F488302

General Info

Members Datasets Scaffolds Average Seq Length
1017 390 2034 274

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|637000220|637322234
Length 311
Sequence VIQRQCHASTPIGLPRLRDLRAGCCCAYCGTAKEQGIPMKVELAQLAGRDNATAYNLERALAAIAACAADTRLIVFPETHLMGFPSAETVAAVAEPLDGPTVQAVIQAARARNIAVVIGMAENDDGRFYNTTLLITPEGIALRYRKTHLWASDRGVFTPGDRYTTCLWNGVRVGLLICYDIEFPESARALAQLGAELLIVTNGNMDPYGPTHRTAIMARAQENQAFALMVNRVEEGDGGLLFAGGSALVDPLGSLLFEAGREEGQFKVELDLKQLQVARQDYRYLEDQRLKLAGEVLEHGDGVRELLIPIR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
28 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
79 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
84 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
85 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
86 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
87 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
100 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
101 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
102 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
103 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
104 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
105 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
106 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
107 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
108 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
109 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
110 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
111 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
112 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
113 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
114 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
115 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
116 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
120 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
121 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
122 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
138 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
143 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
155 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
156 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
185 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
186 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
200 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
223 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
231 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
232 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
236 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
237 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
238 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
239 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
240 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
241 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
242 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
243 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
244 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
245 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
246 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
247 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
248 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
249 2511231007 Pseudomonas sp. GM18 Isolate Nodule
250 2511231010 Pseudomonas sp. GM25 Isolate Nodule
251 2511231011 Pseudomonas sp. GM30 Isolate Nodule
252 2511231012 Pseudomonas sp. GM33 Isolate Nodule
253 2511231014 Pseudomonas sp. GM48 Isolate Nodule
254 2511231015 Pseudomonas sp. GM49 Isolate Nodule
255 2511231017 Pseudomonas sp. GM55 Isolate Nodule
256 2511231018 Pseudomonas sp. GM60 Isolate Nodule
257 2511231019 Pseudomonas sp. GM67 Isolate Nodule
258 2511231020 Pseudomonas sp. GM74 Isolate Nodule
259 2511231021 Pseudomonas sp. GM78 Isolate Nodule
260 2511231031 Pseudomonas sp. GM16 Isolate Nodule
261 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
262 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
263 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
264 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
265 2519103095 Burkholderia sp. KJ006 Isolate Nodule
266 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
267 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
268 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
269 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
270 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
271 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
272 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
273 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
274 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
275 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
276 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
277 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
278 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
279 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
280 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
281 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
282 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
283 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
284 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
285 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
286 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
287 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
288 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
289 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
290 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
291 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
292 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
293 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
294 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
295 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
296 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
297 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
298 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
299 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
300 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
301 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
302 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
303 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
304 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
305 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
306 2773857670 Pseudomonas sp. 478 Isolate Unclassified
307 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
308 2773857673 Pseudomonas sp. 443 Isolate Unclassified
309 2784132063 Pseudomonas sp. 424 Isolate Unclassified
310 2784132072 Pseudomonas sp. 460 Isolate Unclassified
311 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
312 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
313 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
314 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
315 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
316 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
317 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
318 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
319 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
320 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
321 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
322 2818991452 Burkholderia cepacia 561 Isolate Unclassified
323 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
324 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
325 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
326 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
327 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
328 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
329 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
330 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
331 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
332 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
333 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
334 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
335 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
336 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
337 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
338 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
339 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
340 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
341 2904564687 Burkholderia sp. 571 Isolate Unclassified
342 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
343 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
344 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
345 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
346 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
347 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
348 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
349 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
350 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
351 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
352 2928163908 Burkholderia sp. 567 Isolate Unclassified
353 2928170801 Burkholderia sp. 572 Isolate Unclassified
354 2928536128 Burkholderia sola 565 Isolate Unclassified
355 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
356 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
357 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
358 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
359 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
360 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
361 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
362 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
363 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
364 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
365 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
366 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
367 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
368 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
369 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
370 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
371 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
372 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
373 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
374 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
375 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
376 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
377 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
378 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
379 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
380 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
381 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
382 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
383 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
384 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
385 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
386 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
387 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
388 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
389 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
390 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.35
Metatranscriptomes 0
Isolates 14.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 4.42
Nodule 2.46
Rhizoplane 4.33
Rhizosphere 77.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_175 2124908027 Bacteria 28106
2 MRS2a_Contig_977 2124908027 Bacteria 5437
3 JGI24739J22299_10015584 3300001989 Bacteria 2761
4 JGI25162J39368_1000034 3300002737 Bacteria 183428
5 JGI25163J39215_1000345 3300002771 Bacteria 15362
6 JGI25164J39214_1000018 3300002772 Bacteria 185215
7 JGI25165J46597_1000123 3300003214 Bacteria 131481
8 rootL2_10084227 3300003322 Bacteria 3665
9 JGI25160J50197_1000151 3300003354 Bacteria 61351
10 Ga0055532_1000392 3300003758 Bacteria 22046
11 Ga0055532_1000449 3300003758 Bacteria 19192
12 Ga0055527_1000492 3300003760 Bacteria 14185
13 Ga0055535_1000254 3300003761 Bacteria 56175
14 Ga0055542_1000291 3300003762 Bacteria 56190
15 Ga0055529_1000290 3300003763 Bacteria 58992
16 Ga0055530_10015417 3300003791 Bacteria 2495
17 Ga0055540_1000229 3300003792 Bacteria 52012
18 Ga0055531_10000140 3300003794 Bacteria 82793
19 Ga0058692_1006666 3300003856 Bacteria 3142
20 Ga0065165_1000789 3300005262 Bacteria 42391
21 Ga0065714_10002842 3300005288 Bacteria 13006
22 Ga0065714_10066993 3300005288 Bacteria 6022
23 Ga0065712_10113511 3300005290 Bacteria 1782
24 Ga0065715_10000901 3300005293 Bacteria 11411
25 Ga0070658_10180301 3300005327 Bacteria 1777
26 Ga0070665_100163899 3300005548 Bacteria 2225
27 Ga0068855_100082194 3300005563 Bacteria 3733
28 Ga0075432_10013513 3300006058 Bacteria 2773
29 Ga0075432_10146812 3300006058 Bacteria 903
30 Ga0075369_10083665 3300006186 Bacteria 1417
31 Ga0079104_1000285 3300006946 Bacteria 64757
32 Ga0105251_10000124 3300009011 Bacteria 77079
33 Ga0105251_10009119 3300009011 Bacteria 5899
34 Ga0105251_10016845 3300009011 Bacteria 3932
35 Ga0105251_10062689 3300009011 Bacteria 1745
36 Ga0105251_10100719 3300009011 Bacteria 1320
37 Ga0105244_10000053 3300009036 Bacteria 133900
38 Ga0105244_10001897 3300009036 Bacteria 16249
39 Ga0105244_10068651 3300009036 Bacteria 1771
40 Ga0105244_10097843 3300009036 Bacteria 1438
41 Ga0105244_10101493 3300009036 Bacteria 1407
42 Ga0105244_10105733 3300009036 Bacteria 1373
43 Ga0105244_10108358 3300009036 Bacteria 1354
44 Ga0105244_10149346 3300009036 Bacteria 1120
45 Ga0105250_10035181 3300009092 Bacteria 2009
46 Ga0105250_10048284 3300009092 Bacteria 1708
47 Ga0105243_10000133 3300009148 Bacteria 85133
48 Ga0105243_10002559 3300009148 Bacteria 15201
49 Ga0105243_10105900 3300009148 Bacteria 2343
50 Ga0105248_10074471 3300009177 Bacteria 3816
51 Ga0105249_10509945 3300009553 Bacteria 1249
52 Ga0157345_1000010 3300012498 Bacteria 53625
53 Ga0157373_10000311 3300013100 Bacteria 39322
54 Ga0157373_10000672 3300013100 Bacteria 26718
55 Ga0157373_10017233 3300013100 Bacteria 5260
56 Ga0157373_10053316 3300013100 Bacteria 2876
57 Ga0157373_10087888 3300013100 Bacteria 2190
58 Ga0157373_10237939 3300013100 Bacteria 1287
59 Ga0157371_10000730 3300013102 Bacteria 38386
60 Ga0157371_10003726 3300013102 Bacteria 13660
61 Ga0157370_10053876 3300013104 Bacteria 3835
62 Ga0157370_10064909 3300013104 Bacteria 3455
63 Ga0157370_10090265 3300013104 Bacteria 2877
64 Ga0157370_10095963 3300013104 Bacteria 2782
65 Ga0157369_10001717 3300013105 Bacteria 26675
66 Ga0157369_10011964 3300013105 Bacteria 9858
67 Ga0157369_10023273 3300013105 Bacteria 6901
68 Ga0157369_10201461 3300013105 Bacteria 2089
69 Ga0163162_10071390 3300013306 Bacteria 3525
70 Ga0157372_10003539 3300013307 Bacteria 16835
71 Ga0157372_10020323 3300013307 Bacteria 7162
72 Ga0157372_10096671 3300013307 Bacteria 3366
73 Ga0157375_10003511 3300013308 Bacteria 13597
74 Ga0157375_10165303 3300013308 Bacteria 2357
75 Ga0182008_10001305 3300014497 Bacteria 17029
76 Ga0182008_10007301 3300014497 Bacteria 6111
77 Ga0182008_10051392 3300014497 Bacteria 2044
78 Ga0182008_10094761 3300014497 Bacteria 1473
79 Ga0182006_1000259 3300015261 Bacteria 48611
80 Ga0182006_1005747 3300015261 Bacteria 5854
81 Ga0182006_1010009 3300015261 Bacteria 4230
82 Ga0182006_1016082 3300015261 Bacteria 3197
83 Ga0182006_1025853 3300015261 Bacteria 2409
84 Ga0182006_1035255 3300015261 Bacteria 1997
85 Ga0182007_10001758 3300015262 Bacteria 11378
86 Ga0182007_10007208 3300015262 Bacteria 4686
87 Ga0182007_10083808 3300015262 Bacteria 1047
88 Ga0182005_1001180 3300015265 Bacteria 10801
89 Ga0182005_1001799 3300015265 Bacteria 8211
90 Ga0182005_1009459 3300015265 Bacteria 2835
91 Ga0182005_1050489 3300015265 Bacteria 1131
92 Ga0183361_10006 3300016635 Bacteria 368532
93 Ga0163161_10000469 3300017792 Bacteria 33513
94 Ga0163161_10002500 3300017792 Bacteria 13110
95 Ga0163161_10016164 3300017792 Bacteria 5209
96 Ga0163161_10041371 3300017792 Bacteria 3312
97 Ga0163161_10184380 3300017792 Bacteria 1602
98 Ga0163161_10190611 3300017792 Bacteria 1576
99 Ga0163161_10255502 3300017792 Bacteria 1367
100 Ga0163161_10265609 3300017792 Bacteria 1341
101 Ga0209760_100084 3300025207 Bacteria 75138
102 Ga0209566_100352 3300025225 Bacteria 39223
103 Ga0209672_100081 3300025228 Bacteria 142296
104 Ga0209672_101226 3300025228 Bacteria 10354
105 Ga0209147_100102 3300025229 Bacteria 159415
106 Ga0209147_100124 3300025229 Bacteria 133627
107 Ga0209563_100322 3300025230 Bacteria 18881
108 Ga0207427_100007 3300025231 Bacteria 746220
109 Ga0209437_100006 3300025233 Bacteria 1042724
110 Ga0209258_100131 3300025242 Bacteria 175316
111 Ga0209148_1000130 3300025254 Bacteria 175316
112 Ga0209233_1000059 3300025261 Bacteria 414562
113 Ga0209565_1011659 3300025263 Bacteria 2127
114 Ga0209455_1000118 3300025272 Bacteria 175316
115 Ga0209673_1000028 3300025273 Bacteria 358901
116 Ga0209675_1008548 3300025291 Bacteria 3743
117 Ga0209676_1000010 3300025292 Bacteria 954025
118 Ga0209676_1001599 3300025292 Bacteria 20145
119 Ga0209676_1001982 3300025292 Bacteria 16296
120 Ga0209564_1004215 3300025295 Bacteria 8959
121 Ga0209050_1000019 3300025298 Bacteria 608757
122 Ga0209050_1001159 3300025298 Bacteria 31450
123 Ga0207426_1000125 3300025302 Bacteria 217504
124 Ga0209051_1000238 3300025303 Bacteria 92629
125 Ga0209051_1002663 3300025303 Bacteria 12493
126 Ga0209257_1000119 3300025304 Bacteria 225893
127 Ga0207696_1000179 3300025711 Bacteria 99732
128 Ga0207696_1000474 3300025711 Bacteria 34199
129 Ga0207696_1003414 3300025711 Bacteria 7253
130 Ga0207696_1012275 3300025711 Bacteria 3036
131 Ga0207696_1020029 3300025711 Bacteria 2163
132 Ga0207696_1043977 3300025711 Bacteria 1297
133 Ga0207655_1000049 3300025728 Bacteria 295872
134 Ga0207655_1000437 3300025728 Bacteria 55747
135 Ga0207655_1003954 3300025728 Bacteria 10745
136 Ga0207655_1011153 3300025728 Bacteria 5376
137 Ga0207655_1011550 3300025728 Bacteria 5247
138 Ga0207655_1013904 3300025728 Bacteria 4585
139 Ga0207655_1028544 3300025728 Bacteria 2631
140 Ga0207655_1030276 3300025728 Bacteria 2519
141 Ga0207655_1036683 3300025728 Bacteria 2171
142 Ga0207655_1041297 3300025728 Bacteria 1978
143 Ga0207655_1060284 3300025728 Bacteria 1472
144 Ga0207655_1067720 3300025728 Bacteria 1343
145 Ga0207713_1000219 3300025735 Bacteria 77126
146 Ga0207713_1000322 3300025735 Bacteria 54257
147 Ga0207713_1001158 3300025735 Bacteria 22280
148 Ga0207713_1007092 3300025735 Bacteria 6704
149 Ga0207713_1014348 3300025735 Bacteria 4122
150 Ga0207713_1075901 3300025735 Bacteria 1225
151 Ga0207713_1108296 3300025735 Bacteria 949
152 Ga0207647_10007136 3300025904 Bacteria 8101
153 Ga0207705_10156140 3300025909 Bacteria 1712
154 Ga0207706_10002046 3300025933 Bacteria 19776
155 Ga0207709_10000013 3300025935 Bacteria 531977
156 Ga0207709_10000296 3300025935 Bacteria 55698
157 Ga0207709_10020767 3300025935 Bacteria 3709
158 Ga0207709_10126369 3300025935 Bacteria 1735
159 Ga0207711_10039704 3300025941 Bacteria 4004
160 Ga0207667_10035616 3300025949 Bacteria 5339
161 Ga0207712_10320008 3300025961 Bacteria 1279
162 Ga0209281_1000013 3300027111 Bacteria 653449
163 Ga0209281_1007856 3300027111 Bacteria 2640
164 Ga0209371_1000195 3300027312 Bacteria 89403
165 Ga0209371_1000326 3300027312 Bacteria 52194
166 Ga0209371_1000446 3300027312 Bacteria 41253
167 Ga0207428_10009548 3300027907 Bacteria 8693
168 Ga0207428_10134971 3300027907 Bacteria 1887
169 Ga0207428_10145629 3300027907 Bacteria 1806
170 Ga0207428_10186143 3300027907 Bacteria 1567
171 Ga0207428_10309227 3300027907 Bacteria 1169
172 Ga0268266_10400088 3300028379 Bacteria 1298
173 Ga0265338_10000045 3300028800 Bacteria 223264
174 Ga0268256_1000134 3300030500 Bacteria 102725
175 Ga0268256_1000168 3300030500 Bacteria 81587
176 Ga0268256_1000382 3300030500 Bacteria 41253
177 Ga0307511_10151860 3300030521 Bacteria 1327
178 Ga0316178_1018055 3300030735 Bacteria 9187
179 Ga0316183_1156053 3300030742 Bacteria 3167
180 Ga0265332_10022915 3300031238 Bacteria 2755
181 Ga0307408_100001237 3300031548 Bacteria 19178
182 Ga0307408_100003660 3300031548 Bacteria 10474
183 Ga0307408_100178381 3300031548 Bacteria 1701
184 Ga0307405_10001160 3300031731 Bacteria 10826
185 Ga0307405_10003535 3300031731 Bacteria 7200
186 Ga0307405_10014540 3300031731 Bacteria 4235
187 Ga0307406_10006514 3300031901 Bacteria 6451
188 Ga0307406_10574777 3300031901 Bacteria 925
189 Ga0307407_10003333 3300031903 Bacteria 6564
190 Ga0307407_10209811 3300031903 Bacteria 1310
191 Ga0307412_10000577 3300031911 Bacteria 21796
192 Ga0307412_10025970 3300031911 Bacteria 3635
193 Ga0307412_10031846 3300031911 Bacteria 3334
194 Ga0307416_100061798 3300032002 Bacteria 3059
195 Ga0307416_100160353 3300032002 Bacteria 2078
196 Ga0307414_10018307 3300032004 Bacteria 4308
197 Ga0307414_10027034 3300032004 Bacteria 3701
198 Ga0307414_10112965 3300032004 Bacteria 2072
199 Ga0307414_10246130 3300032004 Bacteria 1483
200 Ga0307411_10008595 3300032005 Bacteria 5302
201 Ga0307411_10102194 3300032005 Bacteria 2030
202 Ga0307411_10181061 3300032005 Bacteria 1599
203 Ga0307510_10001045 3300033180 Bacteria 29367
204 Ga0307510_10055904 3300033180 Bacteria 4117
205 Ga0307510_10241994 3300033180 Bacteria 1298
206 Ga0395898_0380235 3300037466 Bacteria 1347
207 Ga0395905_0000076 3300037471 Bacteria 164190
208 Ga0439438_000189 3300041405 Bacteria 27725
209 Ga0439438_000276 3300041405 Bacteria 23108
210 Ga0439438_001012 3300041405 Bacteria 12542
211 Ga0439438_002308 3300041405 Bacteria 8160
212 Ga0439438_002423 3300041405 Bacteria 7944
213 Ga0439438_002988 3300041405 Bacteria 6982
214 Ga0439438_017083 3300041405 Bacteria 2097
215 Ga0439438_029636 3300041405 Bacteria 1463
216 Ga0439447_003254 3300041407 Bacteria 5774
217 Ga0439447_012130 3300041407 Bacteria 2489
218 Ga0439447_019196 3300041407 Bacteria 1825
219 Ga0439447_030707 3300041407 Bacteria 1352
220 Ga0439466_0002173 3300041411 Bacteria 7689
221 Ga0439466_0002558 3300041411 Bacteria 7126
222 Ga0439466_0010518 3300041411 Bacteria 3439
223 Ga0439466_0040358 3300041411 Bacteria 1560
224 Ga0439466_0087203 3300041411 Bacteria 980
225 Ga0439432_001693 3300042006 Bacteria 8256
226 Ga0439432_005446 3300042006 Bacteria 4580
227 Ga0439432_007406 3300042006 Bacteria 3890
228 Ga0439432_008285 3300042006 Bacteria 3654
229 Ga0439432_012954 3300042006 Bacteria 2840
230 Ga0439451_002707 3300042009 Bacteria 3598
231 Ga0439451_009495 3300042009 Bacteria 1969
232 Ga0439452_000182 3300042010 Bacteria 47292
233 Ga0439452_000198 3300042010 Bacteria 43963
234 Ga0439452_002790 3300042010 Bacteria 6316
235 Ga0439452_003400 3300042010 Bacteria 5581
236 Ga0439452_011244 3300042010 Bacteria 2578
237 Ga0439452_012299 3300042010 Bacteria 2440
238 Ga0439456_002249 3300042013 Bacteria 3888
239 Ga0439456_006123 3300042013 Bacteria 2448
240 Ga0439456_026042 3300042013 Bacteria 1243
241 Ga0439456_031681 3300042013 Bacteria 1133
242 Ga0439463_000277 3300042016 Bacteria 14187
243 Ga0439463_004565 3300042016 Bacteria 3469
244 Ga0450911_000585 3300042115 Bacteria 11220
245 Ga0450911_007934 3300042115 Bacteria 1524
246 Ga0450920_002009 3300042122 Bacteria 3435
247 Ga0450904_001098 3300042139 Bacteria 4156
248 Ga0450905_002207 3300042142 Bacteria 2493
249 Ga0450906_002793 3300042145 Bacteria 3807
250 Ga0450906_013073 3300042145 Bacteria 1534
251 Ga0450907_000017 3300042146 Bacteria 83894
252 Ga0450907_000656 3300042146 Bacteria 9087
253 Ga0450910_003923 3300042147 Bacteria 1995
254 Ga0439446_0022255 3300042156 Bacteria 1796
255 Ga0450909_004321 3300042185 Bacteria 2027
256 Ga0450909_008449 3300042185 Bacteria 1498
257 Ga0439434_0000313 3300042435 Bacteria 13787
258 Ga0439464_0015463 3300042439 Bacteria 2059
259 Ga0439460_0001972 3300042461 Bacteria 4910
260 Ga0450893_0001832 3300042532 Bacteria 3277
261 Ga0450901_003638 3300042533 Bacteria 1606
262 Ga0439440_0008706 3300042993 Bacteria 2088
263 Ga0466982_0063869 3300044672 Bacteria 2268
264 Ga0466966_0098498 3300044684 Bacteria 1810
265 Ga0466961_0000500 3300044693 Bacteria 25029
266 Ga0466970_0263860 3300044765 Bacteria 966
267 Ga0466957_0080863 3300044842 Bacteria 2023
268 Ga0466960_0003644 3300044901 Bacteria 5943
269 Ga0495617_014741 3300046452 Bacteria 2654
270 Ga0495617_017653 3300046452 Bacteria 2412
271 Ga0495617_022272 3300046452 Bacteria 2141
272 Ga0495617_051847 3300046452 Bacteria 1363
273 Ga0495617_084724 3300046452 Bacteria 1037
274 Ga0495627_000502 3300046453 Bacteria 32804
275 Ga0495627_000657 3300046453 Bacteria 26626
276 Ga0495627_001776 3300046453 Bacteria 11569
277 Ga0495627_006169 3300046453 Bacteria 4724
278 Ga0495627_009699 3300046453 Bacteria 3533
279 Ga0495603_0056409 3300046455 Bacteria 2325
280 Ga0495603_0063611 3300046455 Bacteria 2176
281 Ga0495603_0154027 3300046455 Bacteria 1334
282 Ga0495590_0007780 3300046457 Bacteria 4113
283 Ga0495590_0010666 3300046457 Bacteria 3444
284 Ga0495590_0012255 3300046457 Bacteria 3184
285 Ga0495590_0017613 3300046457 Bacteria 2569
286 Ga0495590_0018736 3300046457 Bacteria 2476
287 Ga0495590_0029350 3300046457 Bacteria 1928
288 Ga0495590_0032741 3300046457 Bacteria 1818
289 Ga0495590_0063801 3300046457 Bacteria 1289
290 Ga0495591_000226 3300046458 Bacteria 55990
291 Ga0495591_000347 3300046458 Bacteria 41024
292 Ga0495591_000414 3300046458 Bacteria 35561
293 Ga0495591_001045 3300046458 Bacteria 18641
294 Ga0495591_004233 3300046458 Bacteria 7112
295 Ga0495591_004888 3300046458 Bacteria 6374
296 Ga0495591_010805 3300046458 Bacteria 3504
297 Ga0495591_011161 3300046458 Bacteria 3421
298 Ga0495591_011437 3300046458 Bacteria 3362
299 Ga0495591_014559 3300046458 Bacteria 2822
300 Ga0495591_018095 3300046458 Bacteria 2398
301 Ga0495591_018245 3300046458 Bacteria 2383
302 Ga0495591_032757 3300046458 Bacteria 1543
303 Ga0495591_036105 3300046458 Bacteria 1441
304 Ga0495629_0000054 3300046459 Bacteria 106374
305 Ga0495638_0000974 3300046460 Bacteria 28825
306 Ga0495638_0034516 3300046460 Bacteria 3229
307 Ga0495638_0037590 3300046460 Bacteria 3079
308 Ga0495638_0046395 3300046460 Bacteria 2729
309 Ga0495638_0061828 3300046460 Bacteria 2312
310 Ga0495638_0063703 3300046460 Bacteria 2272
311 Ga0495638_0069068 3300046460 Bacteria 2165
312 Ga0495638_0075031 3300046460 Bacteria 2061
313 Ga0495638_0125280 3300046460 Bacteria 1514
314 Ga0495653_0000099 3300046463 Bacteria 71802
315 Ga0495653_0011756 3300046463 Bacteria 7149
316 Ga0495653_0081696 3300046463 Bacteria 2387
317 Ga0495653_0106933 3300046463 Bacteria 2016
318 Ga0495650_0001114 3300046471 Bacteria 29356
319 Ga0495650_0001703 3300046471 Bacteria 20212
320 Ga0495650_0013408 3300046471 Bacteria 4334
321 Ga0495650_0020415 3300046471 Bacteria 3231
322 Ga0495650_0026717 3300046471 Bacteria 2678
323 Ga0495650_0032411 3300046471 Bacteria 2336
324 Ga0495650_0039434 3300046471 Bacteria 2038
325 Ga0495650_0089936 3300046471 Bacteria 1169
326 Ga0495580_0000594 3300046472 Bacteria 30607
327 Ga0495580_0007041 3300046472 Bacteria 9068
328 Ga0495580_0008413 3300046472 Bacteria 8208
329 Ga0495580_0009363 3300046472 Bacteria 7705
330 Ga0495580_0013815 3300046472 Bacteria 6147
331 Ga0495605_0000016 3300046474 Bacteria 289508
332 Ga0495605_0000031 3300046474 Bacteria 213242
333 Ga0495605_0000523 3300046474 Bacteria 32529
334 Ga0495605_0001023 3300046474 Bacteria 18826
335 Ga0495605_0001085 3300046474 Bacteria 18130
336 Ga0495605_0001270 3300046474 Bacteria 16722
337 Ga0495605_0003972 3300046474 Bacteria 8740
338 Ga0495605_0008760 3300046474 Bacteria 5708
339 Ga0495605_0020784 3300046474 Bacteria 3485
340 Ga0495605_0028661 3300046474 Bacteria 2872
341 Ga0495605_0059564 3300046474 Bacteria 1833
342 Ga0495605_0091644 3300046474 Bacteria 1407
343 Ga0495662_0024204 3300046476 Bacteria 2930
344 Ga0495664_0032174 3300046477 Bacteria 3077
345 Ga0495584_0000180 3300046491 Bacteria 44615
346 Ga0495584_0000427 3300046491 Bacteria 29042
347 Ga0495584_0003008 3300046491 Bacteria 9349
348 Ga0495584_0008038 3300046491 Bacteria 5483
349 Ga0495584_0025198 3300046491 Bacteria 3015
350 Ga0495584_0028994 3300046491 Bacteria 2805
351 Ga0495584_0061704 3300046491 Bacteria 1884
352 Ga0495584_0105980 3300046491 Bacteria 1421
353 Ga0495584_0127443 3300046491 Bacteria 1290
354 Ga0495585_0026441 3300046492 Bacteria 3313
355 Ga0495585_0031898 3300046492 Bacteria 2988
356 Ga0495585_0109072 3300046492 Bacteria 1474
357 Ga0495585_0134860 3300046492 Bacteria 1297
358 Ga0495585_0136495 3300046492 Bacteria 1287
359 Ga0495585_0227522 3300046492 Bacteria 939
360 Ga0495594_0000448 3300046499 Bacteria 20894
361 Ga0495594_0085605 3300046499 Bacteria 1763
362 Ga0495596_0026721 3300046500 Bacteria 2324
363 Ga0495596_0027662 3300046500 Bacteria 2278
364 Ga0495607_0000305 3300046501 Bacteria 51421
365 Ga0495607_0000372 3300046501 Bacteria 46245
366 Ga0495607_0000780 3300046501 Bacteria 30486
367 Ga0495607_0004132 3300046501 Bacteria 10828
368 Ga0495607_0012558 3300046501 Bacteria 5585
369 Ga0495607_0013981 3300046501 Bacteria 5240
370 Ga0495607_0019008 3300046501 Bacteria 4368
371 Ga0495607_0022066 3300046501 Bacteria 4002
372 Ga0495607_0024487 3300046501 Bacteria 3762
373 Ga0495607_0035208 3300046501 Bacteria 3030
374 Ga0495607_0062443 3300046501 Bacteria 2111
375 Ga0495607_0096963 3300046501 Bacteria 1586
376 Ga0495607_0150726 3300046501 Bacteria 1190
377 Ga0495607_0153926 3300046501 Bacteria 1174
378 Ga0495583_0000041 3300046506 Bacteria 234707
379 Ga0495583_0000572 3300046506 Bacteria 50655
380 Ga0495583_0001141 3300046506 Bacteria 28937
381 Ga0495583_0001653 3300046506 Bacteria 21659
382 Ga0495583_0004682 3300046506 Bacteria 9643
383 Ga0495583_0006028 3300046506 Bacteria 8032
384 Ga0495583_0007804 3300046506 Bacteria 6650
385 Ga0495583_0011771 3300046506 Bacteria 5004
386 Ga0495583_0018460 3300046506 Bacteria 3671
387 Ga0495583_0026897 3300046506 Bacteria 2845
388 Ga0495583_0053569 3300046506 Bacteria 1830
389 Ga0495606_0000022 3300046507 Bacteria 265567
390 Ga0495606_0000567 3300046507 Bacteria 58569
391 Ga0495606_0000574 3300046507 Bacteria 58351
392 Ga0495606_0001959 3300046507 Bacteria 25412
393 Ga0495606_0002039 3300046507 Bacteria 24754
394 Ga0495606_0004659 3300046507 Bacteria 13563
395 Ga0495606_0004718 3300046507 Bacteria 13435
396 Ga0495606_0013593 3300046507 Bacteria 6420
397 Ga0495606_0019059 3300046507 Bacteria 5121
398 Ga0495606_0033634 3300046507 Bacteria 3533
399 Ga0495606_0076054 3300046507 Bacteria 2099
400 Ga0495606_0151858 3300046507 Bacteria 1358
401 Ga0495610_0001181 3300046512 Bacteria 23629
402 Ga0495610_0002573 3300046512 Bacteria 15076
403 Ga0495610_0008362 3300046512 Bacteria 6716
404 Ga0495610_0011077 3300046512 Bacteria 5539
405 Ga0495610_0022590 3300046512 Bacteria 3436
406 Ga0495610_0028907 3300046512 Bacteria 2926
407 Ga0495610_0043121 3300046512 Bacteria 2250
408 Ga0495610_0054461 3300046512 Bacteria 1932
409 Ga0495610_0095448 3300046512 Bacteria 1340
410 Ga0495616_0000337 3300046513 Bacteria 37139
411 Ga0495616_0000862 3300046513 Bacteria 22037
412 Ga0495616_0001325 3300046513 Bacteria 17295
413 Ga0495616_0014179 3300046513 Bacteria 4470
414 Ga0495616_0033514 3300046513 Bacteria 2675
415 Ga0495616_0037740 3300046513 Bacteria 2483
416 Ga0495616_0099236 3300046513 Bacteria 1367
417 Ga0495616_0101928 3300046513 Bacteria 1345
418 Ga0495616_0104881 3300046513 Bacteria 1320
419 Ga0495620_0000015 3300046515 Bacteria 154625
420 Ga0495620_0000230 3300046515 Bacteria 41717
421 Ga0495620_0000333 3300046515 Bacteria 32903
422 Ga0495620_0000431 3300046515 Bacteria 27951
423 Ga0495620_0000861 3300046515 Bacteria 18784
424 Ga0495620_0004910 3300046515 Bacteria 7502
425 Ga0495620_0006451 3300046515 Bacteria 6445
426 Ga0495620_0038974 3300046515 Bacteria 2105
427 Ga0495620_0046047 3300046515 Bacteria 1885
428 Ga0495620_0058258 3300046515 Bacteria 1617
429 Ga0495620_0069701 3300046515 Bacteria 1441
430 Ga0495620_0072124 3300046515 Bacteria 1410
431 Ga0495628_0002119 3300046516 Bacteria 17974
432 Ga0495628_0034694 3300046516 Bacteria 4057
433 Ga0495630_0005613 3300046517 Bacteria 8862
434 Ga0495630_0025466 3300046517 Bacteria 4375
435 Ga0495630_0030332 3300046517 Bacteria 4022
436 Ga0495630_0041149 3300046517 Bacteria 3451
437 Ga0495630_0053191 3300046517 Bacteria 3031
438 Ga0495630_0089773 3300046517 Bacteria 2321
439 Ga0495631_0000992 3300046518 Bacteria 17612
440 Ga0495631_0001406 3300046518 Bacteria 14634
441 Ga0495631_0015535 3300046518 Bacteria 3645
442 Ga0495631_0016980 3300046518 Bacteria 3452
443 Ga0495631_0017642 3300046518 Bacteria 3372
444 Ga0495631_0028423 3300046518 Bacteria 2550
445 Ga0495631_0046854 3300046518 Bacteria 1899
446 Ga0495631_0076873 3300046518 Bacteria 1440
447 Ga0495631_0135319 3300046518 Bacteria 1058
448 Ga0495632_0000502 3300046519 Bacteria 36868
449 Ga0495632_0000815 3300046519 Bacteria 27584
450 Ga0495632_0001297 3300046519 Bacteria 21153
451 Ga0495632_0004282 3300046519 Bacteria 9743
452 Ga0495632_0012510 3300046519 Bacteria 4892
453 Ga0495632_0020825 3300046519 Bacteria 3543
454 Ga0495632_0038276 3300046519 Bacteria 2429
455 Ga0495632_0097324 3300046519 Bacteria 1389
456 Ga0495632_0107905 3300046519 Bacteria 1308
457 Ga0495637_0000146 3300046520 Bacteria 53551
458 Ga0495637_0000252 3300046520 Bacteria 42250
459 Ga0495637_0000485 3300046520 Bacteria 28934
460 Ga0495637_0000519 3300046520 Bacteria 27987
461 Ga0495637_0014606 3300046520 Bacteria 3702
462 Ga0495637_0023023 3300046520 Bacteria 2835
463 Ga0495637_0028219 3300046520 Bacteria 2507
464 Ga0495637_0028241 3300046520 Bacteria 2506
465 Ga0495637_0043281 3300046520 Bacteria 1923
466 Ga0495637_0055894 3300046520 Bacteria 1635
467 Ga0495637_0075018 3300046520 Bacteria 1357
468 Ga0495637_0091449 3300046520 Bacteria 1199
469 Ga0495643_0001102 3300046522 Bacteria 26873
470 Ga0495643_0007052 3300046522 Bacteria 7298
471 Ga0495643_0011746 3300046522 Bacteria 5313
472 Ga0495643_0020805 3300046522 Bacteria 3775
473 Ga0495643_0030130 3300046522 Bacteria 3031
474 Ga0495643_0035482 3300046522 Bacteria 2746
475 Ga0495643_0071517 3300046522 Bacteria 1820
476 Ga0495643_0088337 3300046522 Bacteria 1602
477 Ga0495644_0000198 3300046523 Bacteria 28286
478 Ga0495644_0041458 3300046523 Bacteria 1733
479 Ga0495644_0052607 3300046523 Bacteria 1529
480 Ga0495648_0000190 3300046524 Bacteria 70740
481 Ga0495648_0001670 3300046524 Bacteria 21519
482 Ga0495648_0003838 3300046524 Bacteria 13040
483 Ga0495648_0005693 3300046524 Bacteria 10304
484 Ga0495648_0008646 3300046524 Bacteria 7982
485 Ga0495648_0028705 3300046524 Bacteria 3701
486 Ga0495648_0029963 3300046524 Bacteria 3604
487 Ga0495648_0042161 3300046524 Bacteria 2873
488 Ga0495648_0046672 3300046524 Bacteria 2682
489 Ga0495648_0057182 3300046524 Bacteria 2341
490 Ga0495648_0060617 3300046524 Bacteria 2250
491 Ga0495648_0068862 3300046524 Bacteria 2062
492 Ga0495648_0075820 3300046524 Bacteria 1932
493 Ga0495648_0095894 3300046524 Bacteria 1649
494 Ga0495648_0122439 3300046524 Bacteria 1395
495 Ga0495648_0147351 3300046524 Bacteria 1231
496 Ga0495648_0148053 3300046524 Bacteria 1227
497 Ga0495666_0000221 3300046526 Bacteria 24316
498 Ga0495666_0002081 3300046526 Bacteria 9911
499 Ga0495666_0026057 3300046526 Bacteria 2885
500 Ga0495666_0035081 3300046526 Bacteria 2446
501 Ga0495642_0001710 3300046528 Bacteria 9462
502 Ga0495642_0008921 3300046528 Bacteria 3837
503 Ga0495654_0000235 3300046530 Bacteria 51932
504 Ga0495654_0000402 3300046530 Bacteria 36997
505 Ga0495654_0002359 3300046530 Bacteria 12202
506 Ga0495654_0003822 3300046530 Bacteria 9105
507 Ga0495654_0004187 3300046530 Bacteria 8632
508 Ga0495654_0008650 3300046530 Bacteria 5610
509 Ga0495654_0010543 3300046530 Bacteria 5029
510 Ga0495654_0012874 3300046530 Bacteria 4484
511 Ga0495654_0017898 3300046530 Bacteria 3718
512 Ga0495654_0025989 3300046530 Bacteria 3014
513 Ga0495654_0028688 3300046530 Bacteria 2843
514 Ga0495654_0038332 3300046530 Bacteria 2397
515 Ga0495654_0078966 3300046530 Bacteria 1546
516 Ga0495654_0094289 3300046530 Bacteria 1385
517 Ga0495654_0156293 3300046530 Bacteria 1004
518 Ga0495665_0019037 3300046531 Bacteria 3690
519 Ga0495665_0045425 3300046531 Bacteria 2333
520 Ga0495587_0001393 3300046536 Bacteria 16085
521 Ga0495587_0002294 3300046536 Bacteria 12811
522 Ga0495609_0000014 3300046538 Bacteria 326023
523 Ga0495609_0000015 3300046538 Bacteria 322474
524 Ga0495609_0000070 3300046538 Bacteria 128181
525 Ga0495609_0000197 3300046538 Bacteria 60324
526 Ga0495609_0013308 3300046538 Bacteria 3890
527 Ga0495609_0013528 3300046538 Bacteria 3850
528 Ga0495609_0021687 3300046538 Bacteria 2963
529 Ga0495609_0038268 3300046538 Bacteria 2163
530 Ga0495609_0075978 3300046538 Bacteria 1472
531 Ga0495609_0089101 3300046538 Bacteria 1342
532 Ga0495609_0092496 3300046538 Bacteria 1315
533 Ga0495609_0112171 3300046538 Bacteria 1176
534 Ga0495609_0145566 3300046538 Bacteria 1009
535 Ga0495597_0001637 3300046542 Bacteria 15663
536 Ga0495597_0003829 3300046542 Bacteria 8547
537 Ga0495597_0006001 3300046542 Bacteria 6332
538 Ga0495597_0036741 3300046542 Bacteria 2203
539 Ga0495597_0057371 3300046542 Bacteria 1704
540 Ga0495597_0064393 3300046542 Bacteria 1592
541 Ga0495622_0001636 3300046557 Bacteria 11065
542 Ga0495622_0004664 3300046557 Bacteria 6353
543 Ga0495622_0004946 3300046557 Bacteria 6172
544 Ga0495622_0056237 3300046557 Bacteria 1824
545 Ga0495622_0078472 3300046557 Bacteria 1520
546 Ga0495622_0090294 3300046557 Bacteria 1407
547 Ga0495633_0000060 3300046558 Bacteria 144561
548 Ga0495633_0001653 3300046558 Bacteria 16807
549 Ga0495633_0036153 3300046558 Bacteria 2368
550 Ga0495633_0052676 3300046558 Bacteria 1916
551 Ga0495633_0071730 3300046558 Bacteria 1615
552 Ga0495656_0072710 3300046615 Bacteria 1531
553 Ga0495656_0114591 3300046615 Bacteria 1265
554 Ga0495668_0007155 3300046616 Bacteria 7174
555 Ga0495668_0023080 3300046616 Bacteria 3551
556 Ga0495668_0024704 3300046616 Bacteria 3417
557 Ga0495634_0001985 3300046642 Bacteria 17420
558 Ga0495611_0000094 3300046648 Bacteria 61349
559 Ga0495611_0005536 3300046648 Bacteria 5392
560 Ga0495611_0005691 3300046648 Bacteria 5319
561 Ga0495611_0036842 3300046648 Bacteria 2172
562 Ga0495611_0058614 3300046648 Bacteria 1746
563 Ga0495611_0067453 3300046648 Bacteria 1632
564 Ga0495611_0083521 3300046648 Bacteria 1471
565 Ga0495625_0000354 3300046660 Bacteria 69894
566 Ga0495625_0004035 3300046660 Bacteria 14033
567 Ga0495625_0013054 3300046660 Bacteria 6696
568 Ga0495625_0035522 3300046660 Bacteria 3673
569 Ga0495625_0082585 3300046660 Bacteria 2234
570 Ga0495625_0148581 3300046660 Bacteria 1576
571 Ga0495625_0184742 3300046660 Bacteria 1384
572 Ga0495625_0212657 3300046660 Bacteria 1270
573 Ga0495625_0236712 3300046660 Bacteria 1190
574 Ga0495635_0001016 3300046663 Bacteria 18525
575 Ga0495635_0045009 3300046663 Bacteria 3044
576 Ga0495659_0048228 3300046664 Bacteria 1542
577 Ga0495661_0000110 3300046665 Bacteria 97854
578 Ga0495661_0000180 3300046665 Bacteria 72613
579 Ga0495661_0000185 3300046665 Bacteria 71615
580 Ga0495661_0000329 3300046665 Bacteria 51418
581 Ga0495661_0000803 3300046665 Bacteria 29661
582 Ga0495661_0004644 3300046665 Bacteria 9880
583 Ga0495661_0067426 3300046665 Bacteria 2102
584 Ga0495661_0143164 3300046665 Bacteria 1298
585 Ga0495588_0068800 3300046674 Bacteria 1839
586 Ga0495588_0072432 3300046674 Bacteria 1793
587 Ga0495657_0106488 3300046675 Bacteria 1780
588 Ga0495599_0024674 3300046678 Bacteria 3760
589 Ga0495623_0000884 3300046679 Bacteria 20323
590 Ga0495623_0002201 3300046679 Bacteria 12978
591 Ga0495623_0002533 3300046679 Bacteria 12093
592 Ga0495623_0118152 3300046679 Bacteria 1600
593 Ga0495646_0009130 3300046680 Bacteria 6289
594 Ga0495646_0034366 3300046680 Bacteria 3148
595 Ga0495646_0067333 3300046680 Bacteria 2116
596 Ga0495669_0078622 3300046684 Bacteria 1511
597 Ga0495613_0027240 3300046689 Bacteria 4253
598 Ga0495613_0107054 3300046689 Bacteria 2017
599 Ga0495613_0251741 3300046689 Bacteria 1232
600 Ga0495624_0000296 3300046690 Bacteria 39250
601 Ga0495624_0005199 3300046690 Bacteria 9406
602 Ga0495624_0012568 3300046690 Bacteria 5780
603 Ga0495624_0020044 3300046690 Bacteria 4455
604 Ga0495670_0000233 3300046691 Bacteria 25407
605 Ga0495670_0003053 3300046691 Bacteria 8258
606 Ga0495670_0018119 3300046691 Bacteria 3467
607 Ga0495670_0058208 3300046691 Bacteria 1940
608 Ga0495670_0203681 3300046691 Bacteria 1048
609 Ga0495671_0000069 3300046692 Bacteria 98738
610 Ga0495671_0003043 3300046692 Bacteria 10417
611 Ga0495671_0004677 3300046692 Bacteria 8105
612 Ga0495671_0010107 3300046692 Bacteria 5246
613 Ga0495671_0022361 3300046692 Bacteria 3314
614 Ga0495671_0023762 3300046692 Bacteria 3200
615 Ga0495671_0058357 3300046692 Bacteria 1909
616 Ga0495671_0080258 3300046692 Bacteria 1598
617 Ga0495671_0105697 3300046692 Bacteria 1374
618 Ga0495671_0114872 3300046692 Bacteria 1314
619 Ga0495671_0125148 3300046692 Bacteria 1253
620 Ga0495649_0000420 3300046694 Bacteria 36874
621 Ga0495649_0000900 3300046694 Bacteria 23592
622 Ga0495649_0003545 3300046694 Bacteria 10486
623 Ga0495649_0013341 3300046694 Bacteria 4741
624 Ga0495649_0014290 3300046694 Bacteria 4557
625 Ga0495649_0017443 3300046694 Bacteria 4049
626 Ga0495649_0034773 3300046694 Bacteria 2772
627 Ga0495649_0059766 3300046694 Bacteria 2051
628 Ga0495649_0151830 3300046694 Bacteria 1216
629 Ga0495589_0000480 3300046794 Bacteria 28684
630 Ga0495589_0000496 3300046794 Bacteria 27951
631 Ga0495589_0002087 3300046794 Bacteria 11299
632 Ga0495589_0005297 3300046794 Bacteria 6814
633 Ga0495589_0038636 3300046794 Bacteria 2388
634 Ga0495589_0064514 3300046794 Bacteria 1795
635 Ga0495589_0100547 3300046794 Bacteria 1399
636 Ga0495600_0010631 3300046809 Bacteria 5718
637 Ga0495600_0041384 3300046809 Bacteria 3002
638 Ga0495600_0063181 3300046809 Bacteria 2419
639 Ga0495660_0001405 3300046810 Bacteria 16525
640 Ga0495660_0001621 3300046810 Bacteria 15107
641 Ga0495660_0003347 3300046810 Bacteria 9944
642 Ga0495660_0009593 3300046810 Bacteria 5642
643 Ga0495660_0011038 3300046810 Bacteria 5245
644 Ga0495660_0033621 3300046810 Bacteria 2873
645 Ga0495660_0065049 3300046810 Bacteria 1947
646 Ga0495660_0090796 3300046810 Bacteria 1588
647 Ga0495604_0001809 3300047317 Bacteria 17426
648 Ga0495604_0013801 3300047317 Bacteria 6442
649 Ga0495604_0016776 3300047317 Bacteria 5859
650 Ga0495604_0039684 3300047317 Bacteria 3699
651 Ga0495604_0045817 3300047317 Bacteria 3411
652 Ga0495604_0054424 3300047317 Bacteria 3087
653 Ga0495674_0009594 3300047319 Bacteria 9194
654 Ga0495674_0020324 3300047319 Bacteria 6149
655 Ga0495674_0025373 3300047319 Bacteria 5435
656 Ga0495674_0026993 3300047319 Bacteria 5252
657 Ga0495674_0027624 3300047319 Bacteria 5183
658 Ga0495674_0152169 3300047319 Bacteria 1939
659 Ga0495672_0000487 3300047320 Bacteria 46342
660 Ga0495672_0000645 3300047320 Bacteria 38766
661 Ga0495672_0000680 3300047320 Bacteria 37902
662 Ga0495672_0008214 3300047320 Bacteria 7739
663 Ga0495672_0016638 3300047320 Bacteria 4945
664 Ga0495672_0019069 3300047320 Bacteria 4535
665 Ga0495672_0019848 3300047320 Bacteria 4420
666 Ga0495672_0021118 3300047320 Bacteria 4251
667 Ga0495672_0025389 3300047320 Bacteria 3794
668 Ga0495672_0037650 3300047320 Bacteria 2957
669 Ga0495672_0044250 3300047320 Bacteria 2672
670 Ga0495672_0044854 3300047320 Bacteria 2649
671 Ga0495672_0125651 3300047320 Bacteria 1357
672 Ga0495672_0157562 3300047320 Bacteria 1171
673 Ga0495672_0182543 3300047320 Bacteria 1061
674 Ga0495672_0235124 3300047320 Bacteria 897
675 Ga0495676_0000081 3300047321 Bacteria 70377
676 Ga0495680_0003333 3300047322 Bacteria 15875
677 Ga0495680_0013929 3300047322 Bacteria 6994
678 Ga0495680_0047314 3300047322 Bacteria 3384
679 Ga0495680_0094603 3300047322 Bacteria 2235
680 Ga0495683_0000027 3300047323 Bacteria 153730
681 Ga0495683_0000135 3300047323 Bacteria 72196
682 Ga0495683_0000471 3300047323 Bacteria 31258
683 Ga0495683_0024392 3300047323 Bacteria 3104
684 Ga0495683_0035554 3300047323 Bacteria 2532
685 Ga0495683_0070075 3300047323 Bacteria 1722
686 Ga0495683_0070986 3300047323 Bacteria 1709
687 Ga0495683_0129842 3300047323 Bacteria 1189
688 Ga0495687_017683 3300047443 Bacteria 3544
689 Ga0495687_033263 3300047443 Bacteria 2341
690 Ga0495687_056572 3300047443 Bacteria 1635
691 Ga0495675_0001310 3300047444 Bacteria 15075
692 Ga0495675_0170489 3300047444 Bacteria 1337
693 Ga0495677_0027955 3300047445 Bacteria 2046
694 Ga0495677_0031168 3300047445 Bacteria 1941
695 Ga0495679_000110 3300047446 Bacteria 74091
696 Ga0495679_000186 3300047446 Bacteria 54909
697 Ga0495679_000246 3300047446 Bacteria 44791
698 Ga0495679_000775 3300047446 Bacteria 20284
699 Ga0495679_006642 3300047446 Bacteria 4947
700 Ga0495679_016313 3300047446 Bacteria 2690
701 Ga0495679_016880 3300047446 Bacteria 2628
702 Ga0495679_020174 3300047446 Bacteria 2325
703 Ga0495679_030995 3300047446 Bacteria 1729
704 Ga0495685_036396 3300047447 Bacteria 1690
705 Ga0495673_0000611 3300047469 Bacteria 35502
706 Ga0495673_0000613 3300047469 Bacteria 35247
707 Ga0495673_0000946 3300047469 Bacteria 26295
708 Ga0495673_0001275 3300047469 Bacteria 20727
709 Ga0495673_0002624 3300047469 Bacteria 12458
710 Ga0495673_0005054 3300047469 Bacteria 8074
711 Ga0495673_0007699 3300047469 Bacteria 6152
712 Ga0495673_0011445 3300047469 Bacteria 4769
713 Ga0495673_0014183 3300047469 Bacteria 4150
714 Ga0495673_0025348 3300047469 Bacteria 2849
715 Ga0495673_0027195 3300047469 Bacteria 2725
716 Ga0495673_0050394 3300047469 Bacteria 1827
717 Ga0495673_0090906 3300047469 Bacteria 1247
718 Ga0495673_0115760 3300047469 Bacteria 1066
719 Ga0495681_0000503 3300047470 Bacteria 29854
720 Ga0495681_0000950 3300047470 Bacteria 22262
721 Ga0495681_0001126 3300047470 Bacteria 20301
722 Ga0495681_0003859 3300047470 Bacteria 10362
723 Ga0495681_0011086 3300047470 Bacteria 5402
724 Ga0495681_0017071 3300047470 Bacteria 4044
725 Ga0495681_0026491 3300047470 Bacteria 3015
726 Ga0495681_0028912 3300047470 Bacteria 2844
727 Ga0495681_0064088 3300047470 Bacteria 1684
728 Ga0495681_0107476 3300047470 Bacteria 1212
729 Ga0495684_0268259 3300047471 Bacteria 1236
730 Ga0495686_0000012 3300047472 Bacteria 508428
731 Ga0495686_0001458 3300047472 Bacteria 25781
732 Ga0495686_0008877 3300047472 Bacteria 7312
733 Ga0495686_0015030 3300047472 Bacteria 5305
734 Ga0495686_0022026 3300047472 Bacteria 4220
735 Ga0495686_0025466 3300047472 Bacteria 3878
736 Ga0495686_0068210 3300047472 Bacteria 2194
737 Ga0495686_0097489 3300047472 Bacteria 1777
738 Ga0495686_0118747 3300047472 Bacteria 1578
739 Ga0495686_0126438 3300047472 Bacteria 1519
740 Ga0495593_0001027 3300047673 Bacteria 16375
741 Ga0495593_0005749 3300047673 Bacteria 7318
742 Ga0495593_0024606 3300047673 Bacteria 3336
743 Ga0495593_0034535 3300047673 Bacteria 2750
744 Ga0495593_0098826 3300047673 Bacteria 1498
745 Ga0495593_0107216 3300047673 Bacteria 1428
746 Ga0495593_0217878 3300047673 Bacteria 958
747 Ga0495602_0099636 3300048088 Bacteria 2388
748 Ga0495602_0230343 3300048088 Bacteria 1392
749 Ga0495614_0064177 3300048089 Bacteria 1579
750 Ga0495626_0000256 3300048091 Bacteria 60994
751 Ga0495626_0002346 3300048091 Bacteria 13339
752 Ga0495626_0010868 3300048091 Bacteria 4834
753 Ga0495626_0022642 3300048091 Bacteria 3101
754 Ga0495626_0026901 3300048091 Bacteria 2799
755 Ga0495626_0027428 3300048091 Bacteria 2769
756 Ga0495626_0079542 3300048091 Bacteria 1458
757 Ga0495626_0119387 3300048091 Bacteria 1135
758 Ga0496100_0000354 3300048903 Bacteria 22328
759 Ga0496101_0000527 3300048904 Bacteria 23690
760 Ga0496101_0191280 3300048904 Bacteria 1579
761 Ga0496101_0363666 3300048904 Bacteria 1137
762 Ga0496102_0000563 3300048905 Bacteria 39364
763 Ga0496102_0002557 3300048905 Bacteria 15519
764 Ga0496102_0144964 3300048905 Bacteria 2228
765 Ga0496103_0000752 3300048906 Bacteria 23872
766 Ga0496104_0037712 3300048907 Bacteria 4519
767 Ga0496104_0040778 3300048907 Bacteria 4352
768 Ga0496104_0287201 3300048907 Bacteria 1557
769 Ga0496105_0269813 3300048908 Bacteria 1374
770 Ga0496111_0133890 3300048914 Bacteria 1835
771 Ga0496111_0152976 3300048914 Bacteria 1711
772 Ga0496112_0007724 3300048915 Bacteria 9568
773 Ga0496112_0230769 3300048915 Bacteria 1805
774 Ga0496112_0346049 3300048915 Bacteria 1429
775 Ga0496113_0009043 3300048916 Bacteria 6524
776 Ga0496113_0071880 3300048916 Bacteria 2632
777 Ga0496113_0286823 3300048916 Bacteria 1317
778 Ga0496113_0343718 3300048916 Bacteria 1197
779 Ga0496115_0100202 3300048918 Bacteria 2375
780 Ga0496116_0000415 3300048919 Bacteria 60526
781 Ga0496116_0000638 3300048919 Bacteria 45765
782 Ga0496116_0026677 3300048919 Bacteria 4217
783 Ga0496116_0040432 3300048919 Bacteria 3211
784 Ga0496116_0111014 3300048919 Bacteria 1611
785 Ga0496117_0000266 3300048920 Bacteria 98856
786 Ga0496117_0000507 3300048920 Bacteria 64318
787 Ga0496117_0008301 3300048920 Bacteria 9882
788 Ga0496117_0053157 3300048920 Bacteria 2848
789 Ga0496117_0130103 3300048920 Bacteria 1527
790 Ga0496117_0142335 3300048920 Bacteria 1434
791 Ga0496118_0020834 3300048921 Bacteria 5801
792 Ga0496118_0050345 3300048921 Bacteria 3198
793 Ga0496118_0086228 3300048921 Bacteria 2182
794 Ga0496118_0139439 3300048921 Bacteria 1540
795 Ga0496118_0153498 3300048921 Bacteria 1437
796 Ga0496118_0163011 3300048921 Bacteria 1375
797 Ga0496118_0184982 3300048921 Bacteria 1253
798 Ga0496119_0000223 3300048922 Bacteria 79814
799 Ga0496119_0036446 3300048922 Bacteria 3210
800 Ga0496119_0233952 3300048922 Bacteria 933
801 Ga0496120_0000254 3300048923 Bacteria 89523
802 Ga0496120_0011371 3300048923 Bacteria 6122
803 Ga0496121_0003148 3300048924 Bacteria 23801
804 Ga0496121_0003838 3300048924 Bacteria 20899
805 Ga0496121_0006375 3300048924 Bacteria 14690
806 Ga0496121_0006873 3300048924 Bacteria 13909
807 Ga0496121_0028909 3300048924 Bacteria 5147
808 Ga0496121_0072840 3300048924 Bacteria 2756
809 Ga0496121_0160826 3300048924 Bacteria 1642
810 Ga0496121_0247972 3300048924 Bacteria 1236
811 Ga0496121_0280095 3300048924 Bacteria 1141
812 Ga0496121_0292848 3300048924 Bacteria 1108
813 Ga0496122_0001077 3300048925 Bacteria 47364
814 Ga0496122_0003544 3300048925 Bacteria 20415
815 Ga0496122_0038158 3300048925 Bacteria 3854
816 Ga0496122_0040109 3300048925 Bacteria 3726
817 Ga0496122_0056309 3300048925 Bacteria 2932
818 Ga0496122_0150655 3300048925 Bacteria 1436
819 Ga0496122_0201445 3300048925 Bacteria 1163
820 Ga0496122_0228716 3300048925 Bacteria 1059
821 Ga0496123_0001931 3300048926 Bacteria 27034
822 Ga0496123_0009796 3300048926 Bacteria 8561
823 Ga0496123_0033254 3300048926 Bacteria 3713
824 Ga0496123_0050957 3300048926 Bacteria 2761
825 Ga0496123_0066875 3300048926 Bacteria 2274
826 Ga0496123_0084712 3300048926 Bacteria 1910
827 Ga0496123_0197249 3300048926 Bacteria 1035
828 Ga0496124_0000222 3300048927 Bacteria 110854
829 Ga0496124_0000537 3300048927 Bacteria 64567
830 Ga0496124_0001864 3300048927 Bacteria 29037
831 Ga0496124_0005123 3300048927 Bacteria 14925
832 Ga0496124_0005908 3300048927 Bacteria 13545
833 Ga0496124_0122676 3300048927 Bacteria 2074
834 Ga0496124_0181960 3300048927 Bacteria 1616
835 Ga0496124_0276782 3300048927 Bacteria 1226
836 Ga0496125_0000565 3300048928 Bacteria 63608
837 Ga0496125_0081717 3300048928 Bacteria 2467
838 Ga0496125_0185508 3300048928 Bacteria 1380
839 Ga0496126_0011328 3300048929 Bacteria 9245
840 Ga0496126_0338010 3300048929 Bacteria 1234
841 Ga0466983_0065679 3300048986 Bacteria 3045
842 Ga0495678_000031 3300049459 Bacteria 215528
843 Ga0495678_000039 3300049459 Bacteria 191665
844 Ga0495678_001875 3300049459 Bacteria 15281
845 Ga0495678_003174 3300049459 Bacteria 10359
846 Ga0495678_016209 3300049459 Bacteria 3413
847 Ga0495678_017566 3300049459 Bacteria 3237
848 Ga0495678_022461 3300049459 Bacteria 2758
849 Ga0495678_022746 3300049459 Bacteria 2736
850 Ga0495678_039511 3300049459 Bacteria 1903
851 Ga0495678_045556 3300049459 Bacteria 1729
852 Ga0495678_055025 3300049459 Bacteria 1520
853 Ga0495678_080206 3300049459 Bacteria 1173
854 Ga0495682_0000300 3300049460 Bacteria 37560
855 Ga0495682_0000765 3300049460 Bacteria 20604
856 Ga0495682_0001588 3300049460 Bacteria 11806
857 Ga0495682_0013710 3300049460 Bacteria 3081
858 Ga0495682_0023668 3300049460 Bacteria 2291
859 Ga0495682_0077171 3300049460 Bacteria 1198
860 Ga0501031_0068038 3300049568 Bacteria 2320
861 Ga0501034_0115534 3300049571 Bacteria 2672
862 Ga0501222_001005 3300049662 Bacteria 4017
863 Ga0501227_000772 3300049665 Bacteria 6981
864 Ga0501241_000077 3300049758 Bacteria 22143
865 Ga0501226_000674 3300049853 Bacteria 4636
866 Ga0500572_000450 3300053111 Bacteria 14295
867 Ga0500618_010032 3300053125 Bacteria 2557
868 Ga0500634_0000121 3300053161 Bacteria 29459
869 637322234 637000220 Bacteria 7074893
870 2501074096 2501025501 Bacteria 7768574
871 2501083696 2501025502 Bacteria 9641094
872 2501413225 2501025504 Bacteria 8008976
873 2511087474 2510917013 Bacteria 9951648
874 2511100332 2510917014 Bacteria 8296963
875 2511106003 2510917015 Bacteria 7950052
876 2511274484 2511231007 Bacteria 6306603
877 2511289192 2511231010 Bacteria 6373152
878 2511298188 2511231011 Bacteria 6149768
879 2511301962 2511231012 Bacteria 6738011
880 2511313428 2511231014 Bacteria 6462302
881 2511321253 2511231015 Bacteria 6598026
882 2511334801 2511231017 Bacteria 6503007
883 2511339986 2511231018 Bacteria 6436256
884 2511346748 2511231019 Bacteria 6520662
885 2511348570 2511231020 Bacteria 6115223
886 2511355051 2511231021 Bacteria 7302637
887 2511414808 2511231031 Bacteria 6558529
888 2513551916 2513237082 Bacteria 8640282
889 2513563314 2513237083 Bacteria 8410967
890 2514054155 2513237166 Bacteria 10373764
891 2516017820 2515154189 Bacteria 9629850
892 2519458766 2519103095 Bacteria 6629912
893 2554813711 2554235132 Bacteria 6772433
894 2555671823 2554235341 Bacteria 6867980
895 2563058672 2562617112 Bacteria 10918404
896 2585292415 2582581311 Bacteria 6763856
897 2597869296 2597489889 Bacteria 6297495
898 2599354021 2599185160 Bacteria 6844013
899 2599360300 2599185161 Bacteria 6960462
900 2599366622 2599185162 Bacteria 6957254
901 2599373411 2599185163 Bacteria 6995158
902 2599379129 2599185164 Bacteria 6841688
903 2599385893 2599185165 Bacteria 6843250
904 2599392270 2599185166 Bacteria 6959206
905 2599404036 2599185168 Bacteria 6997636
906 2599460855 2599185181 Bacteria 6844519
907 2599470402 2599185182 Bacteria 6883168
908 2599489876 2599185186 Bacteria 6831633
909 2599740635 2599185239 Bacteria 8686614
910 2599975359 2599185307 Bacteria 6194719
911 2600213470 2599185356 Bacteria 6843884
912 2601625711 2600255283 Bacteria 6061572
913 2601773637 2600255313 Bacteria 6842543
914 2601796832 2600255318 Bacteria 6383414
915 2606073982 2603880185 Bacteria 6379190
916 2606126373 2603880199 Bacteria 6377649
917 2608381126 2606217733 Bacteria 6360972
918 2624482529 2623620443 Bacteria 6427864
919 2643844301 2643221565 Bacteria 6216018
920 2643952257 2643221589 Bacteria 6250934
921 2644023981 2643221602 Bacteria 6249926
922 2644187132 2643221633 Bacteria 6733554
923 2644622581 2643221713 Bacteria 6554480
924 2671096603 2667528171 Bacteria 6900659
925 2713476679 2711768613 Bacteria 11048459
926 2715750521 2713897148 Bacteria 5883533
927 2715755076 2713897149 Bacteria 6506249
928 2718635731 2718217725 Bacteria 5758958
929 2739256817 2738543015 Bacteria 6750701
930 2739315576 2738543025 Bacteria 6600348
931 2746089321 2744054900 Bacteria 8399525
932 2746099483 2744054901 Bacteria 8397047
933 2774123014 2773857670 Bacteria 6407454
934 2774128528 2773857672 Bacteria 4993178
935 2774133408 2773857673 Bacteria 6513460
936 2784262712 2784132063 Bacteria 6262788
937 2784315372 2784132072 Bacteria 6596533
938 2808930421 2808606377 Bacteria 6646337
939 2808952543 2808606381 Bacteria 6646461
940 2808960464 2808606382 Bacteria 6841132
941 2808973219 2808606384 Bacteria 8474373
942 2809008843 2808606390 Bacteria 8476311
943 2809015048 2808606391 Bacteria 8308166
944 2809218405 2808606445 Bacteria 6057339
945 2812370976 2811994881 Bacteria 6298475
946 2817261038 2816332253 Bacteria 6764532
947 2817278733 2816332256 Bacteria 6891714
948 2817451808 2816332286 Bacteria 6853759
949 2819637102 2818991452 Bacteria 8442785
950 2819656211 2818991456 Bacteria 6123676
951 2819701696 2818991464 Bacteria 6907494
952 2842327792 2842324504 Bacteria 9364110
953 2842351600 2842348783 Bacteria 9002918
954 2842460588 2842454564 Bacteria 8730687
955 2842837379 2842832357 Bacteria 5959113
956 2842845172 2842843487 Bacteria 6004777
957 2842860062 2842854478 Bacteria 6143501
958 2844665981 2844665904 Bacteria 6817974
959 2852660731 2852657418 Bacteria 6472974
960 2856291101 2856287931 Bacteria 7223934
961 2857364139 2857357740 Bacteria 9937880
962 2860341393 2860339153 Bacteria 6846989
963 2878034458 2878029506 Bacteria 6418441
964 2880235102 2880230671 Bacteria 6140320
965 2883090844 2883087390 Bacteria 9532701
966 2904521471 2904518522 Bacteria 6068986
967 2904551156 2904550169 Bacteria 6221258
968 2904565230 2904564687 Bacteria 7609577
969 2904572074 2904571731 Bacteria 7608790
970 2908447878 2908446538 Bacteria 6829095
971 2917075694 2917070673 Bacteria 6868303
972 2919066483 2919063839 Bacteria 6302690
973 2919158304 2919155634 Bacteria 4860545
974 2919459500 2919456309 Bacteria 6586567
975 2919490157 2919487758 Bacteria 5929766
976 2921651820 2921643360 Bacteria 11448031
977 2923525083 2923519811 Bacteria 6298479
978 2928160363 2928157003 Bacteria 7522202
979 2928170600 2928163908 Bacteria 7561269
980 2928176649 2928170801 Bacteria 8785406
981 2928537393 2928536128 Bacteria 7657547
982 2929192498 2929189879 Bacteria 5930554
983 2931397140 2931396565 Bacteria 7251677
984 2935356683 2935353572 Unclassified 6955622
985 2939638072 2939636861 Bacteria 6297853
986 2945929510 2945928738 Bacteria 6053221
987 2945965789 2945961074 Bacteria 7342064
988 2946011784 2946006987 Bacteria 6705746
989 2969309239 2969304461 Bacteria 6601805
990 2981996322 2981990288 Bacteria 7590678
991 2984501670 2984499530 Bacteria 5020881
992 2998144515 2998139840 Bacteria 6073514
993 3007319332 3007315729 Bacteria 5076637
994 3007424900 3007419365 Bacteria 7026924
995 3007516311 3007511990 Bacteria 6481491
996 3007623355 3007619802 Bacteria 6411688
997 3007720259 3007718800 Bacteria 5971527
998 3007858501 3007855910 Bacteria 5637581
999 3007865974 3007861166 Bacteria 6045338
1000 3007871107 3007866637 Bacteria 5899198
1001 642418967 641736154 Bacteria 7689995
1002 8003957083 8003955200 Bacteria 8601927
1003 8011356606 8011350971 Bacteria 6158957
1004 8018845647 8018845410 Bacteria 8933938
1005 8020813255 8020807995 Bacteria 6801506
1006 8021123093 8021120328 Bacteria 8782274
1007 8029996368 8029995093 Bacteria 5990776
1008 8040169982 8040167225 Bacteria 6542727
1009 8040173447 8040173305 Bacteria 6827067
1010 8055273594 8055266321 Bacteria 7999742
1011 8055819097 8055817908 Bacteria 6609162
1012 8056127142 8056125926 Bacteria 6228218
1013 8056148065 8056143049 Bacteria 6307666
1014 8056154705 8056148874 Bacteria 6479865
1015 8056166829 8056161164 Bacteria 6106669
1016 8056172061 8056166840 Bacteria 5820959
1017 8056180516 8056177738 Bacteria 6748268
1018 MRS2a_Contig_175
1019 MRS2a_Contig_977
1020 JGI24739J22299_10015584
1021 JGI25162J39368_1000034
1022 JGI25163J39215_1000345
1023 JGI25164J39214_1000018
1024 JGI25165J46597_1000123
1025 rootL2_10084227
1026 JGI25160J50197_1000151
1027 Ga0055532_1000392
1028 Ga0055532_1000449
1029 Ga0055527_1000492
1030 Ga0055535_1000254
1031 Ga0055542_1000291
1032 Ga0055529_1000290
1033 Ga0055530_10015417
1034 Ga0055540_1000229
1035 Ga0055531_10000140
1036 Ga0058692_1006666
1037 Ga0065165_1000789
1038 Ga0065714_10002842
1039 Ga0065714_10066993
1040 Ga0065712_10113511
1041 Ga0065715_10000901
1042 Ga0070658_10180301
1043 Ga0070665_100163899
1044 Ga0068855_100082194
1045 Ga0075432_10013513
1046 Ga0075432_10146812
1047 Ga0075369_10083665
1048 Ga0079104_1000285
1049 Ga0105251_10000124
1050 Ga0105251_10009119
1051 Ga0105251_10016845
1052 Ga0105251_10062689
1053 Ga0105251_10100719
1054 Ga0105244_10000053
1055 Ga0105244_10001897
1056 Ga0105244_10068651
1057 Ga0105244_10097843
1058 Ga0105244_10101493
1059 Ga0105244_10105733
1060 Ga0105244_10108358
1061 Ga0105244_10149346
1062 Ga0105250_10035181
1063 Ga0105250_10048284
1064 Ga0105243_10000133
1065 Ga0105243_10002559
1066 Ga0105243_10105900
1067 Ga0105248_10074471
1068 Ga0105249_10509945
1069 Ga0157345_1000010
1070 Ga0157373_10000311
1071 Ga0157373_10000672
1072 Ga0157373_10017233
1073 Ga0157373_10053316
1074 Ga0157373_10087888
1075 Ga0157373_10237939
1076 Ga0157371_10000730
1077 Ga0157371_10003726
1078 Ga0157370_10053876
1079 Ga0157370_10064909
1080 Ga0157370_10090265
1081 Ga0157370_10095963
1082 Ga0157369_10001717
1083 Ga0157369_10011964
1084 Ga0157369_10023273
1085 Ga0157369_10201461
1086 Ga0163162_10071390
1087 Ga0157372_10003539
1088 Ga0157372_10020323
1089 Ga0157372_10096671
1090 Ga0157375_10003511
1091 Ga0157375_10165303
1092 Ga0182008_10001305
1093 Ga0182008_10007301
1094 Ga0182008_10051392
1095 Ga0182008_10094761
1096 Ga0182006_1000259
1097 Ga0182006_1005747
1098 Ga0182006_1010009
1099 Ga0182006_1016082
1100 Ga0182006_1025853
1101 Ga0182006_1035255
1102 Ga0182007_10001758
1103 Ga0182007_10007208
1104 Ga0182007_10083808
1105 Ga0182005_1001180
1106 Ga0182005_1001799
1107 Ga0182005_1009459
1108 Ga0182005_1050489
1109 Ga0183361_10006
1110 Ga0163161_10000469
1111 Ga0163161_10002500
1112 Ga0163161_10016164
1113 Ga0163161_10041371
1114 Ga0163161_10184380
1115 Ga0163161_10190611
1116 Ga0163161_10255502
1117 Ga0163161_10265609
1118 Ga0209760_100084
1119 Ga0209566_100352
1120 Ga0209672_100081
1121 Ga0209672_101226
1122 Ga0209147_100102
1123 Ga0209147_100124
1124 Ga0209563_100322
1125 Ga0207427_100007
1126 Ga0209437_100006
1127 Ga0209258_100131
1128 Ga0209148_1000130
1129 Ga0209233_1000059
1130 Ga0209565_1011659
1131 Ga0209455_1000118
1132 Ga0209673_1000028
1133 Ga0209675_1008548
1134 Ga0209676_1000010
1135 Ga0209676_1001599
1136 Ga0209676_1001982
1137 Ga0209564_1004215
1138 Ga0209050_1000019
1139 Ga0209050_1001159
1140 Ga0207426_1000125
1141 Ga0209051_1000238
1142 Ga0209051_1002663
1143 Ga0209257_1000119
1144 Ga0207696_1000179
1145 Ga0207696_1000474
1146 Ga0207696_1003414
1147 Ga0207696_1012275
1148 Ga0207696_1020029
1149 Ga0207696_1043977
1150 Ga0207655_1000049
1151 Ga0207655_1000437
1152 Ga0207655_1003954
1153 Ga0207655_1011153
1154 Ga0207655_1011550
1155 Ga0207655_1013904
1156 Ga0207655_1028544
1157 Ga0207655_1030276
1158 Ga0207655_1036683
1159 Ga0207655_1041297
1160 Ga0207655_1060284
1161 Ga0207655_1067720
1162 Ga0207713_1000219
1163 Ga0207713_1000322
1164 Ga0207713_1001158
1165 Ga0207713_1007092
1166 Ga0207713_1014348
1167 Ga0207713_1075901
1168 Ga0207713_1108296
1169 Ga0207647_10007136
1170 Ga0207705_10156140
1171 Ga0207706_10002046
1172 Ga0207709_10000013
1173 Ga0207709_10000296
1174 Ga0207709_10020767
1175 Ga0207709_10126369
1176 Ga0207711_10039704
1177 Ga0207667_10035616
1178 Ga0207712_10320008
1179 Ga0209281_1000013
1180 Ga0209281_1007856
1181 Ga0209371_1000195
1182 Ga0209371_1000326
1183 Ga0209371_1000446
1184 Ga0207428_10009548
1185 Ga0207428_10134971
1186 Ga0207428_10145629
1187 Ga0207428_10186143
1188 Ga0207428_10309227
1189 Ga0268266_10400088
1190 Ga0265338_10000045
1191 Ga0268256_1000134
1192 Ga0268256_1000168
1193 Ga0268256_1000382
1194 Ga0307511_10151860
1195 Ga0316178_1018055
1196 Ga0316183_1156053
1197 Ga0265332_10022915
1198 Ga0307408_100001237
1199 Ga0307408_100003660
1200 Ga0307408_100178381
1201 Ga0307405_10001160
1202 Ga0307405_10003535
1203 Ga0307405_10014540
1204 Ga0307406_10006514
1205 Ga0307406_10574777
1206 Ga0307407_10003333
1207 Ga0307407_10209811
1208 Ga0307412_10000577
1209 Ga0307412_10025970
1210 Ga0307412_10031846
1211 Ga0307416_100061798
1212 Ga0307416_100160353
1213 Ga0307414_10018307
1214 Ga0307414_10027034
1215 Ga0307414_10112965
1216 Ga0307414_10246130
1217 Ga0307411_10008595
1218 Ga0307411_10102194
1219 Ga0307411_10181061
1220 Ga0307510_10001045
1221 Ga0307510_10055904
1222 Ga0307510_10241994
1223 Ga0395898_0380235
1224 Ga0395905_0000076
1225 Ga0439438_000189
1226 Ga0439438_000276
1227 Ga0439438_001012
1228 Ga0439438_002308
1229 Ga0439438_002423
1230 Ga0439438_002988
1231 Ga0439438_017083
1232 Ga0439438_029636
1233 Ga0439447_003254
1234 Ga0439447_012130
1235 Ga0439447_019196
1236 Ga0439447_030707
1237 Ga0439466_0002173
1238 Ga0439466_0002558
1239 Ga0439466_0010518
1240 Ga0439466_0040358
1241 Ga0439466_0087203
1242 Ga0439432_001693
1243 Ga0439432_005446
1244 Ga0439432_007406
1245 Ga0439432_008285
1246 Ga0439432_012954
1247 Ga0439451_002707
1248 Ga0439451_009495
1249 Ga0439452_000182
1250 Ga0439452_000198
1251 Ga0439452_002790
1252 Ga0439452_003400
1253 Ga0439452_011244
1254 Ga0439452_012299
1255 Ga0439456_002249
1256 Ga0439456_006123
1257 Ga0439456_026042
1258 Ga0439456_031681
1259 Ga0439463_000277
1260 Ga0439463_004565
1261 Ga0450911_000585
1262 Ga0450911_007934
1263 Ga0450920_002009
1264 Ga0450904_001098
1265 Ga0450905_002207
1266 Ga0450906_002793
1267 Ga0450906_013073
1268 Ga0450907_000017
1269 Ga0450907_000656
1270 Ga0450910_003923
1271 Ga0439446_0022255
1272 Ga0450909_004321
1273 Ga0450909_008449
1274 Ga0439434_0000313
1275 Ga0439464_0015463
1276 Ga0439460_0001972
1277 Ga0450893_0001832
1278 Ga0450901_003638
1279 Ga0439440_0008706
1280 Ga0466982_0063869
1281 Ga0466966_0098498
1282 Ga0466961_0000500
1283 Ga0466970_0263860
1284 Ga0466957_0080863
1285 Ga0466960_0003644
1286 Ga0495617_014741
1287 Ga0495617_017653
1288 Ga0495617_022272
1289 Ga0495617_051847
1290 Ga0495617_084724
1291 Ga0495627_000502
1292 Ga0495627_000657
1293 Ga0495627_001776
1294 Ga0495627_006169
1295 Ga0495627_009699
1296 Ga0495603_0056409
1297 Ga0495603_0063611
1298 Ga0495603_0154027
1299 Ga0495590_0007780
1300 Ga0495590_0010666
1301 Ga0495590_0012255
1302 Ga0495590_0017613
1303 Ga0495590_0018736
1304 Ga0495590_0029350
1305 Ga0495590_0032741
1306 Ga0495590_0063801
1307 Ga0495591_000226
1308 Ga0495591_000347
1309 Ga0495591_000414
1310 Ga0495591_001045
1311 Ga0495591_004233
1312 Ga0495591_004888
1313 Ga0495591_010805
1314 Ga0495591_011161
1315 Ga0495591_011437
1316 Ga0495591_014559
1317 Ga0495591_018095
1318 Ga0495591_018245
1319 Ga0495591_032757
1320 Ga0495591_036105
1321 Ga0495629_0000054
1322 Ga0495638_0000974
1323 Ga0495638_0034516
1324 Ga0495638_0037590
1325 Ga0495638_0046395
1326 Ga0495638_0061828
1327 Ga0495638_0063703
1328 Ga0495638_0069068
1329 Ga0495638_0075031
1330 Ga0495638_0125280
1331 Ga0495653_0000099
1332 Ga0495653_0011756
1333 Ga0495653_0081696
1334 Ga0495653_0106933
1335 Ga0495650_0001114
1336 Ga0495650_0001703
1337 Ga0495650_0013408
1338 Ga0495650_0020415
1339 Ga0495650_0026717
1340 Ga0495650_0032411
1341 Ga0495650_0039434
1342 Ga0495650_0089936
1343 Ga0495580_0000594
1344 Ga0495580_0007041
1345 Ga0495580_0008413
1346 Ga0495580_0009363
1347 Ga0495580_0013815
1348 Ga0495605_0000016
1349 Ga0495605_0000031
1350 Ga0495605_0000523
1351 Ga0495605_0001023
1352 Ga0495605_0001085
1353 Ga0495605_0001270
1354 Ga0495605_0003972
1355 Ga0495605_0008760
1356 Ga0495605_0020784
1357 Ga0495605_0028661
1358 Ga0495605_0059564
1359 Ga0495605_0091644
1360 Ga0495662_0024204
1361 Ga0495664_0032174
1362 Ga0495584_0000180
1363 Ga0495584_0000427
1364 Ga0495584_0003008
1365 Ga0495584_0008038
1366 Ga0495584_0025198
1367 Ga0495584_0028994
1368 Ga0495584_0061704
1369 Ga0495584_0105980
1370 Ga0495584_0127443
1371 Ga0495585_0026441
1372 Ga0495585_0031898
1373 Ga0495585_0109072
1374 Ga0495585_0134860
1375 Ga0495585_0136495
1376 Ga0495585_0227522
1377 Ga0495594_0000448
1378 Ga0495594_0085605
1379 Ga0495596_0026721
1380 Ga0495596_0027662
1381 Ga0495607_0000305
1382 Ga0495607_0000372
1383 Ga0495607_0000780
1384 Ga0495607_0004132
1385 Ga0495607_0012558
1386 Ga0495607_0013981
1387 Ga0495607_0019008
1388 Ga0495607_0022066
1389 Ga0495607_0024487
1390 Ga0495607_0035208
1391 Ga0495607_0062443
1392 Ga0495607_0096963
1393 Ga0495607_0150726
1394 Ga0495607_0153926
1395 Ga0495583_0000041
1396 Ga0495583_0000572
1397 Ga0495583_0001141
1398 Ga0495583_0001653
1399 Ga0495583_0004682
1400 Ga0495583_0006028
1401 Ga0495583_0007804
1402 Ga0495583_0011771
1403 Ga0495583_0018460
1404 Ga0495583_0026897
1405 Ga0495583_0053569
1406 Ga0495606_0000022
1407 Ga0495606_0000567
1408 Ga0495606_0000574
1409 Ga0495606_0001959
1410 Ga0495606_0002039
1411 Ga0495606_0004659
1412 Ga0495606_0004718
1413 Ga0495606_0013593
1414 Ga0495606_0019059
1415 Ga0495606_0033634
1416 Ga0495606_0076054
1417 Ga0495606_0151858
1418 Ga0495610_0001181
1419 Ga0495610_0002573
1420 Ga0495610_0008362
1421 Ga0495610_0011077
1422 Ga0495610_0022590
1423 Ga0495610_0028907
1424 Ga0495610_0043121
1425 Ga0495610_0054461
1426 Ga0495610_0095448
1427 Ga0495616_0000337
1428 Ga0495616_0000862
1429 Ga0495616_0001325
1430 Ga0495616_0014179
1431 Ga0495616_0033514
1432 Ga0495616_0037740
1433 Ga0495616_0099236
1434 Ga0495616_0101928
1435 Ga0495616_0104881
1436 Ga0495620_0000015
1437 Ga0495620_0000230
1438 Ga0495620_0000333
1439 Ga0495620_0000431
1440 Ga0495620_0000861
1441 Ga0495620_0004910
1442 Ga0495620_0006451
1443 Ga0495620_0038974
1444 Ga0495620_0046047
1445 Ga0495620_0058258
1446 Ga0495620_0069701
1447 Ga0495620_0072124
1448 Ga0495628_0002119
1449 Ga0495628_0034694
1450 Ga0495630_0005613
1451 Ga0495630_0025466
1452 Ga0495630_0030332
1453 Ga0495630_0041149
1454 Ga0495630_0053191
1455 Ga0495630_0089773
1456 Ga0495631_0000992
1457 Ga0495631_0001406
1458 Ga0495631_0015535
1459 Ga0495631_0016980
1460 Ga0495631_0017642
1461 Ga0495631_0028423
1462 Ga0495631_0046854
1463 Ga0495631_0076873
1464 Ga0495631_0135319
1465 Ga0495632_0000502
1466 Ga0495632_0000815
1467 Ga0495632_0001297
1468 Ga0495632_0004282
1469 Ga0495632_0012510
1470 Ga0495632_0020825
1471 Ga0495632_0038276
1472 Ga0495632_0097324
1473 Ga0495632_0107905
1474 Ga0495637_0000146
1475 Ga0495637_0000252
1476 Ga0495637_0000485
1477 Ga0495637_0000519
1478 Ga0495637_0014606
1479 Ga0495637_0023023
1480 Ga0495637_0028219
1481 Ga0495637_0028241
1482 Ga0495637_0043281
1483 Ga0495637_0055894
1484 Ga0495637_0075018
1485 Ga0495637_0091449
1486 Ga0495643_0001102
1487 Ga0495643_0007052
1488 Ga0495643_0011746
1489 Ga0495643_0020805
1490 Ga0495643_0030130
1491 Ga0495643_0035482
1492 Ga0495643_0071517
1493 Ga0495643_0088337
1494 Ga0495644_0000198
1495 Ga0495644_0041458
1496 Ga0495644_0052607
1497 Ga0495648_0000190
1498 Ga0495648_0001670
1499 Ga0495648_0003838
1500 Ga0495648_0005693
1501 Ga0495648_0008646
1502 Ga0495648_0028705
1503 Ga0495648_0029963
1504 Ga0495648_0042161
1505 Ga0495648_0046672
1506 Ga0495648_0057182
1507 Ga0495648_0060617
1508 Ga0495648_0068862
1509 Ga0495648_0075820
1510 Ga0495648_0095894
1511 Ga0495648_0122439
1512 Ga0495648_0147351
1513 Ga0495648_0148053
1514 Ga0495666_0000221
1515 Ga0495666_0002081
1516 Ga0495666_0026057
1517 Ga0495666_0035081
1518 Ga0495642_0001710
1519 Ga0495642_0008921
1520 Ga0495654_0000235
1521 Ga0495654_0000402
1522 Ga0495654_0002359
1523 Ga0495654_0003822
1524 Ga0495654_0004187
1525 Ga0495654_0008650
1526 Ga0495654_0010543
1527 Ga0495654_0012874
1528 Ga0495654_0017898
1529 Ga0495654_0025989
1530 Ga0495654_0028688
1531 Ga0495654_0038332
1532 Ga0495654_0078966
1533 Ga0495654_0094289
1534 Ga0495654_0156293
1535 Ga0495665_0019037
1536 Ga0495665_0045425
1537 Ga0495587_0001393
1538 Ga0495587_0002294
1539 Ga0495609_0000014
1540 Ga0495609_0000015
1541 Ga0495609_0000070
1542 Ga0495609_0000197
1543 Ga0495609_0013308
1544 Ga0495609_0013528
1545 Ga0495609_0021687
1546 Ga0495609_0038268
1547 Ga0495609_0075978
1548 Ga0495609_0089101
1549 Ga0495609_0092496
1550 Ga0495609_0112171
1551 Ga0495609_0145566
1552 Ga0495597_0001637
1553 Ga0495597_0003829
1554 Ga0495597_0006001
1555 Ga0495597_0036741
1556 Ga0495597_0057371
1557 Ga0495597_0064393
1558 Ga0495622_0001636
1559 Ga0495622_0004664
1560 Ga0495622_0004946
1561 Ga0495622_0056237
1562 Ga0495622_0078472
1563 Ga0495622_0090294
1564 Ga0495633_0000060
1565 Ga0495633_0001653
1566 Ga0495633_0036153
1567 Ga0495633_0052676
1568 Ga0495633_0071730
1569 Ga0495656_0072710
1570 Ga0495656_0114591
1571 Ga0495668_0007155
1572 Ga0495668_0023080
1573 Ga0495668_0024704
1574 Ga0495634_0001985
1575 Ga0495611_0000094
1576 Ga0495611_0005536
1577 Ga0495611_0005691
1578 Ga0495611_0036842
1579 Ga0495611_0058614
1580 Ga0495611_0067453
1581 Ga0495611_0083521
1582 Ga0495625_0000354
1583 Ga0495625_0004035
1584 Ga0495625_0013054
1585 Ga0495625_0035522
1586 Ga0495625_0082585
1587 Ga0495625_0148581
1588 Ga0495625_0184742
1589 Ga0495625_0212657
1590 Ga0495625_0236712
1591 Ga0495635_0001016
1592 Ga0495635_0045009
1593 Ga0495659_0048228
1594 Ga0495661_0000110
1595 Ga0495661_0000180
1596 Ga0495661_0000185
1597 Ga0495661_0000329
1598 Ga0495661_0000803
1599 Ga0495661_0004644
1600 Ga0495661_0067426
1601 Ga0495661_0143164
1602 Ga0495588_0068800
1603 Ga0495588_0072432
1604 Ga0495657_0106488
1605 Ga0495599_0024674
1606 Ga0495623_0000884
1607 Ga0495623_0002201
1608 Ga0495623_0002533
1609 Ga0495623_0118152
1610 Ga0495646_0009130
1611 Ga0495646_0034366
1612 Ga0495646_0067333
1613 Ga0495669_0078622
1614 Ga0495613_0027240
1615 Ga0495613_0107054
1616 Ga0495613_0251741
1617 Ga0495624_0000296
1618 Ga0495624_0005199
1619 Ga0495624_0012568
1620 Ga0495624_0020044
1621 Ga0495670_0000233
1622 Ga0495670_0003053
1623 Ga0495670_0018119
1624 Ga0495670_0058208
1625 Ga0495670_0203681
1626 Ga0495671_0000069
1627 Ga0495671_0003043
1628 Ga0495671_0004677
1629 Ga0495671_0010107
1630 Ga0495671_0022361
1631 Ga0495671_0023762
1632 Ga0495671_0058357
1633 Ga0495671_0080258
1634 Ga0495671_0105697
1635 Ga0495671_0114872
1636 Ga0495671_0125148
1637 Ga0495649_0000420
1638 Ga0495649_0000900
1639 Ga0495649_0003545
1640 Ga0495649_0013341
1641 Ga0495649_0014290
1642 Ga0495649_0017443
1643 Ga0495649_0034773
1644 Ga0495649_0059766
1645 Ga0495649_0151830
1646 Ga0495589_0000480
1647 Ga0495589_0000496
1648 Ga0495589_0002087
1649 Ga0495589_0005297
1650 Ga0495589_0038636
1651 Ga0495589_0064514
1652 Ga0495589_0100547
1653 Ga0495600_0010631
1654 Ga0495600_0041384
1655 Ga0495600_0063181
1656 Ga0495660_0001405
1657 Ga0495660_0001621
1658 Ga0495660_0003347
1659 Ga0495660_0009593
1660 Ga0495660_0011038
1661 Ga0495660_0033621
1662 Ga0495660_0065049
1663 Ga0495660_0090796
1664 Ga0495604_0001809
1665 Ga0495604_0013801
1666 Ga0495604_0016776
1667 Ga0495604_0039684
1668 Ga0495604_0045817
1669 Ga0495604_0054424
1670 Ga0495674_0009594
1671 Ga0495674_0020324
1672 Ga0495674_0025373
1673 Ga0495674_0026993
1674 Ga0495674_0027624
1675 Ga0495674_0152169
1676 Ga0495672_0000487
1677 Ga0495672_0000645
1678 Ga0495672_0000680
1679 Ga0495672_0008214
1680 Ga0495672_0016638
1681 Ga0495672_0019069
1682 Ga0495672_0019848
1683 Ga0495672_0021118
1684 Ga0495672_0025389
1685 Ga0495672_0037650
1686 Ga0495672_0044250
1687 Ga0495672_0044854
1688 Ga0495672_0125651
1689 Ga0495672_0157562
1690 Ga0495672_0182543
1691 Ga0495672_0235124
1692 Ga0495676_0000081
1693 Ga0495680_0003333
1694 Ga0495680_0013929
1695 Ga0495680_0047314
1696 Ga0495680_0094603
1697 Ga0495683_0000027
1698 Ga0495683_0000135
1699 Ga0495683_0000471
1700 Ga0495683_0024392
1701 Ga0495683_0035554
1702 Ga0495683_0070075
1703 Ga0495683_0070986
1704 Ga0495683_0129842
1705 Ga0495687_017683
1706 Ga0495687_033263
1707 Ga0495687_056572
1708 Ga0495675_0001310
1709 Ga0495675_0170489
1710 Ga0495677_0027955
1711 Ga0495677_0031168
1712 Ga0495679_000110
1713 Ga0495679_000186
1714 Ga0495679_000246
1715 Ga0495679_000775
1716 Ga0495679_006642
1717 Ga0495679_016313
1718 Ga0495679_016880
1719 Ga0495679_020174
1720 Ga0495679_030995
1721 Ga0495685_036396
1722 Ga0495673_0000611
1723 Ga0495673_0000613
1724 Ga0495673_0000946
1725 Ga0495673_0001275
1726 Ga0495673_0002624
1727 Ga0495673_0005054
1728 Ga0495673_0007699
1729 Ga0495673_0011445
1730 Ga0495673_0014183
1731 Ga0495673_0025348
1732 Ga0495673_0027195
1733 Ga0495673_0050394
1734 Ga0495673_0090906
1735 Ga0495673_0115760
1736 Ga0495681_0000503
1737 Ga0495681_0000950
1738 Ga0495681_0001126
1739 Ga0495681_0003859
1740 Ga0495681_0011086
1741 Ga0495681_0017071
1742 Ga0495681_0026491
1743 Ga0495681_0028912
1744 Ga0495681_0064088
1745 Ga0495681_0107476
1746 Ga0495684_0268259
1747 Ga0495686_0000012
1748 Ga0495686_0001458
1749 Ga0495686_0008877
1750 Ga0495686_0015030
1751 Ga0495686_0022026
1752 Ga0495686_0025466
1753 Ga0495686_0068210
1754 Ga0495686_0097489
1755 Ga0495686_0118747
1756 Ga0495686_0126438
1757 Ga0495593_0001027
1758 Ga0495593_0005749
1759 Ga0495593_0024606
1760 Ga0495593_0034535
1761 Ga0495593_0098826
1762 Ga0495593_0107216
1763 Ga0495593_0217878
1764 Ga0495602_0099636
1765 Ga0495602_0230343
1766 Ga0495614_0064177
1767 Ga0495626_0000256
1768 Ga0495626_0002346
1769 Ga0495626_0010868
1770 Ga0495626_0022642
1771 Ga0495626_0026901
1772 Ga0495626_0027428
1773 Ga0495626_0079542
1774 Ga0495626_0119387
1775 Ga0496100_0000354
1776 Ga0496101_0000527
1777 Ga0496101_0191280
1778 Ga0496101_0363666
1779 Ga0496102_0000563
1780 Ga0496102_0002557
1781 Ga0496102_0144964
1782 Ga0496103_0000752
1783 Ga0496104_0037712
1784 Ga0496104_0040778
1785 Ga0496104_0287201
1786 Ga0496105_0269813
1787 Ga0496111_0133890
1788 Ga0496111_0152976
1789 Ga0496112_0007724
1790 Ga0496112_0230769
1791 Ga0496112_0346049
1792 Ga0496113_0009043
1793 Ga0496113_0071880
1794 Ga0496113_0286823
1795 Ga0496113_0343718
1796 Ga0496115_0100202
1797 Ga0496116_0000415
1798 Ga0496116_0000638
1799 Ga0496116_0026677
1800 Ga0496116_0040432
1801 Ga0496116_0111014
1802 Ga0496117_0000266
1803 Ga0496117_0000507
1804 Ga0496117_0008301
1805 Ga0496117_0053157
1806 Ga0496117_0130103
1807 Ga0496117_0142335
1808 Ga0496118_0020834
1809 Ga0496118_0050345
1810 Ga0496118_0086228
1811 Ga0496118_0139439
1812 Ga0496118_0153498
1813 Ga0496118_0163011
1814 Ga0496118_0184982
1815 Ga0496119_0000223
1816 Ga0496119_0036446
1817 Ga0496119_0233952
1818 Ga0496120_0000254
1819 Ga0496120_0011371
1820 Ga0496121_0003148
1821 Ga0496121_0003838
1822 Ga0496121_0006375
1823 Ga0496121_0006873
1824 Ga0496121_0028909
1825 Ga0496121_0072840
1826 Ga0496121_0160826
1827 Ga0496121_0247972
1828 Ga0496121_0280095
1829 Ga0496121_0292848
1830 Ga0496122_0001077
1831 Ga0496122_0003544
1832 Ga0496122_0038158
1833 Ga0496122_0040109
1834 Ga0496122_0056309
1835 Ga0496122_0150655
1836 Ga0496122_0201445
1837 Ga0496122_0228716
1838 Ga0496123_0001931
1839 Ga0496123_0009796
1840 Ga0496123_0033254
1841 Ga0496123_0050957
1842 Ga0496123_0066875
1843 Ga0496123_0084712
1844 Ga0496123_0197249
1845 Ga0496124_0000222
1846 Ga0496124_0000537
1847 Ga0496124_0001864
1848 Ga0496124_0005123
1849 Ga0496124_0005908
1850 Ga0496124_0122676
1851 Ga0496124_0181960
1852 Ga0496124_0276782
1853 Ga0496125_0000565
1854 Ga0496125_0081717
1855 Ga0496125_0185508
1856 Ga0496126_0011328
1857 Ga0496126_0338010
1858 Ga0466983_0065679
1859 Ga0495678_000031
1860 Ga0495678_000039
1861 Ga0495678_001875
1862 Ga0495678_003174
1863 Ga0495678_016209
1864 Ga0495678_017566
1865 Ga0495678_022461
1866 Ga0495678_022746
1867 Ga0495678_039511
1868 Ga0495678_045556
1869 Ga0495678_055025
1870 Ga0495678_080206
1871 Ga0495682_0000300
1872 Ga0495682_0000765
1873 Ga0495682_0001588
1874 Ga0495682_0013710
1875 Ga0495682_0023668
1876 Ga0495682_0077171
1877 Ga0501031_0068038
1878 Ga0501034_0115534
1879 Ga0501222_001005
1880 Ga0501227_000772
1881 Ga0501241_000077
1882 Ga0501226_000674
1883 Ga0500572_000450
1884 Ga0500618_010032
1885 Ga0500634_0000121
1886 637322234
1887 2501074096
1888 2501083696
1889 2501413225
1890 2511087474
1891 2511100332
1892 2511106003
1893 2511274484
1894 2511289192
1895 2511298188
1896 2511301962
1897 2511313428
1898 2511321253
1899 2511334801
1900 2511339986
1901 2511346748
1902 2511348570
1903 2511355051
1904 2511414808
1905 2513551916
1906 2513563314
1907 2514054155
1908 2516017820
1909 2519458766
1910 2554813711
1911 2555671823
1912 2563058672
1913 2585292415
1914 2597869296
1915 2599354021
1916 2599360300
1917 2599366622
1918 2599373411
1919 2599379129
1920 2599385893
1921 2599392270
1922 2599404036
1923 2599460855
1924 2599470402
1925 2599489876
1926 2599740635
1927 2599975359
1928 2600213470
1929 2601625711
1930 2601773637
1931 2601796832
1932 2606073982
1933 2606126373
1934 2608381126
1935 2624482529
1936 2643844301
1937 2643952257
1938 2644023981
1939 2644187132
1940 2644622581
1941 2671096603
1942 2713476679
1943 2715750521
1944 2715755076
1945 2718635731
1946 2739256817
1947 2739315576
1948 2746089321
1949 2746099483
1950 2774123014
1951 2774128528
1952 2774133408
1953 2784262712
1954 2784315372
1955 2808930421
1956 2808952543
1957 2808960464
1958 2808973219
1959 2809008843
1960 2809015048
1961 2809218405
1962 2812370976
1963 2817261038
1964 2817278733
1965 2817451808
1966 2819637102
1967 2819656211
1968 2819701696
1969 2842327792
1970 2842351600
1971 2842460588
1972 2842837379
1973 2842845172
1974 2842860062
1975 2844665981
1976 2852660731
1977 2856291101
1978 2857364139
1979 2860341393
1980 2878034458
1981 2880235102
1982 2883090844
1983 2904521471
1984 2904551156
1985 2904565230
1986 2904572074
1987 2908447878
1988 2917075694
1989 2919066483
1990 2919158304
1991 2919459500
1992 2919490157
1993 2921651820
1994 2923525083
1995 2928160363
1996 2928170600
1997 2928176649
1998 2928537393
1999 2929192498
2000 2931397140
2001 2935356683
2002 2939638072
2003 2945929510
2004 2945965789
2005 2946011784
2006 2969309239
2007 2981996322
2008 2984501670
2009 2998144515
2010 3007319332
2011 3007424900
2012 3007516311
2013 3007623355
2014 3007720259
2015 3007858501
2016 3007865974
2017 3007871107
2018 642418967
2019 8003957083
2020 8011356606
2021 8018845647
2022 8020813255
2023 8021123093
2024 8029996368
2025 8040169982
2026 8040173447
2027 8055273594
2028 8055819097
2029 8056127142
2030 8056148065
2031 8056154705
2032 8056166829
2033 8056172061
2034 8056180516

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

40

280

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p8k-assembly1.cif.gz_B crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus 0.9532 1 242
2e11-assembly2.cif.gz_D the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site 0.9385 1 255
5g3o-assembly1.cif.gz_E bacillus cereus formamidase (bceamif) inhibited with urea. 0.9283 1 242
2w1v-assembly1.cif.gz_B crystal structure of mouse nitrilase-2 at 1.4a resolution 0.9257 2 250
5g3p-assembly1.cif.gz_C bacillus cereus formamidase (bceamif) acetylated at the active site. 0.9251 1 243
ID Description Score Start End Superfamily
af_O59829_1_271_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.956 2 251 3.60.110.10
af_Q2FWM9_1_261_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.947 1 251 3.60.110.10
2e11D00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9385 1 255 3.60.110.10
af_Q9VHE4_6_282_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9314 1 250 3.60.110.10
af_Q47679_3_256_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9304 1 253 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A136QA53-F1-model_v4 deleted 0.9973 1 237
AF-Q9HY28-F1-model_v4 CN hydrolase domain-containing protein 0.9968 1 270 GO:0016787
AF-A0A3P0NXV4-F1-model_v4 Carbon-nitrogen hydrolase 0.9952 1 270 GO:0016787
AF-A0A6P3BAL8-F1-model_v4 Carbon-nitrogen hydrolase 0.9947 1 270 GO:0016811
AF-A0A364GRS6-F1-model_v4 (R)-amidase 0.9923 1 270 GO:0016787

Map