F488302
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1017 | 390 | 2034 | 274 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|637000220|637322234 |
| Length | 311 |
| Sequence | VIQRQCHASTPIGLPRLRDLRAGCCCAYCGTAKEQGIPMKVELAQLAGRDNATAYNLERALAAIAACAADTRLIVFPETHLMGFPSAETVAAVAEPLDGPTVQAVIQAARARNIAVVIGMAENDDGRFYNTTLLITPEGIALRYRKTHLWASDRGVFTPGDRYTTCLWNGVRVGLLICYDIEFPESARALAQLGAELLIVTNGNMDPYGPTHRTAIMARAQENQAFALMVNRVEEGDGGLLFAGGSALVDPLGSLLFEAGREEGQFKVELDLKQLQVARQDYRYLEDQRLKLAGEVLEHGDGVRELLIPIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 13 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 26 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 27 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 28 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 35 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 43 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 44 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 47 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 59 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 62 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 79 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 81 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 83 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 84 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 85 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 86 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 87 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 89 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 90 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 91 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 92 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 93 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 94 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 95 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 96 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 97 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 98 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 99 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 100 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 101 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 102 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 103 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 104 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 105 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 106 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 107 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 108 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 109 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 110 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 111 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 112 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 113 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 114 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 115 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 116 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 117 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 118 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 119 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 120 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 121 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 122 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 123 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 124 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 125 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 126 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 127 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 128 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 212 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 215 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 216 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 217 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 220 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 221 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 222 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 223 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 224 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 225 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 226 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 227 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 228 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 229 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 230 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 231 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 236 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 238 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 239 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 240 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 241 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 242 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 243 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 244 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 245 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 246 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 247 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 248 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 249 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 250 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 251 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 252 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 253 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 254 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 255 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 256 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 257 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 258 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 259 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 260 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 261 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 262 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 263 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 264 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 265 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 266 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 267 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 268 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 269 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 270 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 271 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 272 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 273 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 274 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 275 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 276 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 277 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 278 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 279 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 280 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 281 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 282 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 283 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 284 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 285 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 286 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 287 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 288 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 289 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 290 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 291 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 292 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 293 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 294 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 295 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 296 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 297 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 298 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 299 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 300 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 301 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 302 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 303 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 304 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 305 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 306 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 307 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 308 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 309 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 310 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 311 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 312 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 313 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 314 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 315 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 316 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 317 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 318 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 319 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 320 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 321 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 322 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 323 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 324 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 325 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 326 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 327 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 328 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 329 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 330 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 331 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 332 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 333 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 334 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 335 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 336 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 337 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 338 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 339 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 340 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 341 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 342 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 343 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 344 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 345 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 346 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 347 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 348 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 349 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 350 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 351 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 352 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 353 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 354 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 355 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 356 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 357 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 358 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 359 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 360 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 361 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 362 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 363 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 364 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 365 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 366 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 367 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 368 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 369 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 370 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 371 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 372 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 373 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 374 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 375 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 376 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 377 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 378 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 379 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 380 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 381 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 382 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 383 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 384 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 385 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 386 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 387 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 388 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 389 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 390 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.35 |
| Metatranscriptomes | 0 |
| Isolates | 14.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 4.42 |
| Nodule | 2.46 |
| Rhizoplane | 4.33 |
| Rhizosphere | 77.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_175 | 2124908027 | Bacteria | 28106 |
| 2 | MRS2a_Contig_977 | 2124908027 | Bacteria | 5437 |
| 3 | JGI24739J22299_10015584 | 3300001989 | Bacteria | 2761 |
| 4 | JGI25162J39368_1000034 | 3300002737 | Bacteria | 183428 |
| 5 | JGI25163J39215_1000345 | 3300002771 | Bacteria | 15362 |
| 6 | JGI25164J39214_1000018 | 3300002772 | Bacteria | 185215 |
| 7 | JGI25165J46597_1000123 | 3300003214 | Bacteria | 131481 |
| 8 | rootL2_10084227 | 3300003322 | Bacteria | 3665 |
| 9 | JGI25160J50197_1000151 | 3300003354 | Bacteria | 61351 |
| 10 | Ga0055532_1000392 | 3300003758 | Bacteria | 22046 |
| 11 | Ga0055532_1000449 | 3300003758 | Bacteria | 19192 |
| 12 | Ga0055527_1000492 | 3300003760 | Bacteria | 14185 |
| 13 | Ga0055535_1000254 | 3300003761 | Bacteria | 56175 |
| 14 | Ga0055542_1000291 | 3300003762 | Bacteria | 56190 |
| 15 | Ga0055529_1000290 | 3300003763 | Bacteria | 58992 |
| 16 | Ga0055530_10015417 | 3300003791 | Bacteria | 2495 |
| 17 | Ga0055540_1000229 | 3300003792 | Bacteria | 52012 |
| 18 | Ga0055531_10000140 | 3300003794 | Bacteria | 82793 |
| 19 | Ga0058692_1006666 | 3300003856 | Bacteria | 3142 |
| 20 | Ga0065165_1000789 | 3300005262 | Bacteria | 42391 |
| 21 | Ga0065714_10002842 | 3300005288 | Bacteria | 13006 |
| 22 | Ga0065714_10066993 | 3300005288 | Bacteria | 6022 |
| 23 | Ga0065712_10113511 | 3300005290 | Bacteria | 1782 |
| 24 | Ga0065715_10000901 | 3300005293 | Bacteria | 11411 |
| 25 | Ga0070658_10180301 | 3300005327 | Bacteria | 1777 |
| 26 | Ga0070665_100163899 | 3300005548 | Bacteria | 2225 |
| 27 | Ga0068855_100082194 | 3300005563 | Bacteria | 3733 |
| 28 | Ga0075432_10013513 | 3300006058 | Bacteria | 2773 |
| 29 | Ga0075432_10146812 | 3300006058 | Bacteria | 903 |
| 30 | Ga0075369_10083665 | 3300006186 | Bacteria | 1417 |
| 31 | Ga0079104_1000285 | 3300006946 | Bacteria | 64757 |
| 32 | Ga0105251_10000124 | 3300009011 | Bacteria | 77079 |
| 33 | Ga0105251_10009119 | 3300009011 | Bacteria | 5899 |
| 34 | Ga0105251_10016845 | 3300009011 | Bacteria | 3932 |
| 35 | Ga0105251_10062689 | 3300009011 | Bacteria | 1745 |
| 36 | Ga0105251_10100719 | 3300009011 | Bacteria | 1320 |
| 37 | Ga0105244_10000053 | 3300009036 | Bacteria | 133900 |
| 38 | Ga0105244_10001897 | 3300009036 | Bacteria | 16249 |
| 39 | Ga0105244_10068651 | 3300009036 | Bacteria | 1771 |
| 40 | Ga0105244_10097843 | 3300009036 | Bacteria | 1438 |
| 41 | Ga0105244_10101493 | 3300009036 | Bacteria | 1407 |
| 42 | Ga0105244_10105733 | 3300009036 | Bacteria | 1373 |
| 43 | Ga0105244_10108358 | 3300009036 | Bacteria | 1354 |
| 44 | Ga0105244_10149346 | 3300009036 | Bacteria | 1120 |
| 45 | Ga0105250_10035181 | 3300009092 | Bacteria | 2009 |
| 46 | Ga0105250_10048284 | 3300009092 | Bacteria | 1708 |
| 47 | Ga0105243_10000133 | 3300009148 | Bacteria | 85133 |
| 48 | Ga0105243_10002559 | 3300009148 | Bacteria | 15201 |
| 49 | Ga0105243_10105900 | 3300009148 | Bacteria | 2343 |
| 50 | Ga0105248_10074471 | 3300009177 | Bacteria | 3816 |
| 51 | Ga0105249_10509945 | 3300009553 | Bacteria | 1249 |
| 52 | Ga0157345_1000010 | 3300012498 | Bacteria | 53625 |
| 53 | Ga0157373_10000311 | 3300013100 | Bacteria | 39322 |
| 54 | Ga0157373_10000672 | 3300013100 | Bacteria | 26718 |
| 55 | Ga0157373_10017233 | 3300013100 | Bacteria | 5260 |
| 56 | Ga0157373_10053316 | 3300013100 | Bacteria | 2876 |
| 57 | Ga0157373_10087888 | 3300013100 | Bacteria | 2190 |
| 58 | Ga0157373_10237939 | 3300013100 | Bacteria | 1287 |
| 59 | Ga0157371_10000730 | 3300013102 | Bacteria | 38386 |
| 60 | Ga0157371_10003726 | 3300013102 | Bacteria | 13660 |
| 61 | Ga0157370_10053876 | 3300013104 | Bacteria | 3835 |
| 62 | Ga0157370_10064909 | 3300013104 | Bacteria | 3455 |
| 63 | Ga0157370_10090265 | 3300013104 | Bacteria | 2877 |
| 64 | Ga0157370_10095963 | 3300013104 | Bacteria | 2782 |
| 65 | Ga0157369_10001717 | 3300013105 | Bacteria | 26675 |
| 66 | Ga0157369_10011964 | 3300013105 | Bacteria | 9858 |
| 67 | Ga0157369_10023273 | 3300013105 | Bacteria | 6901 |
| 68 | Ga0157369_10201461 | 3300013105 | Bacteria | 2089 |
| 69 | Ga0163162_10071390 | 3300013306 | Bacteria | 3525 |
| 70 | Ga0157372_10003539 | 3300013307 | Bacteria | 16835 |
| 71 | Ga0157372_10020323 | 3300013307 | Bacteria | 7162 |
| 72 | Ga0157372_10096671 | 3300013307 | Bacteria | 3366 |
| 73 | Ga0157375_10003511 | 3300013308 | Bacteria | 13597 |
| 74 | Ga0157375_10165303 | 3300013308 | Bacteria | 2357 |
| 75 | Ga0182008_10001305 | 3300014497 | Bacteria | 17029 |
| 76 | Ga0182008_10007301 | 3300014497 | Bacteria | 6111 |
| 77 | Ga0182008_10051392 | 3300014497 | Bacteria | 2044 |
| 78 | Ga0182008_10094761 | 3300014497 | Bacteria | 1473 |
| 79 | Ga0182006_1000259 | 3300015261 | Bacteria | 48611 |
| 80 | Ga0182006_1005747 | 3300015261 | Bacteria | 5854 |
| 81 | Ga0182006_1010009 | 3300015261 | Bacteria | 4230 |
| 82 | Ga0182006_1016082 | 3300015261 | Bacteria | 3197 |
| 83 | Ga0182006_1025853 | 3300015261 | Bacteria | 2409 |
| 84 | Ga0182006_1035255 | 3300015261 | Bacteria | 1997 |
| 85 | Ga0182007_10001758 | 3300015262 | Bacteria | 11378 |
| 86 | Ga0182007_10007208 | 3300015262 | Bacteria | 4686 |
| 87 | Ga0182007_10083808 | 3300015262 | Bacteria | 1047 |
| 88 | Ga0182005_1001180 | 3300015265 | Bacteria | 10801 |
| 89 | Ga0182005_1001799 | 3300015265 | Bacteria | 8211 |
| 90 | Ga0182005_1009459 | 3300015265 | Bacteria | 2835 |
| 91 | Ga0182005_1050489 | 3300015265 | Bacteria | 1131 |
| 92 | Ga0183361_10006 | 3300016635 | Bacteria | 368532 |
| 93 | Ga0163161_10000469 | 3300017792 | Bacteria | 33513 |
| 94 | Ga0163161_10002500 | 3300017792 | Bacteria | 13110 |
| 95 | Ga0163161_10016164 | 3300017792 | Bacteria | 5209 |
| 96 | Ga0163161_10041371 | 3300017792 | Bacteria | 3312 |
| 97 | Ga0163161_10184380 | 3300017792 | Bacteria | 1602 |
| 98 | Ga0163161_10190611 | 3300017792 | Bacteria | 1576 |
| 99 | Ga0163161_10255502 | 3300017792 | Bacteria | 1367 |
| 100 | Ga0163161_10265609 | 3300017792 | Bacteria | 1341 |
| 101 | Ga0209760_100084 | 3300025207 | Bacteria | 75138 |
| 102 | Ga0209566_100352 | 3300025225 | Bacteria | 39223 |
| 103 | Ga0209672_100081 | 3300025228 | Bacteria | 142296 |
| 104 | Ga0209672_101226 | 3300025228 | Bacteria | 10354 |
| 105 | Ga0209147_100102 | 3300025229 | Bacteria | 159415 |
| 106 | Ga0209147_100124 | 3300025229 | Bacteria | 133627 |
| 107 | Ga0209563_100322 | 3300025230 | Bacteria | 18881 |
| 108 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 109 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 110 | Ga0209258_100131 | 3300025242 | Bacteria | 175316 |
| 111 | Ga0209148_1000130 | 3300025254 | Bacteria | 175316 |
| 112 | Ga0209233_1000059 | 3300025261 | Bacteria | 414562 |
| 113 | Ga0209565_1011659 | 3300025263 | Bacteria | 2127 |
| 114 | Ga0209455_1000118 | 3300025272 | Bacteria | 175316 |
| 115 | Ga0209673_1000028 | 3300025273 | Bacteria | 358901 |
| 116 | Ga0209675_1008548 | 3300025291 | Bacteria | 3743 |
| 117 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 118 | Ga0209676_1001599 | 3300025292 | Bacteria | 20145 |
| 119 | Ga0209676_1001982 | 3300025292 | Bacteria | 16296 |
| 120 | Ga0209564_1004215 | 3300025295 | Bacteria | 8959 |
| 121 | Ga0209050_1000019 | 3300025298 | Bacteria | 608757 |
| 122 | Ga0209050_1001159 | 3300025298 | Bacteria | 31450 |
| 123 | Ga0207426_1000125 | 3300025302 | Bacteria | 217504 |
| 124 | Ga0209051_1000238 | 3300025303 | Bacteria | 92629 |
| 125 | Ga0209051_1002663 | 3300025303 | Bacteria | 12493 |
| 126 | Ga0209257_1000119 | 3300025304 | Bacteria | 225893 |
| 127 | Ga0207696_1000179 | 3300025711 | Bacteria | 99732 |
| 128 | Ga0207696_1000474 | 3300025711 | Bacteria | 34199 |
| 129 | Ga0207696_1003414 | 3300025711 | Bacteria | 7253 |
| 130 | Ga0207696_1012275 | 3300025711 | Bacteria | 3036 |
| 131 | Ga0207696_1020029 | 3300025711 | Bacteria | 2163 |
| 132 | Ga0207696_1043977 | 3300025711 | Bacteria | 1297 |
| 133 | Ga0207655_1000049 | 3300025728 | Bacteria | 295872 |
| 134 | Ga0207655_1000437 | 3300025728 | Bacteria | 55747 |
| 135 | Ga0207655_1003954 | 3300025728 | Bacteria | 10745 |
| 136 | Ga0207655_1011153 | 3300025728 | Bacteria | 5376 |
| 137 | Ga0207655_1011550 | 3300025728 | Bacteria | 5247 |
| 138 | Ga0207655_1013904 | 3300025728 | Bacteria | 4585 |
| 139 | Ga0207655_1028544 | 3300025728 | Bacteria | 2631 |
| 140 | Ga0207655_1030276 | 3300025728 | Bacteria | 2519 |
| 141 | Ga0207655_1036683 | 3300025728 | Bacteria | 2171 |
| 142 | Ga0207655_1041297 | 3300025728 | Bacteria | 1978 |
| 143 | Ga0207655_1060284 | 3300025728 | Bacteria | 1472 |
| 144 | Ga0207655_1067720 | 3300025728 | Bacteria | 1343 |
| 145 | Ga0207713_1000219 | 3300025735 | Bacteria | 77126 |
| 146 | Ga0207713_1000322 | 3300025735 | Bacteria | 54257 |
| 147 | Ga0207713_1001158 | 3300025735 | Bacteria | 22280 |
| 148 | Ga0207713_1007092 | 3300025735 | Bacteria | 6704 |
| 149 | Ga0207713_1014348 | 3300025735 | Bacteria | 4122 |
| 150 | Ga0207713_1075901 | 3300025735 | Bacteria | 1225 |
| 151 | Ga0207713_1108296 | 3300025735 | Bacteria | 949 |
| 152 | Ga0207647_10007136 | 3300025904 | Bacteria | 8101 |
| 153 | Ga0207705_10156140 | 3300025909 | Bacteria | 1712 |
| 154 | Ga0207706_10002046 | 3300025933 | Bacteria | 19776 |
| 155 | Ga0207709_10000013 | 3300025935 | Bacteria | 531977 |
| 156 | Ga0207709_10000296 | 3300025935 | Bacteria | 55698 |
| 157 | Ga0207709_10020767 | 3300025935 | Bacteria | 3709 |
| 158 | Ga0207709_10126369 | 3300025935 | Bacteria | 1735 |
| 159 | Ga0207711_10039704 | 3300025941 | Bacteria | 4004 |
| 160 | Ga0207667_10035616 | 3300025949 | Bacteria | 5339 |
| 161 | Ga0207712_10320008 | 3300025961 | Bacteria | 1279 |
| 162 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 163 | Ga0209281_1007856 | 3300027111 | Bacteria | 2640 |
| 164 | Ga0209371_1000195 | 3300027312 | Bacteria | 89403 |
| 165 | Ga0209371_1000326 | 3300027312 | Bacteria | 52194 |
| 166 | Ga0209371_1000446 | 3300027312 | Bacteria | 41253 |
| 167 | Ga0207428_10009548 | 3300027907 | Bacteria | 8693 |
| 168 | Ga0207428_10134971 | 3300027907 | Bacteria | 1887 |
| 169 | Ga0207428_10145629 | 3300027907 | Bacteria | 1806 |
| 170 | Ga0207428_10186143 | 3300027907 | Bacteria | 1567 |
| 171 | Ga0207428_10309227 | 3300027907 | Bacteria | 1169 |
| 172 | Ga0268266_10400088 | 3300028379 | Bacteria | 1298 |
| 173 | Ga0265338_10000045 | 3300028800 | Bacteria | 223264 |
| 174 | Ga0268256_1000134 | 3300030500 | Bacteria | 102725 |
| 175 | Ga0268256_1000168 | 3300030500 | Bacteria | 81587 |
| 176 | Ga0268256_1000382 | 3300030500 | Bacteria | 41253 |
| 177 | Ga0307511_10151860 | 3300030521 | Bacteria | 1327 |
| 178 | Ga0316178_1018055 | 3300030735 | Bacteria | 9187 |
| 179 | Ga0316183_1156053 | 3300030742 | Bacteria | 3167 |
| 180 | Ga0265332_10022915 | 3300031238 | Bacteria | 2755 |
| 181 | Ga0307408_100001237 | 3300031548 | Bacteria | 19178 |
| 182 | Ga0307408_100003660 | 3300031548 | Bacteria | 10474 |
| 183 | Ga0307408_100178381 | 3300031548 | Bacteria | 1701 |
| 184 | Ga0307405_10001160 | 3300031731 | Bacteria | 10826 |
| 185 | Ga0307405_10003535 | 3300031731 | Bacteria | 7200 |
| 186 | Ga0307405_10014540 | 3300031731 | Bacteria | 4235 |
| 187 | Ga0307406_10006514 | 3300031901 | Bacteria | 6451 |
| 188 | Ga0307406_10574777 | 3300031901 | Bacteria | 925 |
| 189 | Ga0307407_10003333 | 3300031903 | Bacteria | 6564 |
| 190 | Ga0307407_10209811 | 3300031903 | Bacteria | 1310 |
| 191 | Ga0307412_10000577 | 3300031911 | Bacteria | 21796 |
| 192 | Ga0307412_10025970 | 3300031911 | Bacteria | 3635 |
| 193 | Ga0307412_10031846 | 3300031911 | Bacteria | 3334 |
| 194 | Ga0307416_100061798 | 3300032002 | Bacteria | 3059 |
| 195 | Ga0307416_100160353 | 3300032002 | Bacteria | 2078 |
| 196 | Ga0307414_10018307 | 3300032004 | Bacteria | 4308 |
| 197 | Ga0307414_10027034 | 3300032004 | Bacteria | 3701 |
| 198 | Ga0307414_10112965 | 3300032004 | Bacteria | 2072 |
| 199 | Ga0307414_10246130 | 3300032004 | Bacteria | 1483 |
| 200 | Ga0307411_10008595 | 3300032005 | Bacteria | 5302 |
| 201 | Ga0307411_10102194 | 3300032005 | Bacteria | 2030 |
| 202 | Ga0307411_10181061 | 3300032005 | Bacteria | 1599 |
| 203 | Ga0307510_10001045 | 3300033180 | Bacteria | 29367 |
| 204 | Ga0307510_10055904 | 3300033180 | Bacteria | 4117 |
| 205 | Ga0307510_10241994 | 3300033180 | Bacteria | 1298 |
| 206 | Ga0395898_0380235 | 3300037466 | Bacteria | 1347 |
| 207 | Ga0395905_0000076 | 3300037471 | Bacteria | 164190 |
| 208 | Ga0439438_000189 | 3300041405 | Bacteria | 27725 |
| 209 | Ga0439438_000276 | 3300041405 | Bacteria | 23108 |
| 210 | Ga0439438_001012 | 3300041405 | Bacteria | 12542 |
| 211 | Ga0439438_002308 | 3300041405 | Bacteria | 8160 |
| 212 | Ga0439438_002423 | 3300041405 | Bacteria | 7944 |
| 213 | Ga0439438_002988 | 3300041405 | Bacteria | 6982 |
| 214 | Ga0439438_017083 | 3300041405 | Bacteria | 2097 |
| 215 | Ga0439438_029636 | 3300041405 | Bacteria | 1463 |
| 216 | Ga0439447_003254 | 3300041407 | Bacteria | 5774 |
| 217 | Ga0439447_012130 | 3300041407 | Bacteria | 2489 |
| 218 | Ga0439447_019196 | 3300041407 | Bacteria | 1825 |
| 219 | Ga0439447_030707 | 3300041407 | Bacteria | 1352 |
| 220 | Ga0439466_0002173 | 3300041411 | Bacteria | 7689 |
| 221 | Ga0439466_0002558 | 3300041411 | Bacteria | 7126 |
| 222 | Ga0439466_0010518 | 3300041411 | Bacteria | 3439 |
| 223 | Ga0439466_0040358 | 3300041411 | Bacteria | 1560 |
| 224 | Ga0439466_0087203 | 3300041411 | Bacteria | 980 |
| 225 | Ga0439432_001693 | 3300042006 | Bacteria | 8256 |
| 226 | Ga0439432_005446 | 3300042006 | Bacteria | 4580 |
| 227 | Ga0439432_007406 | 3300042006 | Bacteria | 3890 |
| 228 | Ga0439432_008285 | 3300042006 | Bacteria | 3654 |
| 229 | Ga0439432_012954 | 3300042006 | Bacteria | 2840 |
| 230 | Ga0439451_002707 | 3300042009 | Bacteria | 3598 |
| 231 | Ga0439451_009495 | 3300042009 | Bacteria | 1969 |
| 232 | Ga0439452_000182 | 3300042010 | Bacteria | 47292 |
| 233 | Ga0439452_000198 | 3300042010 | Bacteria | 43963 |
| 234 | Ga0439452_002790 | 3300042010 | Bacteria | 6316 |
| 235 | Ga0439452_003400 | 3300042010 | Bacteria | 5581 |
| 236 | Ga0439452_011244 | 3300042010 | Bacteria | 2578 |
| 237 | Ga0439452_012299 | 3300042010 | Bacteria | 2440 |
| 238 | Ga0439456_002249 | 3300042013 | Bacteria | 3888 |
| 239 | Ga0439456_006123 | 3300042013 | Bacteria | 2448 |
| 240 | Ga0439456_026042 | 3300042013 | Bacteria | 1243 |
| 241 | Ga0439456_031681 | 3300042013 | Bacteria | 1133 |
| 242 | Ga0439463_000277 | 3300042016 | Bacteria | 14187 |
| 243 | Ga0439463_004565 | 3300042016 | Bacteria | 3469 |
| 244 | Ga0450911_000585 | 3300042115 | Bacteria | 11220 |
| 245 | Ga0450911_007934 | 3300042115 | Bacteria | 1524 |
| 246 | Ga0450920_002009 | 3300042122 | Bacteria | 3435 |
| 247 | Ga0450904_001098 | 3300042139 | Bacteria | 4156 |
| 248 | Ga0450905_002207 | 3300042142 | Bacteria | 2493 |
| 249 | Ga0450906_002793 | 3300042145 | Bacteria | 3807 |
| 250 | Ga0450906_013073 | 3300042145 | Bacteria | 1534 |
| 251 | Ga0450907_000017 | 3300042146 | Bacteria | 83894 |
| 252 | Ga0450907_000656 | 3300042146 | Bacteria | 9087 |
| 253 | Ga0450910_003923 | 3300042147 | Bacteria | 1995 |
| 254 | Ga0439446_0022255 | 3300042156 | Bacteria | 1796 |
| 255 | Ga0450909_004321 | 3300042185 | Bacteria | 2027 |
| 256 | Ga0450909_008449 | 3300042185 | Bacteria | 1498 |
| 257 | Ga0439434_0000313 | 3300042435 | Bacteria | 13787 |
| 258 | Ga0439464_0015463 | 3300042439 | Bacteria | 2059 |
| 259 | Ga0439460_0001972 | 3300042461 | Bacteria | 4910 |
| 260 | Ga0450893_0001832 | 3300042532 | Bacteria | 3277 |
| 261 | Ga0450901_003638 | 3300042533 | Bacteria | 1606 |
| 262 | Ga0439440_0008706 | 3300042993 | Bacteria | 2088 |
| 263 | Ga0466982_0063869 | 3300044672 | Bacteria | 2268 |
| 264 | Ga0466966_0098498 | 3300044684 | Bacteria | 1810 |
| 265 | Ga0466961_0000500 | 3300044693 | Bacteria | 25029 |
| 266 | Ga0466970_0263860 | 3300044765 | Bacteria | 966 |
| 267 | Ga0466957_0080863 | 3300044842 | Bacteria | 2023 |
| 268 | Ga0466960_0003644 | 3300044901 | Bacteria | 5943 |
| 269 | Ga0495617_014741 | 3300046452 | Bacteria | 2654 |
| 270 | Ga0495617_017653 | 3300046452 | Bacteria | 2412 |
| 271 | Ga0495617_022272 | 3300046452 | Bacteria | 2141 |
| 272 | Ga0495617_051847 | 3300046452 | Bacteria | 1363 |
| 273 | Ga0495617_084724 | 3300046452 | Bacteria | 1037 |
| 274 | Ga0495627_000502 | 3300046453 | Bacteria | 32804 |
| 275 | Ga0495627_000657 | 3300046453 | Bacteria | 26626 |
| 276 | Ga0495627_001776 | 3300046453 | Bacteria | 11569 |
| 277 | Ga0495627_006169 | 3300046453 | Bacteria | 4724 |
| 278 | Ga0495627_009699 | 3300046453 | Bacteria | 3533 |
| 279 | Ga0495603_0056409 | 3300046455 | Bacteria | 2325 |
| 280 | Ga0495603_0063611 | 3300046455 | Bacteria | 2176 |
| 281 | Ga0495603_0154027 | 3300046455 | Bacteria | 1334 |
| 282 | Ga0495590_0007780 | 3300046457 | Bacteria | 4113 |
| 283 | Ga0495590_0010666 | 3300046457 | Bacteria | 3444 |
| 284 | Ga0495590_0012255 | 3300046457 | Bacteria | 3184 |
| 285 | Ga0495590_0017613 | 3300046457 | Bacteria | 2569 |
| 286 | Ga0495590_0018736 | 3300046457 | Bacteria | 2476 |
| 287 | Ga0495590_0029350 | 3300046457 | Bacteria | 1928 |
| 288 | Ga0495590_0032741 | 3300046457 | Bacteria | 1818 |
| 289 | Ga0495590_0063801 | 3300046457 | Bacteria | 1289 |
| 290 | Ga0495591_000226 | 3300046458 | Bacteria | 55990 |
| 291 | Ga0495591_000347 | 3300046458 | Bacteria | 41024 |
| 292 | Ga0495591_000414 | 3300046458 | Bacteria | 35561 |
| 293 | Ga0495591_001045 | 3300046458 | Bacteria | 18641 |
| 294 | Ga0495591_004233 | 3300046458 | Bacteria | 7112 |
| 295 | Ga0495591_004888 | 3300046458 | Bacteria | 6374 |
| 296 | Ga0495591_010805 | 3300046458 | Bacteria | 3504 |
| 297 | Ga0495591_011161 | 3300046458 | Bacteria | 3421 |
| 298 | Ga0495591_011437 | 3300046458 | Bacteria | 3362 |
| 299 | Ga0495591_014559 | 3300046458 | Bacteria | 2822 |
| 300 | Ga0495591_018095 | 3300046458 | Bacteria | 2398 |
| 301 | Ga0495591_018245 | 3300046458 | Bacteria | 2383 |
| 302 | Ga0495591_032757 | 3300046458 | Bacteria | 1543 |
| 303 | Ga0495591_036105 | 3300046458 | Bacteria | 1441 |
| 304 | Ga0495629_0000054 | 3300046459 | Bacteria | 106374 |
| 305 | Ga0495638_0000974 | 3300046460 | Bacteria | 28825 |
| 306 | Ga0495638_0034516 | 3300046460 | Bacteria | 3229 |
| 307 | Ga0495638_0037590 | 3300046460 | Bacteria | 3079 |
| 308 | Ga0495638_0046395 | 3300046460 | Bacteria | 2729 |
| 309 | Ga0495638_0061828 | 3300046460 | Bacteria | 2312 |
| 310 | Ga0495638_0063703 | 3300046460 | Bacteria | 2272 |
| 311 | Ga0495638_0069068 | 3300046460 | Bacteria | 2165 |
| 312 | Ga0495638_0075031 | 3300046460 | Bacteria | 2061 |
| 313 | Ga0495638_0125280 | 3300046460 | Bacteria | 1514 |
| 314 | Ga0495653_0000099 | 3300046463 | Bacteria | 71802 |
| 315 | Ga0495653_0011756 | 3300046463 | Bacteria | 7149 |
| 316 | Ga0495653_0081696 | 3300046463 | Bacteria | 2387 |
| 317 | Ga0495653_0106933 | 3300046463 | Bacteria | 2016 |
| 318 | Ga0495650_0001114 | 3300046471 | Bacteria | 29356 |
| 319 | Ga0495650_0001703 | 3300046471 | Bacteria | 20212 |
| 320 | Ga0495650_0013408 | 3300046471 | Bacteria | 4334 |
| 321 | Ga0495650_0020415 | 3300046471 | Bacteria | 3231 |
| 322 | Ga0495650_0026717 | 3300046471 | Bacteria | 2678 |
| 323 | Ga0495650_0032411 | 3300046471 | Bacteria | 2336 |
| 324 | Ga0495650_0039434 | 3300046471 | Bacteria | 2038 |
| 325 | Ga0495650_0089936 | 3300046471 | Bacteria | 1169 |
| 326 | Ga0495580_0000594 | 3300046472 | Bacteria | 30607 |
| 327 | Ga0495580_0007041 | 3300046472 | Bacteria | 9068 |
| 328 | Ga0495580_0008413 | 3300046472 | Bacteria | 8208 |
| 329 | Ga0495580_0009363 | 3300046472 | Bacteria | 7705 |
| 330 | Ga0495580_0013815 | 3300046472 | Bacteria | 6147 |
| 331 | Ga0495605_0000016 | 3300046474 | Bacteria | 289508 |
| 332 | Ga0495605_0000031 | 3300046474 | Bacteria | 213242 |
| 333 | Ga0495605_0000523 | 3300046474 | Bacteria | 32529 |
| 334 | Ga0495605_0001023 | 3300046474 | Bacteria | 18826 |
| 335 | Ga0495605_0001085 | 3300046474 | Bacteria | 18130 |
| 336 | Ga0495605_0001270 | 3300046474 | Bacteria | 16722 |
| 337 | Ga0495605_0003972 | 3300046474 | Bacteria | 8740 |
| 338 | Ga0495605_0008760 | 3300046474 | Bacteria | 5708 |
| 339 | Ga0495605_0020784 | 3300046474 | Bacteria | 3485 |
| 340 | Ga0495605_0028661 | 3300046474 | Bacteria | 2872 |
| 341 | Ga0495605_0059564 | 3300046474 | Bacteria | 1833 |
| 342 | Ga0495605_0091644 | 3300046474 | Bacteria | 1407 |
| 343 | Ga0495662_0024204 | 3300046476 | Bacteria | 2930 |
| 344 | Ga0495664_0032174 | 3300046477 | Bacteria | 3077 |
| 345 | Ga0495584_0000180 | 3300046491 | Bacteria | 44615 |
| 346 | Ga0495584_0000427 | 3300046491 | Bacteria | 29042 |
| 347 | Ga0495584_0003008 | 3300046491 | Bacteria | 9349 |
| 348 | Ga0495584_0008038 | 3300046491 | Bacteria | 5483 |
| 349 | Ga0495584_0025198 | 3300046491 | Bacteria | 3015 |
| 350 | Ga0495584_0028994 | 3300046491 | Bacteria | 2805 |
| 351 | Ga0495584_0061704 | 3300046491 | Bacteria | 1884 |
| 352 | Ga0495584_0105980 | 3300046491 | Bacteria | 1421 |
| 353 | Ga0495584_0127443 | 3300046491 | Bacteria | 1290 |
| 354 | Ga0495585_0026441 | 3300046492 | Bacteria | 3313 |
| 355 | Ga0495585_0031898 | 3300046492 | Bacteria | 2988 |
| 356 | Ga0495585_0109072 | 3300046492 | Bacteria | 1474 |
| 357 | Ga0495585_0134860 | 3300046492 | Bacteria | 1297 |
| 358 | Ga0495585_0136495 | 3300046492 | Bacteria | 1287 |
| 359 | Ga0495585_0227522 | 3300046492 | Bacteria | 939 |
| 360 | Ga0495594_0000448 | 3300046499 | Bacteria | 20894 |
| 361 | Ga0495594_0085605 | 3300046499 | Bacteria | 1763 |
| 362 | Ga0495596_0026721 | 3300046500 | Bacteria | 2324 |
| 363 | Ga0495596_0027662 | 3300046500 | Bacteria | 2278 |
| 364 | Ga0495607_0000305 | 3300046501 | Bacteria | 51421 |
| 365 | Ga0495607_0000372 | 3300046501 | Bacteria | 46245 |
| 366 | Ga0495607_0000780 | 3300046501 | Bacteria | 30486 |
| 367 | Ga0495607_0004132 | 3300046501 | Bacteria | 10828 |
| 368 | Ga0495607_0012558 | 3300046501 | Bacteria | 5585 |
| 369 | Ga0495607_0013981 | 3300046501 | Bacteria | 5240 |
| 370 | Ga0495607_0019008 | 3300046501 | Bacteria | 4368 |
| 371 | Ga0495607_0022066 | 3300046501 | Bacteria | 4002 |
| 372 | Ga0495607_0024487 | 3300046501 | Bacteria | 3762 |
| 373 | Ga0495607_0035208 | 3300046501 | Bacteria | 3030 |
| 374 | Ga0495607_0062443 | 3300046501 | Bacteria | 2111 |
| 375 | Ga0495607_0096963 | 3300046501 | Bacteria | 1586 |
| 376 | Ga0495607_0150726 | 3300046501 | Bacteria | 1190 |
| 377 | Ga0495607_0153926 | 3300046501 | Bacteria | 1174 |
| 378 | Ga0495583_0000041 | 3300046506 | Bacteria | 234707 |
| 379 | Ga0495583_0000572 | 3300046506 | Bacteria | 50655 |
| 380 | Ga0495583_0001141 | 3300046506 | Bacteria | 28937 |
| 381 | Ga0495583_0001653 | 3300046506 | Bacteria | 21659 |
| 382 | Ga0495583_0004682 | 3300046506 | Bacteria | 9643 |
| 383 | Ga0495583_0006028 | 3300046506 | Bacteria | 8032 |
| 384 | Ga0495583_0007804 | 3300046506 | Bacteria | 6650 |
| 385 | Ga0495583_0011771 | 3300046506 | Bacteria | 5004 |
| 386 | Ga0495583_0018460 | 3300046506 | Bacteria | 3671 |
| 387 | Ga0495583_0026897 | 3300046506 | Bacteria | 2845 |
| 388 | Ga0495583_0053569 | 3300046506 | Bacteria | 1830 |
| 389 | Ga0495606_0000022 | 3300046507 | Bacteria | 265567 |
| 390 | Ga0495606_0000567 | 3300046507 | Bacteria | 58569 |
| 391 | Ga0495606_0000574 | 3300046507 | Bacteria | 58351 |
| 392 | Ga0495606_0001959 | 3300046507 | Bacteria | 25412 |
| 393 | Ga0495606_0002039 | 3300046507 | Bacteria | 24754 |
| 394 | Ga0495606_0004659 | 3300046507 | Bacteria | 13563 |
| 395 | Ga0495606_0004718 | 3300046507 | Bacteria | 13435 |
| 396 | Ga0495606_0013593 | 3300046507 | Bacteria | 6420 |
| 397 | Ga0495606_0019059 | 3300046507 | Bacteria | 5121 |
| 398 | Ga0495606_0033634 | 3300046507 | Bacteria | 3533 |
| 399 | Ga0495606_0076054 | 3300046507 | Bacteria | 2099 |
| 400 | Ga0495606_0151858 | 3300046507 | Bacteria | 1358 |
| 401 | Ga0495610_0001181 | 3300046512 | Bacteria | 23629 |
| 402 | Ga0495610_0002573 | 3300046512 | Bacteria | 15076 |
| 403 | Ga0495610_0008362 | 3300046512 | Bacteria | 6716 |
| 404 | Ga0495610_0011077 | 3300046512 | Bacteria | 5539 |
| 405 | Ga0495610_0022590 | 3300046512 | Bacteria | 3436 |
| 406 | Ga0495610_0028907 | 3300046512 | Bacteria | 2926 |
| 407 | Ga0495610_0043121 | 3300046512 | Bacteria | 2250 |
| 408 | Ga0495610_0054461 | 3300046512 | Bacteria | 1932 |
| 409 | Ga0495610_0095448 | 3300046512 | Bacteria | 1340 |
| 410 | Ga0495616_0000337 | 3300046513 | Bacteria | 37139 |
| 411 | Ga0495616_0000862 | 3300046513 | Bacteria | 22037 |
| 412 | Ga0495616_0001325 | 3300046513 | Bacteria | 17295 |
| 413 | Ga0495616_0014179 | 3300046513 | Bacteria | 4470 |
| 414 | Ga0495616_0033514 | 3300046513 | Bacteria | 2675 |
| 415 | Ga0495616_0037740 | 3300046513 | Bacteria | 2483 |
| 416 | Ga0495616_0099236 | 3300046513 | Bacteria | 1367 |
| 417 | Ga0495616_0101928 | 3300046513 | Bacteria | 1345 |
| 418 | Ga0495616_0104881 | 3300046513 | Bacteria | 1320 |
| 419 | Ga0495620_0000015 | 3300046515 | Bacteria | 154625 |
| 420 | Ga0495620_0000230 | 3300046515 | Bacteria | 41717 |
| 421 | Ga0495620_0000333 | 3300046515 | Bacteria | 32903 |
| 422 | Ga0495620_0000431 | 3300046515 | Bacteria | 27951 |
| 423 | Ga0495620_0000861 | 3300046515 | Bacteria | 18784 |
| 424 | Ga0495620_0004910 | 3300046515 | Bacteria | 7502 |
| 425 | Ga0495620_0006451 | 3300046515 | Bacteria | 6445 |
| 426 | Ga0495620_0038974 | 3300046515 | Bacteria | 2105 |
| 427 | Ga0495620_0046047 | 3300046515 | Bacteria | 1885 |
| 428 | Ga0495620_0058258 | 3300046515 | Bacteria | 1617 |
| 429 | Ga0495620_0069701 | 3300046515 | Bacteria | 1441 |
| 430 | Ga0495620_0072124 | 3300046515 | Bacteria | 1410 |
| 431 | Ga0495628_0002119 | 3300046516 | Bacteria | 17974 |
| 432 | Ga0495628_0034694 | 3300046516 | Bacteria | 4057 |
| 433 | Ga0495630_0005613 | 3300046517 | Bacteria | 8862 |
| 434 | Ga0495630_0025466 | 3300046517 | Bacteria | 4375 |
| 435 | Ga0495630_0030332 | 3300046517 | Bacteria | 4022 |
| 436 | Ga0495630_0041149 | 3300046517 | Bacteria | 3451 |
| 437 | Ga0495630_0053191 | 3300046517 | Bacteria | 3031 |
| 438 | Ga0495630_0089773 | 3300046517 | Bacteria | 2321 |
| 439 | Ga0495631_0000992 | 3300046518 | Bacteria | 17612 |
| 440 | Ga0495631_0001406 | 3300046518 | Bacteria | 14634 |
| 441 | Ga0495631_0015535 | 3300046518 | Bacteria | 3645 |
| 442 | Ga0495631_0016980 | 3300046518 | Bacteria | 3452 |
| 443 | Ga0495631_0017642 | 3300046518 | Bacteria | 3372 |
| 444 | Ga0495631_0028423 | 3300046518 | Bacteria | 2550 |
| 445 | Ga0495631_0046854 | 3300046518 | Bacteria | 1899 |
| 446 | Ga0495631_0076873 | 3300046518 | Bacteria | 1440 |
| 447 | Ga0495631_0135319 | 3300046518 | Bacteria | 1058 |
| 448 | Ga0495632_0000502 | 3300046519 | Bacteria | 36868 |
| 449 | Ga0495632_0000815 | 3300046519 | Bacteria | 27584 |
| 450 | Ga0495632_0001297 | 3300046519 | Bacteria | 21153 |
| 451 | Ga0495632_0004282 | 3300046519 | Bacteria | 9743 |
| 452 | Ga0495632_0012510 | 3300046519 | Bacteria | 4892 |
| 453 | Ga0495632_0020825 | 3300046519 | Bacteria | 3543 |
| 454 | Ga0495632_0038276 | 3300046519 | Bacteria | 2429 |
| 455 | Ga0495632_0097324 | 3300046519 | Bacteria | 1389 |
| 456 | Ga0495632_0107905 | 3300046519 | Bacteria | 1308 |
| 457 | Ga0495637_0000146 | 3300046520 | Bacteria | 53551 |
| 458 | Ga0495637_0000252 | 3300046520 | Bacteria | 42250 |
| 459 | Ga0495637_0000485 | 3300046520 | Bacteria | 28934 |
| 460 | Ga0495637_0000519 | 3300046520 | Bacteria | 27987 |
| 461 | Ga0495637_0014606 | 3300046520 | Bacteria | 3702 |
| 462 | Ga0495637_0023023 | 3300046520 | Bacteria | 2835 |
| 463 | Ga0495637_0028219 | 3300046520 | Bacteria | 2507 |
| 464 | Ga0495637_0028241 | 3300046520 | Bacteria | 2506 |
| 465 | Ga0495637_0043281 | 3300046520 | Bacteria | 1923 |
| 466 | Ga0495637_0055894 | 3300046520 | Bacteria | 1635 |
| 467 | Ga0495637_0075018 | 3300046520 | Bacteria | 1357 |
| 468 | Ga0495637_0091449 | 3300046520 | Bacteria | 1199 |
| 469 | Ga0495643_0001102 | 3300046522 | Bacteria | 26873 |
| 470 | Ga0495643_0007052 | 3300046522 | Bacteria | 7298 |
| 471 | Ga0495643_0011746 | 3300046522 | Bacteria | 5313 |
| 472 | Ga0495643_0020805 | 3300046522 | Bacteria | 3775 |
| 473 | Ga0495643_0030130 | 3300046522 | Bacteria | 3031 |
| 474 | Ga0495643_0035482 | 3300046522 | Bacteria | 2746 |
| 475 | Ga0495643_0071517 | 3300046522 | Bacteria | 1820 |
| 476 | Ga0495643_0088337 | 3300046522 | Bacteria | 1602 |
| 477 | Ga0495644_0000198 | 3300046523 | Bacteria | 28286 |
| 478 | Ga0495644_0041458 | 3300046523 | Bacteria | 1733 |
| 479 | Ga0495644_0052607 | 3300046523 | Bacteria | 1529 |
| 480 | Ga0495648_0000190 | 3300046524 | Bacteria | 70740 |
| 481 | Ga0495648_0001670 | 3300046524 | Bacteria | 21519 |
| 482 | Ga0495648_0003838 | 3300046524 | Bacteria | 13040 |
| 483 | Ga0495648_0005693 | 3300046524 | Bacteria | 10304 |
| 484 | Ga0495648_0008646 | 3300046524 | Bacteria | 7982 |
| 485 | Ga0495648_0028705 | 3300046524 | Bacteria | 3701 |
| 486 | Ga0495648_0029963 | 3300046524 | Bacteria | 3604 |
| 487 | Ga0495648_0042161 | 3300046524 | Bacteria | 2873 |
| 488 | Ga0495648_0046672 | 3300046524 | Bacteria | 2682 |
| 489 | Ga0495648_0057182 | 3300046524 | Bacteria | 2341 |
| 490 | Ga0495648_0060617 | 3300046524 | Bacteria | 2250 |
| 491 | Ga0495648_0068862 | 3300046524 | Bacteria | 2062 |
| 492 | Ga0495648_0075820 | 3300046524 | Bacteria | 1932 |
| 493 | Ga0495648_0095894 | 3300046524 | Bacteria | 1649 |
| 494 | Ga0495648_0122439 | 3300046524 | Bacteria | 1395 |
| 495 | Ga0495648_0147351 | 3300046524 | Bacteria | 1231 |
| 496 | Ga0495648_0148053 | 3300046524 | Bacteria | 1227 |
| 497 | Ga0495666_0000221 | 3300046526 | Bacteria | 24316 |
| 498 | Ga0495666_0002081 | 3300046526 | Bacteria | 9911 |
| 499 | Ga0495666_0026057 | 3300046526 | Bacteria | 2885 |
| 500 | Ga0495666_0035081 | 3300046526 | Bacteria | 2446 |
| 501 | Ga0495642_0001710 | 3300046528 | Bacteria | 9462 |
| 502 | Ga0495642_0008921 | 3300046528 | Bacteria | 3837 |
| 503 | Ga0495654_0000235 | 3300046530 | Bacteria | 51932 |
| 504 | Ga0495654_0000402 | 3300046530 | Bacteria | 36997 |
| 505 | Ga0495654_0002359 | 3300046530 | Bacteria | 12202 |
| 506 | Ga0495654_0003822 | 3300046530 | Bacteria | 9105 |
| 507 | Ga0495654_0004187 | 3300046530 | Bacteria | 8632 |
| 508 | Ga0495654_0008650 | 3300046530 | Bacteria | 5610 |
| 509 | Ga0495654_0010543 | 3300046530 | Bacteria | 5029 |
| 510 | Ga0495654_0012874 | 3300046530 | Bacteria | 4484 |
| 511 | Ga0495654_0017898 | 3300046530 | Bacteria | 3718 |
| 512 | Ga0495654_0025989 | 3300046530 | Bacteria | 3014 |
| 513 | Ga0495654_0028688 | 3300046530 | Bacteria | 2843 |
| 514 | Ga0495654_0038332 | 3300046530 | Bacteria | 2397 |
| 515 | Ga0495654_0078966 | 3300046530 | Bacteria | 1546 |
| 516 | Ga0495654_0094289 | 3300046530 | Bacteria | 1385 |
| 517 | Ga0495654_0156293 | 3300046530 | Bacteria | 1004 |
| 518 | Ga0495665_0019037 | 3300046531 | Bacteria | 3690 |
| 519 | Ga0495665_0045425 | 3300046531 | Bacteria | 2333 |
| 520 | Ga0495587_0001393 | 3300046536 | Bacteria | 16085 |
| 521 | Ga0495587_0002294 | 3300046536 | Bacteria | 12811 |
| 522 | Ga0495609_0000014 | 3300046538 | Bacteria | 326023 |
| 523 | Ga0495609_0000015 | 3300046538 | Bacteria | 322474 |
| 524 | Ga0495609_0000070 | 3300046538 | Bacteria | 128181 |
| 525 | Ga0495609_0000197 | 3300046538 | Bacteria | 60324 |
| 526 | Ga0495609_0013308 | 3300046538 | Bacteria | 3890 |
| 527 | Ga0495609_0013528 | 3300046538 | Bacteria | 3850 |
| 528 | Ga0495609_0021687 | 3300046538 | Bacteria | 2963 |
| 529 | Ga0495609_0038268 | 3300046538 | Bacteria | 2163 |
| 530 | Ga0495609_0075978 | 3300046538 | Bacteria | 1472 |
| 531 | Ga0495609_0089101 | 3300046538 | Bacteria | 1342 |
| 532 | Ga0495609_0092496 | 3300046538 | Bacteria | 1315 |
| 533 | Ga0495609_0112171 | 3300046538 | Bacteria | 1176 |
| 534 | Ga0495609_0145566 | 3300046538 | Bacteria | 1009 |
| 535 | Ga0495597_0001637 | 3300046542 | Bacteria | 15663 |
| 536 | Ga0495597_0003829 | 3300046542 | Bacteria | 8547 |
| 537 | Ga0495597_0006001 | 3300046542 | Bacteria | 6332 |
| 538 | Ga0495597_0036741 | 3300046542 | Bacteria | 2203 |
| 539 | Ga0495597_0057371 | 3300046542 | Bacteria | 1704 |
| 540 | Ga0495597_0064393 | 3300046542 | Bacteria | 1592 |
| 541 | Ga0495622_0001636 | 3300046557 | Bacteria | 11065 |
| 542 | Ga0495622_0004664 | 3300046557 | Bacteria | 6353 |
| 543 | Ga0495622_0004946 | 3300046557 | Bacteria | 6172 |
| 544 | Ga0495622_0056237 | 3300046557 | Bacteria | 1824 |
| 545 | Ga0495622_0078472 | 3300046557 | Bacteria | 1520 |
| 546 | Ga0495622_0090294 | 3300046557 | Bacteria | 1407 |
| 547 | Ga0495633_0000060 | 3300046558 | Bacteria | 144561 |
| 548 | Ga0495633_0001653 | 3300046558 | Bacteria | 16807 |
| 549 | Ga0495633_0036153 | 3300046558 | Bacteria | 2368 |
| 550 | Ga0495633_0052676 | 3300046558 | Bacteria | 1916 |
| 551 | Ga0495633_0071730 | 3300046558 | Bacteria | 1615 |
| 552 | Ga0495656_0072710 | 3300046615 | Bacteria | 1531 |
| 553 | Ga0495656_0114591 | 3300046615 | Bacteria | 1265 |
| 554 | Ga0495668_0007155 | 3300046616 | Bacteria | 7174 |
| 555 | Ga0495668_0023080 | 3300046616 | Bacteria | 3551 |
| 556 | Ga0495668_0024704 | 3300046616 | Bacteria | 3417 |
| 557 | Ga0495634_0001985 | 3300046642 | Bacteria | 17420 |
| 558 | Ga0495611_0000094 | 3300046648 | Bacteria | 61349 |
| 559 | Ga0495611_0005536 | 3300046648 | Bacteria | 5392 |
| 560 | Ga0495611_0005691 | 3300046648 | Bacteria | 5319 |
| 561 | Ga0495611_0036842 | 3300046648 | Bacteria | 2172 |
| 562 | Ga0495611_0058614 | 3300046648 | Bacteria | 1746 |
| 563 | Ga0495611_0067453 | 3300046648 | Bacteria | 1632 |
| 564 | Ga0495611_0083521 | 3300046648 | Bacteria | 1471 |
| 565 | Ga0495625_0000354 | 3300046660 | Bacteria | 69894 |
| 566 | Ga0495625_0004035 | 3300046660 | Bacteria | 14033 |
| 567 | Ga0495625_0013054 | 3300046660 | Bacteria | 6696 |
| 568 | Ga0495625_0035522 | 3300046660 | Bacteria | 3673 |
| 569 | Ga0495625_0082585 | 3300046660 | Bacteria | 2234 |
| 570 | Ga0495625_0148581 | 3300046660 | Bacteria | 1576 |
| 571 | Ga0495625_0184742 | 3300046660 | Bacteria | 1384 |
| 572 | Ga0495625_0212657 | 3300046660 | Bacteria | 1270 |
| 573 | Ga0495625_0236712 | 3300046660 | Bacteria | 1190 |
| 574 | Ga0495635_0001016 | 3300046663 | Bacteria | 18525 |
| 575 | Ga0495635_0045009 | 3300046663 | Bacteria | 3044 |
| 576 | Ga0495659_0048228 | 3300046664 | Bacteria | 1542 |
| 577 | Ga0495661_0000110 | 3300046665 | Bacteria | 97854 |
| 578 | Ga0495661_0000180 | 3300046665 | Bacteria | 72613 |
| 579 | Ga0495661_0000185 | 3300046665 | Bacteria | 71615 |
| 580 | Ga0495661_0000329 | 3300046665 | Bacteria | 51418 |
| 581 | Ga0495661_0000803 | 3300046665 | Bacteria | 29661 |
| 582 | Ga0495661_0004644 | 3300046665 | Bacteria | 9880 |
| 583 | Ga0495661_0067426 | 3300046665 | Bacteria | 2102 |
| 584 | Ga0495661_0143164 | 3300046665 | Bacteria | 1298 |
| 585 | Ga0495588_0068800 | 3300046674 | Bacteria | 1839 |
| 586 | Ga0495588_0072432 | 3300046674 | Bacteria | 1793 |
| 587 | Ga0495657_0106488 | 3300046675 | Bacteria | 1780 |
| 588 | Ga0495599_0024674 | 3300046678 | Bacteria | 3760 |
| 589 | Ga0495623_0000884 | 3300046679 | Bacteria | 20323 |
| 590 | Ga0495623_0002201 | 3300046679 | Bacteria | 12978 |
| 591 | Ga0495623_0002533 | 3300046679 | Bacteria | 12093 |
| 592 | Ga0495623_0118152 | 3300046679 | Bacteria | 1600 |
| 593 | Ga0495646_0009130 | 3300046680 | Bacteria | 6289 |
| 594 | Ga0495646_0034366 | 3300046680 | Bacteria | 3148 |
| 595 | Ga0495646_0067333 | 3300046680 | Bacteria | 2116 |
| 596 | Ga0495669_0078622 | 3300046684 | Bacteria | 1511 |
| 597 | Ga0495613_0027240 | 3300046689 | Bacteria | 4253 |
| 598 | Ga0495613_0107054 | 3300046689 | Bacteria | 2017 |
| 599 | Ga0495613_0251741 | 3300046689 | Bacteria | 1232 |
| 600 | Ga0495624_0000296 | 3300046690 | Bacteria | 39250 |
| 601 | Ga0495624_0005199 | 3300046690 | Bacteria | 9406 |
| 602 | Ga0495624_0012568 | 3300046690 | Bacteria | 5780 |
| 603 | Ga0495624_0020044 | 3300046690 | Bacteria | 4455 |
| 604 | Ga0495670_0000233 | 3300046691 | Bacteria | 25407 |
| 605 | Ga0495670_0003053 | 3300046691 | Bacteria | 8258 |
| 606 | Ga0495670_0018119 | 3300046691 | Bacteria | 3467 |
| 607 | Ga0495670_0058208 | 3300046691 | Bacteria | 1940 |
| 608 | Ga0495670_0203681 | 3300046691 | Bacteria | 1048 |
| 609 | Ga0495671_0000069 | 3300046692 | Bacteria | 98738 |
| 610 | Ga0495671_0003043 | 3300046692 | Bacteria | 10417 |
| 611 | Ga0495671_0004677 | 3300046692 | Bacteria | 8105 |
| 612 | Ga0495671_0010107 | 3300046692 | Bacteria | 5246 |
| 613 | Ga0495671_0022361 | 3300046692 | Bacteria | 3314 |
| 614 | Ga0495671_0023762 | 3300046692 | Bacteria | 3200 |
| 615 | Ga0495671_0058357 | 3300046692 | Bacteria | 1909 |
| 616 | Ga0495671_0080258 | 3300046692 | Bacteria | 1598 |
| 617 | Ga0495671_0105697 | 3300046692 | Bacteria | 1374 |
| 618 | Ga0495671_0114872 | 3300046692 | Bacteria | 1314 |
| 619 | Ga0495671_0125148 | 3300046692 | Bacteria | 1253 |
| 620 | Ga0495649_0000420 | 3300046694 | Bacteria | 36874 |
| 621 | Ga0495649_0000900 | 3300046694 | Bacteria | 23592 |
| 622 | Ga0495649_0003545 | 3300046694 | Bacteria | 10486 |
| 623 | Ga0495649_0013341 | 3300046694 | Bacteria | 4741 |
| 624 | Ga0495649_0014290 | 3300046694 | Bacteria | 4557 |
| 625 | Ga0495649_0017443 | 3300046694 | Bacteria | 4049 |
| 626 | Ga0495649_0034773 | 3300046694 | Bacteria | 2772 |
| 627 | Ga0495649_0059766 | 3300046694 | Bacteria | 2051 |
| 628 | Ga0495649_0151830 | 3300046694 | Bacteria | 1216 |
| 629 | Ga0495589_0000480 | 3300046794 | Bacteria | 28684 |
| 630 | Ga0495589_0000496 | 3300046794 | Bacteria | 27951 |
| 631 | Ga0495589_0002087 | 3300046794 | Bacteria | 11299 |
| 632 | Ga0495589_0005297 | 3300046794 | Bacteria | 6814 |
| 633 | Ga0495589_0038636 | 3300046794 | Bacteria | 2388 |
| 634 | Ga0495589_0064514 | 3300046794 | Bacteria | 1795 |
| 635 | Ga0495589_0100547 | 3300046794 | Bacteria | 1399 |
| 636 | Ga0495600_0010631 | 3300046809 | Bacteria | 5718 |
| 637 | Ga0495600_0041384 | 3300046809 | Bacteria | 3002 |
| 638 | Ga0495600_0063181 | 3300046809 | Bacteria | 2419 |
| 639 | Ga0495660_0001405 | 3300046810 | Bacteria | 16525 |
| 640 | Ga0495660_0001621 | 3300046810 | Bacteria | 15107 |
| 641 | Ga0495660_0003347 | 3300046810 | Bacteria | 9944 |
| 642 | Ga0495660_0009593 | 3300046810 | Bacteria | 5642 |
| 643 | Ga0495660_0011038 | 3300046810 | Bacteria | 5245 |
| 644 | Ga0495660_0033621 | 3300046810 | Bacteria | 2873 |
| 645 | Ga0495660_0065049 | 3300046810 | Bacteria | 1947 |
| 646 | Ga0495660_0090796 | 3300046810 | Bacteria | 1588 |
| 647 | Ga0495604_0001809 | 3300047317 | Bacteria | 17426 |
| 648 | Ga0495604_0013801 | 3300047317 | Bacteria | 6442 |
| 649 | Ga0495604_0016776 | 3300047317 | Bacteria | 5859 |
| 650 | Ga0495604_0039684 | 3300047317 | Bacteria | 3699 |
| 651 | Ga0495604_0045817 | 3300047317 | Bacteria | 3411 |
| 652 | Ga0495604_0054424 | 3300047317 | Bacteria | 3087 |
| 653 | Ga0495674_0009594 | 3300047319 | Bacteria | 9194 |
| 654 | Ga0495674_0020324 | 3300047319 | Bacteria | 6149 |
| 655 | Ga0495674_0025373 | 3300047319 | Bacteria | 5435 |
| 656 | Ga0495674_0026993 | 3300047319 | Bacteria | 5252 |
| 657 | Ga0495674_0027624 | 3300047319 | Bacteria | 5183 |
| 658 | Ga0495674_0152169 | 3300047319 | Bacteria | 1939 |
| 659 | Ga0495672_0000487 | 3300047320 | Bacteria | 46342 |
| 660 | Ga0495672_0000645 | 3300047320 | Bacteria | 38766 |
| 661 | Ga0495672_0000680 | 3300047320 | Bacteria | 37902 |
| 662 | Ga0495672_0008214 | 3300047320 | Bacteria | 7739 |
| 663 | Ga0495672_0016638 | 3300047320 | Bacteria | 4945 |
| 664 | Ga0495672_0019069 | 3300047320 | Bacteria | 4535 |
| 665 | Ga0495672_0019848 | 3300047320 | Bacteria | 4420 |
| 666 | Ga0495672_0021118 | 3300047320 | Bacteria | 4251 |
| 667 | Ga0495672_0025389 | 3300047320 | Bacteria | 3794 |
| 668 | Ga0495672_0037650 | 3300047320 | Bacteria | 2957 |
| 669 | Ga0495672_0044250 | 3300047320 | Bacteria | 2672 |
| 670 | Ga0495672_0044854 | 3300047320 | Bacteria | 2649 |
| 671 | Ga0495672_0125651 | 3300047320 | Bacteria | 1357 |
| 672 | Ga0495672_0157562 | 3300047320 | Bacteria | 1171 |
| 673 | Ga0495672_0182543 | 3300047320 | Bacteria | 1061 |
| 674 | Ga0495672_0235124 | 3300047320 | Bacteria | 897 |
| 675 | Ga0495676_0000081 | 3300047321 | Bacteria | 70377 |
| 676 | Ga0495680_0003333 | 3300047322 | Bacteria | 15875 |
| 677 | Ga0495680_0013929 | 3300047322 | Bacteria | 6994 |
| 678 | Ga0495680_0047314 | 3300047322 | Bacteria | 3384 |
| 679 | Ga0495680_0094603 | 3300047322 | Bacteria | 2235 |
| 680 | Ga0495683_0000027 | 3300047323 | Bacteria | 153730 |
| 681 | Ga0495683_0000135 | 3300047323 | Bacteria | 72196 |
| 682 | Ga0495683_0000471 | 3300047323 | Bacteria | 31258 |
| 683 | Ga0495683_0024392 | 3300047323 | Bacteria | 3104 |
| 684 | Ga0495683_0035554 | 3300047323 | Bacteria | 2532 |
| 685 | Ga0495683_0070075 | 3300047323 | Bacteria | 1722 |
| 686 | Ga0495683_0070986 | 3300047323 | Bacteria | 1709 |
| 687 | Ga0495683_0129842 | 3300047323 | Bacteria | 1189 |
| 688 | Ga0495687_017683 | 3300047443 | Bacteria | 3544 |
| 689 | Ga0495687_033263 | 3300047443 | Bacteria | 2341 |
| 690 | Ga0495687_056572 | 3300047443 | Bacteria | 1635 |
| 691 | Ga0495675_0001310 | 3300047444 | Bacteria | 15075 |
| 692 | Ga0495675_0170489 | 3300047444 | Bacteria | 1337 |
| 693 | Ga0495677_0027955 | 3300047445 | Bacteria | 2046 |
| 694 | Ga0495677_0031168 | 3300047445 | Bacteria | 1941 |
| 695 | Ga0495679_000110 | 3300047446 | Bacteria | 74091 |
| 696 | Ga0495679_000186 | 3300047446 | Bacteria | 54909 |
| 697 | Ga0495679_000246 | 3300047446 | Bacteria | 44791 |
| 698 | Ga0495679_000775 | 3300047446 | Bacteria | 20284 |
| 699 | Ga0495679_006642 | 3300047446 | Bacteria | 4947 |
| 700 | Ga0495679_016313 | 3300047446 | Bacteria | 2690 |
| 701 | Ga0495679_016880 | 3300047446 | Bacteria | 2628 |
| 702 | Ga0495679_020174 | 3300047446 | Bacteria | 2325 |
| 703 | Ga0495679_030995 | 3300047446 | Bacteria | 1729 |
| 704 | Ga0495685_036396 | 3300047447 | Bacteria | 1690 |
| 705 | Ga0495673_0000611 | 3300047469 | Bacteria | 35502 |
| 706 | Ga0495673_0000613 | 3300047469 | Bacteria | 35247 |
| 707 | Ga0495673_0000946 | 3300047469 | Bacteria | 26295 |
| 708 | Ga0495673_0001275 | 3300047469 | Bacteria | 20727 |
| 709 | Ga0495673_0002624 | 3300047469 | Bacteria | 12458 |
| 710 | Ga0495673_0005054 | 3300047469 | Bacteria | 8074 |
| 711 | Ga0495673_0007699 | 3300047469 | Bacteria | 6152 |
| 712 | Ga0495673_0011445 | 3300047469 | Bacteria | 4769 |
| 713 | Ga0495673_0014183 | 3300047469 | Bacteria | 4150 |
| 714 | Ga0495673_0025348 | 3300047469 | Bacteria | 2849 |
| 715 | Ga0495673_0027195 | 3300047469 | Bacteria | 2725 |
| 716 | Ga0495673_0050394 | 3300047469 | Bacteria | 1827 |
| 717 | Ga0495673_0090906 | 3300047469 | Bacteria | 1247 |
| 718 | Ga0495673_0115760 | 3300047469 | Bacteria | 1066 |
| 719 | Ga0495681_0000503 | 3300047470 | Bacteria | 29854 |
| 720 | Ga0495681_0000950 | 3300047470 | Bacteria | 22262 |
| 721 | Ga0495681_0001126 | 3300047470 | Bacteria | 20301 |
| 722 | Ga0495681_0003859 | 3300047470 | Bacteria | 10362 |
| 723 | Ga0495681_0011086 | 3300047470 | Bacteria | 5402 |
| 724 | Ga0495681_0017071 | 3300047470 | Bacteria | 4044 |
| 725 | Ga0495681_0026491 | 3300047470 | Bacteria | 3015 |
| 726 | Ga0495681_0028912 | 3300047470 | Bacteria | 2844 |
| 727 | Ga0495681_0064088 | 3300047470 | Bacteria | 1684 |
| 728 | Ga0495681_0107476 | 3300047470 | Bacteria | 1212 |
| 729 | Ga0495684_0268259 | 3300047471 | Bacteria | 1236 |
| 730 | Ga0495686_0000012 | 3300047472 | Bacteria | 508428 |
| 731 | Ga0495686_0001458 | 3300047472 | Bacteria | 25781 |
| 732 | Ga0495686_0008877 | 3300047472 | Bacteria | 7312 |
| 733 | Ga0495686_0015030 | 3300047472 | Bacteria | 5305 |
| 734 | Ga0495686_0022026 | 3300047472 | Bacteria | 4220 |
| 735 | Ga0495686_0025466 | 3300047472 | Bacteria | 3878 |
| 736 | Ga0495686_0068210 | 3300047472 | Bacteria | 2194 |
| 737 | Ga0495686_0097489 | 3300047472 | Bacteria | 1777 |
| 738 | Ga0495686_0118747 | 3300047472 | Bacteria | 1578 |
| 739 | Ga0495686_0126438 | 3300047472 | Bacteria | 1519 |
| 740 | Ga0495593_0001027 | 3300047673 | Bacteria | 16375 |
| 741 | Ga0495593_0005749 | 3300047673 | Bacteria | 7318 |
| 742 | Ga0495593_0024606 | 3300047673 | Bacteria | 3336 |
| 743 | Ga0495593_0034535 | 3300047673 | Bacteria | 2750 |
| 744 | Ga0495593_0098826 | 3300047673 | Bacteria | 1498 |
| 745 | Ga0495593_0107216 | 3300047673 | Bacteria | 1428 |
| 746 | Ga0495593_0217878 | 3300047673 | Bacteria | 958 |
| 747 | Ga0495602_0099636 | 3300048088 | Bacteria | 2388 |
| 748 | Ga0495602_0230343 | 3300048088 | Bacteria | 1392 |
| 749 | Ga0495614_0064177 | 3300048089 | Bacteria | 1579 |
| 750 | Ga0495626_0000256 | 3300048091 | Bacteria | 60994 |
| 751 | Ga0495626_0002346 | 3300048091 | Bacteria | 13339 |
| 752 | Ga0495626_0010868 | 3300048091 | Bacteria | 4834 |
| 753 | Ga0495626_0022642 | 3300048091 | Bacteria | 3101 |
| 754 | Ga0495626_0026901 | 3300048091 | Bacteria | 2799 |
| 755 | Ga0495626_0027428 | 3300048091 | Bacteria | 2769 |
| 756 | Ga0495626_0079542 | 3300048091 | Bacteria | 1458 |
| 757 | Ga0495626_0119387 | 3300048091 | Bacteria | 1135 |
| 758 | Ga0496100_0000354 | 3300048903 | Bacteria | 22328 |
| 759 | Ga0496101_0000527 | 3300048904 | Bacteria | 23690 |
| 760 | Ga0496101_0191280 | 3300048904 | Bacteria | 1579 |
| 761 | Ga0496101_0363666 | 3300048904 | Bacteria | 1137 |
| 762 | Ga0496102_0000563 | 3300048905 | Bacteria | 39364 |
| 763 | Ga0496102_0002557 | 3300048905 | Bacteria | 15519 |
| 764 | Ga0496102_0144964 | 3300048905 | Bacteria | 2228 |
| 765 | Ga0496103_0000752 | 3300048906 | Bacteria | 23872 |
| 766 | Ga0496104_0037712 | 3300048907 | Bacteria | 4519 |
| 767 | Ga0496104_0040778 | 3300048907 | Bacteria | 4352 |
| 768 | Ga0496104_0287201 | 3300048907 | Bacteria | 1557 |
| 769 | Ga0496105_0269813 | 3300048908 | Bacteria | 1374 |
| 770 | Ga0496111_0133890 | 3300048914 | Bacteria | 1835 |
| 771 | Ga0496111_0152976 | 3300048914 | Bacteria | 1711 |
| 772 | Ga0496112_0007724 | 3300048915 | Bacteria | 9568 |
| 773 | Ga0496112_0230769 | 3300048915 | Bacteria | 1805 |
| 774 | Ga0496112_0346049 | 3300048915 | Bacteria | 1429 |
| 775 | Ga0496113_0009043 | 3300048916 | Bacteria | 6524 |
| 776 | Ga0496113_0071880 | 3300048916 | Bacteria | 2632 |
| 777 | Ga0496113_0286823 | 3300048916 | Bacteria | 1317 |
| 778 | Ga0496113_0343718 | 3300048916 | Bacteria | 1197 |
| 779 | Ga0496115_0100202 | 3300048918 | Bacteria | 2375 |
| 780 | Ga0496116_0000415 | 3300048919 | Bacteria | 60526 |
| 781 | Ga0496116_0000638 | 3300048919 | Bacteria | 45765 |
| 782 | Ga0496116_0026677 | 3300048919 | Bacteria | 4217 |
| 783 | Ga0496116_0040432 | 3300048919 | Bacteria | 3211 |
| 784 | Ga0496116_0111014 | 3300048919 | Bacteria | 1611 |
| 785 | Ga0496117_0000266 | 3300048920 | Bacteria | 98856 |
| 786 | Ga0496117_0000507 | 3300048920 | Bacteria | 64318 |
| 787 | Ga0496117_0008301 | 3300048920 | Bacteria | 9882 |
| 788 | Ga0496117_0053157 | 3300048920 | Bacteria | 2848 |
| 789 | Ga0496117_0130103 | 3300048920 | Bacteria | 1527 |
| 790 | Ga0496117_0142335 | 3300048920 | Bacteria | 1434 |
| 791 | Ga0496118_0020834 | 3300048921 | Bacteria | 5801 |
| 792 | Ga0496118_0050345 | 3300048921 | Bacteria | 3198 |
| 793 | Ga0496118_0086228 | 3300048921 | Bacteria | 2182 |
| 794 | Ga0496118_0139439 | 3300048921 | Bacteria | 1540 |
| 795 | Ga0496118_0153498 | 3300048921 | Bacteria | 1437 |
| 796 | Ga0496118_0163011 | 3300048921 | Bacteria | 1375 |
| 797 | Ga0496118_0184982 | 3300048921 | Bacteria | 1253 |
| 798 | Ga0496119_0000223 | 3300048922 | Bacteria | 79814 |
| 799 | Ga0496119_0036446 | 3300048922 | Bacteria | 3210 |
| 800 | Ga0496119_0233952 | 3300048922 | Bacteria | 933 |
| 801 | Ga0496120_0000254 | 3300048923 | Bacteria | 89523 |
| 802 | Ga0496120_0011371 | 3300048923 | Bacteria | 6122 |
| 803 | Ga0496121_0003148 | 3300048924 | Bacteria | 23801 |
| 804 | Ga0496121_0003838 | 3300048924 | Bacteria | 20899 |
| 805 | Ga0496121_0006375 | 3300048924 | Bacteria | 14690 |
| 806 | Ga0496121_0006873 | 3300048924 | Bacteria | 13909 |
| 807 | Ga0496121_0028909 | 3300048924 | Bacteria | 5147 |
| 808 | Ga0496121_0072840 | 3300048924 | Bacteria | 2756 |
| 809 | Ga0496121_0160826 | 3300048924 | Bacteria | 1642 |
| 810 | Ga0496121_0247972 | 3300048924 | Bacteria | 1236 |
| 811 | Ga0496121_0280095 | 3300048924 | Bacteria | 1141 |
| 812 | Ga0496121_0292848 | 3300048924 | Bacteria | 1108 |
| 813 | Ga0496122_0001077 | 3300048925 | Bacteria | 47364 |
| 814 | Ga0496122_0003544 | 3300048925 | Bacteria | 20415 |
| 815 | Ga0496122_0038158 | 3300048925 | Bacteria | 3854 |
| 816 | Ga0496122_0040109 | 3300048925 | Bacteria | 3726 |
| 817 | Ga0496122_0056309 | 3300048925 | Bacteria | 2932 |
| 818 | Ga0496122_0150655 | 3300048925 | Bacteria | 1436 |
| 819 | Ga0496122_0201445 | 3300048925 | Bacteria | 1163 |
| 820 | Ga0496122_0228716 | 3300048925 | Bacteria | 1059 |
| 821 | Ga0496123_0001931 | 3300048926 | Bacteria | 27034 |
| 822 | Ga0496123_0009796 | 3300048926 | Bacteria | 8561 |
| 823 | Ga0496123_0033254 | 3300048926 | Bacteria | 3713 |
| 824 | Ga0496123_0050957 | 3300048926 | Bacteria | 2761 |
| 825 | Ga0496123_0066875 | 3300048926 | Bacteria | 2274 |
| 826 | Ga0496123_0084712 | 3300048926 | Bacteria | 1910 |
| 827 | Ga0496123_0197249 | 3300048926 | Bacteria | 1035 |
| 828 | Ga0496124_0000222 | 3300048927 | Bacteria | 110854 |
| 829 | Ga0496124_0000537 | 3300048927 | Bacteria | 64567 |
| 830 | Ga0496124_0001864 | 3300048927 | Bacteria | 29037 |
| 831 | Ga0496124_0005123 | 3300048927 | Bacteria | 14925 |
| 832 | Ga0496124_0005908 | 3300048927 | Bacteria | 13545 |
| 833 | Ga0496124_0122676 | 3300048927 | Bacteria | 2074 |
| 834 | Ga0496124_0181960 | 3300048927 | Bacteria | 1616 |
| 835 | Ga0496124_0276782 | 3300048927 | Bacteria | 1226 |
| 836 | Ga0496125_0000565 | 3300048928 | Bacteria | 63608 |
| 837 | Ga0496125_0081717 | 3300048928 | Bacteria | 2467 |
| 838 | Ga0496125_0185508 | 3300048928 | Bacteria | 1380 |
| 839 | Ga0496126_0011328 | 3300048929 | Bacteria | 9245 |
| 840 | Ga0496126_0338010 | 3300048929 | Bacteria | 1234 |
| 841 | Ga0466983_0065679 | 3300048986 | Bacteria | 3045 |
| 842 | Ga0495678_000031 | 3300049459 | Bacteria | 215528 |
| 843 | Ga0495678_000039 | 3300049459 | Bacteria | 191665 |
| 844 | Ga0495678_001875 | 3300049459 | Bacteria | 15281 |
| 845 | Ga0495678_003174 | 3300049459 | Bacteria | 10359 |
| 846 | Ga0495678_016209 | 3300049459 | Bacteria | 3413 |
| 847 | Ga0495678_017566 | 3300049459 | Bacteria | 3237 |
| 848 | Ga0495678_022461 | 3300049459 | Bacteria | 2758 |
| 849 | Ga0495678_022746 | 3300049459 | Bacteria | 2736 |
| 850 | Ga0495678_039511 | 3300049459 | Bacteria | 1903 |
| 851 | Ga0495678_045556 | 3300049459 | Bacteria | 1729 |
| 852 | Ga0495678_055025 | 3300049459 | Bacteria | 1520 |
| 853 | Ga0495678_080206 | 3300049459 | Bacteria | 1173 |
| 854 | Ga0495682_0000300 | 3300049460 | Bacteria | 37560 |
| 855 | Ga0495682_0000765 | 3300049460 | Bacteria | 20604 |
| 856 | Ga0495682_0001588 | 3300049460 | Bacteria | 11806 |
| 857 | Ga0495682_0013710 | 3300049460 | Bacteria | 3081 |
| 858 | Ga0495682_0023668 | 3300049460 | Bacteria | 2291 |
| 859 | Ga0495682_0077171 | 3300049460 | Bacteria | 1198 |
| 860 | Ga0501031_0068038 | 3300049568 | Bacteria | 2320 |
| 861 | Ga0501034_0115534 | 3300049571 | Bacteria | 2672 |
| 862 | Ga0501222_001005 | 3300049662 | Bacteria | 4017 |
| 863 | Ga0501227_000772 | 3300049665 | Bacteria | 6981 |
| 864 | Ga0501241_000077 | 3300049758 | Bacteria | 22143 |
| 865 | Ga0501226_000674 | 3300049853 | Bacteria | 4636 |
| 866 | Ga0500572_000450 | 3300053111 | Bacteria | 14295 |
| 867 | Ga0500618_010032 | 3300053125 | Bacteria | 2557 |
| 868 | Ga0500634_0000121 | 3300053161 | Bacteria | 29459 |
| 869 | 637322234 | 637000220 | Bacteria | 7074893 |
| 870 | 2501074096 | 2501025501 | Bacteria | 7768574 |
| 871 | 2501083696 | 2501025502 | Bacteria | 9641094 |
| 872 | 2501413225 | 2501025504 | Bacteria | 8008976 |
| 873 | 2511087474 | 2510917013 | Bacteria | 9951648 |
| 874 | 2511100332 | 2510917014 | Bacteria | 8296963 |
| 875 | 2511106003 | 2510917015 | Bacteria | 7950052 |
| 876 | 2511274484 | 2511231007 | Bacteria | 6306603 |
| 877 | 2511289192 | 2511231010 | Bacteria | 6373152 |
| 878 | 2511298188 | 2511231011 | Bacteria | 6149768 |
| 879 | 2511301962 | 2511231012 | Bacteria | 6738011 |
| 880 | 2511313428 | 2511231014 | Bacteria | 6462302 |
| 881 | 2511321253 | 2511231015 | Bacteria | 6598026 |
| 882 | 2511334801 | 2511231017 | Bacteria | 6503007 |
| 883 | 2511339986 | 2511231018 | Bacteria | 6436256 |
| 884 | 2511346748 | 2511231019 | Bacteria | 6520662 |
| 885 | 2511348570 | 2511231020 | Bacteria | 6115223 |
| 886 | 2511355051 | 2511231021 | Bacteria | 7302637 |
| 887 | 2511414808 | 2511231031 | Bacteria | 6558529 |
| 888 | 2513551916 | 2513237082 | Bacteria | 8640282 |
| 889 | 2513563314 | 2513237083 | Bacteria | 8410967 |
| 890 | 2514054155 | 2513237166 | Bacteria | 10373764 |
| 891 | 2516017820 | 2515154189 | Bacteria | 9629850 |
| 892 | 2519458766 | 2519103095 | Bacteria | 6629912 |
| 893 | 2554813711 | 2554235132 | Bacteria | 6772433 |
| 894 | 2555671823 | 2554235341 | Bacteria | 6867980 |
| 895 | 2563058672 | 2562617112 | Bacteria | 10918404 |
| 896 | 2585292415 | 2582581311 | Bacteria | 6763856 |
| 897 | 2597869296 | 2597489889 | Bacteria | 6297495 |
| 898 | 2599354021 | 2599185160 | Bacteria | 6844013 |
| 899 | 2599360300 | 2599185161 | Bacteria | 6960462 |
| 900 | 2599366622 | 2599185162 | Bacteria | 6957254 |
| 901 | 2599373411 | 2599185163 | Bacteria | 6995158 |
| 902 | 2599379129 | 2599185164 | Bacteria | 6841688 |
| 903 | 2599385893 | 2599185165 | Bacteria | 6843250 |
| 904 | 2599392270 | 2599185166 | Bacteria | 6959206 |
| 905 | 2599404036 | 2599185168 | Bacteria | 6997636 |
| 906 | 2599460855 | 2599185181 | Bacteria | 6844519 |
| 907 | 2599470402 | 2599185182 | Bacteria | 6883168 |
| 908 | 2599489876 | 2599185186 | Bacteria | 6831633 |
| 909 | 2599740635 | 2599185239 | Bacteria | 8686614 |
| 910 | 2599975359 | 2599185307 | Bacteria | 6194719 |
| 911 | 2600213470 | 2599185356 | Bacteria | 6843884 |
| 912 | 2601625711 | 2600255283 | Bacteria | 6061572 |
| 913 | 2601773637 | 2600255313 | Bacteria | 6842543 |
| 914 | 2601796832 | 2600255318 | Bacteria | 6383414 |
| 915 | 2606073982 | 2603880185 | Bacteria | 6379190 |
| 916 | 2606126373 | 2603880199 | Bacteria | 6377649 |
| 917 | 2608381126 | 2606217733 | Bacteria | 6360972 |
| 918 | 2624482529 | 2623620443 | Bacteria | 6427864 |
| 919 | 2643844301 | 2643221565 | Bacteria | 6216018 |
| 920 | 2643952257 | 2643221589 | Bacteria | 6250934 |
| 921 | 2644023981 | 2643221602 | Bacteria | 6249926 |
| 922 | 2644187132 | 2643221633 | Bacteria | 6733554 |
| 923 | 2644622581 | 2643221713 | Bacteria | 6554480 |
| 924 | 2671096603 | 2667528171 | Bacteria | 6900659 |
| 925 | 2713476679 | 2711768613 | Bacteria | 11048459 |
| 926 | 2715750521 | 2713897148 | Bacteria | 5883533 |
| 927 | 2715755076 | 2713897149 | Bacteria | 6506249 |
| 928 | 2718635731 | 2718217725 | Bacteria | 5758958 |
| 929 | 2739256817 | 2738543015 | Bacteria | 6750701 |
| 930 | 2739315576 | 2738543025 | Bacteria | 6600348 |
| 931 | 2746089321 | 2744054900 | Bacteria | 8399525 |
| 932 | 2746099483 | 2744054901 | Bacteria | 8397047 |
| 933 | 2774123014 | 2773857670 | Bacteria | 6407454 |
| 934 | 2774128528 | 2773857672 | Bacteria | 4993178 |
| 935 | 2774133408 | 2773857673 | Bacteria | 6513460 |
| 936 | 2784262712 | 2784132063 | Bacteria | 6262788 |
| 937 | 2784315372 | 2784132072 | Bacteria | 6596533 |
| 938 | 2808930421 | 2808606377 | Bacteria | 6646337 |
| 939 | 2808952543 | 2808606381 | Bacteria | 6646461 |
| 940 | 2808960464 | 2808606382 | Bacteria | 6841132 |
| 941 | 2808973219 | 2808606384 | Bacteria | 8474373 |
| 942 | 2809008843 | 2808606390 | Bacteria | 8476311 |
| 943 | 2809015048 | 2808606391 | Bacteria | 8308166 |
| 944 | 2809218405 | 2808606445 | Bacteria | 6057339 |
| 945 | 2812370976 | 2811994881 | Bacteria | 6298475 |
| 946 | 2817261038 | 2816332253 | Bacteria | 6764532 |
| 947 | 2817278733 | 2816332256 | Bacteria | 6891714 |
| 948 | 2817451808 | 2816332286 | Bacteria | 6853759 |
| 949 | 2819637102 | 2818991452 | Bacteria | 8442785 |
| 950 | 2819656211 | 2818991456 | Bacteria | 6123676 |
| 951 | 2819701696 | 2818991464 | Bacteria | 6907494 |
| 952 | 2842327792 | 2842324504 | Bacteria | 9364110 |
| 953 | 2842351600 | 2842348783 | Bacteria | 9002918 |
| 954 | 2842460588 | 2842454564 | Bacteria | 8730687 |
| 955 | 2842837379 | 2842832357 | Bacteria | 5959113 |
| 956 | 2842845172 | 2842843487 | Bacteria | 6004777 |
| 957 | 2842860062 | 2842854478 | Bacteria | 6143501 |
| 958 | 2844665981 | 2844665904 | Bacteria | 6817974 |
| 959 | 2852660731 | 2852657418 | Bacteria | 6472974 |
| 960 | 2856291101 | 2856287931 | Bacteria | 7223934 |
| 961 | 2857364139 | 2857357740 | Bacteria | 9937880 |
| 962 | 2860341393 | 2860339153 | Bacteria | 6846989 |
| 963 | 2878034458 | 2878029506 | Bacteria | 6418441 |
| 964 | 2880235102 | 2880230671 | Bacteria | 6140320 |
| 965 | 2883090844 | 2883087390 | Bacteria | 9532701 |
| 966 | 2904521471 | 2904518522 | Bacteria | 6068986 |
| 967 | 2904551156 | 2904550169 | Bacteria | 6221258 |
| 968 | 2904565230 | 2904564687 | Bacteria | 7609577 |
| 969 | 2904572074 | 2904571731 | Bacteria | 7608790 |
| 970 | 2908447878 | 2908446538 | Bacteria | 6829095 |
| 971 | 2917075694 | 2917070673 | Bacteria | 6868303 |
| 972 | 2919066483 | 2919063839 | Bacteria | 6302690 |
| 973 | 2919158304 | 2919155634 | Bacteria | 4860545 |
| 974 | 2919459500 | 2919456309 | Bacteria | 6586567 |
| 975 | 2919490157 | 2919487758 | Bacteria | 5929766 |
| 976 | 2921651820 | 2921643360 | Bacteria | 11448031 |
| 977 | 2923525083 | 2923519811 | Bacteria | 6298479 |
| 978 | 2928160363 | 2928157003 | Bacteria | 7522202 |
| 979 | 2928170600 | 2928163908 | Bacteria | 7561269 |
| 980 | 2928176649 | 2928170801 | Bacteria | 8785406 |
| 981 | 2928537393 | 2928536128 | Bacteria | 7657547 |
| 982 | 2929192498 | 2929189879 | Bacteria | 5930554 |
| 983 | 2931397140 | 2931396565 | Bacteria | 7251677 |
| 984 | 2935356683 | 2935353572 | Unclassified | 6955622 |
| 985 | 2939638072 | 2939636861 | Bacteria | 6297853 |
| 986 | 2945929510 | 2945928738 | Bacteria | 6053221 |
| 987 | 2945965789 | 2945961074 | Bacteria | 7342064 |
| 988 | 2946011784 | 2946006987 | Bacteria | 6705746 |
| 989 | 2969309239 | 2969304461 | Bacteria | 6601805 |
| 990 | 2981996322 | 2981990288 | Bacteria | 7590678 |
| 991 | 2984501670 | 2984499530 | Bacteria | 5020881 |
| 992 | 2998144515 | 2998139840 | Bacteria | 6073514 |
| 993 | 3007319332 | 3007315729 | Bacteria | 5076637 |
| 994 | 3007424900 | 3007419365 | Bacteria | 7026924 |
| 995 | 3007516311 | 3007511990 | Bacteria | 6481491 |
| 996 | 3007623355 | 3007619802 | Bacteria | 6411688 |
| 997 | 3007720259 | 3007718800 | Bacteria | 5971527 |
| 998 | 3007858501 | 3007855910 | Bacteria | 5637581 |
| 999 | 3007865974 | 3007861166 | Bacteria | 6045338 |
| 1000 | 3007871107 | 3007866637 | Bacteria | 5899198 |
| 1001 | 642418967 | 641736154 | Bacteria | 7689995 |
| 1002 | 8003957083 | 8003955200 | Bacteria | 8601927 |
| 1003 | 8011356606 | 8011350971 | Bacteria | 6158957 |
| 1004 | 8018845647 | 8018845410 | Bacteria | 8933938 |
| 1005 | 8020813255 | 8020807995 | Bacteria | 6801506 |
| 1006 | 8021123093 | 8021120328 | Bacteria | 8782274 |
| 1007 | 8029996368 | 8029995093 | Bacteria | 5990776 |
| 1008 | 8040169982 | 8040167225 | Bacteria | 6542727 |
| 1009 | 8040173447 | 8040173305 | Bacteria | 6827067 |
| 1010 | 8055273594 | 8055266321 | Bacteria | 7999742 |
| 1011 | 8055819097 | 8055817908 | Bacteria | 6609162 |
| 1012 | 8056127142 | 8056125926 | Bacteria | 6228218 |
| 1013 | 8056148065 | 8056143049 | Bacteria | 6307666 |
| 1014 | 8056154705 | 8056148874 | Bacteria | 6479865 |
| 1015 | 8056166829 | 8056161164 | Bacteria | 6106669 |
| 1016 | 8056172061 | 8056166840 | Bacteria | 5820959 |
| 1017 | 8056180516 | 8056177738 | Bacteria | 6748268 |
| 1018 | MRS2a_Contig_175 | |||
| 1019 | MRS2a_Contig_977 | |||
| 1020 | JGI24739J22299_10015584 | |||
| 1021 | JGI25162J39368_1000034 | |||
| 1022 | JGI25163J39215_1000345 | |||
| 1023 | JGI25164J39214_1000018 | |||
| 1024 | JGI25165J46597_1000123 | |||
| 1025 | rootL2_10084227 | |||
| 1026 | JGI25160J50197_1000151 | |||
| 1027 | Ga0055532_1000392 | |||
| 1028 | Ga0055532_1000449 | |||
| 1029 | Ga0055527_1000492 | |||
| 1030 | Ga0055535_1000254 | |||
| 1031 | Ga0055542_1000291 | |||
| 1032 | Ga0055529_1000290 | |||
| 1033 | Ga0055530_10015417 | |||
| 1034 | Ga0055540_1000229 | |||
| 1035 | Ga0055531_10000140 | |||
| 1036 | Ga0058692_1006666 | |||
| 1037 | Ga0065165_1000789 | |||
| 1038 | Ga0065714_10002842 | |||
| 1039 | Ga0065714_10066993 | |||
| 1040 | Ga0065712_10113511 | |||
| 1041 | Ga0065715_10000901 | |||
| 1042 | Ga0070658_10180301 | |||
| 1043 | Ga0070665_100163899 | |||
| 1044 | Ga0068855_100082194 | |||
| 1045 | Ga0075432_10013513 | |||
| 1046 | Ga0075432_10146812 | |||
| 1047 | Ga0075369_10083665 | |||
| 1048 | Ga0079104_1000285 | |||
| 1049 | Ga0105251_10000124 | |||
| 1050 | Ga0105251_10009119 | |||
| 1051 | Ga0105251_10016845 | |||
| 1052 | Ga0105251_10062689 | |||
| 1053 | Ga0105251_10100719 | |||
| 1054 | Ga0105244_10000053 | |||
| 1055 | Ga0105244_10001897 | |||
| 1056 | Ga0105244_10068651 | |||
| 1057 | Ga0105244_10097843 | |||
| 1058 | Ga0105244_10101493 | |||
| 1059 | Ga0105244_10105733 | |||
| 1060 | Ga0105244_10108358 | |||
| 1061 | Ga0105244_10149346 | |||
| 1062 | Ga0105250_10035181 | |||
| 1063 | Ga0105250_10048284 | |||
| 1064 | Ga0105243_10000133 | |||
| 1065 | Ga0105243_10002559 | |||
| 1066 | Ga0105243_10105900 | |||
| 1067 | Ga0105248_10074471 | |||
| 1068 | Ga0105249_10509945 | |||
| 1069 | Ga0157345_1000010 | |||
| 1070 | Ga0157373_10000311 | |||
| 1071 | Ga0157373_10000672 | |||
| 1072 | Ga0157373_10017233 | |||
| 1073 | Ga0157373_10053316 | |||
| 1074 | Ga0157373_10087888 | |||
| 1075 | Ga0157373_10237939 | |||
| 1076 | Ga0157371_10000730 | |||
| 1077 | Ga0157371_10003726 | |||
| 1078 | Ga0157370_10053876 | |||
| 1079 | Ga0157370_10064909 | |||
| 1080 | Ga0157370_10090265 | |||
| 1081 | Ga0157370_10095963 | |||
| 1082 | Ga0157369_10001717 | |||
| 1083 | Ga0157369_10011964 | |||
| 1084 | Ga0157369_10023273 | |||
| 1085 | Ga0157369_10201461 | |||
| 1086 | Ga0163162_10071390 | |||
| 1087 | Ga0157372_10003539 | |||
| 1088 | Ga0157372_10020323 | |||
| 1089 | Ga0157372_10096671 | |||
| 1090 | Ga0157375_10003511 | |||
| 1091 | Ga0157375_10165303 | |||
| 1092 | Ga0182008_10001305 | |||
| 1093 | Ga0182008_10007301 | |||
| 1094 | Ga0182008_10051392 | |||
| 1095 | Ga0182008_10094761 | |||
| 1096 | Ga0182006_1000259 | |||
| 1097 | Ga0182006_1005747 | |||
| 1098 | Ga0182006_1010009 | |||
| 1099 | Ga0182006_1016082 | |||
| 1100 | Ga0182006_1025853 | |||
| 1101 | Ga0182006_1035255 | |||
| 1102 | Ga0182007_10001758 | |||
| 1103 | Ga0182007_10007208 | |||
| 1104 | Ga0182007_10083808 | |||
| 1105 | Ga0182005_1001180 | |||
| 1106 | Ga0182005_1001799 | |||
| 1107 | Ga0182005_1009459 | |||
| 1108 | Ga0182005_1050489 | |||
| 1109 | Ga0183361_10006 | |||
| 1110 | Ga0163161_10000469 | |||
| 1111 | Ga0163161_10002500 | |||
| 1112 | Ga0163161_10016164 | |||
| 1113 | Ga0163161_10041371 | |||
| 1114 | Ga0163161_10184380 | |||
| 1115 | Ga0163161_10190611 | |||
| 1116 | Ga0163161_10255502 | |||
| 1117 | Ga0163161_10265609 | |||
| 1118 | Ga0209760_100084 | |||
| 1119 | Ga0209566_100352 | |||
| 1120 | Ga0209672_100081 | |||
| 1121 | Ga0209672_101226 | |||
| 1122 | Ga0209147_100102 | |||
| 1123 | Ga0209147_100124 | |||
| 1124 | Ga0209563_100322 | |||
| 1125 | Ga0207427_100007 | |||
| 1126 | Ga0209437_100006 | |||
| 1127 | Ga0209258_100131 | |||
| 1128 | Ga0209148_1000130 | |||
| 1129 | Ga0209233_1000059 | |||
| 1130 | Ga0209565_1011659 | |||
| 1131 | Ga0209455_1000118 | |||
| 1132 | Ga0209673_1000028 | |||
| 1133 | Ga0209675_1008548 | |||
| 1134 | Ga0209676_1000010 | |||
| 1135 | Ga0209676_1001599 | |||
| 1136 | Ga0209676_1001982 | |||
| 1137 | Ga0209564_1004215 | |||
| 1138 | Ga0209050_1000019 | |||
| 1139 | Ga0209050_1001159 | |||
| 1140 | Ga0207426_1000125 | |||
| 1141 | Ga0209051_1000238 | |||
| 1142 | Ga0209051_1002663 | |||
| 1143 | Ga0209257_1000119 | |||
| 1144 | Ga0207696_1000179 | |||
| 1145 | Ga0207696_1000474 | |||
| 1146 | Ga0207696_1003414 | |||
| 1147 | Ga0207696_1012275 | |||
| 1148 | Ga0207696_1020029 | |||
| 1149 | Ga0207696_1043977 | |||
| 1150 | Ga0207655_1000049 | |||
| 1151 | Ga0207655_1000437 | |||
| 1152 | Ga0207655_1003954 | |||
| 1153 | Ga0207655_1011153 | |||
| 1154 | Ga0207655_1011550 | |||
| 1155 | Ga0207655_1013904 | |||
| 1156 | Ga0207655_1028544 | |||
| 1157 | Ga0207655_1030276 | |||
| 1158 | Ga0207655_1036683 | |||
| 1159 | Ga0207655_1041297 | |||
| 1160 | Ga0207655_1060284 | |||
| 1161 | Ga0207655_1067720 | |||
| 1162 | Ga0207713_1000219 | |||
| 1163 | Ga0207713_1000322 | |||
| 1164 | Ga0207713_1001158 | |||
| 1165 | Ga0207713_1007092 | |||
| 1166 | Ga0207713_1014348 | |||
| 1167 | Ga0207713_1075901 | |||
| 1168 | Ga0207713_1108296 | |||
| 1169 | Ga0207647_10007136 | |||
| 1170 | Ga0207705_10156140 | |||
| 1171 | Ga0207706_10002046 | |||
| 1172 | Ga0207709_10000013 | |||
| 1173 | Ga0207709_10000296 | |||
| 1174 | Ga0207709_10020767 | |||
| 1175 | Ga0207709_10126369 | |||
| 1176 | Ga0207711_10039704 | |||
| 1177 | Ga0207667_10035616 | |||
| 1178 | Ga0207712_10320008 | |||
| 1179 | Ga0209281_1000013 | |||
| 1180 | Ga0209281_1007856 | |||
| 1181 | Ga0209371_1000195 | |||
| 1182 | Ga0209371_1000326 | |||
| 1183 | Ga0209371_1000446 | |||
| 1184 | Ga0207428_10009548 | |||
| 1185 | Ga0207428_10134971 | |||
| 1186 | Ga0207428_10145629 | |||
| 1187 | Ga0207428_10186143 | |||
| 1188 | Ga0207428_10309227 | |||
| 1189 | Ga0268266_10400088 | |||
| 1190 | Ga0265338_10000045 | |||
| 1191 | Ga0268256_1000134 | |||
| 1192 | Ga0268256_1000168 | |||
| 1193 | Ga0268256_1000382 | |||
| 1194 | Ga0307511_10151860 | |||
| 1195 | Ga0316178_1018055 | |||
| 1196 | Ga0316183_1156053 | |||
| 1197 | Ga0265332_10022915 | |||
| 1198 | Ga0307408_100001237 | |||
| 1199 | Ga0307408_100003660 | |||
| 1200 | Ga0307408_100178381 | |||
| 1201 | Ga0307405_10001160 | |||
| 1202 | Ga0307405_10003535 | |||
| 1203 | Ga0307405_10014540 | |||
| 1204 | Ga0307406_10006514 | |||
| 1205 | Ga0307406_10574777 | |||
| 1206 | Ga0307407_10003333 | |||
| 1207 | Ga0307407_10209811 | |||
| 1208 | Ga0307412_10000577 | |||
| 1209 | Ga0307412_10025970 | |||
| 1210 | Ga0307412_10031846 | |||
| 1211 | Ga0307416_100061798 | |||
| 1212 | Ga0307416_100160353 | |||
| 1213 | Ga0307414_10018307 | |||
| 1214 | Ga0307414_10027034 | |||
| 1215 | Ga0307414_10112965 | |||
| 1216 | Ga0307414_10246130 | |||
| 1217 | Ga0307411_10008595 | |||
| 1218 | Ga0307411_10102194 | |||
| 1219 | Ga0307411_10181061 | |||
| 1220 | Ga0307510_10001045 | |||
| 1221 | Ga0307510_10055904 | |||
| 1222 | Ga0307510_10241994 | |||
| 1223 | Ga0395898_0380235 | |||
| 1224 | Ga0395905_0000076 | |||
| 1225 | Ga0439438_000189 | |||
| 1226 | Ga0439438_000276 | |||
| 1227 | Ga0439438_001012 | |||
| 1228 | Ga0439438_002308 | |||
| 1229 | Ga0439438_002423 | |||
| 1230 | Ga0439438_002988 | |||
| 1231 | Ga0439438_017083 | |||
| 1232 | Ga0439438_029636 | |||
| 1233 | Ga0439447_003254 | |||
| 1234 | Ga0439447_012130 | |||
| 1235 | Ga0439447_019196 | |||
| 1236 | Ga0439447_030707 | |||
| 1237 | Ga0439466_0002173 | |||
| 1238 | Ga0439466_0002558 | |||
| 1239 | Ga0439466_0010518 | |||
| 1240 | Ga0439466_0040358 | |||
| 1241 | Ga0439466_0087203 | |||
| 1242 | Ga0439432_001693 | |||
| 1243 | Ga0439432_005446 | |||
| 1244 | Ga0439432_007406 | |||
| 1245 | Ga0439432_008285 | |||
| 1246 | Ga0439432_012954 | |||
| 1247 | Ga0439451_002707 | |||
| 1248 | Ga0439451_009495 | |||
| 1249 | Ga0439452_000182 | |||
| 1250 | Ga0439452_000198 | |||
| 1251 | Ga0439452_002790 | |||
| 1252 | Ga0439452_003400 | |||
| 1253 | Ga0439452_011244 | |||
| 1254 | Ga0439452_012299 | |||
| 1255 | Ga0439456_002249 | |||
| 1256 | Ga0439456_006123 | |||
| 1257 | Ga0439456_026042 | |||
| 1258 | Ga0439456_031681 | |||
| 1259 | Ga0439463_000277 | |||
| 1260 | Ga0439463_004565 | |||
| 1261 | Ga0450911_000585 | |||
| 1262 | Ga0450911_007934 | |||
| 1263 | Ga0450920_002009 | |||
| 1264 | Ga0450904_001098 | |||
| 1265 | Ga0450905_002207 | |||
| 1266 | Ga0450906_002793 | |||
| 1267 | Ga0450906_013073 | |||
| 1268 | Ga0450907_000017 | |||
| 1269 | Ga0450907_000656 | |||
| 1270 | Ga0450910_003923 | |||
| 1271 | Ga0439446_0022255 | |||
| 1272 | Ga0450909_004321 | |||
| 1273 | Ga0450909_008449 | |||
| 1274 | Ga0439434_0000313 | |||
| 1275 | Ga0439464_0015463 | |||
| 1276 | Ga0439460_0001972 | |||
| 1277 | Ga0450893_0001832 | |||
| 1278 | Ga0450901_003638 | |||
| 1279 | Ga0439440_0008706 | |||
| 1280 | Ga0466982_0063869 | |||
| 1281 | Ga0466966_0098498 | |||
| 1282 | Ga0466961_0000500 | |||
| 1283 | Ga0466970_0263860 | |||
| 1284 | Ga0466957_0080863 | |||
| 1285 | Ga0466960_0003644 | |||
| 1286 | Ga0495617_014741 | |||
| 1287 | Ga0495617_017653 | |||
| 1288 | Ga0495617_022272 | |||
| 1289 | Ga0495617_051847 | |||
| 1290 | Ga0495617_084724 | |||
| 1291 | Ga0495627_000502 | |||
| 1292 | Ga0495627_000657 | |||
| 1293 | Ga0495627_001776 | |||
| 1294 | Ga0495627_006169 | |||
| 1295 | Ga0495627_009699 | |||
| 1296 | Ga0495603_0056409 | |||
| 1297 | Ga0495603_0063611 | |||
| 1298 | Ga0495603_0154027 | |||
| 1299 | Ga0495590_0007780 | |||
| 1300 | Ga0495590_0010666 | |||
| 1301 | Ga0495590_0012255 | |||
| 1302 | Ga0495590_0017613 | |||
| 1303 | Ga0495590_0018736 | |||
| 1304 | Ga0495590_0029350 | |||
| 1305 | Ga0495590_0032741 | |||
| 1306 | Ga0495590_0063801 | |||
| 1307 | Ga0495591_000226 | |||
| 1308 | Ga0495591_000347 | |||
| 1309 | Ga0495591_000414 | |||
| 1310 | Ga0495591_001045 | |||
| 1311 | Ga0495591_004233 | |||
| 1312 | Ga0495591_004888 | |||
| 1313 | Ga0495591_010805 | |||
| 1314 | Ga0495591_011161 | |||
| 1315 | Ga0495591_011437 | |||
| 1316 | Ga0495591_014559 | |||
| 1317 | Ga0495591_018095 | |||
| 1318 | Ga0495591_018245 | |||
| 1319 | Ga0495591_032757 | |||
| 1320 | Ga0495591_036105 | |||
| 1321 | Ga0495629_0000054 | |||
| 1322 | Ga0495638_0000974 | |||
| 1323 | Ga0495638_0034516 | |||
| 1324 | Ga0495638_0037590 | |||
| 1325 | Ga0495638_0046395 | |||
| 1326 | Ga0495638_0061828 | |||
| 1327 | Ga0495638_0063703 | |||
| 1328 | Ga0495638_0069068 | |||
| 1329 | Ga0495638_0075031 | |||
| 1330 | Ga0495638_0125280 | |||
| 1331 | Ga0495653_0000099 | |||
| 1332 | Ga0495653_0011756 | |||
| 1333 | Ga0495653_0081696 | |||
| 1334 | Ga0495653_0106933 | |||
| 1335 | Ga0495650_0001114 | |||
| 1336 | Ga0495650_0001703 | |||
| 1337 | Ga0495650_0013408 | |||
| 1338 | Ga0495650_0020415 | |||
| 1339 | Ga0495650_0026717 | |||
| 1340 | Ga0495650_0032411 | |||
| 1341 | Ga0495650_0039434 | |||
| 1342 | Ga0495650_0089936 | |||
| 1343 | Ga0495580_0000594 | |||
| 1344 | Ga0495580_0007041 | |||
| 1345 | Ga0495580_0008413 | |||
| 1346 | Ga0495580_0009363 | |||
| 1347 | Ga0495580_0013815 | |||
| 1348 | Ga0495605_0000016 | |||
| 1349 | Ga0495605_0000031 | |||
| 1350 | Ga0495605_0000523 | |||
| 1351 | Ga0495605_0001023 | |||
| 1352 | Ga0495605_0001085 | |||
| 1353 | Ga0495605_0001270 | |||
| 1354 | Ga0495605_0003972 | |||
| 1355 | Ga0495605_0008760 | |||
| 1356 | Ga0495605_0020784 | |||
| 1357 | Ga0495605_0028661 | |||
| 1358 | Ga0495605_0059564 | |||
| 1359 | Ga0495605_0091644 | |||
| 1360 | Ga0495662_0024204 | |||
| 1361 | Ga0495664_0032174 | |||
| 1362 | Ga0495584_0000180 | |||
| 1363 | Ga0495584_0000427 | |||
| 1364 | Ga0495584_0003008 | |||
| 1365 | Ga0495584_0008038 | |||
| 1366 | Ga0495584_0025198 | |||
| 1367 | Ga0495584_0028994 | |||
| 1368 | Ga0495584_0061704 | |||
| 1369 | Ga0495584_0105980 | |||
| 1370 | Ga0495584_0127443 | |||
| 1371 | Ga0495585_0026441 | |||
| 1372 | Ga0495585_0031898 | |||
| 1373 | Ga0495585_0109072 | |||
| 1374 | Ga0495585_0134860 | |||
| 1375 | Ga0495585_0136495 | |||
| 1376 | Ga0495585_0227522 | |||
| 1377 | Ga0495594_0000448 | |||
| 1378 | Ga0495594_0085605 | |||
| 1379 | Ga0495596_0026721 | |||
| 1380 | Ga0495596_0027662 | |||
| 1381 | Ga0495607_0000305 | |||
| 1382 | Ga0495607_0000372 | |||
| 1383 | Ga0495607_0000780 | |||
| 1384 | Ga0495607_0004132 | |||
| 1385 | Ga0495607_0012558 | |||
| 1386 | Ga0495607_0013981 | |||
| 1387 | Ga0495607_0019008 | |||
| 1388 | Ga0495607_0022066 | |||
| 1389 | Ga0495607_0024487 | |||
| 1390 | Ga0495607_0035208 | |||
| 1391 | Ga0495607_0062443 | |||
| 1392 | Ga0495607_0096963 | |||
| 1393 | Ga0495607_0150726 | |||
| 1394 | Ga0495607_0153926 | |||
| 1395 | Ga0495583_0000041 | |||
| 1396 | Ga0495583_0000572 | |||
| 1397 | Ga0495583_0001141 | |||
| 1398 | Ga0495583_0001653 | |||
| 1399 | Ga0495583_0004682 | |||
| 1400 | Ga0495583_0006028 | |||
| 1401 | Ga0495583_0007804 | |||
| 1402 | Ga0495583_0011771 | |||
| 1403 | Ga0495583_0018460 | |||
| 1404 | Ga0495583_0026897 | |||
| 1405 | Ga0495583_0053569 | |||
| 1406 | Ga0495606_0000022 | |||
| 1407 | Ga0495606_0000567 | |||
| 1408 | Ga0495606_0000574 | |||
| 1409 | Ga0495606_0001959 | |||
| 1410 | Ga0495606_0002039 | |||
| 1411 | Ga0495606_0004659 | |||
| 1412 | Ga0495606_0004718 | |||
| 1413 | Ga0495606_0013593 | |||
| 1414 | Ga0495606_0019059 | |||
| 1415 | Ga0495606_0033634 | |||
| 1416 | Ga0495606_0076054 | |||
| 1417 | Ga0495606_0151858 | |||
| 1418 | Ga0495610_0001181 | |||
| 1419 | Ga0495610_0002573 | |||
| 1420 | Ga0495610_0008362 | |||
| 1421 | Ga0495610_0011077 | |||
| 1422 | Ga0495610_0022590 | |||
| 1423 | Ga0495610_0028907 | |||
| 1424 | Ga0495610_0043121 | |||
| 1425 | Ga0495610_0054461 | |||
| 1426 | Ga0495610_0095448 | |||
| 1427 | Ga0495616_0000337 | |||
| 1428 | Ga0495616_0000862 | |||
| 1429 | Ga0495616_0001325 | |||
| 1430 | Ga0495616_0014179 | |||
| 1431 | Ga0495616_0033514 | |||
| 1432 | Ga0495616_0037740 | |||
| 1433 | Ga0495616_0099236 | |||
| 1434 | Ga0495616_0101928 | |||
| 1435 | Ga0495616_0104881 | |||
| 1436 | Ga0495620_0000015 | |||
| 1437 | Ga0495620_0000230 | |||
| 1438 | Ga0495620_0000333 | |||
| 1439 | Ga0495620_0000431 | |||
| 1440 | Ga0495620_0000861 | |||
| 1441 | Ga0495620_0004910 | |||
| 1442 | Ga0495620_0006451 | |||
| 1443 | Ga0495620_0038974 | |||
| 1444 | Ga0495620_0046047 | |||
| 1445 | Ga0495620_0058258 | |||
| 1446 | Ga0495620_0069701 | |||
| 1447 | Ga0495620_0072124 | |||
| 1448 | Ga0495628_0002119 | |||
| 1449 | Ga0495628_0034694 | |||
| 1450 | Ga0495630_0005613 | |||
| 1451 | Ga0495630_0025466 | |||
| 1452 | Ga0495630_0030332 | |||
| 1453 | Ga0495630_0041149 | |||
| 1454 | Ga0495630_0053191 | |||
| 1455 | Ga0495630_0089773 | |||
| 1456 | Ga0495631_0000992 | |||
| 1457 | Ga0495631_0001406 | |||
| 1458 | Ga0495631_0015535 | |||
| 1459 | Ga0495631_0016980 | |||
| 1460 | Ga0495631_0017642 | |||
| 1461 | Ga0495631_0028423 | |||
| 1462 | Ga0495631_0046854 | |||
| 1463 | Ga0495631_0076873 | |||
| 1464 | Ga0495631_0135319 | |||
| 1465 | Ga0495632_0000502 | |||
| 1466 | Ga0495632_0000815 | |||
| 1467 | Ga0495632_0001297 | |||
| 1468 | Ga0495632_0004282 | |||
| 1469 | Ga0495632_0012510 | |||
| 1470 | Ga0495632_0020825 | |||
| 1471 | Ga0495632_0038276 | |||
| 1472 | Ga0495632_0097324 | |||
| 1473 | Ga0495632_0107905 | |||
| 1474 | Ga0495637_0000146 | |||
| 1475 | Ga0495637_0000252 | |||
| 1476 | Ga0495637_0000485 | |||
| 1477 | Ga0495637_0000519 | |||
| 1478 | Ga0495637_0014606 | |||
| 1479 | Ga0495637_0023023 | |||
| 1480 | Ga0495637_0028219 | |||
| 1481 | Ga0495637_0028241 | |||
| 1482 | Ga0495637_0043281 | |||
| 1483 | Ga0495637_0055894 | |||
| 1484 | Ga0495637_0075018 | |||
| 1485 | Ga0495637_0091449 | |||
| 1486 | Ga0495643_0001102 | |||
| 1487 | Ga0495643_0007052 | |||
| 1488 | Ga0495643_0011746 | |||
| 1489 | Ga0495643_0020805 | |||
| 1490 | Ga0495643_0030130 | |||
| 1491 | Ga0495643_0035482 | |||
| 1492 | Ga0495643_0071517 | |||
| 1493 | Ga0495643_0088337 | |||
| 1494 | Ga0495644_0000198 | |||
| 1495 | Ga0495644_0041458 | |||
| 1496 | Ga0495644_0052607 | |||
| 1497 | Ga0495648_0000190 | |||
| 1498 | Ga0495648_0001670 | |||
| 1499 | Ga0495648_0003838 | |||
| 1500 | Ga0495648_0005693 | |||
| 1501 | Ga0495648_0008646 | |||
| 1502 | Ga0495648_0028705 | |||
| 1503 | Ga0495648_0029963 | |||
| 1504 | Ga0495648_0042161 | |||
| 1505 | Ga0495648_0046672 | |||
| 1506 | Ga0495648_0057182 | |||
| 1507 | Ga0495648_0060617 | |||
| 1508 | Ga0495648_0068862 | |||
| 1509 | Ga0495648_0075820 | |||
| 1510 | Ga0495648_0095894 | |||
| 1511 | Ga0495648_0122439 | |||
| 1512 | Ga0495648_0147351 | |||
| 1513 | Ga0495648_0148053 | |||
| 1514 | Ga0495666_0000221 | |||
| 1515 | Ga0495666_0002081 | |||
| 1516 | Ga0495666_0026057 | |||
| 1517 | Ga0495666_0035081 | |||
| 1518 | Ga0495642_0001710 | |||
| 1519 | Ga0495642_0008921 | |||
| 1520 | Ga0495654_0000235 | |||
| 1521 | Ga0495654_0000402 | |||
| 1522 | Ga0495654_0002359 | |||
| 1523 | Ga0495654_0003822 | |||
| 1524 | Ga0495654_0004187 | |||
| 1525 | Ga0495654_0008650 | |||
| 1526 | Ga0495654_0010543 | |||
| 1527 | Ga0495654_0012874 | |||
| 1528 | Ga0495654_0017898 | |||
| 1529 | Ga0495654_0025989 | |||
| 1530 | Ga0495654_0028688 | |||
| 1531 | Ga0495654_0038332 | |||
| 1532 | Ga0495654_0078966 | |||
| 1533 | Ga0495654_0094289 | |||
| 1534 | Ga0495654_0156293 | |||
| 1535 | Ga0495665_0019037 | |||
| 1536 | Ga0495665_0045425 | |||
| 1537 | Ga0495587_0001393 | |||
| 1538 | Ga0495587_0002294 | |||
| 1539 | Ga0495609_0000014 | |||
| 1540 | Ga0495609_0000015 | |||
| 1541 | Ga0495609_0000070 | |||
| 1542 | Ga0495609_0000197 | |||
| 1543 | Ga0495609_0013308 | |||
| 1544 | Ga0495609_0013528 | |||
| 1545 | Ga0495609_0021687 | |||
| 1546 | Ga0495609_0038268 | |||
| 1547 | Ga0495609_0075978 | |||
| 1548 | Ga0495609_0089101 | |||
| 1549 | Ga0495609_0092496 | |||
| 1550 | Ga0495609_0112171 | |||
| 1551 | Ga0495609_0145566 | |||
| 1552 | Ga0495597_0001637 | |||
| 1553 | Ga0495597_0003829 | |||
| 1554 | Ga0495597_0006001 | |||
| 1555 | Ga0495597_0036741 | |||
| 1556 | Ga0495597_0057371 | |||
| 1557 | Ga0495597_0064393 | |||
| 1558 | Ga0495622_0001636 | |||
| 1559 | Ga0495622_0004664 | |||
| 1560 | Ga0495622_0004946 | |||
| 1561 | Ga0495622_0056237 | |||
| 1562 | Ga0495622_0078472 | |||
| 1563 | Ga0495622_0090294 | |||
| 1564 | Ga0495633_0000060 | |||
| 1565 | Ga0495633_0001653 | |||
| 1566 | Ga0495633_0036153 | |||
| 1567 | Ga0495633_0052676 | |||
| 1568 | Ga0495633_0071730 | |||
| 1569 | Ga0495656_0072710 | |||
| 1570 | Ga0495656_0114591 | |||
| 1571 | Ga0495668_0007155 | |||
| 1572 | Ga0495668_0023080 | |||
| 1573 | Ga0495668_0024704 | |||
| 1574 | Ga0495634_0001985 | |||
| 1575 | Ga0495611_0000094 | |||
| 1576 | Ga0495611_0005536 | |||
| 1577 | Ga0495611_0005691 | |||
| 1578 | Ga0495611_0036842 | |||
| 1579 | Ga0495611_0058614 | |||
| 1580 | Ga0495611_0067453 | |||
| 1581 | Ga0495611_0083521 | |||
| 1582 | Ga0495625_0000354 | |||
| 1583 | Ga0495625_0004035 | |||
| 1584 | Ga0495625_0013054 | |||
| 1585 | Ga0495625_0035522 | |||
| 1586 | Ga0495625_0082585 | |||
| 1587 | Ga0495625_0148581 | |||
| 1588 | Ga0495625_0184742 | |||
| 1589 | Ga0495625_0212657 | |||
| 1590 | Ga0495625_0236712 | |||
| 1591 | Ga0495635_0001016 | |||
| 1592 | Ga0495635_0045009 | |||
| 1593 | Ga0495659_0048228 | |||
| 1594 | Ga0495661_0000110 | |||
| 1595 | Ga0495661_0000180 | |||
| 1596 | Ga0495661_0000185 | |||
| 1597 | Ga0495661_0000329 | |||
| 1598 | Ga0495661_0000803 | |||
| 1599 | Ga0495661_0004644 | |||
| 1600 | Ga0495661_0067426 | |||
| 1601 | Ga0495661_0143164 | |||
| 1602 | Ga0495588_0068800 | |||
| 1603 | Ga0495588_0072432 | |||
| 1604 | Ga0495657_0106488 | |||
| 1605 | Ga0495599_0024674 | |||
| 1606 | Ga0495623_0000884 | |||
| 1607 | Ga0495623_0002201 | |||
| 1608 | Ga0495623_0002533 | |||
| 1609 | Ga0495623_0118152 | |||
| 1610 | Ga0495646_0009130 | |||
| 1611 | Ga0495646_0034366 | |||
| 1612 | Ga0495646_0067333 | |||
| 1613 | Ga0495669_0078622 | |||
| 1614 | Ga0495613_0027240 | |||
| 1615 | Ga0495613_0107054 | |||
| 1616 | Ga0495613_0251741 | |||
| 1617 | Ga0495624_0000296 | |||
| 1618 | Ga0495624_0005199 | |||
| 1619 | Ga0495624_0012568 | |||
| 1620 | Ga0495624_0020044 | |||
| 1621 | Ga0495670_0000233 | |||
| 1622 | Ga0495670_0003053 | |||
| 1623 | Ga0495670_0018119 | |||
| 1624 | Ga0495670_0058208 | |||
| 1625 | Ga0495670_0203681 | |||
| 1626 | Ga0495671_0000069 | |||
| 1627 | Ga0495671_0003043 | |||
| 1628 | Ga0495671_0004677 | |||
| 1629 | Ga0495671_0010107 | |||
| 1630 | Ga0495671_0022361 | |||
| 1631 | Ga0495671_0023762 | |||
| 1632 | Ga0495671_0058357 | |||
| 1633 | Ga0495671_0080258 | |||
| 1634 | Ga0495671_0105697 | |||
| 1635 | Ga0495671_0114872 | |||
| 1636 | Ga0495671_0125148 | |||
| 1637 | Ga0495649_0000420 | |||
| 1638 | Ga0495649_0000900 | |||
| 1639 | Ga0495649_0003545 | |||
| 1640 | Ga0495649_0013341 | |||
| 1641 | Ga0495649_0014290 | |||
| 1642 | Ga0495649_0017443 | |||
| 1643 | Ga0495649_0034773 | |||
| 1644 | Ga0495649_0059766 | |||
| 1645 | Ga0495649_0151830 | |||
| 1646 | Ga0495589_0000480 | |||
| 1647 | Ga0495589_0000496 | |||
| 1648 | Ga0495589_0002087 | |||
| 1649 | Ga0495589_0005297 | |||
| 1650 | Ga0495589_0038636 | |||
| 1651 | Ga0495589_0064514 | |||
| 1652 | Ga0495589_0100547 | |||
| 1653 | Ga0495600_0010631 | |||
| 1654 | Ga0495600_0041384 | |||
| 1655 | Ga0495600_0063181 | |||
| 1656 | Ga0495660_0001405 | |||
| 1657 | Ga0495660_0001621 | |||
| 1658 | Ga0495660_0003347 | |||
| 1659 | Ga0495660_0009593 | |||
| 1660 | Ga0495660_0011038 | |||
| 1661 | Ga0495660_0033621 | |||
| 1662 | Ga0495660_0065049 | |||
| 1663 | Ga0495660_0090796 | |||
| 1664 | Ga0495604_0001809 | |||
| 1665 | Ga0495604_0013801 | |||
| 1666 | Ga0495604_0016776 | |||
| 1667 | Ga0495604_0039684 | |||
| 1668 | Ga0495604_0045817 | |||
| 1669 | Ga0495604_0054424 | |||
| 1670 | Ga0495674_0009594 | |||
| 1671 | Ga0495674_0020324 | |||
| 1672 | Ga0495674_0025373 | |||
| 1673 | Ga0495674_0026993 | |||
| 1674 | Ga0495674_0027624 | |||
| 1675 | Ga0495674_0152169 | |||
| 1676 | Ga0495672_0000487 | |||
| 1677 | Ga0495672_0000645 | |||
| 1678 | Ga0495672_0000680 | |||
| 1679 | Ga0495672_0008214 | |||
| 1680 | Ga0495672_0016638 | |||
| 1681 | Ga0495672_0019069 | |||
| 1682 | Ga0495672_0019848 | |||
| 1683 | Ga0495672_0021118 | |||
| 1684 | Ga0495672_0025389 | |||
| 1685 | Ga0495672_0037650 | |||
| 1686 | Ga0495672_0044250 | |||
| 1687 | Ga0495672_0044854 | |||
| 1688 | Ga0495672_0125651 | |||
| 1689 | Ga0495672_0157562 | |||
| 1690 | Ga0495672_0182543 | |||
| 1691 | Ga0495672_0235124 | |||
| 1692 | Ga0495676_0000081 | |||
| 1693 | Ga0495680_0003333 | |||
| 1694 | Ga0495680_0013929 | |||
| 1695 | Ga0495680_0047314 | |||
| 1696 | Ga0495680_0094603 | |||
| 1697 | Ga0495683_0000027 | |||
| 1698 | Ga0495683_0000135 | |||
| 1699 | Ga0495683_0000471 | |||
| 1700 | Ga0495683_0024392 | |||
| 1701 | Ga0495683_0035554 | |||
| 1702 | Ga0495683_0070075 | |||
| 1703 | Ga0495683_0070986 | |||
| 1704 | Ga0495683_0129842 | |||
| 1705 | Ga0495687_017683 | |||
| 1706 | Ga0495687_033263 | |||
| 1707 | Ga0495687_056572 | |||
| 1708 | Ga0495675_0001310 | |||
| 1709 | Ga0495675_0170489 | |||
| 1710 | Ga0495677_0027955 | |||
| 1711 | Ga0495677_0031168 | |||
| 1712 | Ga0495679_000110 | |||
| 1713 | Ga0495679_000186 | |||
| 1714 | Ga0495679_000246 | |||
| 1715 | Ga0495679_000775 | |||
| 1716 | Ga0495679_006642 | |||
| 1717 | Ga0495679_016313 | |||
| 1718 | Ga0495679_016880 | |||
| 1719 | Ga0495679_020174 | |||
| 1720 | Ga0495679_030995 | |||
| 1721 | Ga0495685_036396 | |||
| 1722 | Ga0495673_0000611 | |||
| 1723 | Ga0495673_0000613 | |||
| 1724 | Ga0495673_0000946 | |||
| 1725 | Ga0495673_0001275 | |||
| 1726 | Ga0495673_0002624 | |||
| 1727 | Ga0495673_0005054 | |||
| 1728 | Ga0495673_0007699 | |||
| 1729 | Ga0495673_0011445 | |||
| 1730 | Ga0495673_0014183 | |||
| 1731 | Ga0495673_0025348 | |||
| 1732 | Ga0495673_0027195 | |||
| 1733 | Ga0495673_0050394 | |||
| 1734 | Ga0495673_0090906 | |||
| 1735 | Ga0495673_0115760 | |||
| 1736 | Ga0495681_0000503 | |||
| 1737 | Ga0495681_0000950 | |||
| 1738 | Ga0495681_0001126 | |||
| 1739 | Ga0495681_0003859 | |||
| 1740 | Ga0495681_0011086 | |||
| 1741 | Ga0495681_0017071 | |||
| 1742 | Ga0495681_0026491 | |||
| 1743 | Ga0495681_0028912 | |||
| 1744 | Ga0495681_0064088 | |||
| 1745 | Ga0495681_0107476 | |||
| 1746 | Ga0495684_0268259 | |||
| 1747 | Ga0495686_0000012 | |||
| 1748 | Ga0495686_0001458 | |||
| 1749 | Ga0495686_0008877 | |||
| 1750 | Ga0495686_0015030 | |||
| 1751 | Ga0495686_0022026 | |||
| 1752 | Ga0495686_0025466 | |||
| 1753 | Ga0495686_0068210 | |||
| 1754 | Ga0495686_0097489 | |||
| 1755 | Ga0495686_0118747 | |||
| 1756 | Ga0495686_0126438 | |||
| 1757 | Ga0495593_0001027 | |||
| 1758 | Ga0495593_0005749 | |||
| 1759 | Ga0495593_0024606 | |||
| 1760 | Ga0495593_0034535 | |||
| 1761 | Ga0495593_0098826 | |||
| 1762 | Ga0495593_0107216 | |||
| 1763 | Ga0495593_0217878 | |||
| 1764 | Ga0495602_0099636 | |||
| 1765 | Ga0495602_0230343 | |||
| 1766 | Ga0495614_0064177 | |||
| 1767 | Ga0495626_0000256 | |||
| 1768 | Ga0495626_0002346 | |||
| 1769 | Ga0495626_0010868 | |||
| 1770 | Ga0495626_0022642 | |||
| 1771 | Ga0495626_0026901 | |||
| 1772 | Ga0495626_0027428 | |||
| 1773 | Ga0495626_0079542 | |||
| 1774 | Ga0495626_0119387 | |||
| 1775 | Ga0496100_0000354 | |||
| 1776 | Ga0496101_0000527 | |||
| 1777 | Ga0496101_0191280 | |||
| 1778 | Ga0496101_0363666 | |||
| 1779 | Ga0496102_0000563 | |||
| 1780 | Ga0496102_0002557 | |||
| 1781 | Ga0496102_0144964 | |||
| 1782 | Ga0496103_0000752 | |||
| 1783 | Ga0496104_0037712 | |||
| 1784 | Ga0496104_0040778 | |||
| 1785 | Ga0496104_0287201 | |||
| 1786 | Ga0496105_0269813 | |||
| 1787 | Ga0496111_0133890 | |||
| 1788 | Ga0496111_0152976 | |||
| 1789 | Ga0496112_0007724 | |||
| 1790 | Ga0496112_0230769 | |||
| 1791 | Ga0496112_0346049 | |||
| 1792 | Ga0496113_0009043 | |||
| 1793 | Ga0496113_0071880 | |||
| 1794 | Ga0496113_0286823 | |||
| 1795 | Ga0496113_0343718 | |||
| 1796 | Ga0496115_0100202 | |||
| 1797 | Ga0496116_0000415 | |||
| 1798 | Ga0496116_0000638 | |||
| 1799 | Ga0496116_0026677 | |||
| 1800 | Ga0496116_0040432 | |||
| 1801 | Ga0496116_0111014 | |||
| 1802 | Ga0496117_0000266 | |||
| 1803 | Ga0496117_0000507 | |||
| 1804 | Ga0496117_0008301 | |||
| 1805 | Ga0496117_0053157 | |||
| 1806 | Ga0496117_0130103 | |||
| 1807 | Ga0496117_0142335 | |||
| 1808 | Ga0496118_0020834 | |||
| 1809 | Ga0496118_0050345 | |||
| 1810 | Ga0496118_0086228 | |||
| 1811 | Ga0496118_0139439 | |||
| 1812 | Ga0496118_0153498 | |||
| 1813 | Ga0496118_0163011 | |||
| 1814 | Ga0496118_0184982 | |||
| 1815 | Ga0496119_0000223 | |||
| 1816 | Ga0496119_0036446 | |||
| 1817 | Ga0496119_0233952 | |||
| 1818 | Ga0496120_0000254 | |||
| 1819 | Ga0496120_0011371 | |||
| 1820 | Ga0496121_0003148 | |||
| 1821 | Ga0496121_0003838 | |||
| 1822 | Ga0496121_0006375 | |||
| 1823 | Ga0496121_0006873 | |||
| 1824 | Ga0496121_0028909 | |||
| 1825 | Ga0496121_0072840 | |||
| 1826 | Ga0496121_0160826 | |||
| 1827 | Ga0496121_0247972 | |||
| 1828 | Ga0496121_0280095 | |||
| 1829 | Ga0496121_0292848 | |||
| 1830 | Ga0496122_0001077 | |||
| 1831 | Ga0496122_0003544 | |||
| 1832 | Ga0496122_0038158 | |||
| 1833 | Ga0496122_0040109 | |||
| 1834 | Ga0496122_0056309 | |||
| 1835 | Ga0496122_0150655 | |||
| 1836 | Ga0496122_0201445 | |||
| 1837 | Ga0496122_0228716 | |||
| 1838 | Ga0496123_0001931 | |||
| 1839 | Ga0496123_0009796 | |||
| 1840 | Ga0496123_0033254 | |||
| 1841 | Ga0496123_0050957 | |||
| 1842 | Ga0496123_0066875 | |||
| 1843 | Ga0496123_0084712 | |||
| 1844 | Ga0496123_0197249 | |||
| 1845 | Ga0496124_0000222 | |||
| 1846 | Ga0496124_0000537 | |||
| 1847 | Ga0496124_0001864 | |||
| 1848 | Ga0496124_0005123 | |||
| 1849 | Ga0496124_0005908 | |||
| 1850 | Ga0496124_0122676 | |||
| 1851 | Ga0496124_0181960 | |||
| 1852 | Ga0496124_0276782 | |||
| 1853 | Ga0496125_0000565 | |||
| 1854 | Ga0496125_0081717 | |||
| 1855 | Ga0496125_0185508 | |||
| 1856 | Ga0496126_0011328 | |||
| 1857 | Ga0496126_0338010 | |||
| 1858 | Ga0466983_0065679 | |||
| 1859 | Ga0495678_000031 | |||
| 1860 | Ga0495678_000039 | |||
| 1861 | Ga0495678_001875 | |||
| 1862 | Ga0495678_003174 | |||
| 1863 | Ga0495678_016209 | |||
| 1864 | Ga0495678_017566 | |||
| 1865 | Ga0495678_022461 | |||
| 1866 | Ga0495678_022746 | |||
| 1867 | Ga0495678_039511 | |||
| 1868 | Ga0495678_045556 | |||
| 1869 | Ga0495678_055025 | |||
| 1870 | Ga0495678_080206 | |||
| 1871 | Ga0495682_0000300 | |||
| 1872 | Ga0495682_0000765 | |||
| 1873 | Ga0495682_0001588 | |||
| 1874 | Ga0495682_0013710 | |||
| 1875 | Ga0495682_0023668 | |||
| 1876 | Ga0495682_0077171 | |||
| 1877 | Ga0501031_0068038 | |||
| 1878 | Ga0501034_0115534 | |||
| 1879 | Ga0501222_001005 | |||
| 1880 | Ga0501227_000772 | |||
| 1881 | Ga0501241_000077 | |||
| 1882 | Ga0501226_000674 | |||
| 1883 | Ga0500572_000450 | |||
| 1884 | Ga0500618_010032 | |||
| 1885 | Ga0500634_0000121 | |||
| 1886 | 637322234 | |||
| 1887 | 2501074096 | |||
| 1888 | 2501083696 | |||
| 1889 | 2501413225 | |||
| 1890 | 2511087474 | |||
| 1891 | 2511100332 | |||
| 1892 | 2511106003 | |||
| 1893 | 2511274484 | |||
| 1894 | 2511289192 | |||
| 1895 | 2511298188 | |||
| 1896 | 2511301962 | |||
| 1897 | 2511313428 | |||
| 1898 | 2511321253 | |||
| 1899 | 2511334801 | |||
| 1900 | 2511339986 | |||
| 1901 | 2511346748 | |||
| 1902 | 2511348570 | |||
| 1903 | 2511355051 | |||
| 1904 | 2511414808 | |||
| 1905 | 2513551916 | |||
| 1906 | 2513563314 | |||
| 1907 | 2514054155 | |||
| 1908 | 2516017820 | |||
| 1909 | 2519458766 | |||
| 1910 | 2554813711 | |||
| 1911 | 2555671823 | |||
| 1912 | 2563058672 | |||
| 1913 | 2585292415 | |||
| 1914 | 2597869296 | |||
| 1915 | 2599354021 | |||
| 1916 | 2599360300 | |||
| 1917 | 2599366622 | |||
| 1918 | 2599373411 | |||
| 1919 | 2599379129 | |||
| 1920 | 2599385893 | |||
| 1921 | 2599392270 | |||
| 1922 | 2599404036 | |||
| 1923 | 2599460855 | |||
| 1924 | 2599470402 | |||
| 1925 | 2599489876 | |||
| 1926 | 2599740635 | |||
| 1927 | 2599975359 | |||
| 1928 | 2600213470 | |||
| 1929 | 2601625711 | |||
| 1930 | 2601773637 | |||
| 1931 | 2601796832 | |||
| 1932 | 2606073982 | |||
| 1933 | 2606126373 | |||
| 1934 | 2608381126 | |||
| 1935 | 2624482529 | |||
| 1936 | 2643844301 | |||
| 1937 | 2643952257 | |||
| 1938 | 2644023981 | |||
| 1939 | 2644187132 | |||
| 1940 | 2644622581 | |||
| 1941 | 2671096603 | |||
| 1942 | 2713476679 | |||
| 1943 | 2715750521 | |||
| 1944 | 2715755076 | |||
| 1945 | 2718635731 | |||
| 1946 | 2739256817 | |||
| 1947 | 2739315576 | |||
| 1948 | 2746089321 | |||
| 1949 | 2746099483 | |||
| 1950 | 2774123014 | |||
| 1951 | 2774128528 | |||
| 1952 | 2774133408 | |||
| 1953 | 2784262712 | |||
| 1954 | 2784315372 | |||
| 1955 | 2808930421 | |||
| 1956 | 2808952543 | |||
| 1957 | 2808960464 | |||
| 1958 | 2808973219 | |||
| 1959 | 2809008843 | |||
| 1960 | 2809015048 | |||
| 1961 | 2809218405 | |||
| 1962 | 2812370976 | |||
| 1963 | 2817261038 | |||
| 1964 | 2817278733 | |||
| 1965 | 2817451808 | |||
| 1966 | 2819637102 | |||
| 1967 | 2819656211 | |||
| 1968 | 2819701696 | |||
| 1969 | 2842327792 | |||
| 1970 | 2842351600 | |||
| 1971 | 2842460588 | |||
| 1972 | 2842837379 | |||
| 1973 | 2842845172 | |||
| 1974 | 2842860062 | |||
| 1975 | 2844665981 | |||
| 1976 | 2852660731 | |||
| 1977 | 2856291101 | |||
| 1978 | 2857364139 | |||
| 1979 | 2860341393 | |||
| 1980 | 2878034458 | |||
| 1981 | 2880235102 | |||
| 1982 | 2883090844 | |||
| 1983 | 2904521471 | |||
| 1984 | 2904551156 | |||
| 1985 | 2904565230 | |||
| 1986 | 2904572074 | |||
| 1987 | 2908447878 | |||
| 1988 | 2917075694 | |||
| 1989 | 2919066483 | |||
| 1990 | 2919158304 | |||
| 1991 | 2919459500 | |||
| 1992 | 2919490157 | |||
| 1993 | 2921651820 | |||
| 1994 | 2923525083 | |||
| 1995 | 2928160363 | |||
| 1996 | 2928170600 | |||
| 1997 | 2928176649 | |||
| 1998 | 2928537393 | |||
| 1999 | 2929192498 | |||
| 2000 | 2931397140 | |||
| 2001 | 2935356683 | |||
| 2002 | 2939638072 | |||
| 2003 | 2945929510 | |||
| 2004 | 2945965789 | |||
| 2005 | 2946011784 | |||
| 2006 | 2969309239 | |||
| 2007 | 2981996322 | |||
| 2008 | 2984501670 | |||
| 2009 | 2998144515 | |||
| 2010 | 3007319332 | |||
| 2011 | 3007424900 | |||
| 2012 | 3007516311 | |||
| 2013 | 3007623355 | |||
| 2014 | 3007720259 | |||
| 2015 | 3007858501 | |||
| 2016 | 3007865974 | |||
| 2017 | 3007871107 | |||
| 2018 | 642418967 | |||
| 2019 | 8003957083 | |||
| 2020 | 8011356606 | |||
| 2021 | 8018845647 | |||
| 2022 | 8020813255 | |||
| 2023 | 8021123093 | |||
| 2024 | 8029996368 | |||
| 2025 | 8040169982 | |||
| 2026 | 8040173447 | |||
| 2027 | 8055273594 | |||
| 2028 | 8055819097 | |||
| 2029 | 8056127142 | |||
| 2030 | 8056148065 | |||
| 2031 | 8056154705 | |||
| 2032 | 8056166829 | |||
| 2033 | 8056172061 | |||
| 2034 | 8056180516 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p8k-assembly1.cif.gz_B | crystal structure of a putative carbon-nitrogen family hydrolase from staphylococcus aureus | 0.9532 | 1 | 242 |
| 2e11-assembly2.cif.gz_D | the crystal structure of xc1258 from xanthomonas campestris: a cn-hydrolase superfamily protein with an arsenic adduct in the active site | 0.9385 | 1 | 255 |
| 5g3o-assembly1.cif.gz_E | bacillus cereus formamidase (bceamif) inhibited with urea. | 0.9283 | 1 | 242 |
| 2w1v-assembly1.cif.gz_B | crystal structure of mouse nitrilase-2 at 1.4a resolution | 0.9257 | 2 | 250 |
| 5g3p-assembly1.cif.gz_C | bacillus cereus formamidase (bceamif) acetylated at the active site. | 0.9251 | 1 | 243 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O59829_1_271_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.956 | 2 | 251 | 3.60.110.10 |
| af_Q2FWM9_1_261_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.947 | 1 | 251 | 3.60.110.10 |
| 2e11D00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9385 | 1 | 255 | 3.60.110.10 |
| af_Q9VHE4_6_282_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9314 | 1 | 250 | 3.60.110.10 |
| af_Q47679_3_256_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9304 | 1 | 253 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A136QA53-F1-model_v4 | deleted | 0.9973 | 1 | 237 |
|
| AF-Q9HY28-F1-model_v4 | CN hydrolase domain-containing protein | 0.9968 | 1 | 270 |
GO:0016787
|
| AF-A0A3P0NXV4-F1-model_v4 | Carbon-nitrogen hydrolase | 0.9952 | 1 | 270 |
GO:0016787
|
| AF-A0A6P3BAL8-F1-model_v4 | Carbon-nitrogen hydrolase | 0.9947 | 1 | 270 |
GO:0016811
|
| AF-A0A364GRS6-F1-model_v4 | (R)-amidase | 0.9923 | 1 | 270 |
GO:0016787
|