057025 3300049671 Bacteria 592
936 Ga0501246_018320 3300049676 Bacteria 705
937 Ga0501247_015519 3300049677 Bacteria 952
938 Ga0501247_049607 3300049677 Bacteria 620
939 Ga0501249_024916 3300049679 Bacteria 1319
940 Ga0501249_039494 3300049679 Bacteria 1067
941 Ga0501249_067965 3300049679 Bacteria 830
942 Ga0501249_160061 3300049679 Bacteria 571
943 Ga0501250_093189 3300049680 Bacteria 527
944 Ga0501253_066061 3300049683 Bacteria 790
945 Ga0501253_089612 3300049683 Bacteria 706
946 Ga0501257_058817 3300049686 Bacteria 969
947 Ga0501259_030012 3300049688 Bacteria 1021
948 Ga0501259_135490 3300049688 Bacteria 598
949 Ga0501225_0035821 3300049705 Bacteria 1367
950 Ga0501229_074495 3300049706 Bacteria 536
951 Ga0501245_156005 3300049708 Bacteria 508
952 Ga0501080_0270777 3300049742 Bacteria 1546
953 Ga0501080_0747330 3300049742 Bacteria 860
954 Ga0501241_067917 3300049758 Bacteria 724
955 Ga0501263_089368 3300049760 Bacteria 518
956 Ga0501265_077458 3300049762 Bacteria 572
957 Ga0501266_057431 3300049763 Unclassified 615
958 Ga0501266_083037 3300049763 Bacteria 546
959 Ga0501268_005903 3300049765 Bacteria 1776
960 Ga0501269_063891 3300049766 Bacteria 525
961 Ga0501272_034014 3300049769 Bacteria 658
962 Ga0501272_050608 3300049769 Bacteria 576
963 Ga0501272_068084 3300049769 Bacteria 517
964 Ga0501279_049312 3300049775 Bacteria 664
965 Ga0501283_041000 3300049779 Bacteria 801
966 Ga0501283_100161 3300049779 Bacteria 563
967 Ga0501035_0164990 3300049822 Bacteria 1916
968 Ga0501044_0016350 3300049823 Bacteria 7966
969 Ga0501044_0220011 3300049823 Bacteria 1850
970 nmdc:mga03n38_271498_c1 3300050490 Bacteria 902
971 nmdc:mga05p37_1049884_c1 3300050507 Bacteria 859
972 nmdc:mga05p37_112785_c1 3300050507 Bacteria 3343
973 nmdc:mga05p37_1715128_c1 3300050507 Bacteria 611
974 nmdc:mga09592_129339_c1 3300050508 Bacteria 2172
975 nmdc:mga09592_195702_c1 3300050508 Bacteria 1750
976 nmdc:mga0qj67_482812_c1 3300050509 Bacteria 997
977 nmdc:mga06r32_125035_c1 3300050510 Bacteria 2539
978 nmdc:mga06r32_1380961_c1 3300050510 Bacteria 647
979 nmdc:mga06r32_575707_c1 3300050510 Bacteria 1098
980 nmdc:mga06r32_604928_c1 3300050510 Bacteria 1067
981 nmdc:mga08y16_1008304_c1 3300050511 Bacteria 812
982 nmdc:mga08y16_1128336_c1 3300050511 Bacteria 758
983 nmdc:mga08y16_1219967_c1 3300050511 Unclassified 722
984 nmdc:mga08y16_1601200_c1 3300050511 Bacteria 609
985 nmdc:mga08y16_22712_c2 3300050511 Bacteria 6419
986 nmdc:mga08y16_38177_c1 3300050511 Bacteria 5044
987 nmdc:mga08y16_492206_c1 3300050511 Bacteria 1247
988 nmdc:mga08y16_721655_c1 3300050511 Bacteria 995
989 nmdc:mga08y16_9515_c1 3300050511 Bacteria 10197
990 nmdc:mga0n895_14555_c1 3300050512 Bacteria 7149
991 nmdc:mga0n895_25288_c1 3300050512 Bacteria 5608
992 nmdc:mga0n895_74179_c1 3300050512 Bacteria 3379
993 nmdc:mga0rr50_1061802_c1 3300050513 Bacteria 689
994 nmdc:mga0rr50_145246_c1 3300050513 Bacteria 1912
995 nmdc:mga0rr50_171652_c1 3300050513 Bacteria 1767
996 nmdc:mga08x19_22079_c1 3300050514 Bacteria 3937
997 nmdc:mga08x19_6811_c1 3300050514 Bacteria 6787
998 nmdc:mga0a205_171250_c1 3300050515 Bacteria 2067
999 nmdc:mga0a205_26159_c1 3300050515 Bacteria 5560
1000 nmdc:mga0a205_428254_c1 3300050515 Bacteria 1185
1001 nmdc:mga0a205_723661_c1 3300050515 Bacteria 844
1002 Ga0500646_0004679 3300053090 Bacteria 3458
1003 Ga0500646_0101629 3300053090 Bacteria 903
1004 Ga0500554_042253 3300053102 Bacteria 1404
1005 Ga0500628_000202 3300053129 Bacteria 11575
1006 Ga0500652_302633 3300053131 Bacteria 618
1007 Ga0500658_0074588 3300053134 Bacteria 1439
1008 Ga0500568_0033398 3300053139 Bacteria 2111
1009 Ga0500616_0000575 3300053153 Bacteria 44655
1010 Ga0500616_0096194 3300053153 Bacteria 1456
1011 Ga0500622_0006275 3300053156 Bacteria 6947
1012 Ga0500622_0007430 3300053156 Bacteria 6223
1013 Ga0500633_0323998 3300053160 Bacteria 564
1014 Ga0501084_1086663 3300054114 Bacteria 672
1015 Ga0590071_037169 3300059421 Bacteria 1168
1016 Ga0590074_009280 3300059423 Bacteria 1639
1017 Ga0530510_1128322 3300061734 Unclassified 601

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_11490986 Ga0307405_114909861 108
2 3300031901 Ga0307406_10143337 Ga0307406_101433371 108
3 3300031911 Ga0307412_10372344 Ga0307412_103723441 108
4 3300032002 Ga0307416_100854641 Ga0307416_1008546411 108
5 3300005328 Ga0070676_10552157 Ga0070676_105521571 110
6 3300005336 Ga0070680_100060199 Ga0070680_1000601992 110
7 3300005336 Ga0070680_100630449 Ga0070680_1006304492 110
8 3300005406 Ga0070703_10575581 Ga0070703_105755811 110
9 3300005458 Ga0070681_10014161 Ga0070681_100141614 110
10 3300005530 Ga0070679_100196255 Ga0070679_1001962553 110
11 3300006844 Ga0075428_100017080 Ga0075428_1000170805 110
12 3300009094 Ga0111539_10255592 Ga0111539_102555922 110
13 3300009147 Ga0114129_10121071 Ga0114129_101210712 110
14 3300012512 Ga0157327_1003733 Ga0157327_10037331 110
15 3300013297 Ga0157378_10221099 Ga0157378_102210992 110
16 3300017792 Ga0163161_11175931 Ga0163161_111759311 110
17 3300025899 Ga0207642_10625636 Ga0207642_106256361 110
18 3300025910 Ga0207684_10065996 Ga0207684_100659961 110
19 3300025912 Ga0207707_10041123 Ga0207707_100411236 110
20 3300025931 Ga0207644_10308870 Ga0207644_103088703 110
21 3300025937 Ga0207669_10727829 Ga0207669_107278292 110
22 3300025940 Ga0207691_10097144 Ga0207691_100971444 110
23 3300025981 Ga0207640_10726259 Ga0207640_107262591 110
24 3300026089 Ga0207648_10040177 Ga0207648_100401775 110
25 3300031901 Ga0307406_10035208 Ga0307406_100352083 110
26 3300032002 Ga0307416_100092765 Ga0307416_1000927652 110
27 3300042876 Ga0451577_0113739 Ga0451577_0113739_417_749 110
28 3300044712 Ga0453684_0000939 Ga0453684_0000939_10932_11264 110
29 3300046461 Ga0495641_0014204 Ga0495641_0014204_1561_1911 110
30 3300049519 Ga0501296_020584 Ga0501296_020584_396_740 110
31 3300049679 Ga0501249_067965 Ga0501249_067965_10_342 110
32 3300049680 Ga0501250_093189 Ga0501250_093189_46_390 110
33 3300049758 Ga0501241_067917 Ga0501241_067917_192_536 110
34 3300006194 Ga0075427_10021685 Ga0075427_100216852 111
35 3300014745 Ga0157377_10451901 Ga0157377_104519012 111
36 3300025945 Ga0207679_11826462 Ga0207679_118264621 111
37 3300026089 Ga0207648_10146559 Ga0207648_101465591 111
38 3300032005 Ga0307411_11181599 Ga0307411_111815992 111
39 3300033180 Ga0307510_10000276 Ga0307510_1000027629 111
40 3300041503 Ga0451847_0370653 Ga0451847_0370653_70_405 111
41 3300044842 Ga0466957_0369214 Ga0466957_0369214_304_639 111
42 3300046471 Ga0495650_0000027 Ga0495650_0000027_299846_300181 111
43 3300049568 Ga0501031_0740531 Ga0501031_0740531_249_584 111
44 3300049570 Ga0501033_0025163 Ga0501033_0025163_1233_1568 111
45 3300049572 Ga0501036_0047981 Ga0501036_0047981_3067_3402 111
46 3300049581 Ga0501047_0787812 Ga0501047_0787812_359_694 111
47 3300049586 Ga0501070_0310953 Ga0501070_0310953_100_435 111
48 3300049822 Ga0501035_0164990 Ga0501035_0164990_769_1104 111
49 3300049823 Ga0501044_0016350 Ga0501044_0016350_1528_1863 111
50 3300005290 Ga0065712_10008022 Ga0065712_100080224 112
51 3300005293 Ga0065715_10393698 Ga0065715_103936982 112
52 3300005327 Ga0070658_10794943 Ga0070658_107949432 112
53 3300005329 Ga0070683_100890703 Ga0070683_1008907032 112
54 3300005330 Ga0070690_100074756 Ga0070690_1000747562 112
55 3300005331 Ga0070670_100664503 Ga0070670_1006645031 112
56 3300005340 Ga0070689_100071117 Ga0070689_1000711174 112
57 3300005343 Ga0070687_100095140 Ga0070687_1000951402 112
58 3300005344 Ga0070661_101005954 Ga0070661_1010059542 112
59 3300005353 Ga0070669_100089004 Ga0070669_1000890045 112
60 3300005354 Ga0070675_100033024 Ga0070675_1000330242 112
61 3300005355 Ga0070671_100179082 Ga0070671_1001790821 112
62 3300005364 Ga0070673_100419539 Ga0070673_1004195392 112
63 3300005365 Ga0070688_100485119 Ga0070688_1004851192 112
64 3300005366 Ga0070659_100771709 Ga0070659_1007717091 112
65 3300005367 Ga0070667_100064211 Ga0070667_1000642112 112
66 3300005438 Ga0070701_10333854 Ga0070701_103338542 112
67 3300005455 Ga0070663_101055043 Ga0070663_1010550432 112
68 3300005457 Ga0070662_100225888 Ga0070662_1002258882 112
69 3300005458 Ga0070681_10558475 Ga0070681_105584751 112
70 3300005466 Ga0070685_10061086 Ga0070685_100610865 112
71 3300005530 Ga0070679_100281350 Ga0070679_1002813502 112
72 3300005543 Ga0070672_100080600 Ga0070672_1000806003 112
73 3300005544 Ga0070686_100520786 Ga0070686_1005207862 112
74 3300005564 Ga0070664_100141951 Ga0070664_1001419513 112
75 3300005577 Ga0068857_100051176 Ga0068857_1000511765 112
76 3300005616 Ga0068852_100920858 Ga0068852_1009208582 112
77 3300005617 Ga0068859_100020078 Ga0068859_1000200783 112
78 3300005840 Ga0068870_10029793 Ga0068870_100297934 112
79 3300005842 Ga0068858_100491077 Ga0068858_1004910772 112
80 3300005844 Ga0068862_100158957 Ga0068862_1001589574 112
81 3300006931 Ga0097620_100020078 Ga0097620_1000200783 112
82 3300009094 Ga0111539_10656679 Ga0111539_106566792 112
83 3300009177 Ga0105248_11492275 Ga0105248_114922752 112
84 3300009551 Ga0105238_10247955 Ga0105238_102479552 112
85 3300013308 Ga0157375_10069477 Ga0157375_100694776 112
86 3300014745 Ga0157377_10100295 Ga0157377_101002952 112
87 3300014969 Ga0157376_12371917 Ga0157376_123719171 112
88 3300020082 Ga0206353_10233494 Ga0206353_102334941 112
89 3300025315 Ga0207697_10183676 Ga0207697_101836762 112
90 3300025901 Ga0207688_10059278 Ga0207688_100592782 112
91 3300025903 Ga0207680_10278909 Ga0207680_102789092 112
92 3300025904 Ga0207647_10257058 Ga0207647_102570582 112
93 3300025908 Ga0207643_10042901 Ga0207643_100429014 112
94 3300025909 Ga0207705_10887568 Ga0207705_108875682 112
95 3300025909 Ga0207705_10955775 Ga0207705_109557752 112
96 3300025918 Ga0207662_10054696 Ga0207662_100546962 112
97 3300025921 Ga0207652_11747936 Ga0207652_117479362 112
98 3300025924 Ga0207694_10249068 Ga0207694_102490683 112
99 3300025925 Ga0207650_10050200 Ga0207650_100502002 112
100 3300025926 Ga0207659_10079982 Ga0207659_100799824 112
101 3300025931 Ga0207644_10262683 Ga0207644_102626832 112
102 3300025932 Ga0207690_10872051 Ga0207690_108720511 112
103 3300025936 Ga0207670_10337339 Ga0207670_103373392 112
104 3300025940 Ga0207691_10099416 Ga0207691_100994162 112
105 3300025945 Ga0207679_10613656 Ga0207679_106136562 112
106 3300025986 Ga0207658_10147742 Ga0207658_101477422 112
107 3300026035 Ga0207703_10425013 Ga0207703_104250132 112
108 3300026067 Ga0207678_10411538 Ga0207678_104115382 112
109 3300026116 Ga0207674_10122083 Ga0207674_101220832 112
110 3300026142 Ga0207698_11163174 Ga0207698_111631741 112
111 3300037471 Ga0395905_1815990 Ga0395905_1815990_97_447 112
112 3300042005 Ga0439448_0017521 Ga0439448_0017521_42_380 112
113 3300042184 Ga0450908_037959 Ga0450908_037959_472_810 112
114 3300046525 Ga0495663_0124817 Ga0495663_0124817_402_740 112
115 3300046539 Ga0495621_0115680 Ga0495621_0115680_208_546 112
116 3300046678 Ga0495599_0360437 Ga0495599_0360437_236_574 112
117 3300047447 Ga0495685_041165 Ga0495685_041165_188_526 112
118 3300049583 Ga0501067_0099968 Ga0501067_0099968_647_985 112
119 3300049584 Ga0501068_0780134 Ga0501068_0780134_151_489 112
120 3300050511 nmdc:mga08y16_1008304_c1 nmdc:mga08y16_1008304_c1_252_590 112
121 3300061734 Ga0530510_1128322 Ga0530510_1128322_244_582 112
122 3300001990 JGI24737J22298_10236793 JGI24737J22298_102367931 113
123 3300002126 JGI24035J26624_1011242 JGI24035J26624_10112422 113
124 3300002987 JGI25159J45721_1024851 JGI25159J45721_10248512 113
125 3300003187 JGI25151J46595_10086933 JGI25151J46595_100869331 113
126 3300003771 Ga0055526_1012111 Ga0055526_10121112 113
127 3300003775 Ga0055524_1000951 Ga0055524_100095110 113
128 3300003775 Ga0055524_1001641 Ga0055524_10016417 113
129 3300003781 Ga0055536_1014134 Ga0055536_10141344 113
130 3300003784 Ga0055534_1008563 Ga0055534_10085634 113
131 3300003790 Ga0055528_1036653 Ga0055528_10366531 113
132 3300003791 Ga0055530_10005594 Ga0055530_100055949 113
133 3300003794 Ga0055531_10001261 Ga0055531_100012614 113
134 3300003794 Ga0055531_10002230 Ga0055531_100022309 113
135 3300003794 Ga0055531_10003072 Ga0055531_1000307211 113
136 3300003794 Ga0055531_10010188 Ga0055531_100101886 113
137 3300003794 Ga0055531_10030703 Ga0055531_100307034 113
138 3300005289 Ga0065704_10294183 Ga0065704_102941832 113
139 3300005290 Ga0065712_10024919 Ga0065712_100249192 113
140 3300005290 Ga0065712_10078049 Ga0065712_100780492 113
141 3300005290 Ga0065712_10173609 Ga0065712_101736093 113
142 3300005290 Ga0065712_10316965 Ga0065712_103169651 113
143 3300005293 Ga0065715_10348131 Ga0065715_103481311 113
144 3300005293 Ga0065715_11103161 Ga0065715_111031611 113
145 3300005295 Ga0065707_10110278 Ga0065707_101102783 113
146 3300005295 Ga0065707_10115019 Ga0065707_101150193 113
147 3300005295 Ga0065707_10122585 Ga0065707_101225854 113
148 3300005295 Ga0065707_10140491 Ga0065707_101404912 113
149 3300005295 Ga0065707_10531151 Ga0065707_105311511 113
150 3300005327 Ga0070658_10033753 Ga0070658_100337532 113
151 3300005327 Ga0070658_10219627 Ga0070658_102196272 113
152 3300005327 Ga0070658_10708727 Ga0070658_107087272 113
153 3300005327 Ga0070658_10917744 Ga0070658_109177442 113
154 3300005328 Ga0070676_10047197 Ga0070676_100471973 113
155 3300005328 Ga0070676_11102439 Ga0070676_111024391 113
156 3300005329 Ga0070683_100002327 Ga0070683_1000023275 113
157 3300005329 Ga0070683_100022612 Ga0070683_1000226125 113
158 3300005329 Ga0070683_100049118 Ga0070683_1000491184 113
159 3300005329 Ga0070683_100087981 Ga0070683_1000879813 113
160 3300005329 Ga0070683_100106856 Ga0070683_1001068565 113
161 3300005329 Ga0070683_100148129 Ga0070683_1001481291 113
162 3300005329 Ga0070683_100164656 Ga0070683_1001646564 113
163 3300005329 Ga0070683_100190785 Ga0070683_1001907852 113
164 3300005329 Ga0070683_100204496 Ga0070683_1002044961 113
165 3300005329 Ga0070683_101207398 Ga0070683_1012073982 113
166 3300005330 Ga0070690_100552771 Ga0070690_1005527711 113
167 3300005331 Ga0070670_100091108 Ga0070670_1000911083 113
168 3300005331 Ga0070670_100555444 Ga0070670_1005554441 113
169 3300005331 Ga0070670_100559526 Ga0070670_1005595261 113
170 3300005331 Ga0070670_100618898 Ga0070670_1006188981 113
171 3300005331 Ga0070670_101099977 Ga0070670_1010999772 113
172 3300005333 Ga0070677_10371602 Ga0070677_103716022 113
173 3300005333 Ga0070677_10737192 Ga0070677_107371921 113
174 3300005334 Ga0068869_100046521 Ga0068869_1000465215 113
175 3300005334 Ga0068869_100107791 Ga0068869_1001077913 113
176 3300005334 Ga0068869_100839218 Ga0068869_1008392182 113
177 3300005334 Ga0068869_100848578 Ga0068869_1008485782 113
178 3300005335 Ga0070666_10269224 Ga0070666_102692243 113
179 3300005335 Ga0070666_10335169 Ga0070666_103351692 113
180 3300005336 Ga0070680_100008898 Ga0070680_1000088984 113
181 3300005336 Ga0070680_100485896 Ga0070680_1004858962 113
182 3300005337 Ga0070682_100101276 Ga0070682_1001012761 113
183 3300005337 Ga0070682_100353796 Ga0070682_1003537963 113
184 3300005337 Ga0070682_101752956 Ga0070682_1017529561 113
185 3300005338 Ga0068868_100022080 Ga0068868_1000220807 113
186 3300005339 Ga0070660_100046383 Ga0070660_1000463836 113
187 3300005339 Ga0070660_100085134 Ga0070660_1000851343 113
188 3300005340 Ga0070689_100016259 Ga0070689_1000162595 113
189 3300005340 Ga0070689_101144659 Ga0070689_1011446591 113
190 3300005343 Ga0070687_100010285 Ga0070687_1000102853 113
191 3300005343 Ga0070687_100391455 Ga0070687_1003914552 113
192 3300005343 Ga0070687_101106785 Ga0070687_1011067851 113
193 3300005344 Ga0070661_100002072 Ga0070661_1000020728 113
194 3300005344 Ga0070661_100021059 Ga0070661_1000210594 113
195 3300005344 Ga0070661_100022798 Ga0070661_1000227983 113
196 3300005344 Ga0070661_100804232 Ga0070661_1008042322 113
197 3300005344 Ga0070661_100823882 Ga0070661_1008238822 113
198 3300005345 Ga0070692_10064111 Ga0070692_100641113 113
199 3300005347 Ga0070668_100034983 Ga0070668_1000349834 113
200 3300005347 Ga0070668_100054067 Ga0070668_1000540673 113
201 3300005347 Ga0070668_100785826 Ga0070668_1007858262 113
202 3300005353 Ga0070669_100001824 Ga0070669_10000182412 113
203 3300005354 Ga0070675_100001147 Ga0070675_10000114714 113
204 3300005354 Ga0070675_100143974 Ga0070675_1001439746 113
205 3300005354 Ga0070675_100221505 Ga0070675_1002215052 113
206 3300005354 Ga0070675_101260582 Ga0070675_1012605821 113
207 3300005355 Ga0070671_100312256 Ga0070671_1003122562 113
208 3300005355 Ga0070671_100564838 Ga0070671_1005648382 113
209 3300005364 Ga0070673_100062378 Ga0070673_1000623786 113
210 3300005365 Ga0070688_100038678 Ga0070688_1000386782 113
211 3300005365 Ga0070688_100343518 Ga0070688_1003435182 113
212 3300005365 Ga0070688_100550927 Ga0070688_1005509271 113
213 3300005365 Ga0070688_100571762 Ga0070688_1005717621 113
214 3300005366 Ga0070659_100037782 Ga0070659_1000377824 113
215 3300005366 Ga0070659_100087344 Ga0070659_1000873442 113
216 3300005366 Ga0070659_100117239 Ga0070659_1001172393 113
217 3300005366 Ga0070659_100264869 Ga0070659_1002648692 113
218 3300005366 Ga0070659_100448035 Ga0070659_1004480352 113
219 3300005366 Ga0070659_100483195 Ga0070659_1004831952 113
220 3300005366 Ga0070659_101284901 Ga0070659_1012849012 113
221 3300005367 Ga0070667_100314189 Ga0070667_1003141893 113
222 3300005367 Ga0070667_100575319 Ga0070667_1005753192 113
223 3300005367 Ga0070667_100836368 Ga0070667_1008363682 113
224 3300005367 Ga0070667_101047847 Ga0070667_1010478472 113
225 3300005367 Ga0070667_101710805 Ga0070667_1017108052 113
226 3300005406 Ga0070703_10257965 Ga0070703_102579652 113
227 3300005438 Ga0070701_10023737 Ga0070701_100237374 113
228 3300005440 Ga0070705_100005429 Ga0070705_1000054291 113
229 3300005440 Ga0070705_101201364 Ga0070705_1012013642 113
230 3300005440 Ga0070705_101390433 Ga0070705_1013904332 113
231 3300005441 Ga0070700_100028866 Ga0070700_1000288662 113
232 3300005441 Ga0070700_100125557 Ga0070700_1001255572 113
233 3300005441 Ga0070700_100262775 Ga0070700_1002627751 113
234 3300005444 Ga0070694_100046697 Ga0070694_1000466972 113
235 3300005444 Ga0070694_100467427 Ga0070694_1004674272 113
236 3300005444 Ga0070694_100667087 Ga0070694_1006670871 113
237 3300005455 Ga0070663_100624087 Ga0070663_1006240872 113
238 3300005456 Ga0070678_100185328 Ga0070678_1001853282 113
239 3300005456 Ga0070678_101792386 Ga0070678_1017923861 113
240 3300005457 Ga0070662_100013116 Ga0070662_1000131166 113
241 3300005457 Ga0070662_100064872 Ga0070662_1000648725 113
242 3300005457 Ga0070662_100066832 Ga0070662_1000668323 113
243 3300005457 Ga0070662_100422641 Ga0070662_1004226412 113
244 3300005457 Ga0070662_101260712 Ga0070662_1012607122 113
245 3300005457 Ga0070662_101713121 Ga0070662_1017131212 113
246 3300005458 Ga0070681_10008511 Ga0070681_100085117 113
247 3300005458 Ga0070681_10008667 Ga0070681_100086679 113
248 3300005458 Ga0070681_10017926 Ga0070681_100179263 113
249 3300005458 Ga0070681_10127822 Ga0070681_101278223 113
250 3300005458 Ga0070681_10350335 Ga0070681_103503353 113
251 3300005458 Ga0070681_10503191 Ga0070681_105031912 113
252 3300005458 Ga0070681_10916527 Ga0070681_109165271 113
253 3300005458 Ga0070681_11340398 Ga0070681_113403982 113
254 3300005458 Ga0070681_11384466 Ga0070681_113844662 113
255 3300005459 Ga0068867_101095795 Ga0068867_1010957951 113
256 3300005459 Ga0068867_102136684 Ga0068867_1021366841 113
257 3300005466 Ga0070685_10014935 Ga0070685_100149353 113
258 3300005466 Ga0070685_10291930 Ga0070685_102919302 113
259 3300005518 Ga0070699_100551056 Ga0070699_1005510562 113
260 3300005530 Ga0070679_100001702 Ga0070679_10000170211 113
261 3300005530 Ga0070679_100117134 Ga0070679_1001171343 113
262 3300005530 Ga0070679_100465364 Ga0070679_1004653642 113
263 3300005530 Ga0070679_100821206 Ga0070679_1008212062 113
264 3300005535 Ga0070684_100013783 Ga0070684_1000137835 113
265 3300005535 Ga0070684_100082361 Ga0070684_1000823614 113
266 3300005535 Ga0070684_100087732 Ga0070684_1000877324 113
267 3300005535 Ga0070684_100113100 Ga0070684_1001131002 113
268 3300005535 Ga0070684_100128544 Ga0070684_1001285444 113
269 3300005535 Ga0070684_100137105 Ga0070684_1001371052 113
270 3300005535 Ga0070684_100400221 Ga0070684_1004002213 113
271 3300005535 Ga0070684_100595088 Ga0070684_1005950881 113
272 3300005535 Ga0070684_101559255 Ga0070684_1015592552 113
273 3300005539 Ga0068853_100005407 Ga0068853_1000054077 113
274 3300005539 Ga0068853_100015819 Ga0068853_1000158193 113
275 3300005539 Ga0068853_101136693 Ga0068853_1011366932 113
276 3300005543 Ga0070672_100153463 Ga0070672_1001534633 113
277 3300005543 Ga0070672_100293531 Ga0070672_1002935313 113
278 3300005543 Ga0070672_100295777 Ga0070672_1002957772 113
279 3300005543 Ga0070672_100621980 Ga0070672_1006219802 113
280 3300005544 Ga0070686_100143250 Ga0070686_1001432501 113
281 3300005544 Ga0070686_100304681 Ga0070686_1003046812 113
282 3300005547 Ga0070693_100069750 Ga0070693_1000697501 113
283 3300005547 Ga0070693_100598019 Ga0070693_1005980191 113
284 3300005547 Ga0070693_100934846 Ga0070693_1009348461 113
285 3300005547 Ga0070693_101113568 Ga0070693_1011135682 113
286 3300005548 Ga0070665_100092233 Ga0070665_1000922333 113
287 3300005548 Ga0070665_100124658 Ga0070665_1001246582 113
288 3300005548 Ga0070665_100946435 Ga0070665_1009464351 113
289 3300005549 Ga0070704_100822956 Ga0070704_1008229562 113
290 3300005549 Ga0070704_101079369 Ga0070704_1010793691 113
291 3300005563 Ga0068855_100034057 Ga0068855_1000340575 113
292 3300005563 Ga0068855_101620525 Ga0068855_1016205251 113
293 3300005564 Ga0070664_100020581 Ga0070664_1000205815 113
294 3300005564 Ga0070664_100088840 Ga0070664_1000888404 113
295 3300005564 Ga0070664_100094612 Ga0070664_1000946124 113
296 3300005564 Ga0070664_100149326 Ga0070664_1001493262 113
297 3300005564 Ga0070664_100171061 Ga0070664_1001710614 113
298 3300005564 Ga0070664_100175576 Ga0070664_1001755762 113
299 3300005564 Ga0070664_100375557 Ga0070664_1003755573 113
300 3300005564 Ga0070664_100419906 Ga0070664_1004199062 113
301 3300005564 Ga0070664_100617040 Ga0070664_1006170402 113
302 3300005564 Ga0070664_100675394 Ga0070664_1006753942 113
303 3300005564 Ga0070664_101070841 Ga0070664_1010708412 113
304 3300005577 Ga0068857_100043819 Ga0068857_1000438194 113
305 3300005577 Ga0068857_100068506 Ga0068857_1000685064 113
306 3300005577 Ga0068857_100112028 Ga0068857_1001120283 113
307 3300005577 Ga0068857_100459159 Ga0068857_1004591592 113
308 3300005578 Ga0068854_100540134 Ga0068854_1005401342 113
309 3300005578 Ga0068854_101611583 Ga0068854_1016115831 113
310 3300005614 Ga0068856_100102001 Ga0068856_1001020014 113
311 3300005614 Ga0068856_100180514 Ga0068856_1001805143 113
312 3300005614 Ga0068856_100843215 Ga0068856_1008432152 113
313 3300005615 Ga0070702_100052170 Ga0070702_1000521704 113
314 3300005615 Ga0070702_100976558 Ga0070702_1009765581 113
315 3300005616 Ga0068852_100009459 Ga0068852_1000094594 113
316 3300005616 Ga0068852_100092675 Ga0068852_1000926754 113
317 3300005616 Ga0068852_100150106 Ga0068852_1001501062 113
318 3300005616 Ga0068852_100678330 Ga0068852_1006783302 113
319 3300005616 Ga0068852_101209822 Ga0068852_1012098222 113
320 3300005616 Ga0068852_101352754 Ga0068852_1013527542 113
321 3300005617 Ga0068859_100184489 Ga0068859_1001844892 113
322 3300005617 Ga0068859_100264811 Ga0068859_1002648112 113
323 3300005618 Ga0068864_100068876 Ga0068864_1000688762 113
324 3300005618 Ga0068864_100218966 Ga0068864_1002189663 113
325 3300005618 Ga0068864_100306502 Ga0068864_1003065022 113
326 3300005618 Ga0068864_100559129 Ga0068864_1005591293 113
327 3300005618 Ga0068864_100893879 Ga0068864_1008938792 113
328 3300005618 Ga0068864_101261451 Ga0068864_1012614512 113
329 3300005618 Ga0068864_101417493 Ga0068864_1014174932 113
330 3300005719 Ga0068861_100004625 Ga0068861_1000046253 113
331 3300005719 Ga0068861_100066574 Ga0068861_1000665745 113
332 3300005719 Ga0068861_100143628 Ga0068861_1001436284 113
333 3300005719 Ga0068861_100624850 Ga0068861_1006248501 113
334 3300005719 Ga0068861_102551930 Ga0068861_1025519301 113
335 3300005834 Ga0068851_10016073 Ga0068851_100160735 113
336 3300005834 Ga0068851_10220794 Ga0068851_102207942 113
337 3300005840 Ga0068870_10060121 Ga0068870_100601212 113
338 3300005840 Ga0068870_10395524 Ga0068870_103955242 113
339 3300005841 Ga0068863_100003611 Ga0068863_10000361112 113
340 3300005841 Ga0068863_100075877 Ga0068863_1000758774 113
341 3300005841 Ga0068863_100317582 Ga0068863_1003175823 113
342 3300005841 Ga0068863_100452830 Ga0068863_1004528303 113
343 3300005841 Ga0068863_100605585 Ga0068863_1006055852 113
344 3300005841 Ga0068863_100812642 Ga0068863_1008126422 113
345 3300005842 Ga0068858_100021630 Ga0068858_1000216305 113
346 3300005842 Ga0068858_101245288 Ga0068858_1012452882 113
347 3300005842 Ga0068858_101377475 Ga0068858_1013774752 113
348 3300005843 Ga0068860_100028624 Ga0068860_1000286243 113
349 3300005843 Ga0068860_100510746 Ga0068860_1005107462 113
350 3300005843 Ga0068860_101010530 Ga0068860_1010105302 113
351 3300005844 Ga0068862_100009967 Ga0068862_1000099675 113
352 3300005844 Ga0068862_100021217 Ga0068862_1000212176 113
353 3300005844 Ga0068862_100185733 Ga0068862_1001857332 113
354 3300005844 Ga0068862_100521507 Ga0068862_1005215073 113
355 3300005937 Ga0081455_10434191 Ga0081455_104341912 113
356 3300006048 Ga0075363_100311093 Ga0075363_1003110932 113
357 3300006058 Ga0075432_10066695 Ga0075432_100666953 113
358 3300006058 Ga0075432_10297490 Ga0075432_102974902 113
359 3300006175 Ga0070712_100650094 Ga0070712_1006500942 113
360 3300006175 Ga0070712_101247602 Ga0070712_1012476022 113
361 3300006237 Ga0097621_100066116 Ga0097621_1000661162 113
362 3300006237 Ga0097621_101162523 Ga0097621_1011625231 113
363 3300006844 Ga0075428_100093041 Ga0075428_1000930412 113
364 3300006844 Ga0075428_101203021 Ga0075428_1012030212 113
365 3300006844 Ga0075428_101391601 Ga0075428_1013916012 113
366 3300006846 Ga0075430_100428689 Ga0075430_1004286892 113
367 3300006846 Ga0075430_100772785 Ga0075430_1007727852 113
368 3300006846 Ga0075430_101084695 Ga0075430_1010846951 113
369 3300006846 Ga0075430_101155436 Ga0075430_1011554362 113
370 3300006847 Ga0075431_100148241 Ga0075431_1001482413 113
371 3300006847 Ga0075431_100615164 Ga0075431_1006151642 113
372 3300006852 Ga0075433_10025380 Ga0075433_100253806 113
373 3300006852 Ga0075433_10074113 Ga0075433_100741132 113
374 3300006852 Ga0075433_10144868 Ga0075433_101448681 113
375 3300006871 Ga0075434_100006240 Ga0075434_10000624013 113
376 3300006871 Ga0075434_100105101 Ga0075434_1001051012 113
377 3300006871 Ga0075434_100353241 Ga0075434_1003532411 113
378 3300006880 Ga0075429_100074976 Ga0075429_1000749762 113
379 3300006880 Ga0075429_100198819 Ga0075429_1001988192 113
380 3300006881 Ga0068865_100004671 Ga0068865_1000046718 113
381 3300006881 Ga0068865_100004928 Ga0068865_1000049286 113
382 3300006881 Ga0068865_101050681 Ga0068865_1010506811 113
383 3300006914 Ga0075436_100014918 Ga0075436_1000149185 113
384 3300006931 Ga0097620_100184490 Ga0097620_1001844902 113
385 3300006931 Ga0097620_100264810 Ga0097620_1002648102 113
386 3300007076 Ga0075435_100084960 Ga0075435_1000849604 113
387 3300007076 Ga0075435_100580976 Ga0075435_1005809762 113
388 3300007076 Ga0075435_101385799 Ga0075435_1013857992 113
389 3300009093 Ga0105240_10032792 Ga0105240_100327925 113
390 3300009093 Ga0105240_11165800 Ga0105240_111658001 113
391 3300009094 Ga0111539_10017919 Ga0111539_100179199 113
392 3300009094 Ga0111539_10049836 Ga0111539_100498364 113
393 3300009094 Ga0111539_10080853 Ga0111539_100808532 113
394 3300009094 Ga0111539_10094070 Ga0111539_100940702 113
395 3300009094 Ga0111539_10108588 Ga0111539_101085882 113
396 3300009094 Ga0111539_10167917 Ga0111539_101679172 113
397 3300009094 Ga0111539_10726126 Ga0111539_107261263 113
398 3300009098 Ga0105245_10279297 Ga0105245_102792972 113
399 3300009101 Ga0105247_10155745 Ga0105247_101557453 113
400 3300009101 Ga0105247_10425335 Ga0105247_104253352 113
401 3300009147 Ga0114129_10088126 Ga0114129_100881263 113
402 3300009147 Ga0114129_10817026 Ga0114129_108170262 113
403 3300009147 Ga0114129_12070114 Ga0114129_120701142 113
404 3300009147 Ga0114129_13222569 Ga0114129_132225691 113
405 3300009148 Ga0105243_10552403 Ga0105243_105524032 113
406 3300009148 Ga0105243_10751262 Ga0105243_107512622 113
407 3300009148 Ga0105243_11693957 Ga0105243_116939572 113
408 3300009174 Ga0105241_10048790 Ga0105241_100487904 113
409 3300009174 Ga0105241_11216060 Ga0105241_112160601 113
410 3300009176 Ga0105242_10059694 Ga0105242_100596943 113
411 3300009176 Ga0105242_10717467 Ga0105242_107174672 113
412 3300009176 Ga0105242_10745422 Ga0105242_107454222 113
413 3300009176 Ga0105242_11209334 Ga0105242_112093341 113
414 3300009176 Ga0105242_12129757 Ga0105242_121297571 113
415 3300009177 Ga0105248_10056165 Ga0105248_100561654 113
416 3300009177 Ga0105248_10070473 Ga0105248_100704736 113
417 3300009177 Ga0105248_10253628 Ga0105248_102536281 113
418 3300009177 Ga0105248_10511315 Ga0105248_105113151 113
419 3300009177 Ga0105248_11199304 Ga0105248_111993042 113
420 3300009177 Ga0105248_11439451 Ga0105248_114394512 113
421 3300009545 Ga0105237_10721189 Ga0105237_107211892 113
422 3300009545 Ga0105237_10888068 Ga0105237_108880682 113
423 3300009551 Ga0105238_10096002 Ga0105238_100960023 113
424 3300009551 Ga0105238_10695910 Ga0105238_106959101 113
425 3300009551 Ga0105238_10716294 Ga0105238_107162942 113
426 3300009551 Ga0105238_10730448 Ga0105238_107304482 113
427 3300009553 Ga0105249_10029865 Ga0105249_100298654 113
428 3300009553 Ga0105249_10041058 Ga0105249_100410585 113
429 3300009553 Ga0105249_10151644 Ga0105249_101516441 113
430 3300009553 Ga0105249_10158694 Ga0105249_101586941 113
431 3300009553 Ga0105249_10524989 Ga0105249_105249891 113
432 3300009553 Ga0105249_11917200 Ga0105249_119172002 113
433 3300010375 Ga0105239_10004359 Ga0105239_1000435913 113
434 3300010375 Ga0105239_12667774 Ga0105239_126677742 113
435 3300012508 Ga0157315_1013431 Ga0157315_10134311 113
436 3300013100 Ga0157373_10053842 Ga0157373_100538421 113
437 3300013100 Ga0157373_10067088 Ga0157373_100670883 113
438 3300013100 Ga0157373_10253994 Ga0157373_102539941 113
439 3300013100 Ga0157373_10294390 Ga0157373_102943901 113
440 3300013100 Ga0157373_10438985 Ga0157373_104389852 113
441 3300013100 Ga0157373_10458019 Ga0157373_104580191 113
442 3300013100 Ga0157373_10556809 Ga0157373_105568091 113
443 3300013100 Ga0157373_10591866 Ga0157373_105918661 113
444 3300013100 Ga0157373_10739503 Ga0157373_107395031 113
445 3300013102 Ga0157371_10036763 Ga0157371_100367633 113
446 3300013102 Ga0157371_10198700 Ga0157371_101987003 113
447 3300013102 Ga0157371_10697026 Ga0157371_106970262 113
448 3300013102 Ga0157371_11437521 Ga0157371_114375212 113
449 3300013104 Ga0157370_10016751 Ga0157370_100167516 113
450 3300013104 Ga0157370_10084953 Ga0157370_100849534 113
451 3300013104 Ga0157370_10648767 Ga0157370_106487672 113
452 3300013104 Ga0157370_10733419 Ga0157370_107334191 113
453 3300013104 Ga0157370_10843135 Ga0157370_108431352 113
454 3300013104 Ga0157370_11141415 Ga0157370_111414151 113
455 3300013105 Ga0157369_10027504 Ga0157369_100275046 113
456 3300013105 Ga0157369_10040652 Ga0157369_100406526 113
457 3300013105 Ga0157369_11322528 Ga0157369_113225282 113
458 3300013296 Ga0157374_10110905 Ga0157374_101109054 113
459 3300013296 Ga0157374_10159090 Ga0157374_101590903 113
460 3300013296 Ga0157374_10786660 Ga0157374_107866602 113
461 3300013297 Ga0157378_11371948 Ga0157378_113719482 113
462 3300013297 Ga0157378_11834058 Ga0157378_118340582 113
463 3300013306 Ga0163162_10012258 Ga0163162_100122587 113
464 3300013306 Ga0163162_11625390 Ga0163162_116253901 113
465 3300013306 Ga0163162_12315488 Ga0163162_123154881 113
466 3300013306 Ga0163162_12761386 Ga0163162_127613862 113
467 3300013307 Ga0157372_10018905 Ga0157372_100189058 113
468 3300013307 Ga0157372_10030499 Ga0157372_100304996 113
469 3300013307 Ga0157372_10094890 Ga0157372_100948905 113
470 3300013307 Ga0157372_10099327 Ga0157372_100993272 113
471 3300013307 Ga0157372_10157722 Ga0157372_101577222 113
472 3300013307 Ga0157372_10196009 Ga0157372_101960094 113
473 3300013307 Ga0157372_10281497 Ga0157372_102814973 113
474 3300013307 Ga0157372_10292597 Ga0157372_102925973 113
475 3300013307 Ga0157372_10383648 Ga0157372_103836482 113
476 3300013307 Ga0157372_10691515 Ga0157372_106915152 113
477 3300013307 Ga0157372_11648719 Ga0157372_116487192 113
478 3300013307 Ga0157372_11673898 Ga0157372_116738981 113
479 3300013307 Ga0157372_12141682 Ga0157372_121416822 113
480 3300013308 Ga0157375_10014319 Ga0157375_100143192 113
481 3300013308 Ga0157375_10045132 Ga0157375_100451324 113
482 3300013308 Ga0157375_10047652 Ga0157375_100476524 113
483 3300013308 Ga0157375_10167683 Ga0157375_101676833 113
484 3300013308 Ga0157375_10822861 Ga0157375_108228611 113
485 3300013308 Ga0157375_12375921 Ga0157375_123759211 113
486 3300014325 Ga0163163_10131822 Ga0163163_101318222 113
487 3300014325 Ga0163163_10215355 Ga0163163_102153553 113
488 3300014326 Ga0157380_10125160 Ga0157380_101251602 113
489 3300014326 Ga0157380_10162324 Ga0157380_101623241 113
490 3300014745 Ga0157377_10008532 Ga0157377_100085324 113
491 3300014745 Ga0157377_10028605 Ga0157377_100286053 113
492 3300014968 Ga0157379_10012695 Ga0157379_100126955 113
493 3300014968 Ga0157379_10288858 Ga0157379_102888583 113
494 3300014968 Ga0157379_10560193 Ga0157379_105601931 113
495 3300014969 Ga0157376_10189927 Ga0157376_101899273 113
496 3300014969 Ga0157376_11630474 Ga0157376_116304741 113
497 3300014969 Ga0157376_12758708 Ga0157376_127587082 113
498 3300015262 Ga0182007_10301113 Ga0182007_103011132 113
499 3300017792 Ga0163161_10018510 Ga0163161_100185103 113
500 3300017792 Ga0163161_10602091 Ga0163161_106020911 113
501 3300021384 Ga0213876_10003094 Ga0213876_100030945 113
502 3300021384 Ga0213876_10011231 Ga0213876_100112314 113
503 3300025273 Ga0209673_1004145 Ga0209673_10041456 113
504 3300025284 Ga0209130_1007131 Ga0209130_10071313 113
505 3300025291 Ga0209675_1006161 Ga0209675_10061615 113
506 3300025291 Ga0209675_1012769 Ga0209675_10127694 113
507 3300025292 Ga0209676_1000764 Ga0209676_100076412 113
508 3300025292 Ga0209676_1001068 Ga0209676_10010683 113
509 3300025294 Ga0209025_1001810 Ga0209025_10018106 113
510 3300025294 Ga0209025_1024030 Ga0209025_10240303 113
511 3300025294 Ga0209025_1075421 Ga0209025_10754213 113
512 3300025295 Ga0209564_1005861 Ga0209564_10058617 113
513 3300025295 Ga0209564_1016181 Ga0209564_10161812 113
514 3300025297 Ga0209758_1040504 Ga0209758_10405043 113
515 3300025298 Ga0209050_1005038 Ga0209050_10050388 113
516 3300025298 Ga0209050_1017947 Ga0209050_10179474 113
517 3300025299 Ga0209256_1000575 Ga0209256_100057527 113
518 3300025299 Ga0209256_1002249 Ga0209256_100224911 113
519 3300025303 Ga0209051_1006260 Ga0209051_10062601 113
520 3300025304 Ga0209257_1000065 Ga0209257_100006552 113
521 3300025304 Ga0209257_1000498 Ga0209257_100049868 113
522 3300025304 Ga0209257_1000593 Ga0209257_100059337 113
523 3300025304 Ga0209257_1001112 Ga0209257_100111218 113
524 3300025304 Ga0209257_1003126 Ga0209257_100312618 113
525 3300025304 Ga0209257_1004270 Ga0209257_10042704 113
526 3300025315 Ga0207697_10009866 Ga0207697_100098662 113
527 3300025315 Ga0207697_10295155 Ga0207697_102951552 113
528 3300025321 Ga0207656_10016846 Ga0207656_100168463 113
529 3300025321 Ga0207656_10046472 Ga0207656_100464723 113
530 3300025321 Ga0207656_10060426 Ga0207656_100604262 113
531 3300025893 Ga0207682_10139122 Ga0207682_101391222 113
532 3300025893 Ga0207682_10431936 Ga0207682_104319362 113
533 3300025901 Ga0207688_10054461 Ga0207688_100544612 113
534 3300025901 Ga0207688_10462002 Ga0207688_104620021 113
535 3300025903 Ga0207680_10094716 Ga0207680_100947163 113
536 3300025904 Ga0207647_10050141 Ga0207647_100501414 113
537 3300025907 Ga0207645_10011297 Ga0207645_100112974 113
538 3300025908 Ga0207643_10201022 Ga0207643_102010222 113
539 3300025909 Ga0207705_10024486 Ga0207705_100244863 113
540 3300025909 Ga0207705_10049896 Ga0207705_100498963 113
541 3300025909 Ga0207705_10200069 Ga0207705_102000691 113
542 3300025909 Ga0207705_10656421 Ga0207705_106564211 113
543 3300025909 Ga0207705_11400917 Ga0207705_114009171 113
544 3300025911 Ga0207654_10017730 Ga0207654_100177302 113
545 3300025911 Ga0207654_10585418 Ga0207654_105854182 113
546 3300025912 Ga0207707_10001539 Ga0207707_1000153912 113
547 3300025912 Ga0207707_10009253 Ga0207707_100092535 113
548 3300025912 Ga0207707_10072921 Ga0207707_100729214 113
549 3300025912 Ga0207707_10096763 Ga0207707_100967633 113
550 3300025912 Ga0207707_10097980 Ga0207707_100979801 113
551 3300025912 Ga0207707_10768404 Ga0207707_107684042 113
552 3300025913 Ga0207695_10064899 Ga0207695_100648992 113
553 3300025914 Ga0207671_10567938 Ga0207671_105679382 113
554 3300025916 Ga0207663_10286707 Ga0207663_102867071 113
555 3300025917 Ga0207660_10007070 Ga0207660_100070703 113
556 3300025917 Ga0207660_10012283 Ga0207660_100122835 113
557 3300025917 Ga0207660_10372285 Ga0207660_103722853 113
558 3300025917 Ga0207660_10663877 Ga0207660_106638772 113
559 3300025918 Ga0207662_10014013 Ga0207662_100140133 113
560 3300025919 Ga0207657_10024845 Ga0207657_100248455 113
561 3300025919 Ga0207657_10086708 Ga0207657_100867083 113
562 3300025919 Ga0207657_10191899 Ga0207657_101918992 113
563 3300025920 Ga0207649_10019705 Ga0207649_100197056 113
564 3300025920 Ga0207649_10033784 Ga0207649_100337845 113
565 3300025920 Ga0207649_10066165 Ga0207649_100661653 113
566 3300025920 Ga0207649_10518634 Ga0207649_105186342 113
567 3300025921 Ga0207652_10067634 Ga0207652_100676344 113
568 3300025921 Ga0207652_10104068 Ga0207652_101040682 113
569 3300025921 Ga0207652_10618453 Ga0207652_106184532 113
570 3300025921 Ga0207652_11362043 Ga0207652_113620432 113
571 3300025923 Ga0207681_10013719 Ga0207681_100137195 113
572 3300025923 Ga0207681_10511789 Ga0207681_105117891 113
573 3300025924 Ga0207694_10742799 Ga0207694_107427991 113
574 3300025924 Ga0207694_10922372 Ga0207694_109223722 113
575 3300025925 Ga0207650_10067932 Ga0207650_100679323 113
576 3300025925 Ga0207650_10333562 Ga0207650_103335622 113
577 3300025925 Ga0207650_11131566 Ga0207650_111315661 113
578 3300025925 Ga0207650_11271985 Ga0207650_112719851 113
579 3300025926 Ga0207659_10252219 Ga0207659_102522192 113
580 3300025926 Ga0207659_10275502 Ga0207659_102755022 113
581 3300025926 Ga0207659_10297605 Ga0207659_102976052 113
582 3300025926 Ga0207659_10418239 Ga0207659_104182391 113
583 3300025926 Ga0207659_10634140 Ga0207659_106341402 113
584 3300025926 Ga0207659_10733871 Ga0207659_107338711 113
585 3300025929 Ga0207664_10364119 Ga0207664_103641192 113
586 3300025931 Ga0207644_10385769 Ga0207644_103857692 113
587 3300025931 Ga0207644_10641008 Ga0207644_106410081 113
588 3300025932 Ga0207690_10016598 Ga0207690_100165984 113
589 3300025932 Ga0207690_10026685 Ga0207690_100266854 113
590 3300025932 Ga0207690_10128824 Ga0207690_101288242 113
591 3300025932 Ga0207690_10330085 Ga0207690_103300852 113
592 3300025932 Ga0207690_10795058 Ga0207690_107950582 113
593 3300025933 Ga0207706_10002237 Ga0207706_1000223713 113
594 3300025933 Ga0207706_10081778 Ga0207706_100817783 113
595 3300025934 Ga0207686_10037265 Ga0207686_100372653 113
596 3300025934 Ga0207686_11306938 Ga0207686_113069381 113
597 3300025935 Ga0207709_10647032 Ga0207709_106470322 113
598 3300025936 Ga0207670_10066576 Ga0207670_100665762 113
599 3300025936 Ga0207670_10959984 Ga0207670_109599842 113
600 3300025936 Ga0207670_11932016 Ga0207670_119320161 113
601 3300025938 Ga0207704_10027971 Ga0207704_100279714 113
602 3300025938 Ga0207704_10124939 Ga0207704_101249393 113
603 3300025938 Ga0207704_11716438 Ga0207704_117164382 113
604 3300025940 Ga0207691_10046847 Ga0207691_100468473 113
605 3300025940 Ga0207691_10125146 Ga0207691_101251464 113
606 3300025940 Ga0207691_10222306 Ga0207691_102223062 113
607 3300025941 Ga0207711_10041786 Ga0207711_100417863 113
608 3300025941 Ga0207711_10473336 Ga0207711_104733362 113
609 3300025942 Ga0207689_10037078 Ga0207689_100370783 113
610 3300025942 Ga0207689_10201212 Ga0207689_102012122 113
611 3300025942 Ga0207689_10546033 Ga0207689_105460331 113
612 3300025942 Ga0207689_11091049 Ga0207689_110910491 113
613 3300025944 Ga0207661_10002394 Ga0207661_100023942 113
614 3300025944 Ga0207661_10028189 Ga0207661_100281894 113
615 3300025944 Ga0207661_10085411 Ga0207661_100854112 113
616 3300025944 Ga0207661_10106480 Ga0207661_101064802 113
617 3300025944 Ga0207661_10168154 Ga0207661_101681541 113
618 3300025944 Ga0207661_10189880 Ga0207661_101898802 113
619 3300025944 Ga0207661_10362443 Ga0207661_103624433 113
620 3300025944 Ga0207661_10868878 Ga0207661_108688782 113
621 3300025944 Ga0207661_10876897 Ga0207661_108768971 113
622 3300025944 Ga0207661_10879246 Ga0207661_108792462 113
623 3300025945 Ga0207679_10002284 Ga0207679_1000228411 113
624 3300025945 Ga0207679_10041988 Ga0207679_100419885 113
625 3300025945 Ga0207679_10077744 Ga0207679_100777442 113
626 3300025945 Ga0207679_10163265 Ga0207679_101632652 113
627 3300025945 Ga0207679_10185497 Ga0207679_101854973 113
628 3300025945 Ga0207679_10208189 Ga0207679_102081892 113
629 3300025945 Ga0207679_10288698 Ga0207679_102886982 113
630 3300025945 Ga0207679_10380007 Ga0207679_103800072 113
631 3300025945 Ga0207679_10424722 Ga0207679_104247222 113
632 3300025945 Ga0207679_10453408 Ga0207679_104534082 113
633 3300025945 Ga0207679_10977952 Ga0207679_109779521 113
634 3300025945 Ga0207679_11207135 Ga0207679_112071351 113
635 3300025949 Ga0207667_10231860 Ga0207667_102318603 113
636 3300025949 Ga0207667_10605382 Ga0207667_106053822 113
637 3300025949 Ga0207667_11039029 Ga0207667_110390291 113
638 3300025949 Ga0207667_11899658 Ga0207667_118996581 113
639 3300025949 Ga0207667_12032403 Ga0207667_120324032 113
640 3300025960 Ga0207651_10025055 Ga0207651_100250551 113
641 3300025960 Ga0207651_10045633 Ga0207651_100456334 113
642 3300025961 Ga0207712_10013793 Ga0207712_100137935 113
643 3300025961 Ga0207712_10015567 Ga0207712_100155674 113
644 3300025961 Ga0207712_10032907 Ga0207712_100329074 113
645 3300025961 Ga0207712_10288438 Ga0207712_102884381 113
646 3300025972 Ga0207668_10009889 Ga0207668_100098892 113
647 3300025972 Ga0207668_10021866 Ga0207668_100218665 113
648 3300025981 Ga0207640_10308730 Ga0207640_103087303 113
649 3300025981 Ga0207640_10483521 Ga0207640_104835212 113
650 3300025981 Ga0207640_11431750 Ga0207640_114317502 113
651 3300025981 Ga0207640_11514858 Ga0207640_115148582 113
652 3300025986 Ga0207658_10052857 Ga0207658_100528574 113
653 3300025986 Ga0207658_11305173 Ga0207658_113051731 113
654 3300026023 Ga0207677_10160633 Ga0207677_101606334 113
655 3300026023 Ga0207677_10256424 Ga0207677_102564242 113
656 3300026023 Ga0207677_11541778 Ga0207677_115417781 113
657 3300026035 Ga0207703_10023800 Ga0207703_100238005 113
658 3300026035 Ga0207703_11019406 Ga0207703_110194062 113
659 3300026035 Ga0207703_11743076 Ga0207703_117430762 113
660 3300026035 Ga0207703_11773075 Ga0207703_117730752 113
661 3300026041 Ga0207639_10016177 Ga0207639_100161775 113
662 3300026041 Ga0207639_10063961 Ga0207639_100639614 113
663 3300026041 Ga0207639_10336450 Ga0207639_103364502 113
664 3300026041 Ga0207639_10592155 Ga0207639_105921552 113
665 3300026041 Ga0207639_10915047 Ga0207639_109150471 113
666 3300026041 Ga0207639_12046953 Ga0207639_120469532 113
667 3300026041 Ga0207639_12197742 Ga0207639_121977422 113
668 3300026067 Ga0207678_10044834 Ga0207678_100448346 113
669 3300026075 Ga0207708_10032553 Ga0207708_100325535 113
670 3300026075 Ga0207708_10528025 Ga0207708_105280252 113
671 3300026078 Ga0207702_10184662 Ga0207702_101846623 113
672 3300026078 Ga0207702_10694463 Ga0207702_106944632 113
673 3300026078 Ga0207702_10893626 Ga0207702_108936262 113
674 3300026078 Ga0207702_11818375 Ga0207702_118183752 113
675 3300026088 Ga0207641_10103975 Ga0207641_101039753 113
676 3300026088 Ga0207641_10325662 Ga0207641_103256621 113
677 3300026088 Ga0207641_10693479 Ga0207641_106934791 113
678 3300026088 Ga0207641_10913838 Ga0207641_109138382 113
679 3300026088 Ga0207641_10926881 Ga0207641_109268812 113
680 3300026088 Ga0207641_11060259 Ga0207641_110602591 113
681 3300026089 Ga0207648_11191749 Ga0207648_111917491 113
682 3300026095 Ga0207676_10247055 Ga0207676_102470552 113
683 3300026095 Ga0207676_10568584 Ga0207676_105685842 113
684 3300026095 Ga0207676_10689996 Ga0207676_106899961 113
685 3300026095 Ga0207676_10798897 Ga0207676_107988972 113
686 3300026095 Ga0207676_11063303 Ga0207676_110633032 113
687 3300026095 Ga0207676_11442351 Ga0207676_114423511 113
688 3300026095 Ga0207676_12065615 Ga0207676_120656151 113
689 3300026116 Ga0207674_10008894 Ga0207674_100088944 113
690 3300026116 Ga0207674_10047433 Ga0207674_100474333 113
691 3300026116 Ga0207674_10056432 Ga0207674_100564324 113
692 3300026116 Ga0207674_10488628 Ga0207674_104886282 113
693 3300026118 Ga0207675_100000209 Ga0207675_10000020912 113
694 3300026118 Ga0207675_100002910 Ga0207675_1000029106 113
695 3300026118 Ga0207675_100594660 Ga0207675_1005946602 113
696 3300026118 Ga0207675_100668168 Ga0207675_1006681683 113
697 3300026118 Ga0207675_100805885 Ga0207675_1008058851 113
698 3300026118 Ga0207675_102189842 Ga0207675_1021898421 113
699 3300026142 Ga0207698_10039806 Ga0207698_100398063 113
700 3300026142 Ga0207698_10051296 Ga0207698_100512962 113
701 3300026142 Ga0207698_10132867 Ga0207698_101328672 113
702 3300026142 Ga0207698_11330778 Ga0207698_113307782 113
703 3300027471 Ga0209995_1062771 Ga0209995_10627712 113
704 3300027614 Ga0209970_1041146 Ga0209970_10411462 113
705 3300027876 Ga0209974_10093259 Ga0209974_100932592 113
706 3300027907 Ga0207428_10009104 Ga0207428_1000910411 113
707 3300027907 Ga0207428_10054860 Ga0207428_100548603 113
708 3300027907 Ga0207428_10067609 Ga0207428_100676093 113
709 3300027907 Ga0207428_10155986 Ga0207428_101559863 113
710 3300027907 Ga0207428_10221820 Ga0207428_102218202 113
711 3300028379 Ga0268266_10237080 Ga0268266_102370803 113
712 3300028379 Ga0268266_10246397 Ga0268266_102463971 113
713 3300028379 Ga0268266_10383095 Ga0268266_103830953 113
714 3300028379 Ga0268266_10691353 Ga0268266_106913531 113
715 3300028379 Ga0268266_12008685 Ga0268266_120086852 113
716 3300028380 Ga0268265_10012226 Ga0268265_100122265 113
717 3300028380 Ga0268265_10013128 Ga0268265_100131283 113
718 3300028380 Ga0268265_10304984 Ga0268265_103049842 113
719 3300028380 Ga0268265_11966241 Ga0268265_119662411 113
720 3300028381 Ga0268264_10087668 Ga0268264_100876683 113
721 3300028786 Ga0307517_10549211 Ga0307517_105492111 113
722 3300028794 Ga0307515_10707329 Ga0307515_107073291 113
723 3300031548 Ga0307408_100005765 Ga0307408_1000057651 113
724 3300031548 Ga0307408_100022310 Ga0307408_1000223104 113
725 3300031548 Ga0307408_100069266 Ga0307408_1000692662 113
726 3300031548 Ga0307408_100071711 Ga0307408_1000717112 113
727 3300031548 Ga0307408_100190589 Ga0307408_1001905891 113
728 3300031731 Ga0307405_10000431 Ga0307405_1000043112 113
729 3300031731 Ga0307405_10000467 Ga0307405_1000046712 113
730 3300031731 Ga0307405_10004308 Ga0307405_100043085 113
731 3300031731 Ga0307405_10025988 Ga0307405_100259884 113
732 3300031731 Ga0307405_10397022 Ga0307405_103970222 113
733 3300031731 Ga0307405_10410594 Ga0307405_104105941 113
734 3300031731 Ga0307405_11061527 Ga0307405_110615272 113
735 3300031824 Ga0307413_10000553 Ga0307413_1000055312 113
736 3300031824 Ga0307413_10000611 Ga0307413_100006114 113
737 3300031824 Ga0307413_10046328 Ga0307413_100463285 113
738 3300031824 Ga0307413_10065562 Ga0307413_100655621 113
739 3300031824 Ga0307413_10086659 Ga0307413_100866591 113
740 3300031824 Ga0307413_10256133 Ga0307413_102561332 113
741 3300031824 Ga0307413_10348001 Ga0307413_103480012 113
742 3300031824 Ga0307413_10431682 Ga0307413_104316823 113
743 3300031824 Ga0307413_10645769 Ga0307413_106457692 113
744 3300031852 Ga0307410_10014163 Ga0307410_100141632 113
745 3300031852 Ga0307410_10047568 Ga0307410_100475683 113
746 3300031852 Ga0307410_10061960 Ga0307410_100619602 113
747 3300031852 Ga0307410_10178373 Ga0307410_101783731 113
748 3300031852 Ga0307410_10197290 Ga0307410_101972901 113
749 3300031852 Ga0307410_10239074 Ga0307410_102390744 113
750 3300031852 Ga0307410_10396720 Ga0307410_103967202 113
751 3300031852 Ga0307410_10422915 Ga0307410_104229152 113
752 3300031852 Ga0307410_11171109 Ga0307410_111711091 113
753 3300031901 Ga0307406_10002382 Ga0307406_1000238217 113
754 3300031901 Ga0307406_10005037 Ga0307406_100050375 113
755 3300031901 Ga0307406_10014924 Ga0307406_100149243 113
756 3300031901 Ga0307406_10053531 Ga0307406_100535313 113
757 3300031901 Ga0307406_10063388 Ga0307406_100633884 113
758 3300031901 Ga0307406_10200322 Ga0307406_102003223 113
759 3300031901 Ga0307406_10229065 Ga0307406_102290652 113
760 3300031903 Ga0307407_10000511 Ga0307407_1000051114 113
761 3300031903 Ga0307407_10004075 Ga0307407_100040753 113
762 3300031903 Ga0307407_10041261 Ga0307407_100412612 113
763 3300031903 Ga0307407_10161929 Ga0307407_101619294 113
764 3300031903 Ga0307407_10250093 Ga0307407_102500931 113
765 3300031903 Ga0307407_10275083 Ga0307407_102750832 113
766 3300031903 Ga0307407_10329993 Ga0307407_103299931 113
767 3300031903 Ga0307407_10883291 Ga0307407_108832911 113
768 3300031903 Ga0307407_11094928 Ga0307407_110949282 113
769 3300031911 Ga0307412_10001715 Ga0307412_100017156 113
770 3300031911 Ga0307412_10010522 Ga0307412_100105226 113
771 3300031911 Ga0307412_10029005 Ga0307412_100290052 113
772 3300031911 Ga0307412_10059476 Ga0307412_100594762 113
773 3300031911 Ga0307412_10454780 Ga0307412_104547802 113
774 3300031911 Ga0307412_12315555 Ga0307412_123155551 113
775 3300031995 Ga0307409_100000474 Ga0307409_10000047413 113
776 3300031995 Ga0307409_100004192 Ga0307409_1000041921 113
777 3300031995 Ga0307409_100066532 Ga0307409_1000665322 113
778 3300031995 Ga0307409_100072959 Ga0307409_1000729593 113
779 3300031995 Ga0307409_100462768 Ga0307409_1004627681 113
780 3300031995 Ga0307409_100913706 Ga0307409_1009137061 113
781 3300031995 Ga0307409_101398726 Ga0307409_1013987262 113
782 3300031995 Ga0307409_101635213 Ga0307409_1016352132 113
783 3300032002 Ga0307416_100000163 Ga0307416_10000016330 113
784 3300032002 Ga0307416_100000912 Ga0307416_10000091217 113
785 3300032002 Ga0307416_100001181 Ga0307416_1000011813 113
786 3300032002 Ga0307416_100018472 Ga0307416_1000184726 113
787 3300032002 Ga0307416_100040050 Ga0307416_1000400502 113
788 3300032002 Ga0307416_100252872 Ga0307416_1002528722 113
789 3300032002 Ga0307416_100310937 Ga0307416_1003109372 113
790 3300032002 Ga0307416_100716573 Ga0307416_1007165732 113
791 3300032002 Ga0307416_101074897 Ga0307416_1010748972 113
792 3300032002 Ga0307416_101810145 Ga0307416_1018101452 113
793 3300032002 Ga0307416_102070073 Ga0307416_1020700732 113
794 3300032004 Ga0307414_10001031 Ga0307414_1000103112 113
795 3300032004 Ga0307414_10002523 Ga0307414_100025239 113
796 3300032004 Ga0307414_10129588 Ga0307414_101295884 113
797 3300032004 Ga0307414_10143624 Ga0307414_101436242 113
798 3300032004 Ga0307414_10314665 Ga0307414_103146651 113
799 3300032004 Ga0307414_10326140 Ga0307414_103261402 113
800 3300032004 Ga0307414_10460805 Ga0307414_104608052 113
801 3300032005 Ga0307411_10000120 Ga0307411_1000012023 113
802 3300032005 Ga0307411_10003303 Ga0307411_100033032 113
803 3300032005 Ga0307411_10010089 Ga0307411_100100892 113
804 3300032005 Ga0307411_10058094 Ga0307411_100580944 113
805 3300032005 Ga0307411_10122995 Ga0307411_101229952 113
806 3300032005 Ga0307411_10163960 Ga0307411_101639603 113
807 3300032005 Ga0307411_10262565 Ga0307411_102625653 113
808 3300032005 Ga0307411_10276649 Ga0307411_102766494 113
809 3300032005 Ga0307411_10798627 Ga0307411_107986272 113
810 3300032126 Ga0307415_100001591 Ga0307415_10000159119 113
811 3300032126 Ga0307415_100022540 Ga0307415_1000225404 113
812 3300032126 Ga0307415_100113318 Ga0307415_1001133182 113
813 3300032126 Ga0307415_100173143 Ga0307415_1001731432 113
814 3300032126 Ga0307415_100534568 Ga0307415_1005345682 113
815 3300032126 Ga0307415_100651072 Ga0307415_1006510722 113
816 3300032126 Ga0307415_101396334 Ga0307415_1013963341 113
817 3300035092 Ga0373952_0058003 Ga0373952_0058003_239_580 113
818 3300035121 Ga0373960_0178499 Ga0373960_0178499_356_697 113
819 3300035171 Ga0373946_0419620 Ga0373946_0419620_303_644 113
820 3300035241 Ga0373961_0129810 Ga0373961_0129810_150_491 113
821 3300035242 Ga0373962_0086014 Ga0373962_0086014_91_444 113
822 3300037312 Ga0395899_0122473 Ga0395899_0122473_111_467 113
823 3300037418 Ga0395900_0001278 Ga0395900_0001278_16189_16545 113
824 3300037418 Ga0395900_0261130 Ga0395900_0261130_10_357 113
825 3300037466 Ga0395898_0002604 Ga0395898_0002604_16774_17121 113
826 3300037466 Ga0395898_0023538 Ga0395898_0023538_5553_5909 113
827 3300037466 Ga0395898_0170279 Ga0395898_0170279_1363_1722 113
828 3300037471 Ga0395905_0086560 Ga0395905_0086560_234_593 113
829 3300037471 Ga0395905_0247916 Ga0395905_0247916_78_422 113
830 3300037853 Ga0436364_1168503 Ga0436364_1168503_580_921 113
831 3300038443 Ga0395901_0000327 Ga0395901_0000327_38524_38880 113
832 3300038443 Ga0395901_0020475 Ga0395901_0020475_6149_6496 113
833 3300038443 Ga0395901_0028345 Ga0395901_0028345_1763_2122 113
834 3300039437 Ga0436365_0137719 Ga0436365_0137719_6809_7159 113
835 3300039437 Ga0436365_0173963 Ga0436365_0173963_2415_2756 113
836 3300039437 Ga0436365_0223687 Ga0436365_0223687_762_1103 113
837 3300039453 Ga0436362_1069022 Ga0436362_1069022_201_542 113
838 3300041406 Ga0439439_0059749 Ga0439439_0059749_70_423 113
839 3300041406 Ga0439439_0131204 Ga0439439_0131204_86_427 113
840 3300041408 Ga0439453_0017774 Ga0439453_0017774_301_642 113
841 3300041410 Ga0439461_0012170 Ga0439461_0012170_1217_1558 113
842 3300041459 Ga0451800_0683371 Ga0451800_0683371_322_675 113
843 3300041512 Ga0451853_1340511 Ga0451853_1340511_43_396 113
844 3300041999 Ga0439433_0031208 Ga0439433_0031208_344_685 113
845 3300042001 Ga0439441_023866 Ga0439441_023866_279_620 113
846 3300042003 Ga0439443_016136 Ga0439443_016136_462_803 113
847 3300042011 Ga0439454_048451 Ga0439454_048451_71_412 113
848 3300042013 Ga0439456_075124 Ga0439456_075124_343_684 113
849 3300042015 Ga0439462_0078786 Ga0439462_0078786_87_428 113
850 3300042120 Ga0450917_027856 Ga0450917_027856_57_398 113
851 3300042125 Ga0450923_000962 Ga0450923_000962_3117_3458 113
852 3300042125 Ga0450923_112777 Ga0450923_112777_80_421 113
853 3300042156 Ga0439446_0001964 Ga0439446_0001964_617_958 113
854 3300042435 Ga0439434_0273614 Ga0439434_0273614_221_562 113
855 3300042436 Ga0439435_0001188 Ga0439435_0001188_3247_3588 113
856 3300042437 Ga0439444_0000441 Ga0439444_0000441_1764_2105 113
857 3300042437 Ga0439444_0028990 Ga0439444_0028990_275_628 113
858 3300042438 Ga0439459_0071438 Ga0439459_0071438_127_480 113
859 3300042439 Ga0439464_0085150 Ga0439464_0085150_65_406 113
860 3300042461 Ga0439460_0060340 Ga0439460_0060340_520_873 113
861 3300044673 Ga0453683_0675118 Ga0453683_0675118_76_417 113
862 3300044693 Ga0466961_0380136 Ga0466961_0380136_399_740 113
863 3300044694 Ga0466963_0571023 Ga0466963_0571023_52_393 113
864 3300044842 Ga0466957_1371645 Ga0466957_1371645_148_489 113
865 3300044901 Ga0466960_0712625 Ga0466960_0712625_145_498 113
866 3300045051 Ga0451576_0439473 Ga0451576_0439473_171_512 113
867 3300045051 Ga0451576_1078838 Ga0451576_1078838_292_633 113
868 3300046459 Ga0495629_0097002 Ga0495629_0097002_449_790 113
869 3300046460 Ga0495638_0361285 Ga0495638_0361285_173_514 113
870 3300046475 Ga0495639_0124882 Ga0495639_0124882_416_757 113
871 3300046475 Ga0495639_0347010 Ga0495639_0347010_16_357 113
872 3300046499 Ga0495594_0007137 Ga0495594_0007137_4203_4556 113
873 3300046499 Ga0495594_0115875 Ga0495594_0115875_519_860 113
874 3300046500 Ga0495596_0312922 Ga0495596_0312922_95_436 113
875 3300046516 Ga0495628_0905706 Ga0495628_0905706_227_568 113
876 3300046519 Ga0495632_0317082 Ga0495632_0317082_306_647 113
877 3300046523 Ga0495644_0106856 Ga0495644_0106856_512_865 113
878 3300046660 Ga0495625_0202858 Ga0495625_0202858_464_805 113
879 3300046665 Ga0495661_0415862 Ga0495661_0415862_63_404 113
880 3300046689 Ga0495613_0055044 Ga0495613_0055044_2125_2466 113
881 3300046809 Ga0495600_0111263 Ga0495600_0111263_779_1120 113
882 3300047315 Ga0495581_0066351 Ga0495581_0066351_602_943 113
883 3300047318 Ga0495636_0075448 Ga0495636_0075448_112_453 113
884 3300047320 Ga0495672_0002532 Ga0495672_0002532_9971_10324 113
885 3300047445 Ga0495677_0026657 Ga0495677_0026657_1745_2086 113
886 3300047471 Ga0495684_0858240 Ga0495684_0858240_195_536 113
887 3300048090 Ga0495615_0228489 Ga0495615_0228489_172_525 113
888 3300048903 Ga0496100_0722153 Ga0496100_0722153_140_481 113
889 3300048905 Ga0496102_1730079 Ga0496102_1730079_118_459 113
890 3300048907 Ga0496104_0204205 Ga0496104_0204205_1482_1823 113
891 3300048907 Ga0496104_0637565 Ga0496104_0637565_565_906 113
892 3300048907 Ga0496104_0648612 Ga0496104_0648612_104_445 113
893 3300048908 Ga0496105_0189172 Ga0496105_0189172_885_1226 113
894 3300048908 Ga0496105_1004879 Ga0496105_1004879_151_492 113
895 3300048909 Ga0496106_0082749 Ga0496106_0082749_41_382 113
896 3300048909 Ga0496106_0087337 Ga0496106_0087337_207_548 113
897 3300048910 Ga0496107_0219086 Ga0496107_0219086_401_742 113
898 3300048910 Ga0496107_1183726 Ga0496107_1183726_12_353 113
899 3300048911 Ga0496108_0062246 Ga0496108_0062246_1793_2134 113
900 3300048911 Ga0496108_0141866 Ga0496108_0141866_799_1140 113
901 3300048911 Ga0496108_0290330 Ga0496108_0290330_554_895 113
902 3300048911 Ga0496108_0660724 Ga0496108_0660724_214_555 113
903 3300048912 Ga0496109_0030074 Ga0496109_0030074_2046_2387 113
904 3300048912 Ga0496109_0269154 Ga0496109_0269154_100_441 113
905 3300048912 Ga0496109_0375171 Ga0496109_0375171_920_1261 113
906 3300048912 Ga0496109_1537762 Ga0496109_1537762_104_445 113
907 3300048912 Ga0496109_1897623 Ga0496109_1897623_119_460 113
908 3300048913 Ga0496110_0044322 Ga0496110_0044322_2175_2516 113
909 3300048915 Ga0496112_0033600 Ga0496112_0033600_2048_2389 113
910 3300048915 Ga0496112_0618920 Ga0496112_0618920_318_659 113
911 3300048915 Ga0496112_1770096 Ga0496112_1770096_80_421 113
912 3300048916 Ga0496113_0122120 Ga0496113_0122120_1458_1799 113
913 3300048916 Ga0496113_0216289 Ga0496113_0216289_797_1138 113
914 3300048918 Ga0496115_0108203 Ga0496115_0108203_229_570 113
915 3300049514 Ga0501291_014518 Ga0501291_014518_194_535 113
916 3300049514 Ga0501291_027040 Ga0501291_027040_555_896 113
917 3300049521 Ga0501298_038603 Ga0501298_038603_27_368 113
918 3300049521 Ga0501298_115275 Ga0501298_115275_155_508 113
919 3300049579 Ga0501043_0704935 Ga0501043_0704935_236_577 113
920 3300049580 Ga0501046_0842413 Ga0501046_0842413_137_478 113
921 3300049581 Ga0501047_0151210 Ga0501047_0151210_441_782 113
922 3300049582 Ga0501048_0334005 Ga0501048_0334005_99_440 113
923 3300049583 Ga0501067_0711961 Ga0501067_0711961_60_413 113
924 3300049584 Ga0501068_0135929 Ga0501068_0135929_943_1284 113
925 3300049586 Ga0501070_0017289 Ga0501070_0017289_2470_2811 113
926 3300049587 Ga0501071_0132060 Ga0501071_0132060_1193_1546 113
927 3300049588 Ga0501072_0273858 Ga0501072_0273858_592_939 113
928 3300049588 Ga0501072_0391494 Ga0501072_0391494_403_744 113
929 3300049591 Ga0501075_0335650 Ga0501075_0335650_201_548 113
930 3300049592 Ga0501076_0184903 Ga0501076_0184903_911_1258 113
931 3300049593 Ga0501077_0219660 Ga0501077_0219660_745_1086 113
932 3300049593 Ga0501077_0618620 Ga0501077_0618620_224_571 113
933 3300049649 Ga0501198_024717 Ga0501198_024717_507_848 113
934 3300049652 Ga0501202_053375 Ga0501202_053375_259_600 113
935 3300049654 Ga0501207_033814 Ga0501207_033814_137_478 113
936 3300049660 Ga0501216_053647 Ga0501216_053647_290_643 113
937 3300049661 Ga0501217_084532 Ga0501217_084532_453_794 113
938 3300049664 Ga0501224_031055 Ga0501224_031055_61_414 113
939 3300049668 Ga0501233_129944 Ga0501233_129944_104_445 113
940 3300049668 Ga0501233_178262 Ga0501233_178262_10_351 113
941 3300049668 Ga0501233_259214 Ga0501233_259214_28_369 113
942 3300049671 Ga0501238_057025 Ga0501238_057025_218_571 113
943 3300049676 Ga0501246_018320 Ga0501246_018320_291_644 113
944 3300049677 Ga0501247_015519 Ga0501247_015519_554_907 113
945 3300049677 Ga0501247_049607 Ga0501247_049607_194_535 113
946 3300049679 Ga0501249_024916 Ga0501249_024916_605_946 113
947 3300049679 Ga0501249_039494 Ga0501249_039494_523_876 113
948 3300049679 Ga0501249_160061 Ga0501249_160061_107_448 113
949 3300049683 Ga0501253_066061 Ga0501253_066061_121_462 113
950 3300049683 Ga0501253_089612 Ga0501253_089612_245_598 113
951 3300049686 Ga0501257_058817 Ga0501257_058817_521_862 113
952 3300049688 Ga0501259_030012 Ga0501259_030012_284_625 113
953 3300049688 Ga0501259_135490 Ga0501259_135490_56_397 113
954 3300049705 Ga0501225_0035821 Ga0501225_0035821_617_970 113
955 3300049706 Ga0501229_074495 Ga0501229_074495_78_419 113
956 3300049708 Ga0501245_156005 Ga0501245_156005_102_455 113
957 3300049742 Ga0501080_0270777 Ga0501080_0270777_233_574 113
958 3300049742 Ga0501080_0747330 Ga0501080_0747330_51_398 113
959 3300049760 Ga0501263_089368 Ga0501263_089368_69_410 113
960 3300049762 Ga0501265_077458 Ga0501265_077458_115_456 113
961 3300049763 Ga0501266_057431 Ga0501266_057431_160_501 113
962 3300049763 Ga0501266_083037 Ga0501266_083037_67_420 113
963 3300049765 Ga0501268_005903 Ga0501268_005903_1283_1624 113
964 3300049766 Ga0501269_063891 Ga0501269_063891_105_446 113
965 3300049769 Ga0501272_034014 Ga0501272_034014_56_409 113
966 3300049769 Ga0501272_050608 Ga0501272_050608_115_468 113
967 3300049769 Ga0501272_068084 Ga0501272_068084_87_440 113
968 3300049775 Ga0501279_049312 Ga0501279_049312_96_437 113
969 3300049779 Ga0501283_041000 Ga0501283_041000_226_579 113
970 3300049779 Ga0501283_100161 Ga0501283_100161_197_538 113
971 3300049823 Ga0501044_0220011 Ga0501044_0220011_1008_1349 113
972 3300050490 nmdc:mga03n38_271498_c1 nmdc:mga03n38_271498_c1_200_541 113
973 3300050507 nmdc:mga05p37_1049884_c1 nmdc:mga05p37_1049884_c1_122_463 113
974 3300050507 nmdc:mga05p37_112785_c1 nmdc:mga05p37_112785_c1_879_1220 113
975 3300050507 nmdc:mga05p37_1715128_c1 nmdc:mga05p37_1715128_c1_107_460 113
976 3300050508 nmdc:mga09592_129339_c1 nmdc:mga09592_129339_c1_1462_1803 113
977 3300050508 nmdc:mga09592_195702_c1 nmdc:mga09592_195702_c1_1058_1399 113
978 3300050509 nmdc:mga0qj67_482812_c1 nmdc:mga0qj67_482812_c1_79_432 113
979 3300050510 nmdc:mga06r32_125035_c1 nmdc:mga06r32_125035_c1_1035_1376 113
980 3300050510 nmdc:mga06r32_1380961_c1 nmdc:mga06r32_1380961_c1_100_453 113
981 3300050510 nmdc:mga06r32_575707_c1 nmdc:mga06r32_575707_c1_79_432 113
982 3300050510 nmdc:mga06r32_604928_c1 nmdc:mga06r32_604928_c1_117_470 113
983 3300050511 nmdc:mga08y16_1128336_c1 nmdc:mga08y16_1128336_c1_125_466 113
984 3300050511 nmdc:mga08y16_1219967_c1 nmdc:mga08y16_1219967_c1_347_688 113
985 3300050511 nmdc:mga08y16_1601200_c1 nmdc:mga08y16_1601200_c1_156_497 113
986 3300050511 nmdc:mga08y16_22712_c2 nmdc:mga08y16_22712_c2_972_1313 113
987 3300050511 nmdc:mga08y16_38177_c1 nmdc:mga08y16_38177_c1_966_1307 113
988 3300050511 nmdc:mga08y16_492206_c1 nmdc:mga08y16_492206_c1_46_387 113
989 3300050511 nmdc:mga08y16_721655_c1 nmdc:mga08y16_721655_c1_208_549 113
990 3300050511 nmdc:mga08y16_9515_c1 nmdc:mga08y16_9515_c1_8164_8505 113
991 3300050512 nmdc:mga0n895_14555_c1 nmdc:mga0n895_14555_c1_5719_6060 113
992 3300050512 nmdc:mga0n895_25288_c1 nmdc:mga0n895_25288_c1_5022_5363 113
993 3300050512 nmdc:mga0n895_74179_c1 nmdc:mga0n895_74179_c1_1031_1372 113
994 3300050513 nmdc:mga0rr50_1061802_c1 nmdc:mga0rr50_1061802_c1_167_508 113
995 3300050513 nmdc:mga0rr50_145246_c1 nmdc:mga0rr50_145246_c1_1054_1395 113
996 3300050513 nmdc:mga0rr50_171652_c1 nmdc:mga0rr50_171652_c1_429_833 113
997 3300050514 nmdc:mga08x19_22079_c1 nmdc:mga08x19_22079_c1_988_1329 113
998 3300050514 nmdc:mga08x19_6811_c1 nmdc:mga08x19_6811_c1_2467_2808 113
999 3300050515 nmdc:mga0a205_171250_c1 nmdc:mga0a205_171250_c1_1653_1994 113
1000 3300050515 nmdc:mga0a205_26159_c1 nmdc:mga0a205_26159_c1_5199_5540 113
1001 3300050515 nmdc:mga0a205_428254_c1 nmdc:mga0a205_428254_c1_180_521 113
1002 3300050515 nmdc:mga0a205_723661_c1 nmdc:mga0a205_723661_c1_142_495 113
1003 3300053090 Ga0500646_0004679 Ga0500646_0004679_2088_2441 113
1004 3300053090 Ga0500646_0101629 Ga0500646_0101629_531_872 113
1005 3300053102 Ga0500554_042253 Ga0500554_042253_515_856 113
1006 3300053129 Ga0500628_000202 Ga0500628_000202_10619_10960 113
1007 3300053131 Ga0500652_302633 Ga0500652_302633_249_602 113
1008 3300053134 Ga0500658_0074588 Ga0500658_0074588_393_734 113
1009 3300053139 Ga0500568_0033398 Ga0500568_0033398_384_725 113
1010 3300053153 Ga0500616_0000575 Ga0500616_0000575_4492_4833 113
1011 3300053153 Ga0500616_0096194 Ga0500616_0096194_13_354 113
1012 3300053156 Ga0500622_0006275 Ga0500622_0006275_3602_3943 113
1013 3300053156 Ga0500622_0007430 Ga0500622_0007430_423_764 113
1014 3300053160 Ga0500633_0323998 Ga0500633_0323998_129_470 113
1015 3300054114 Ga0501084_1086663 Ga0501084_1086663_272_619 113
1016 3300059421 Ga0590071_037169 Ga0590071_037169_404_745 113
1017 3300059423 Ga0590074_009280 Ga0590074_009280_553_894 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

37

83

0.97

PF12840

HTH_20

Helix-turn-helix domain

35

84

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6v-assembly1.cif.gz_A-2 crystal structure of possible transcriptional regulator for arsenical resistance 0.9119 9 87
7p6f-assembly2.cif.gz_CCC-2 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9101 4 87
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9082 4 87
1wq2-assembly1.cif.gz_A neutron crystal structure of dissimilatory sulfite reductase d (dsrd) 0.908 16 75
3lmm-assembly4.cif.gz_D crystal structure of the dip2311 protein from corynebacterium diphtheriae, northeast structural genomics consortium target cdr35 0.8972 18 74
ID Description Score Start End Superfamily
2vxzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9334 18 73 1.10.10.10
af_P71941_17_120_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9169 3 83 1.10.10.10
af_Q2FXF7_1_94_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9129 6 86 1.10.10.10
3f6vA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9119 9 87 1.10.10.10
1wq2A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.908 16 75 1.10.10.10
ID Description Score Start End GO Terms
AF-W7CAE8-F1-model_v4 deleted 0.9704 6 79
AF-A0A3M0T2P4-F1-model_v4 ArsR family transcriptional regulator 0.9675 3 73 GO:0003700
AF-A0A7V5WPP1-F1-model_v4 ArsR family transcriptional regulator 0.9541 6 79 GO:0003700
AF-A0A2S9G3J3-F1-model_v4 Transcriptional regulator 0.947 1 84 GO:0003700
AF-A0A432EPW3-F1-model_v4 Transcriptional regulator 0.9393 6 85 GO:0003700

Feature Viewer

pLDDT pTM Quality
88.84 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map