F488303
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1017 | 506 | 2034 | 701 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|640427133|640488702 |
| Length | 790 |
| Sequence | DAGRHRLQRRPRDLAEPDGALGGAGLQTGRQRVSRPGKRAADGGAYRPALTDACRPTIGWLNRLAFPGGTFDCCLRPRRLEWRDNNSAMREPEMSDISVHHRACHLCEAICGLTIQTEGERILSIKGDPLDSFSRGHICPKAVALQDIQNDPDRLRHPMRRCGDEWQAISWEEAYELVAERLAEIRERHGSNAVAIYQGNPSVHNYGLTTHSNYFLGLLKTRNRFSATSVDQLPHHLTSHLMYGHGLLLPVPDIDHTDFMLILGGNPLASNGSIMTVPDVEKRLKAIRARGGKLVVVDPRRSETAAIADQHLFVRPGQDAALLFGLLNTLFEEGLTRASELPLDGIEEVRTAIAAFSAEAMSARCGVPAEQIRQLARDFAAADRAVCYGRMGVSTQAFGTLCQWLVQLINLVTGNLDRVGGALCTEPAVDLVETTKGGHFDAWRSRVSQLPEYGGELPVAALAEEMLEPGEGQVRALITVAGNPVLSTPNGRKLEQALDGLEFMLSVDFYINETTRYADVILPPTAPLEHDHYDATFNLLAVRNVTRFNLPVLPKPEGALHDWEIFIGLAEAYAGRVGVELKPTMPPQQMMDLALRHGPYGDKSERKLSLAALEDYPHGLDLGPLKPNLARRLKTPNKRIQATPALMLDDLQRFAAQPQAGADELLLIGRRHVRSNNSWMHNYQRLVKGKPRHQLLMHPTDMAARALQDGQRVRVHSRVGVVEVEALASEEMMPGVVSLPHGWGHARPGVQLDIARQQPGASCNDLTDERQLDVSGNAALNGVTVQVSAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 7 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 9 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 38 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 39 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 40 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 41 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 42 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 43 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 64 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 65 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 69 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 79 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 103 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 104 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 111 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 112 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 113 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 114 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 115 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 116 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 117 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 118 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 119 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 127 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 128 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 129 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 130 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 131 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 132 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 133 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 134 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 135 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 136 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 137 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 138 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 139 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 140 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 141 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 142 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 143 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 144 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 145 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 146 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 147 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 148 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 149 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 150 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 151 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 152 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 153 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 154 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 225 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 226 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 227 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 228 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 229 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 230 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 231 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 232 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 233 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 234 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 235 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 236 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 254 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 255 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 256 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 257 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 260 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 261 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 262 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 263 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 264 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 265 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 266 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 267 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 268 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 269 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 270 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 271 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 272 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 273 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 274 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 275 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 276 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 277 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 278 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 279 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 280 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 281 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 282 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 283 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 284 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 285 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 286 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 287 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 288 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 289 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 290 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 291 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 292 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 293 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 294 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 295 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 296 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 297 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 298 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 299 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 300 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 301 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 302 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 303 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 304 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 305 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 306 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 307 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 308 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 309 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 310 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 311 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 312 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 313 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 314 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 315 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 316 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 317 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 318 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 319 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 320 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 321 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 322 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 323 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 324 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 325 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 326 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 327 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 328 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 329 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 330 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 331 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 332 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 333 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 334 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 335 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 336 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 337 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 338 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 339 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 340 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 341 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 342 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 343 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 344 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 345 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 346 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 347 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 348 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 349 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 350 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 351 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 352 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 353 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 354 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 355 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 356 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 357 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 358 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 359 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 360 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 361 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 362 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 363 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 364 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 365 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 366 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 367 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 368 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 369 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 370 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 371 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 372 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 373 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 374 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 375 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 376 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 377 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 378 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 379 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 380 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 381 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 382 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 383 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 384 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 385 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 386 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 387 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 388 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 389 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 390 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 391 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 392 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 393 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 394 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 395 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 396 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 397 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 398 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 399 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 400 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 401 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 402 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 403 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 404 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 405 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 406 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 407 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 408 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 409 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 410 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 411 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 412 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 413 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 414 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 415 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 416 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 417 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 418 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 419 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 420 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 421 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 422 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 423 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 424 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 425 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 426 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 427 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 428 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 429 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 430 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 431 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 432 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 433 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 434 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 435 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 436 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 437 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 438 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 439 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 440 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 441 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 442 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 443 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 444 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 445 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 446 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 447 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 448 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 449 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 450 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 451 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 452 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 453 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 454 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 455 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 456 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 457 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 458 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 459 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 460 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 461 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 462 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 463 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 464 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 465 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 466 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 467 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 468 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 469 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 470 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 471 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 472 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 473 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 474 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 475 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 476 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 477 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 478 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 479 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 480 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 481 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 482 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 483 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 484 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 485 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 486 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 487 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 488 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 489 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 490 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 491 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 492 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 493 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 494 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 495 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 496 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 497 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 498 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 499 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 500 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 501 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 502 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 503 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 504 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 505 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 506 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.61 |
| Metatranscriptomes | 0 |
| Isolates | 24.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.6 |
| Nodule | 2.56 |
| Rhizoplane | 7.28 |
| Rhizosphere | 70.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10001313 | 3300001990 | Bacteria | 8807 |
| 2 | JGI25162J39368_1000034 | 3300002737 | Bacteria | 183428 |
| 3 | JGI25163J39215_1001370 | 3300002771 | Bacteria | 4125 |
| 4 | JGI25163J39215_1001449 | 3300002771 | Bacteria | 3895 |
| 5 | JGI25164J39214_1000018 | 3300002772 | Bacteria | 185215 |
| 6 | JGI25164J39214_1000304 | 3300002772 | Bacteria | 32781 |
| 7 | JGI25165J46597_1000123 | 3300003214 | Bacteria | 131481 |
| 8 | JGI25165J46597_1000575 | 3300003214 | Bacteria | 32781 |
| 9 | Ga0055538_1000073 | 3300003751 | Bacteria | 90843 |
| 10 | Ga0055539_1000109 | 3300003752 | Bacteria | 90843 |
| 11 | Ga0055533_1000117 | 3300003756 | Bacteria | 90843 |
| 12 | Ga0055532_1000283 | 3300003758 | Bacteria | 32601 |
| 13 | Ga0055525_1000156 | 3300003759 | Bacteria | 90843 |
| 14 | Ga0055536_1003129 | 3300003781 | Bacteria | 8985 |
| 15 | Ga0055536_1012012 | 3300003781 | Bacteria | 3255 |
| 16 | Ga0055536_1012314 | 3300003781 | Bacteria | 3185 |
| 17 | Ga0055530_10003450 | 3300003791 | Bacteria | 8985 |
| 18 | Ga0055530_10009909 | 3300003791 | Bacteria | 3591 |
| 19 | Ga0055540_1000849 | 3300003792 | Bacteria | 20440 |
| 20 | Ga0055540_1002831 | 3300003792 | Bacteria | 8847 |
| 21 | Ga0055540_1008308 | 3300003792 | Bacteria | 3753 |
| 22 | Ga0055531_10000573 | 3300003794 | Bacteria | 32112 |
| 23 | Ga0055541_1000074 | 3300003841 | Bacteria | 90843 |
| 24 | Ga0065714_10065199 | 3300005288 | Bacteria | 12019 |
| 25 | Ga0065714_10067505 | 3300005288 | Bacteria | 5429 |
| 26 | Ga0065714_10072768 | 3300005288 | Bacteria | 3305 |
| 27 | Ga0065714_10077307 | 3300005288 | Bacteria | 2700 |
| 28 | Ga0065714_10077484 | 3300005288 | Bacteria | 2685 |
| 29 | Ga0065714_10081270 | 3300005288 | Bacteria | 2376 |
| 30 | Ga0065704_10070645 | 3300005289 | Bacteria | 18454 |
| 31 | Ga0065704_10093716 | 3300005289 | Bacteria | 2580 |
| 32 | Ga0065704_10093739 | 3300005289 | Bacteria | 2574 |
| 33 | Ga0065712_10005361 | 3300005290 | Bacteria | 4531 |
| 34 | Ga0065712_10067808 | 3300005290 | Bacteria | 30719 |
| 35 | Ga0065715_10002829 | 3300005293 | Bacteria | 4618 |
| 36 | Ga0065707_10100167 | 3300005295 | Bacteria | 2950 |
| 37 | Ga0070658_10031202 | 3300005327 | Bacteria | 4279 |
| 38 | Ga0070683_100003158 | 3300005329 | Bacteria | 13282 |
| 39 | Ga0070670_100005001 | 3300005331 | Bacteria | 11155 |
| 40 | Ga0070670_100094465 | 3300005331 | Bacteria | 2572 |
| 41 | Ga0070660_100009380 | 3300005339 | Bacteria | 6879 |
| 42 | Ga0070689_100002206 | 3300005340 | Bacteria | 12625 |
| 43 | Ga0070669_100005309 | 3300005353 | Bacteria | 9304 |
| 44 | Ga0070659_100018251 | 3300005366 | Bacteria | 5294 |
| 45 | Ga0070662_100002261 | 3300005457 | Bacteria | 11813 |
| 46 | Ga0068853_100042334 | 3300005539 | Bacteria | 3894 |
| 47 | Ga0070693_100008503 | 3300005547 | Bacteria | 5067 |
| 48 | Ga0070665_100000865 | 3300005548 | Bacteria | 39234 |
| 49 | Ga0070665_100041084 | 3300005548 | Bacteria | 4648 |
| 50 | Ga0070664_100002637 | 3300005564 | Bacteria | 14465 |
| 51 | Ga0068854_100028702 | 3300005578 | Bacteria | 3847 |
| 52 | Ga0068856_100063831 | 3300005614 | Bacteria | 3638 |
| 53 | Ga0068851_10000006 | 3300005834 | Bacteria | 258116 |
| 54 | Ga0068860_100100040 | 3300005843 | Bacteria | 2766 |
| 55 | Ga0075432_10007294 | 3300006058 | Bacteria | 3764 |
| 56 | Ga0075432_10014552 | 3300006058 | Bacteria | 2679 |
| 57 | Ga0075362_10022416 | 3300006177 | Bacteria | 2661 |
| 58 | Ga0075436_100058307 | 3300006914 | Bacteria | 2666 |
| 59 | Ga0099823_1000052 | 3300006944 | Bacteria | 56662 |
| 60 | Ga0079104_1000202 | 3300006946 | Bacteria | 83431 |
| 61 | Ga0079104_1003010 | 3300006946 | Bacteria | 8281 |
| 62 | Ga0099826_10002165 | 3300006948 | Bacteria | 12502 |
| 63 | Ga0105251_10000035 | 3300009011 | Bacteria | 117861 |
| 64 | Ga0105251_10001730 | 3300009011 | Bacteria | 18229 |
| 65 | Ga0105251_10024190 | 3300009011 | Bacteria | 3121 |
| 66 | Ga0105251_10029612 | 3300009011 | Bacteria | 2757 |
| 67 | Ga0105251_10029711 | 3300009011 | Bacteria | 2751 |
| 68 | Ga0105251_10030994 | 3300009011 | Bacteria | 2679 |
| 69 | Ga0105251_10033226 | 3300009011 | Bacteria | 2563 |
| 70 | Ga0105251_10041566 | 3300009011 | Bacteria | 2236 |
| 71 | Ga0105244_10001239 | 3300009036 | Bacteria | 20944 |
| 72 | Ga0105244_10017260 | 3300009036 | Bacteria | 4084 |
| 73 | Ga0105244_10023428 | 3300009036 | Bacteria | 3385 |
| 74 | Ga0105244_10026959 | 3300009036 | Bacteria | 3103 |
| 75 | Ga0105244_10032621 | 3300009036 | Bacteria | 2755 |
| 76 | Ga0105244_10034773 | 3300009036 | Bacteria | 2651 |
| 77 | Ga0105244_10035232 | 3300009036 | Bacteria | 2630 |
| 78 | Ga0105250_10000056 | 3300009092 | Bacteria | 114085 |
| 79 | Ga0105250_10014720 | 3300009092 | Bacteria | 3209 |
| 80 | Ga0105250_10015060 | 3300009092 | Bacteria | 3169 |
| 81 | Ga0105250_10015386 | 3300009092 | Bacteria | 3131 |
| 82 | Ga0105250_10015561 | 3300009092 | Bacteria | 3114 |
| 83 | Ga0105250_10015844 | 3300009092 | Bacteria | 3081 |
| 84 | Ga0105250_10028354 | 3300009092 | Bacteria | 2255 |
| 85 | Ga0105247_10061324 | 3300009101 | Bacteria | 2332 |
| 86 | Ga0105243_10000133 | 3300009148 | Bacteria | 85133 |
| 87 | Ga0105243_10013241 | 3300009148 | Bacteria | 6236 |
| 88 | Ga0105243_10055268 | 3300009148 | Bacteria | 3154 |
| 89 | Ga0105243_10065587 | 3300009148 | Bacteria | 2917 |
| 90 | Ga0105243_10085452 | 3300009148 | Bacteria | 2586 |
| 91 | Ga0105242_10002285 | 3300009176 | Bacteria | 15140 |
| 92 | Ga0105248_10035793 | 3300009177 | Bacteria | 5553 |
| 93 | Ga0105237_10005854 | 3300009545 | Bacteria | 13790 |
| 94 | Ga0105239_10008909 | 3300010375 | Bacteria | 11355 |
| 95 | Ga0105246_10001386 | 3300011119 | Bacteria | 14308 |
| 96 | Ga0105246_10006579 | 3300011119 | Bacteria | 7096 |
| 97 | Ga0105246_10056823 | 3300011119 | Bacteria | 2706 |
| 98 | Ga0157345_1000466 | 3300012498 | Bacteria | 3875 |
| 99 | Ga0157373_10058499 | 3300013100 | Bacteria | 2733 |
| 100 | Ga0157373_10059460 | 3300013100 | Bacteria | 2708 |
| 101 | Ga0157373_10060687 | 3300013100 | Bacteria | 2678 |
| 102 | Ga0157373_10064824 | 3300013100 | Bacteria | 2586 |
| 103 | Ga0157373_10065719 | 3300013100 | Bacteria | 2566 |
| 104 | Ga0157371_10005665 | 3300013102 | Bacteria | 10486 |
| 105 | Ga0157371_10035009 | 3300013102 | Bacteria | 3600 |
| 106 | Ga0157370_10018287 | 3300013104 | Bacteria | 7050 |
| 107 | Ga0157370_10081418 | 3300013104 | Bacteria | 3046 |
| 108 | Ga0157369_10098005 | 3300013105 | Bacteria | 3127 |
| 109 | Ga0157369_10101594 | 3300013105 | Bacteria | 3064 |
| 110 | Ga0157369_10110445 | 3300013105 | Bacteria | 2923 |
| 111 | Ga0157369_10121333 | 3300013105 | Bacteria | 2773 |
| 112 | Ga0157369_10124194 | 3300013105 | Bacteria | 2738 |
| 113 | Ga0157369_10142667 | 3300013105 | Bacteria | 2534 |
| 114 | Ga0163162_10015613 | 3300013306 | Bacteria | 7422 |
| 115 | Ga0163162_10062608 | 3300013306 | Bacteria | 3761 |
| 116 | Ga0163162_10091796 | 3300013306 | Bacteria | 3120 |
| 117 | Ga0157372_10128859 | 3300013307 | Bacteria | 2910 |
| 118 | Ga0157375_10010253 | 3300013308 | Bacteria | 8243 |
| 119 | Ga0163163_10023175 | 3300014325 | Bacteria | 5890 |
| 120 | Ga0157380_10059801 | 3300014326 | Bacteria | 3042 |
| 121 | Ga0182008_10009257 | 3300014497 | Bacteria | 5324 |
| 122 | Ga0182008_10021127 | 3300014497 | Bacteria | 3346 |
| 123 | Ga0182008_10026059 | 3300014497 | Bacteria | 2966 |
| 124 | Ga0182008_10029299 | 3300014497 | Bacteria | 2782 |
| 125 | Ga0182008_10033809 | 3300014497 | Bacteria | 2565 |
| 126 | Ga0182006_1010175 | 3300015261 | Bacteria | 4191 |
| 127 | Ga0182006_1013977 | 3300015261 | Bacteria | 3468 |
| 128 | Ga0182006_1017585 | 3300015261 | Bacteria | 3035 |
| 129 | Ga0182007_10012959 | 3300015262 | Bacteria | 3194 |
| 130 | Ga0182007_10018219 | 3300015262 | Bacteria | 2547 |
| 131 | Ga0182005_1005690 | 3300015265 | Bacteria | 3875 |
| 132 | Ga0182005_1008456 | 3300015265 | Bacteria | 3031 |
| 133 | Ga0182005_1008628 | 3300015265 | Bacteria | 2996 |
| 134 | Ga0163161_10048991 | 3300017792 | Bacteria | 3052 |
| 135 | Ga0163161_10050044 | 3300017792 | Bacteria | 3022 |
| 136 | Ga0163161_10063375 | 3300017792 | Bacteria | 2694 |
| 137 | Ga0163161_10066150 | 3300017792 | Bacteria | 2639 |
| 138 | Ga0213872_10015263 | 3300021361 | Bacteria | 3575 |
| 139 | Ga0209760_100055 | 3300025207 | Bacteria | 100237 |
| 140 | Ga0209760_100084 | 3300025207 | Bacteria | 75138 |
| 141 | Ga0209784_100015 | 3300025224 | Bacteria | 482117 |
| 142 | Ga0209566_100012 | 3300025225 | Bacteria | 482281 |
| 143 | Ga0209674_100027 | 3300025226 | Bacteria | 482281 |
| 144 | Ga0209147_100019 | 3300025229 | Bacteria | 482139 |
| 145 | Ga0209563_100031 | 3300025230 | Bacteria | 482281 |
| 146 | Ga0207427_100004 | 3300025231 | Bacteria | 939600 |
| 147 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 148 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 149 | Ga0209437_100028 | 3300025233 | Bacteria | 540136 |
| 150 | Ga0209437_101295 | 3300025233 | Bacteria | 6721 |
| 151 | Ga0209258_100296 | 3300025242 | Bacteria | 81403 |
| 152 | Ga0209646_1000213 | 3300025246 | Bacteria | 64543 |
| 153 | Ga0209677_100016 | 3300025253 | Bacteria | 482117 |
| 154 | Ga0209759_1002967 | 3300025256 | Bacteria | 7067 |
| 155 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 156 | Ga0209233_1000059 | 3300025261 | Bacteria | 414562 |
| 157 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 158 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 159 | Ga0209676_1000231 | 3300025292 | Bacteria | 120750 |
| 160 | Ga0209676_1000270 | 3300025292 | Bacteria | 108368 |
| 161 | Ga0209676_1015059 | 3300025292 | Bacteria | 2868 |
| 162 | Ga0209050_1000019 | 3300025298 | Bacteria | 608757 |
| 163 | Ga0209050_1000027 | 3300025298 | Bacteria | 483261 |
| 164 | Ga0209050_1000065 | 3300025298 | Bacteria | 313668 |
| 165 | Ga0209050_1008780 | 3300025298 | Bacteria | 5310 |
| 166 | Ga0209051_1000238 | 3300025303 | Bacteria | 92629 |
| 167 | Ga0209051_1000258 | 3300025303 | Bacteria | 88383 |
| 168 | Ga0209051_1000265 | 3300025303 | Bacteria | 87617 |
| 169 | Ga0209257_1000119 | 3300025304 | Bacteria | 225893 |
| 170 | Ga0209257_1009506 | 3300025304 | Bacteria | 5179 |
| 171 | Ga0207656_10000014 | 3300025321 | Bacteria | 146941 |
| 172 | Ga0207696_1000022 | 3300025711 | Bacteria | 427529 |
| 173 | Ga0207696_1000034 | 3300025711 | Bacteria | 350426 |
| 174 | Ga0207696_1000179 | 3300025711 | Bacteria | 99732 |
| 175 | Ga0207696_1000221 | 3300025711 | Bacteria | 82620 |
| 176 | Ga0207696_1014999 | 3300025711 | Bacteria | 2639 |
| 177 | Ga0207655_1000021 | 3300025728 | Bacteria | 518596 |
| 178 | Ga0207655_1000437 | 3300025728 | Bacteria | 55747 |
| 179 | Ga0207655_1001119 | 3300025728 | Bacteria | 26209 |
| 180 | Ga0207655_1002144 | 3300025728 | Bacteria | 16449 |
| 181 | Ga0207655_1002245 | 3300025728 | Bacteria | 15983 |
| 182 | Ga0207655_1003145 | 3300025728 | Bacteria | 12481 |
| 183 | Ga0207655_1004890 | 3300025728 | Bacteria | 9296 |
| 184 | Ga0207655_1009294 | 3300025728 | Bacteria | 6121 |
| 185 | Ga0207655_1011125 | 3300025728 | Bacteria | 5386 |
| 186 | Ga0207655_1018538 | 3300025728 | Bacteria | 3685 |
| 187 | Ga0207655_1019100 | 3300025728 | Bacteria | 3602 |
| 188 | Ga0207655_1019516 | 3300025728 | Bacteria | 3537 |
| 189 | Ga0207655_1026581 | 3300025728 | Bacteria | 2777 |
| 190 | Ga0207713_1000014 | 3300025735 | Bacteria | 432450 |
| 191 | Ga0207713_1000219 | 3300025735 | Bacteria | 77126 |
| 192 | Ga0207713_1000322 | 3300025735 | Bacteria | 54257 |
| 193 | Ga0207713_1000865 | 3300025735 | Bacteria | 27710 |
| 194 | Ga0207713_1002208 | 3300025735 | Bacteria | 14420 |
| 195 | Ga0207713_1002739 | 3300025735 | Bacteria | 12529 |
| 196 | Ga0207713_1003423 | 3300025735 | Bacteria | 10836 |
| 197 | Ga0207713_1018349 | 3300025735 | Bacteria | 3467 |
| 198 | Ga0207713_1018515 | 3300025735 | Bacteria | 3445 |
| 199 | Ga0207713_1024866 | 3300025735 | Bacteria | 2779 |
| 200 | Ga0207713_1024878 | 3300025735 | Bacteria | 2778 |
| 201 | Ga0207710_10005011 | 3300025900 | Bacteria | 5736 |
| 202 | Ga0207671_10000019 | 3300025914 | Bacteria | 317781 |
| 203 | Ga0207657_10017006 | 3300025919 | Bacteria | 6996 |
| 204 | Ga0207649_10000004 | 3300025920 | Bacteria | 360726 |
| 205 | Ga0207681_10003747 | 3300025923 | Bacteria | 9450 |
| 206 | Ga0207650_10000863 | 3300025925 | Bacteria | 22996 |
| 207 | Ga0207650_10001402 | 3300025925 | Bacteria | 17379 |
| 208 | Ga0207706_10002341 | 3300025933 | Bacteria | 18506 |
| 209 | Ga0207706_10020261 | 3300025933 | Bacteria | 5978 |
| 210 | Ga0207709_10000013 | 3300025935 | Bacteria | 531977 |
| 211 | Ga0207709_10001096 | 3300025935 | Bacteria | 19859 |
| 212 | Ga0207709_10018226 | 3300025935 | Bacteria | 3928 |
| 213 | Ga0207670_10002998 | 3300025936 | Bacteria | 8912 |
| 214 | Ga0207704_10002399 | 3300025938 | Bacteria | 8419 |
| 215 | Ga0207661_10008619 | 3300025944 | Bacteria | 7286 |
| 216 | Ga0207679_10000019 | 3300025945 | Bacteria | 230270 |
| 217 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 218 | Ga0209281_1000049 | 3300027111 | Bacteria | 322274 |
| 219 | Ga0209389_1000005 | 3300027296 | Bacteria | 232255 |
| 220 | Ga0209371_1000239 | 3300027312 | Bacteria | 68842 |
| 221 | Ga0209371_1000253 | 3300027312 | Bacteria | 65388 |
| 222 | Ga0209995_1002313 | 3300027471 | Bacteria | 3007 |
| 223 | Ga0207428_10053616 | 3300027907 | Bacteria | 3215 |
| 224 | Ga0268266_10001168 | 3300028379 | Bacteria | 32486 |
| 225 | Ga0268266_10043777 | 3300028379 | Bacteria | 3826 |
| 226 | Ga0268266_10044230 | 3300028379 | Bacteria | 3806 |
| 227 | Ga0268265_10020412 | 3300028380 | Bacteria | 4624 |
| 228 | Ga0268264_10052167 | 3300028381 | Bacteria | 3410 |
| 229 | Ga0307517_10089734 | 3300028786 | Bacteria | 2528 |
| 230 | Ga0268256_1000199 | 3300030500 | Bacteria | 68849 |
| 231 | Ga0268256_1000797 | 3300030500 | Bacteria | 22655 |
| 232 | Ga0307511_10059086 | 3300030521 | Bacteria | 2954 |
| 233 | Ga0316177_1066524 | 3300030731 | Bacteria | 3395 |
| 234 | Ga0316179_1027375 | 3300030734 | Bacteria | 5590 |
| 235 | Ga0316178_1076411 | 3300030735 | Bacteria | 28643 |
| 236 | Ga0316181_1090496 | 3300030744 | Bacteria | 4262 |
| 237 | Ga0307509_10120304 | 3300031507 | Bacteria | 2605 |
| 238 | Ga0307408_100000047 | 3300031548 | Bacteria | 166310 |
| 239 | Ga0307408_100008794 | 3300031548 | Bacteria | 6667 |
| 240 | Ga0307408_100046273 | 3300031548 | Bacteria | 3111 |
| 241 | Ga0307408_100050617 | 3300031548 | Bacteria | 2988 |
| 242 | Ga0307408_100104467 | 3300031548 | Bacteria | 2164 |
| 243 | Ga0307405_10002250 | 3300031731 | Bacteria | 8446 |
| 244 | Ga0307405_10003033 | 3300031731 | Bacteria | 7607 |
| 245 | Ga0307413_10015659 | 3300031824 | Bacteria | 3893 |
| 246 | Ga0307406_10025698 | 3300031901 | Bacteria | 3527 |
| 247 | Ga0307407_10022106 | 3300031903 | Bacteria | 3293 |
| 248 | Ga0307412_10006998 | 3300031911 | Bacteria | 6402 |
| 249 | Ga0307412_10010807 | 3300031911 | Bacteria | 5268 |
| 250 | Ga0307412_10021728 | 3300031911 | Bacteria | 3924 |
| 251 | Ga0307409_100043923 | 3300031995 | Bacteria | 3361 |
| 252 | Ga0307414_10024247 | 3300032004 | Bacteria | 3865 |
| 253 | Ga0307414_10047289 | 3300032004 | Bacteria | 2960 |
| 254 | Ga0307411_10009125 | 3300032005 | Bacteria | 5192 |
| 255 | Ga0307510_10062651 | 3300033180 | Bacteria | 3798 |
| 256 | Ga0436364_0471212 | 3300037853 | Bacteria | 24075 |
| 257 | Ga0400485_08592 | 3300038735 | Bacteria | 5530 |
| 258 | Ga0436361_0690852 | 3300039447 | Bacteria | 7513 |
| 259 | Ga0436361_1012736 | 3300039447 | Bacteria | 10762 |
| 260 | Ga0439436_0001961 | 3300041404 | Bacteria | 6095 |
| 261 | Ga0439438_001186 | 3300041405 | Bacteria | 11576 |
| 262 | Ga0439438_001866 | 3300041405 | Bacteria | 9220 |
| 263 | Ga0439438_004459 | 3300041405 | Bacteria | 5361 |
| 264 | Ga0439438_008691 | 3300041405 | Bacteria | 3344 |
| 265 | Ga0439438_009584 | 3300041405 | Bacteria | 3125 |
| 266 | Ga0439438_009756 | 3300041405 | Bacteria | 3085 |
| 267 | Ga0439438_010829 | 3300041405 | Bacteria | 2866 |
| 268 | Ga0439447_006808 | 3300041407 | Bacteria | 3674 |
| 269 | Ga0439466_0001022 | 3300041411 | Bacteria | 10767 |
| 270 | Ga0439466_0002186 | 3300041411 | Bacteria | 7667 |
| 271 | Ga0439466_0004468 | 3300041411 | Bacteria | 5381 |
| 272 | Ga0439466_0016097 | 3300041411 | Bacteria | 2707 |
| 273 | Ga0439432_001773 | 3300042006 | Bacteria | 8081 |
| 274 | Ga0439432_002335 | 3300042006 | Bacteria | 7158 |
| 275 | Ga0439432_002494 | 3300042006 | Bacteria | 6935 |
| 276 | Ga0439432_002665 | 3300042006 | Bacteria | 6678 |
| 277 | Ga0439432_003372 | 3300042006 | Bacteria | 5927 |
| 278 | Ga0439451_001619 | 3300042009 | Bacteria | 4465 |
| 279 | Ga0439451_002915 | 3300042009 | Bacteria | 3474 |
| 280 | Ga0439452_000311 | 3300042010 | Bacteria | 31096 |
| 281 | Ga0439452_001075 | 3300042010 | Bacteria | 12056 |
| 282 | Ga0439452_004203 | 3300042010 | Bacteria | 4879 |
| 283 | Ga0439452_006032 | 3300042010 | Bacteria | 3836 |
| 284 | Ga0439452_007158 | 3300042010 | Bacteria | 3435 |
| 285 | Ga0439456_000798 | 3300042013 | Bacteria | 6393 |
| 286 | Ga0439456_001395 | 3300042013 | Bacteria | 4837 |
| 287 | Ga0439463_000274 | 3300042016 | Bacteria | 14223 |
| 288 | Ga0439463_002176 | 3300042016 | Bacteria | 5050 |
| 289 | Ga0450911_000066 | 3300042115 | Bacteria | 43087 |
| 290 | Ga0450911_001637 | 3300042115 | Bacteria | 4984 |
| 291 | Ga0450911_003031 | 3300042115 | Bacteria | 3079 |
| 292 | Ga0450923_003130 | 3300042125 | Bacteria | 2459 |
| 293 | Ga0450902_000205 | 3300042137 | Bacteria | 6903 |
| 294 | Ga0450903_002144 | 3300042138 | Bacteria | 3534 |
| 295 | Ga0450903_004512 | 3300042138 | Bacteria | 2373 |
| 296 | Ga0450904_000048 | 3300042139 | Bacteria | 27569 |
| 297 | Ga0450904_001720 | 3300042139 | Bacteria | 2908 |
| 298 | Ga0450905_001052 | 3300042142 | Bacteria | 3469 |
| 299 | Ga0450906_002598 | 3300042145 | Bacteria | 3936 |
| 300 | Ga0450907_000017 | 3300042146 | Bacteria | 83894 |
| 301 | Ga0450910_001240 | 3300042147 | Bacteria | 3183 |
| 302 | Ga0439446_0007580 | 3300042156 | Bacteria | 2857 |
| 303 | Ga0439446_0011172 | 3300042156 | Bacteria | 2434 |
| 304 | Ga0439434_0002739 | 3300042435 | Bacteria | 5136 |
| 305 | Ga0439460_0004386 | 3300042461 | Bacteria | 3438 |
| 306 | Ga0466972_0017593 | 3300044658 | Bacteria | 3578 |
| 307 | Ga0453684_0059415 | 3300044712 | Bacteria | 4929 |
| 308 | Ga0495617_004289 | 3300046452 | Bacteria | 5202 |
| 309 | Ga0495617_006066 | 3300046452 | Bacteria | 4255 |
| 310 | Ga0495617_011060 | 3300046452 | Bacteria | 3084 |
| 311 | Ga0495617_013012 | 3300046452 | Bacteria | 2835 |
| 312 | Ga0495617_014114 | 3300046452 | Bacteria | 2715 |
| 313 | Ga0495617_015051 | 3300046452 | Bacteria | 2624 |
| 314 | Ga0495627_000047 | 3300046453 | Bacteria | 170068 |
| 315 | Ga0495627_008983 | 3300046453 | Bacteria | 3695 |
| 316 | Ga0495627_012153 | 3300046453 | Bacteria | 3065 |
| 317 | Ga0495627_020716 | 3300046453 | Bacteria | 2189 |
| 318 | Ga0495627_023940 | 3300046453 | Bacteria | 1995 |
| 319 | Ga0495592_0077085 | 3300046454 | Bacteria | 2418 |
| 320 | Ga0495590_0008218 | 3300046457 | Bacteria | 3992 |
| 321 | Ga0495590_0014644 | 3300046457 | Bacteria | 2860 |
| 322 | Ga0495591_000019 | 3300046458 | Bacteria | 223010 |
| 323 | Ga0495591_000226 | 3300046458 | Bacteria | 55990 |
| 324 | Ga0495591_001090 | 3300046458 | Bacteria | 18086 |
| 325 | Ga0495591_001827 | 3300046458 | Bacteria | 12580 |
| 326 | Ga0495591_003767 | 3300046458 | Bacteria | 7671 |
| 327 | Ga0495591_007755 | 3300046458 | Bacteria | 4501 |
| 328 | Ga0495591_008398 | 3300046458 | Bacteria | 4233 |
| 329 | Ga0495591_009279 | 3300046458 | Bacteria | 3925 |
| 330 | Ga0495591_010510 | 3300046458 | Bacteria | 3583 |
| 331 | Ga0495591_012388 | 3300046458 | Bacteria | 3179 |
| 332 | Ga0495591_013155 | 3300046458 | Bacteria | 3043 |
| 333 | Ga0495591_013246 | 3300046458 | Bacteria | 3028 |
| 334 | Ga0495638_0024191 | 3300046460 | Bacteria | 3963 |
| 335 | Ga0495638_0031234 | 3300046460 | Bacteria | 3424 |
| 336 | Ga0495638_0039113 | 3300046460 | Bacteria | 3012 |
| 337 | Ga0495638_0039262 | 3300046460 | Bacteria | 3005 |
| 338 | Ga0495638_0039614 | 3300046460 | Bacteria | 2990 |
| 339 | Ga0495638_0049146 | 3300046460 | Bacteria | 2637 |
| 340 | Ga0495638_0067905 | 3300046460 | Bacteria | 2187 |
| 341 | Ga0495653_0017574 | 3300046463 | Bacteria | 5815 |
| 342 | Ga0495653_0054783 | 3300046463 | Bacteria | 3045 |
| 343 | Ga0495650_0001450 | 3300046471 | Bacteria | 22769 |
| 344 | Ga0495650_0001813 | 3300046471 | Bacteria | 19206 |
| 345 | Ga0495650_0004844 | 3300046471 | Bacteria | 9002 |
| 346 | Ga0495650_0016000 | 3300046471 | Bacteria | 3820 |
| 347 | Ga0495650_0023168 | 3300046471 | Bacteria | 2960 |
| 348 | Ga0495650_0028406 | 3300046471 | Bacteria | 2569 |
| 349 | Ga0495605_0000016 | 3300046474 | Bacteria | 289508 |
| 350 | Ga0495605_0000777 | 3300046474 | Bacteria | 22913 |
| 351 | Ga0495605_0004046 | 3300046474 | Bacteria | 8654 |
| 352 | Ga0495605_0008479 | 3300046474 | Bacteria | 5811 |
| 353 | Ga0495605_0025995 | 3300046474 | Bacteria | 3046 |
| 354 | Ga0495605_0041482 | 3300046474 | Bacteria | 2292 |
| 355 | Ga0495639_0000070 | 3300046475 | Bacteria | 47518 |
| 356 | Ga0495584_0014286 | 3300046491 | Bacteria | 4046 |
| 357 | Ga0495584_0016726 | 3300046491 | Bacteria | 3739 |
| 358 | Ga0495584_0018656 | 3300046491 | Bacteria | 3526 |
| 359 | Ga0495584_0023881 | 3300046491 | Bacteria | 3099 |
| 360 | Ga0495584_0024138 | 3300046491 | Bacteria | 3082 |
| 361 | Ga0495584_0031098 | 3300046491 | Bacteria | 2702 |
| 362 | Ga0495584_0031646 | 3300046491 | Bacteria | 2677 |
| 363 | Ga0495584_0037181 | 3300046491 | Bacteria | 2459 |
| 364 | Ga0495585_0004440 | 3300046492 | Bacteria | 9099 |
| 365 | Ga0495585_0013778 | 3300046492 | Bacteria | 4724 |
| 366 | Ga0495585_0027478 | 3300046492 | Bacteria | 3247 |
| 367 | Ga0495585_0030514 | 3300046492 | Bacteria | 3065 |
| 368 | Ga0495585_0030685 | 3300046492 | Bacteria | 3056 |
| 369 | Ga0495585_0031930 | 3300046492 | Bacteria | 2986 |
| 370 | Ga0495585_0039729 | 3300046492 | Bacteria | 2644 |
| 371 | Ga0495585_0047438 | 3300046492 | Bacteria | 2392 |
| 372 | Ga0495585_0052582 | 3300046492 | Bacteria | 2255 |
| 373 | Ga0495585_0052698 | 3300046492 | Bacteria | 2252 |
| 374 | Ga0495594_0000837 | 3300046499 | Bacteria | 15880 |
| 375 | Ga0495594_0030349 | 3300046499 | Bacteria | 2924 |
| 376 | Ga0495596_0002692 | 3300046500 | Bacteria | 9368 |
| 377 | Ga0495596_0019628 | 3300046500 | Bacteria | 2774 |
| 378 | Ga0495607_0000204 | 3300046501 | Bacteria | 62840 |
| 379 | Ga0495607_0000573 | 3300046501 | Bacteria | 35938 |
| 380 | Ga0495607_0001298 | 3300046501 | Bacteria | 22284 |
| 381 | Ga0495607_0006581 | 3300046501 | Bacteria | 8160 |
| 382 | Ga0495607_0008637 | 3300046501 | Bacteria | 6946 |
| 383 | Ga0495607_0013688 | 3300046501 | Bacteria | 5304 |
| 384 | Ga0495607_0018774 | 3300046501 | Bacteria | 4398 |
| 385 | Ga0495607_0023427 | 3300046501 | Bacteria | 3865 |
| 386 | Ga0495607_0026251 | 3300046501 | Bacteria | 3615 |
| 387 | Ga0495607_0033681 | 3300046501 | Bacteria | 3115 |
| 388 | Ga0495607_0035991 | 3300046501 | Bacteria | 2989 |
| 389 | Ga0495583_0000819 | 3300046506 | Bacteria | 38035 |
| 390 | Ga0495583_0002361 | 3300046506 | Bacteria | 16303 |
| 391 | Ga0495583_0005593 | 3300046506 | Bacteria | 8473 |
| 392 | Ga0495583_0006065 | 3300046506 | Bacteria | 7995 |
| 393 | Ga0495583_0006950 | 3300046506 | Bacteria | 7259 |
| 394 | Ga0495583_0017172 | 3300046506 | Bacteria | 3855 |
| 395 | Ga0495583_0023932 | 3300046506 | Bacteria | 3078 |
| 396 | Ga0495606_0000567 | 3300046507 | Bacteria | 58569 |
| 397 | Ga0495606_0001124 | 3300046507 | Bacteria | 38193 |
| 398 | Ga0495606_0001172 | 3300046507 | Bacteria | 36969 |
| 399 | Ga0495606_0010245 | 3300046507 | Bacteria | 7809 |
| 400 | Ga0495606_0027985 | 3300046507 | Bacteria | 3984 |
| 401 | Ga0495606_0030072 | 3300046507 | Bacteria | 3800 |
| 402 | Ga0495606_0032211 | 3300046507 | Bacteria | 3634 |
| 403 | Ga0495606_0032296 | 3300046507 | Bacteria | 3628 |
| 404 | Ga0495606_0034421 | 3300046507 | Bacteria | 3478 |
| 405 | Ga0495606_0034592 | 3300046507 | Bacteria | 3467 |
| 406 | Ga0495606_0034618 | 3300046507 | Bacteria | 3465 |
| 407 | Ga0495606_0037921 | 3300046507 | Bacteria | 3267 |
| 408 | Ga0495606_0041559 | 3300046507 | Bacteria | 3082 |
| 409 | Ga0495610_0019353 | 3300046512 | Bacteria | 3813 |
| 410 | Ga0495610_0026723 | 3300046512 | Bacteria | 3077 |
| 411 | Ga0495610_0027144 | 3300046512 | Bacteria | 3048 |
| 412 | Ga0495610_0029881 | 3300046512 | Bacteria | 2862 |
| 413 | Ga0495610_0034836 | 3300046512 | Bacteria | 2589 |
| 414 | Ga0495610_0035785 | 3300046512 | Bacteria | 2544 |
| 415 | Ga0495616_0009067 | 3300046513 | Bacteria | 5837 |
| 416 | Ga0495616_0014588 | 3300046513 | Bacteria | 4393 |
| 417 | Ga0495616_0018151 | 3300046513 | Bacteria | 3868 |
| 418 | Ga0495616_0019211 | 3300046513 | Bacteria | 3732 |
| 419 | Ga0495616_0022493 | 3300046513 | Bacteria | 3405 |
| 420 | Ga0495616_0025885 | 3300046513 | Bacteria | 3128 |
| 421 | Ga0495620_0000013 | 3300046515 | Bacteria | 160349 |
| 422 | Ga0495620_0000230 | 3300046515 | Bacteria | 41717 |
| 423 | Ga0495620_0000463 | 3300046515 | Bacteria | 26659 |
| 424 | Ga0495620_0005401 | 3300046515 | Bacteria | 7133 |
| 425 | Ga0495620_0009905 | 3300046515 | Bacteria | 5044 |
| 426 | Ga0495620_0018127 | 3300046515 | Bacteria | 3491 |
| 427 | Ga0495620_0018392 | 3300046515 | Bacteria | 3461 |
| 428 | Ga0495631_0000817 | 3300046518 | Bacteria | 19934 |
| 429 | Ga0495631_0007145 | 3300046518 | Bacteria | 5705 |
| 430 | Ga0495631_0022139 | 3300046518 | Bacteria | 2955 |
| 431 | Ga0495632_0001080 | 3300046519 | Bacteria | 23398 |
| 432 | Ga0495632_0001889 | 3300046519 | Bacteria | 16794 |
| 433 | Ga0495632_0008466 | 3300046519 | Bacteria | 6310 |
| 434 | Ga0495632_0013149 | 3300046519 | Bacteria | 4739 |
| 435 | Ga0495632_0014175 | 3300046519 | Bacteria | 4520 |
| 436 | Ga0495632_0014766 | 3300046519 | Bacteria | 4405 |
| 437 | Ga0495632_0017841 | 3300046519 | Bacteria | 3906 |
| 438 | Ga0495632_0019871 | 3300046519 | Bacteria | 3649 |
| 439 | Ga0495632_0027027 | 3300046519 | Bacteria | 3011 |
| 440 | Ga0495632_0030253 | 3300046519 | Bacteria | 2812 |
| 441 | Ga0495632_0035658 | 3300046519 | Bacteria | 2537 |
| 442 | Ga0495637_0000252 | 3300046520 | Bacteria | 42250 |
| 443 | Ga0495637_0003456 | 3300046520 | Bacteria | 8393 |
| 444 | Ga0495637_0013531 | 3300046520 | Bacteria | 3869 |
| 445 | Ga0495637_0013717 | 3300046520 | Bacteria | 3841 |
| 446 | Ga0495637_0014017 | 3300046520 | Bacteria | 3792 |
| 447 | Ga0495637_0015810 | 3300046520 | Bacteria | 3534 |
| 448 | Ga0495637_0017701 | 3300046520 | Bacteria | 3314 |
| 449 | Ga0495637_0019871 | 3300046520 | Bacteria | 3098 |
| 450 | Ga0495637_0021017 | 3300046520 | Bacteria | 2994 |
| 451 | Ga0495637_0021079 | 3300046520 | Bacteria | 2990 |
| 452 | Ga0495637_0022326 | 3300046520 | Bacteria | 2887 |
| 453 | Ga0495637_0027075 | 3300046520 | Bacteria | 2568 |
| 454 | Ga0495643_0000684 | 3300046522 | Bacteria | 39346 |
| 455 | Ga0495643_0000830 | 3300046522 | Bacteria | 33682 |
| 456 | Ga0495643_0013635 | 3300046522 | Bacteria | 4858 |
| 457 | Ga0495643_0029268 | 3300046522 | Bacteria | 3082 |
| 458 | Ga0495643_0030715 | 3300046522 | Bacteria | 2997 |
| 459 | Ga0495644_0000921 | 3300046523 | Bacteria | 12224 |
| 460 | Ga0495644_0019105 | 3300046523 | Bacteria | 2616 |
| 461 | Ga0495648_0003089 | 3300046524 | Bacteria | 14876 |
| 462 | Ga0495648_0004745 | 3300046524 | Bacteria | 11510 |
| 463 | Ga0495648_0007885 | 3300046524 | Bacteria | 8462 |
| 464 | Ga0495648_0024516 | 3300046524 | Bacteria | 4106 |
| 465 | Ga0495648_0026355 | 3300046524 | Bacteria | 3915 |
| 466 | Ga0495648_0029048 | 3300046524 | Bacteria | 3674 |
| 467 | Ga0495648_0030971 | 3300046524 | Bacteria | 3529 |
| 468 | Ga0495648_0035148 | 3300046524 | Bacteria | 3251 |
| 469 | Ga0495648_0035794 | 3300046524 | Bacteria | 3213 |
| 470 | Ga0495648_0038042 | 3300046524 | Bacteria | 3083 |
| 471 | Ga0495648_0038974 | 3300046524 | Bacteria | 3030 |
| 472 | Ga0495648_0047702 | 3300046524 | Bacteria | 2644 |
| 473 | Ga0495648_0051342 | 3300046524 | Bacteria | 2513 |
| 474 | Ga0495642_0001881 | 3300046528 | Bacteria | 8950 |
| 475 | Ga0495642_0007894 | 3300046528 | Bacteria | 4077 |
| 476 | Ga0495654_0001564 | 3300046530 | Bacteria | 15516 |
| 477 | Ga0495654_0001684 | 3300046530 | Bacteria | 14886 |
| 478 | Ga0495654_0007896 | 3300046530 | Bacteria | 5916 |
| 479 | Ga0495654_0008686 | 3300046530 | Bacteria | 5600 |
| 480 | Ga0495654_0013298 | 3300046530 | Bacteria | 4407 |
| 481 | Ga0495654_0019502 | 3300046530 | Bacteria | 3546 |
| 482 | Ga0495654_0020877 | 3300046530 | Bacteria | 3410 |
| 483 | Ga0495654_0025380 | 3300046530 | Bacteria | 3052 |
| 484 | Ga0495654_0026285 | 3300046530 | Bacteria | 2993 |
| 485 | Ga0495654_0031179 | 3300046530 | Bacteria | 2706 |
| 486 | Ga0495654_0044747 | 3300046530 | Bacteria | 2187 |
| 487 | Ga0495609_0000070 | 3300046538 | Bacteria | 128181 |
| 488 | Ga0495609_0000197 | 3300046538 | Bacteria | 60324 |
| 489 | Ga0495609_0000707 | 3300046538 | Bacteria | 25665 |
| 490 | Ga0495609_0013552 | 3300046538 | Bacteria | 3848 |
| 491 | Ga0495609_0020115 | 3300046538 | Bacteria | 3084 |
| 492 | Ga0495609_0030703 | 3300046538 | Bacteria | 2445 |
| 493 | Ga0495597_0000010 | 3300046542 | Bacteria | 222418 |
| 494 | Ga0495597_0003921 | 3300046542 | Bacteria | 8402 |
| 495 | Ga0495597_0014114 | 3300046542 | Bacteria | 3808 |
| 496 | Ga0495597_0021003 | 3300046542 | Bacteria | 3036 |
| 497 | Ga0495597_0022478 | 3300046542 | Bacteria | 2925 |
| 498 | Ga0495597_0027850 | 3300046542 | Bacteria | 2589 |
| 499 | Ga0495597_0036148 | 3300046542 | Bacteria | 2225 |
| 500 | Ga0495597_0041212 | 3300046542 | Bacteria | 2063 |
| 501 | Ga0495622_0008343 | 3300046557 | Bacteria | 4799 |
| 502 | Ga0495622_0012637 | 3300046557 | Bacteria | 3912 |
| 503 | Ga0495622_0017017 | 3300046557 | Bacteria | 3384 |
| 504 | Ga0495622_0020701 | 3300046557 | Bacteria | 3062 |
| 505 | Ga0495633_0001527 | 3300046558 | Bacteria | 17811 |
| 506 | Ga0495633_0012320 | 3300046558 | Bacteria | 4556 |
| 507 | Ga0495633_0015599 | 3300046558 | Bacteria | 3938 |
| 508 | Ga0495633_0024573 | 3300046558 | Bacteria | 2976 |
| 509 | Ga0495656_0025268 | 3300046615 | Bacteria | 2353 |
| 510 | Ga0495668_0000102 | 3300046616 | Bacteria | 137192 |
| 511 | Ga0495668_0005367 | 3300046616 | Bacteria | 8731 |
| 512 | Ga0495668_0006716 | 3300046616 | Bacteria | 7492 |
| 513 | Ga0495668_0013510 | 3300046616 | Bacteria | 4812 |
| 514 | Ga0495668_0015789 | 3300046616 | Bacteria | 4400 |
| 515 | Ga0495668_0028248 | 3300046616 | Bacteria | 3173 |
| 516 | Ga0495668_0036800 | 3300046616 | Bacteria | 2741 |
| 517 | Ga0495634_0008019 | 3300046642 | Bacteria | 7881 |
| 518 | Ga0495611_0002696 | 3300046648 | Bacteria | 8007 |
| 519 | Ga0495611_0004966 | 3300046648 | Bacteria | 5699 |
| 520 | Ga0495611_0021284 | 3300046648 | Bacteria | 2800 |
| 521 | Ga0495625_0000354 | 3300046660 | Bacteria | 69894 |
| 522 | Ga0495625_0021002 | 3300046660 | Bacteria | 5033 |
| 523 | Ga0495625_0035765 | 3300046660 | Bacteria | 3657 |
| 524 | Ga0495625_0048467 | 3300046660 | Bacteria | 3058 |
| 525 | Ga0495625_0061054 | 3300046660 | Bacteria | 2668 |
| 526 | Ga0495625_0063776 | 3300046660 | Bacteria | 2601 |
| 527 | Ga0495625_0088802 | 3300046660 | Bacteria | 2141 |
| 528 | Ga0495635_0013908 | 3300046663 | Bacteria | 5630 |
| 529 | Ga0495659_0009675 | 3300046664 | Bacteria | 3081 |
| 530 | Ga0495661_0000185 | 3300046665 | Bacteria | 71615 |
| 531 | Ga0495661_0000329 | 3300046665 | Bacteria | 51418 |
| 532 | Ga0495661_0000875 | 3300046665 | Bacteria | 27820 |
| 533 | Ga0495661_0006179 | 3300046665 | Bacteria | 8430 |
| 534 | Ga0495661_0027613 | 3300046665 | Bacteria | 3641 |
| 535 | Ga0495661_0042076 | 3300046665 | Bacteria | 2819 |
| 536 | Ga0495661_0045270 | 3300046665 | Bacteria | 2692 |
| 537 | Ga0495661_0046877 | 3300046665 | Bacteria | 2635 |
| 538 | Ga0495661_0054279 | 3300046665 | Bacteria | 2406 |
| 539 | Ga0495588_0023759 | 3300046674 | Bacteria | 3038 |
| 540 | Ga0495623_0013516 | 3300046679 | Bacteria | 5292 |
| 541 | Ga0495623_0013934 | 3300046679 | Bacteria | 5212 |
| 542 | Ga0495646_0012272 | 3300046680 | Bacteria | 5448 |
| 543 | Ga0495646_0024614 | 3300046680 | Bacteria | 3790 |
| 544 | Ga0495613_0048971 | 3300046689 | Bacteria | 3119 |
| 545 | Ga0495624_0025535 | 3300046690 | Bacteria | 3878 |
| 546 | Ga0495670_0003514 | 3300046691 | Bacteria | 7688 |
| 547 | Ga0495670_0013746 | 3300046691 | Bacteria | 3980 |
| 548 | Ga0495670_0022757 | 3300046691 | Bacteria | 3094 |
| 549 | Ga0495670_0028476 | 3300046691 | Bacteria | 2769 |
| 550 | Ga0495671_0001087 | 3300046692 | Bacteria | 18808 |
| 551 | Ga0495671_0003824 | 3300046692 | Bacteria | 9150 |
| 552 | Ga0495671_0016167 | 3300046692 | Bacteria | 3990 |
| 553 | Ga0495671_0016777 | 3300046692 | Bacteria | 3904 |
| 554 | Ga0495671_0025511 | 3300046692 | Bacteria | 3071 |
| 555 | Ga0495671_0026078 | 3300046692 | Bacteria | 3032 |
| 556 | Ga0495671_0026390 | 3300046692 | Bacteria | 3012 |
| 557 | Ga0495671_0030656 | 3300046692 | Bacteria | 2753 |
| 558 | Ga0495671_0032512 | 3300046692 | Bacteria | 2663 |
| 559 | Ga0495671_0033113 | 3300046692 | Bacteria | 2634 |
| 560 | Ga0495671_0038474 | 3300046692 | Bacteria | 2417 |
| 561 | Ga0495649_0015223 | 3300046694 | Bacteria | 4378 |
| 562 | Ga0495649_0025836 | 3300046694 | Bacteria | 3269 |
| 563 | Ga0495649_0029287 | 3300046694 | Bacteria | 3046 |
| 564 | Ga0495649_0029516 | 3300046694 | Bacteria | 3032 |
| 565 | Ga0495649_0033712 | 3300046694 | Bacteria | 2817 |
| 566 | Ga0495589_0002046 | 3300046794 | Bacteria | 11412 |
| 567 | Ga0495589_0008932 | 3300046794 | Bacteria | 5216 |
| 568 | Ga0495589_0016896 | 3300046794 | Bacteria | 3746 |
| 569 | Ga0495589_0019754 | 3300046794 | Bacteria | 3448 |
| 570 | Ga0495589_0024555 | 3300046794 | Bacteria | 3063 |
| 571 | Ga0495589_0025402 | 3300046794 | Bacteria | 3006 |
| 572 | Ga0495589_0030977 | 3300046794 | Bacteria | 2693 |
| 573 | Ga0495600_0032163 | 3300046809 | Bacteria | 3402 |
| 574 | Ga0495660_0001329 | 3300046810 | Bacteria | 17034 |
| 575 | Ga0495660_0001815 | 3300046810 | Bacteria | 14024 |
| 576 | Ga0495660_0002558 | 3300046810 | Bacteria | 11591 |
| 577 | Ga0495660_0002643 | 3300046810 | Bacteria | 11369 |
| 578 | Ga0495660_0009743 | 3300046810 | Bacteria | 5597 |
| 579 | Ga0495660_0014666 | 3300046810 | Bacteria | 4532 |
| 580 | Ga0495660_0019932 | 3300046810 | Bacteria | 3846 |
| 581 | Ga0495660_0029277 | 3300046810 | Bacteria | 3108 |
| 582 | Ga0495660_0030377 | 3300046810 | Bacteria | 3043 |
| 583 | Ga0495660_0030681 | 3300046810 | Bacteria | 3027 |
| 584 | Ga0495660_0032426 | 3300046810 | Bacteria | 2933 |
| 585 | Ga0495660_0034972 | 3300046810 | Bacteria | 2809 |
| 586 | Ga0495660_0050491 | 3300046810 | Bacteria | 2265 |
| 587 | Ga0495604_0007388 | 3300047317 | Bacteria | 8707 |
| 588 | Ga0495674_0041032 | 3300047319 | Bacteria | 4136 |
| 589 | Ga0495672_0008936 | 3300047320 | Bacteria | 7316 |
| 590 | Ga0495672_0008970 | 3300047320 | Bacteria | 7302 |
| 591 | Ga0495672_0030800 | 3300047320 | Bacteria | 3357 |
| 592 | Ga0495672_0033749 | 3300047320 | Bacteria | 3168 |
| 593 | Ga0495672_0037045 | 3300047320 | Bacteria | 2988 |
| 594 | Ga0495672_0037577 | 3300047320 | Bacteria | 2961 |
| 595 | Ga0495672_0038553 | 3300047320 | Bacteria | 2914 |
| 596 | Ga0495672_0039685 | 3300047320 | Bacteria | 2861 |
| 597 | Ga0495672_0041440 | 3300047320 | Bacteria | 2784 |
| 598 | Ga0495672_0043449 | 3300047320 | Bacteria | 2702 |
| 599 | Ga0495672_0055233 | 3300047320 | Bacteria | 2318 |
| 600 | Ga0495672_0070934 | 3300047320 | Bacteria | 1972 |
| 601 | Ga0495676_0000081 | 3300047321 | Bacteria | 70377 |
| 602 | Ga0495676_0038465 | 3300047321 | Bacteria | 3973 |
| 603 | Ga0495676_0056133 | 3300047321 | Bacteria | 3116 |
| 604 | Ga0495680_0013118 | 3300047322 | Bacteria | 7241 |
| 605 | Ga0495680_0038945 | 3300047322 | Bacteria | 3796 |
| 606 | Ga0495683_0001164 | 3300047323 | Bacteria | 18007 |
| 607 | Ga0495683_0004135 | 3300047323 | Bacteria | 8301 |
| 608 | Ga0495683_0010986 | 3300047323 | Bacteria | 4775 |
| 609 | Ga0495683_0014129 | 3300047323 | Bacteria | 4160 |
| 610 | Ga0495683_0018831 | 3300047323 | Bacteria | 3565 |
| 611 | Ga0495683_0026962 | 3300047323 | Bacteria | 2939 |
| 612 | Ga0495683_0031784 | 3300047323 | Bacteria | 2689 |
| 613 | Ga0495683_0042993 | 3300047323 | Bacteria | 2276 |
| 614 | Ga0495687_015170 | 3300047443 | Bacteria | 3929 |
| 615 | Ga0495687_026899 | 3300047443 | Bacteria | 2699 |
| 616 | Ga0495679_000186 | 3300047446 | Bacteria | 54909 |
| 617 | Ga0495679_001415 | 3300047446 | Bacteria | 13647 |
| 618 | Ga0495679_011118 | 3300047446 | Bacteria | 3494 |
| 619 | Ga0495679_011313 | 3300047446 | Bacteria | 3451 |
| 620 | Ga0495679_013926 | 3300047446 | Bacteria | 2998 |
| 621 | Ga0495679_016933 | 3300047446 | Bacteria | 2621 |
| 622 | Ga0495679_019871 | 3300047446 | Bacteria | 2350 |
| 623 | Ga0495673_0002766 | 3300047469 | Bacteria | 12001 |
| 624 | Ga0495673_0003770 | 3300047469 | Bacteria | 9830 |
| 625 | Ga0495673_0004143 | 3300047469 | Bacteria | 9174 |
| 626 | Ga0495673_0004983 | 3300047469 | Bacteria | 8162 |
| 627 | Ga0495673_0015545 | 3300047469 | Bacteria | 3918 |
| 628 | Ga0495673_0017336 | 3300047469 | Bacteria | 3661 |
| 629 | Ga0495673_0021427 | 3300047469 | Bacteria | 3190 |
| 630 | Ga0495673_0023430 | 3300047469 | Bacteria | 3002 |
| 631 | Ga0495673_0024205 | 3300047469 | Bacteria | 2939 |
| 632 | Ga0495673_0029484 | 3300047469 | Bacteria | 2589 |
| 633 | Ga0495681_0003446 | 3300047470 | Bacteria | 11005 |
| 634 | Ga0495681_0005569 | 3300047470 | Bacteria | 8406 |
| 635 | Ga0495681_0013167 | 3300047470 | Bacteria | 4817 |
| 636 | Ga0495681_0013239 | 3300047470 | Bacteria | 4799 |
| 637 | Ga0495681_0014821 | 3300047470 | Bacteria | 4448 |
| 638 | Ga0495681_0018271 | 3300047470 | Bacteria | 3866 |
| 639 | Ga0495681_0020983 | 3300047470 | Bacteria | 3529 |
| 640 | Ga0495681_0023901 | 3300047470 | Bacteria | 3233 |
| 641 | Ga0495681_0025061 | 3300047470 | Bacteria | 3126 |
| 642 | Ga0495681_0026051 | 3300047470 | Bacteria | 3053 |
| 643 | Ga0495681_0030272 | 3300047470 | Bacteria | 2758 |
| 644 | Ga0495681_0035455 | 3300047470 | Bacteria | 2477 |
| 645 | Ga0495681_0037113 | 3300047470 | Bacteria | 2404 |
| 646 | Ga0495684_0054293 | 3300047471 | Bacteria | 3056 |
| 647 | Ga0495684_0055286 | 3300047471 | Bacteria | 3027 |
| 648 | Ga0495686_0024039 | 3300047472 | Bacteria | 4008 |
| 649 | Ga0495686_0029994 | 3300047472 | Bacteria | 3534 |
| 650 | Ga0495686_0039727 | 3300047472 | Bacteria | 3003 |
| 651 | Ga0495686_0047434 | 3300047472 | Bacteria | 2712 |
| 652 | Ga0495686_0050001 | 3300047472 | Bacteria | 2628 |
| 653 | Ga0495593_0010845 | 3300047673 | Bacteria | 5254 |
| 654 | Ga0495602_0049015 | 3300048088 | Bacteria | 3787 |
| 655 | Ga0495626_0000256 | 3300048091 | Bacteria | 60994 |
| 656 | Ga0495626_0006620 | 3300048091 | Bacteria | 6567 |
| 657 | Ga0495626_0022412 | 3300048091 | Bacteria | 3119 |
| 658 | Ga0495626_0022847 | 3300048091 | Bacteria | 3086 |
| 659 | Ga0495626_0023047 | 3300048091 | Bacteria | 3069 |
| 660 | Ga0495626_0023143 | 3300048091 | Bacteria | 3062 |
| 661 | Ga0495626_0029320 | 3300048091 | Bacteria | 2663 |
| 662 | Ga0495626_0030483 | 3300048091 | Bacteria | 2601 |
| 663 | Ga0495626_0031168 | 3300048091 | Bacteria | 2567 |
| 664 | Ga0496102_0001116 | 3300048905 | Bacteria | 24623 |
| 665 | Ga0496109_0088342 | 3300048912 | Bacteria | 2864 |
| 666 | Ga0496110_0009288 | 3300048913 | Bacteria | 7954 |
| 667 | Ga0496112_0064287 | 3300048915 | Bacteria | 3621 |
| 668 | Ga0496114_0058865 | 3300048917 | Bacteria | 3208 |
| 669 | Ga0496116_0001203 | 3300048919 | Bacteria | 30310 |
| 670 | Ga0496116_0001581 | 3300048919 | Bacteria | 25058 |
| 671 | Ga0496116_0021622 | 3300048919 | Bacteria | 4843 |
| 672 | Ga0496116_0043131 | 3300048919 | Bacteria | 3076 |
| 673 | Ga0496116_0043471 | 3300048919 | Bacteria | 3060 |
| 674 | Ga0496117_0004257 | 3300048920 | Bacteria | 15972 |
| 675 | Ga0496117_0007639 | 3300048920 | Bacteria | 10488 |
| 676 | Ga0496117_0010279 | 3300048920 | Bacteria | 8559 |
| 677 | Ga0496117_0023547 | 3300048920 | Bacteria | 4901 |
| 678 | Ga0496117_0030347 | 3300048920 | Bacteria | 4150 |
| 679 | Ga0496117_0030654 | 3300048920 | Bacteria | 4121 |
| 680 | Ga0496117_0040041 | 3300048920 | Bacteria | 3452 |
| 681 | Ga0496117_0047654 | 3300048920 | Bacteria | 3070 |
| 682 | Ga0496117_0056878 | 3300048920 | Bacteria | 2720 |
| 683 | Ga0496118_0003568 | 3300048921 | Bacteria | 19402 |
| 684 | Ga0496118_0021945 | 3300048921 | Bacteria | 5599 |
| 685 | Ga0496118_0022407 | 3300048921 | Bacteria | 5521 |
| 686 | Ga0496118_0047692 | 3300048921 | Bacteria | 3317 |
| 687 | Ga0496118_0053893 | 3300048921 | Bacteria | 3051 |
| 688 | Ga0496118_0064422 | 3300048921 | Bacteria | 2689 |
| 689 | Ga0496119_0000112 | 3300048922 | Bacteria | 114767 |
| 690 | Ga0496119_0016434 | 3300048922 | Bacteria | 5633 |
| 691 | Ga0496119_0038704 | 3300048922 | Bacteria | 3077 |
| 692 | Ga0496120_0002916 | 3300048923 | Bacteria | 16341 |
| 693 | Ga0496120_0027834 | 3300048923 | Bacteria | 3471 |
| 694 | Ga0496120_0032211 | 3300048923 | Bacteria | 3162 |
| 695 | Ga0496121_0002692 | 3300048924 | Bacteria | 26575 |
| 696 | Ga0496121_0006107 | 3300048924 | Bacteria | 15150 |
| 697 | Ga0496121_0016312 | 3300048924 | Bacteria | 7678 |
| 698 | Ga0496121_0047549 | 3300048924 | Bacteria | 3660 |
| 699 | Ga0496121_0062498 | 3300048924 | Bacteria | 3049 |
| 700 | Ga0496121_0093954 | 3300048924 | Bacteria | 2334 |
| 701 | Ga0496122_0004361 | 3300048925 | Bacteria | 17667 |
| 702 | Ga0496122_0006408 | 3300048925 | Bacteria | 13522 |
| 703 | Ga0496122_0018557 | 3300048925 | Bacteria | 6415 |
| 704 | Ga0496122_0032232 | 3300048925 | Bacteria | 4338 |
| 705 | Ga0496122_0052318 | 3300048925 | Bacteria | 3093 |
| 706 | Ga0496122_0052827 | 3300048925 | Bacteria | 3070 |
| 707 | Ga0496122_0067740 | 3300048925 | Bacteria | 2568 |
| 708 | Ga0496123_0001624 | 3300048926 | Bacteria | 30272 |
| 709 | Ga0496123_0001754 | 3300048926 | Bacteria | 28633 |
| 710 | Ga0496123_0017632 | 3300048926 | Bacteria | 5731 |
| 711 | Ga0496123_0018313 | 3300048926 | Bacteria | 5577 |
| 712 | Ga0496124_0000222 | 3300048927 | Bacteria | 110854 |
| 713 | Ga0496124_0005215 | 3300048927 | Bacteria | 14752 |
| 714 | Ga0496124_0009753 | 3300048927 | Bacteria | 9828 |
| 715 | Ga0496124_0012097 | 3300048927 | Bacteria | 8560 |
| 716 | Ga0496124_0014447 | 3300048927 | Bacteria | 7634 |
| 717 | Ga0496124_0022917 | 3300048927 | Bacteria | 5714 |
| 718 | Ga0496124_0030541 | 3300048927 | Bacteria | 4781 |
| 719 | Ga0496124_0079571 | 3300048927 | Bacteria | 2698 |
| 720 | Ga0496125_0005002 | 3300048928 | Bacteria | 14970 |
| 721 | Ga0496125_0008731 | 3300048928 | Bacteria | 10544 |
| 722 | Ga0496125_0022704 | 3300048928 | Bacteria | 5818 |
| 723 | Ga0496125_0061609 | 3300048928 | Bacteria | 3008 |
| 724 | Ga0496125_0067505 | 3300048928 | Bacteria | 2817 |
| 725 | Ga0496125_0077983 | 3300048928 | Bacteria | 2550 |
| 726 | Ga0496125_0097696 | 3300048928 | Bacteria | 2175 |
| 727 | Ga0496126_0038532 | 3300048929 | Bacteria | 4446 |
| 728 | Ga0496126_0087683 | 3300048929 | Bacteria | 2742 |
| 729 | Ga0495678_000031 | 3300049459 | Bacteria | 215528 |
| 730 | Ga0495678_000508 | 3300049459 | Bacteria | 37991 |
| 731 | Ga0495678_004164 | 3300049459 | Bacteria | 8537 |
| 732 | Ga0495678_012976 | 3300049459 | Bacteria | 3928 |
| 733 | Ga0495678_014044 | 3300049459 | Bacteria | 3736 |
| 734 | Ga0495678_015906 | 3300049459 | Bacteria | 3452 |
| 735 | Ga0495678_016154 | 3300049459 | Bacteria | 3421 |
| 736 | Ga0495678_019192 | 3300049459 | Bacteria | 3055 |
| 737 | Ga0495678_030980 | 3300049459 | Bacteria | 2234 |
| 738 | Ga0495682_0000300 | 3300049460 | Bacteria | 37560 |
| 739 | Ga0495682_0002873 | 3300049460 | Bacteria | 7922 |
| 740 | Ga0495682_0011018 | 3300049460 | Bacteria | 3484 |
| 741 | Ga0495682_0015154 | 3300049460 | Bacteria | 2920 |
| 742 | Ga0501031_0012138 | 3300049568 | Bacteria | 5617 |
| 743 | Ga0501032_0011897 | 3300049569 | Bacteria | 6233 |
| 744 | Ga0501034_0000020 | 3300049571 | Bacteria | 280294 |
| 745 | Ga0501034_0043201 | 3300049571 | Bacteria | 4563 |
| 746 | Ga0501034_0057341 | 3300049571 | Bacteria | 3916 |
| 747 | Ga0501036_0041298 | 3300049572 | Bacteria | 3903 |
| 748 | Ga0501039_0005790 | 3300049575 | Bacteria | 9360 |
| 749 | Ga0501067_0012697 | 3300049583 | Bacteria | 4670 |
| 750 | Ga0501068_0019968 | 3300049584 | Bacteria | 3899 |
| 751 | Ga0501070_0020222 | 3300049586 | Bacteria | 5583 |
| 752 | Ga0501072_0005999 | 3300049588 | Bacteria | 9262 |
| 753 | Ga0501072_0070726 | 3300049588 | Bacteria | 2756 |
| 754 | Ga0501073_0004730 | 3300049589 | Bacteria | 10222 |
| 755 | Ga0501073_0021468 | 3300049589 | Bacteria | 4655 |
| 756 | Ga0501074_0013174 | 3300049590 | Bacteria | 6012 |
| 757 | Ga0501074_0023761 | 3300049590 | Bacteria | 4456 |
| 758 | Ga0501075_0017465 | 3300049591 | Bacteria | 5184 |
| 759 | Ga0501077_0015602 | 3300049593 | Bacteria | 4784 |
| 760 | Ga0501077_0022996 | 3300049593 | Bacteria | 3952 |
| 761 | Ga0501083_0014595 | 3300049744 | Bacteria | 5492 |
| 762 | Ga0501226_000006 | 3300049853 | Bacteria | 259153 |
| 763 | Ga0500572_004618 | 3300053111 | Bacteria | 3123 |
| 764 | Ga0500659_0036793 | 3300053135 | Bacteria | 2665 |
| 765 | Ga0500577_0001698 | 3300053142 | Bacteria | 5630 |
| 766 | Ga0500634_0005037 | 3300053161 | Bacteria | 6219 |
| 767 | Ga0501084_0057279 | 3300054114 | Bacteria | 3261 |
| 768 | Ga0501082_0017045 | 3300060353 | Bacteria | 6257 |
| 769 | Ga0501082_0094459 | 3300060353 | Bacteria | 2584 |
| 770 | 640488702 | 640427133 | Bacteria | 4567418 |
| 771 | 2511254363 | 2511231004 | Bacteria | 6669789 |
| 772 | 2511263867 | 2511231006 | Bacteria | 6794709 |
| 773 | 2511272241 | 2511231007 | Bacteria | 6306603 |
| 774 | 2511275991 | 2511231008 | Bacteria | 6624100 |
| 775 | 2511289223 | 2511231010 | Bacteria | 6373152 |
| 776 | 2511295404 | 2511231011 | Bacteria | 6149768 |
| 777 | 2511299864 | 2511231012 | Bacteria | 6738011 |
| 778 | 2511313497 | 2511231014 | Bacteria | 6462302 |
| 779 | 2511319949 | 2511231015 | Bacteria | 6598026 |
| 780 | 2511326121 | 2511231016 | Bacteria | 6704427 |
| 781 | 2511332352 | 2511231017 | Bacteria | 6503007 |
| 782 | 2511339943 | 2511231018 | Bacteria | 6436256 |
| 783 | 2511342046 | 2511231019 | Bacteria | 6520662 |
| 784 | 2511352788 | 2511231020 | Bacteria | 6115223 |
| 785 | 2511355028 | 2511231021 | Bacteria | 7302637 |
| 786 | 2511361788 | 2511231022 | Bacteria | 6719296 |
| 787 | 2511367803 | 2511231023 | Bacteria | 6808468 |
| 788 | 2511414767 | 2511231031 | Bacteria | 6558529 |
| 789 | 2511826564 | 2511231156 | Bacteria | 6845832 |
| 790 | 2512324197 | 2512047018 | Bacteria | 6663241 |
| 791 | 2554813784 | 2554235132 | Bacteria | 6772433 |
| 792 | 2555671786 | 2554235341 | Bacteria | 6867980 |
| 793 | 2583794288 | 2582580891 | Bacteria | 6800976 |
| 794 | 2597859876 | 2597489887 | Bacteria | 6666321 |
| 795 | 2597862403 | 2597489888 | Bacteria | 6179543 |
| 796 | 2597868120 | 2597489889 | Bacteria | 6297495 |
| 797 | 2599330147 | 2599185155 | Bacteria | 5827168 |
| 798 | 2599354058 | 2599185160 | Bacteria | 6844013 |
| 799 | 2599360263 | 2599185161 | Bacteria | 6960462 |
| 800 | 2599366585 | 2599185162 | Bacteria | 6957254 |
| 801 | 2599373374 | 2599185163 | Bacteria | 6995158 |
| 802 | 2599379166 | 2599185164 | Bacteria | 6841688 |
| 803 | 2599385856 | 2599185165 | Bacteria | 6843250 |
| 804 | 2599392233 | 2599185166 | Bacteria | 6959206 |
| 805 | 2599396985 | 2599185167 | Bacteria | 6353609 |
| 806 | 2599403999 | 2599185168 | Bacteria | 6997636 |
| 807 | 2599448977 | 2599185179 | Bacteria | 6611171 |
| 808 | 2599460892 | 2599185181 | Bacteria | 6844519 |
| 809 | 2599470439 | 2599185182 | Bacteria | 6883168 |
| 810 | 2599482706 | 2599185185 | Bacteria | 6652270 |
| 811 | 2599489913 | 2599185186 | Bacteria | 6831633 |
| 812 | 2599503521 | 2599185188 | Bacteria | 6164180 |
| 813 | 2599508892 | 2599185189 | Bacteria | 5862825 |
| 814 | 2599511278 | 2599185190 | Bacteria | 6285678 |
| 815 | 2599517795 | 2599185191 | Bacteria | 6297582 |
| 816 | 2599613334 | 2599185212 | Bacteria | 6765997 |
| 817 | 2599771006 | 2599185248 | Bacteria | 6696816 |
| 818 | 2599803571 | 2599185257 | Bacteria | 6492581 |
| 819 | 2599879719 | 2599185288 | Bacteria | 6666191 |
| 820 | 2599886154 | 2599185289 | Bacteria | 6778765 |
| 821 | 2599890652 | 2599185290 | Bacteria | 6289611 |
| 822 | 2599897869 | 2599185291 | Bacteria | 6775623 |
| 823 | 2599929856 | 2599185300 | Bacteria | 6062622 |
| 824 | 2599944734 | 2599185302 | Bacteria | 5954930 |
| 825 | 2599948231 | 2599185303 | Bacteria | 6512725 |
| 826 | 2599956470 | 2599185304 | Bacteria | 5951361 |
| 827 | 2599960183 | 2599185305 | Bacteria | 6748700 |
| 828 | 2599969270 | 2599185306 | Bacteria | 6637356 |
| 829 | 2599975006 | 2599185307 | Bacteria | 6194719 |
| 830 | 2599980583 | 2599185308 | Bacteria | 6621546 |
| 831 | 2599983605 | 2599185309 | Bacteria | 5969593 |
| 832 | 2599990012 | 2599185310 | Bacteria | 6014457 |
| 833 | 2599995850 | 2599185311 | Bacteria | 6354990 |
| 834 | 2600000490 | 2599185312 | Bacteria | 5912071 |
| 835 | 2600005167 | 2599185313 | Bacteria | 6658188 |
| 836 | 2600014464 | 2599185314 | Bacteria | 6621749 |
| 837 | 2600017683 | 2599185315 | Bacteria | 6771107 |
| 838 | 2600025688 | 2599185316 | Bacteria | 6320029 |
| 839 | 2600028674 | 2599185317 | Bacteria | 6435722 |
| 840 | 2600033663 | 2599185318 | Bacteria | 6961590 |
| 841 | 2600040045 | 2599185319 | Bacteria | 6637840 |
| 842 | 2600047678 | 2599185320 | Bacteria | 5963263 |
| 843 | 2600053586 | 2599185321 | Bacteria | 6764560 |
| 844 | 2600059017 | 2599185322 | Bacteria | 6763055 |
| 845 | 2600068566 | 2599185323 | Bacteria | 6688755 |
| 846 | 2600070245 | 2599185324 | Bacteria | 6590677 |
| 847 | 2600077090 | 2599185325 | Bacteria | 6324919 |
| 848 | 2600213507 | 2599185356 | Bacteria | 6843884 |
| 849 | 2600357842 | 2600254930 | Bacteria | 6431253 |
| 850 | 2600365162 | 2600254931 | Bacteria | 6734225 |
| 851 | 2600446999 | 2600254954 | Bacteria | 5100516 |
| 852 | 2601625684 | 2600255283 | Bacteria | 6061572 |
| 853 | 2601690983 | 2600255296 | Bacteria | 5784754 |
| 854 | 2601773674 | 2600255313 | Bacteria | 6842543 |
| 855 | 2601796801 | 2600255318 | Bacteria | 6383414 |
| 856 | 2602010113 | 2600255389 | Bacteria | 5275336 |
| 857 | 2606073951 | 2603880185 | Bacteria | 6379190 |
| 858 | 2606126404 | 2603880199 | Bacteria | 6377649 |
| 859 | 2608381061 | 2606217733 | Bacteria | 6360972 |
| 860 | 2621301469 | 2619619299 | Bacteria | 6649820 |
| 861 | 2624482499 | 2623620443 | Bacteria | 6427864 |
| 862 | 2624490470 | 2623620446 | Bacteria | 6500345 |
| 863 | 2643842442 | 2643221565 | Bacteria | 6216018 |
| 864 | 2643868829 | 2643221571 | Bacteria | 6228673 |
| 865 | 2643955304 | 2643221589 | Bacteria | 6250934 |
| 866 | 2644023656 | 2643221602 | Bacteria | 6249926 |
| 867 | 2644187101 | 2643221633 | Bacteria | 6733554 |
| 868 | 2644286961 | 2643221650 | Bacteria | 7029547 |
| 869 | 2644624086 | 2643221713 | Bacteria | 6554480 |
| 870 | 2652546128 | 2651869719 | Bacteria | 6047974 |
| 871 | 2671089962 | 2667528170 | Bacteria | 6786960 |
| 872 | 2671096640 | 2667528171 | Bacteria | 6900659 |
| 873 | 2671125400 | 2667528176 | Bacteria | 6724917 |
| 874 | 2671770861 | 2671180172 | Bacteria | 6495783 |
| 875 | 2677897571 | 2675903420 | Bacteria | 6247433 |
| 876 | 2678264906 | 2675903515 | Bacteria | 6580491 |
| 877 | 2715750493 | 2713897148 | Bacteria | 5883533 |
| 878 | 2715755107 | 2713897149 | Bacteria | 6506249 |
| 879 | 2718635702 | 2718217725 | Bacteria | 5758958 |
| 880 | 2723247293 | 2721755607 | Bacteria | 5841722 |
| 881 | 2729147679 | 2728369097 | Bacteria | 4333476 |
| 882 | 2738673690 | 2738541265 | Bacteria | 6594665 |
| 883 | 2738691503 | 2738541271 | Bacteria | 5657310 |
| 884 | 2738752083 | 2738541282 | Bacteria | 6593925 |
| 885 | 2738809176 | 2738541294 | Bacteria | 6925949 |
| 886 | 2738861124 | 2738541303 | Bacteria | 6591772 |
| 887 | 2738896536 | 2738541309 | Bacteria | 6926455 |
| 888 | 2739196602 | 2738543004 | Bacteria | 6381073 |
| 889 | 2739257581 | 2738543015 | Bacteria | 6750701 |
| 890 | 2739267278 | 2738543016 | Bacteria | 5657564 |
| 891 | 2739288289 | 2738543020 | Bacteria | 5718238 |
| 892 | 2739293382 | 2738543021 | Bacteria | 5718241 |
| 893 | 2739315616 | 2738543025 | Bacteria | 6600348 |
| 894 | 2743739417 | 2740892503 | Bacteria | 6855563 |
| 895 | 2745005362 | 2744054620 | Bacteria | 6551379 |
| 896 | 2765585654 | 2765235841 | Bacteria | 6137024 |
| 897 | 2774122982 | 2773857670 | Bacteria | 6407454 |
| 898 | 2774133384 | 2773857673 | Bacteria | 6513460 |
| 899 | 2784262742 | 2784132063 | Bacteria | 6262788 |
| 900 | 2784315340 | 2784132072 | Bacteria | 6596533 |
| 901 | 2794595780 | 2791355520 | Bacteria | 5948615 |
| 902 | 2807406964 | 2806310737 | Bacteria | 5751088 |
| 903 | 2807455296 | 2806310745 | Bacteria | 5742165 |
| 904 | 2808854656 | 2808606361 | Bacteria | 6136259 |
| 905 | 2808907320 | 2808606373 | Bacteria | 4423627 |
| 906 | 2808921701 | 2808606376 | Bacteria | 6248667 |
| 907 | 2808930470 | 2808606377 | Bacteria | 6646337 |
| 908 | 2808934764 | 2808606378 | Bacteria | 6177535 |
| 909 | 2808943658 | 2808606379 | Bacteria | 5022697 |
| 910 | 2808943822 | 2808606380 | Bacteria | 6248705 |
| 911 | 2808952592 | 2808606381 | Bacteria | 6646461 |
| 912 | 2808960507 | 2808606382 | Bacteria | 6841132 |
| 913 | 2808963161 | 2808606383 | Bacteria | 6138645 |
| 914 | 2808975329 | 2808606385 | Bacteria | 6711065 |
| 915 | 2808991032 | 2808606388 | Bacteria | 6706662 |
| 916 | 2808998049 | 2808606389 | Bacteria | 6138126 |
| 917 | 2809218372 | 2808606445 | Bacteria | 6057339 |
| 918 | 2812371000 | 2811994881 | Bacteria | 6298475 |
| 919 | 2817489176 | 2816332298 | Bacteria | 6852809 |
| 920 | 2819656178 | 2818991456 | Bacteria | 6123676 |
| 921 | 2819701733 | 2818991464 | Bacteria | 6907494 |
| 922 | 2823422610 | 2823421272 | Bacteria | 5372474 |
| 923 | 2825656196 | 2825651385 | Bacteria | 6715909 |
| 924 | 2826585796 | 2826581358 | Bacteria | 5963467 |
| 925 | 2834029083 | 2834028612 | Bacteria | 6354979 |
| 926 | 2842806077 | 2842805378 | Bacteria | 5385175 |
| 927 | 2842820694 | 2842815866 | Bacteria | 5947510 |
| 928 | 2842828790 | 2842826826 | Bacteria | 5974129 |
| 929 | 2842837354 | 2842832357 | Bacteria | 5959113 |
| 930 | 2842842524 | 2842837860 | Bacteria | 6066181 |
| 931 | 2842845146 | 2842843487 | Bacteria | 6004777 |
| 932 | 2842853274 | 2842849001 | Bacteria | 5924277 |
| 933 | 2842856599 | 2842854478 | Bacteria | 6143501 |
| 934 | 2844665945 | 2844665904 | Bacteria | 6817974 |
| 935 | 2852615427 | 2852612431 | Bacteria | 6885235 |
| 936 | 2852660761 | 2852657418 | Bacteria | 6472974 |
| 937 | 2852670395 | 2852667396 | Bacteria | 6885555 |
| 938 | 2860341350 | 2860339153 | Bacteria | 6846989 |
| 939 | 2860869107 | 2860867994 | Bacteria | 5645326 |
| 940 | 2878034427 | 2878029506 | Bacteria | 6418441 |
| 941 | 2880235060 | 2880230671 | Bacteria | 6140320 |
| 942 | 2904521447 | 2904518522 | Bacteria | 6068986 |
| 943 | 2904553099 | 2904550169 | Bacteria | 6221258 |
| 944 | 2908447909 | 2908446538 | Bacteria | 6829095 |
| 945 | 2912967902 | 2912963787 | Bacteria | 5646108 |
| 946 | 2913041507 | 2913036834 | Bacteria | 6704877 |
| 947 | 2917075657 | 2917070673 | Bacteria | 6868303 |
| 948 | 2919066513 | 2919063839 | Bacteria | 6302690 |
| 949 | 2919159316 | 2919155634 | Bacteria | 4860545 |
| 950 | 2919388499 | 2919385768 | Bacteria | 5897293 |
| 951 | 2919459450 | 2919456309 | Bacteria | 6586567 |
| 952 | 2919484440 | 2919481497 | Bacteria | 6907839 |
| 953 | 2919490182 | 2919487758 | Bacteria | 5929766 |
| 954 | 2919504954 | 2919501602 | Bacteria | 5286340 |
| 955 | 2919701665 | 2919697872 | Bacteria | 6553725 |
| 956 | 2923158502 | 2923153595 | Bacteria | 6870622 |
| 957 | 2923525107 | 2923519811 | Bacteria | 6298479 |
| 958 | 2923591323 | 2923586266 | Bacteria | 6565975 |
| 959 | 2926066631 | 2926063275 | Bacteria | 5285848 |
| 960 | 2929148846 | 2929144301 | Bacteria | 6622272 |
| 961 | 2929191102 | 2929189879 | Bacteria | 5930554 |
| 962 | 2931373731 | 2931369376 | Bacteria | 6847892 |
| 963 | 2931392113 | 2931390751 | Bacteria | 6273349 |
| 964 | 2931397088 | 2931396565 | Bacteria | 7251677 |
| 965 | 2935356646 | 2935353572 | Unclassified | 6955622 |
| 966 | 2939637068 | 2939636861 | Bacteria | 6297853 |
| 967 | 2939655998 | 2939651529 | Bacteria | 5895393 |
| 968 | 2945929474 | 2945928738 | Bacteria | 6053221 |
| 969 | 2945965754 | 2945961074 | Bacteria | 7342064 |
| 970 | 2946029344 | 2946027586 | Bacteria | 6049274 |
| 971 | 2969309203 | 2969304461 | Bacteria | 6601805 |
| 972 | 2974289427 | 2974289157 | Bacteria | 6080362 |
| 973 | 2984287667 | 2984286254 | Bacteria | 6702062 |
| 974 | 2988730423 | 2988728565 | Bacteria | 6124362 |
| 975 | 2990200339 | 2990196909 | Bacteria | 4054280 |
| 976 | 2998144490 | 2998139840 | Bacteria | 6073514 |
| 977 | 3007253671 | 3007252601 | Bacteria | 4559114 |
| 978 | 3007317555 | 3007315729 | Bacteria | 5076637 |
| 979 | 3007424861 | 3007419365 | Bacteria | 7026924 |
| 980 | 3007516280 | 3007511990 | Bacteria | 6481491 |
| 981 | 3007618126 | 3007614139 | Bacteria | 6053559 |
| 982 | 3007623203 | 3007619802 | Bacteria | 6411688 |
| 983 | 3007720207 | 3007718800 | Bacteria | 5971527 |
| 984 | 3007858530 | 3007855910 | Bacteria | 5637581 |
| 985 | 3007865942 | 3007861166 | Bacteria | 6045338 |
| 986 | 3007867809 | 3007866637 | Bacteria | 5899198 |
| 987 | 3007874904 | 3007872151 | Bacteria | 5268868 |
| 988 | 637322197 | 637000220 | Bacteria | 7074893 |
| 989 | 651176751 | 651053060 | Bacteria | 4689946 |
| 990 | 8011356578 | 8011350971 | Bacteria | 6158957 |
| 991 | 8015692592 | 8015687852 | Bacteria | 6613826 |
| 992 | 8019771569 | 8019769354 | Bacteria | 6924660 |
| 993 | 8019780797 | 8019775933 | Bacteria | 6858656 |
| 994 | 8029996393 | 8029995093 | Bacteria | 5990776 |
| 995 | 8034966225 | 8034962539 | Bacteria | 4884839 |
| 996 | 8052498851 | 8052494512 | Bacteria | 5765634 |
| 997 | 8054286217 | 8054285046 | Bacteria | 6919322 |
| 998 | 8054348465 | 8054347763 | Bacteria | 5901107 |
| 999 | 8054504692 | 8054503363 | Bacteria | 6101651 |
| 1000 | 8054933279 | 8054929484 | Bacteria | 5599761 |
| 1001 | 8055775824 | 8055770955 | Bacteria | 6827675 |
| 1002 | 8055819134 | 8055817908 | Bacteria | 6609162 |
| 1003 | 8055884110 | 8055878733 | Bacteria | 5907058 |
| 1004 | 8056117477 | 8056115690 | Bacteria | 5527654 |
| 1005 | 8056124824 | 8056120720 | Bacteria | 5758328 |
| 1006 | 8056130776 | 8056125926 | Bacteria | 6228218 |
| 1007 | 8056133004 | 8056131705 | Bacteria | 6107031 |
| 1008 | 8056138619 | 8056137416 | Bacteria | 6147080 |
| 1009 | 8056144553 | 8056143049 | Bacteria | 6307666 |
| 1010 | 8056149218 | 8056148874 | Bacteria | 6479865 |
| 1011 | 8056155466 | 8056155041 | Bacteria | 6486948 |
| 1012 | 8056166793 | 8056161164 | Bacteria | 6106669 |
| 1013 | 8056172086 | 8056166840 | Bacteria | 5820959 |
| 1014 | 8056172759 | 8056172158 | Bacteria | 6133900 |
| 1015 | 8056183390 | 8056177738 | Bacteria | 6748268 |
| 1016 | 8056572567 | 8056569372 | Bacteria | 5997322 |
| 1017 | 8057804675 | 8057798959 | Bacteria | 6713499 |
| 1018 | JGI24737J22298_10001313 | |||
| 1019 | JGI25162J39368_1000034 | |||
| 1020 | JGI25163J39215_1001370 | |||
| 1021 | JGI25163J39215_1001449 | |||
| 1022 | JGI25164J39214_1000018 | |||
| 1023 | JGI25164J39214_1000304 | |||
| 1024 | JGI25165J46597_1000123 | |||
| 1025 | JGI25165J46597_1000575 | |||
| 1026 | Ga0055538_1000073 | |||
| 1027 | Ga0055539_1000109 | |||
| 1028 | Ga0055533_1000117 | |||
| 1029 | Ga0055532_1000283 | |||
| 1030 | Ga0055525_1000156 | |||
| 1031 | Ga0055536_1003129 | |||
| 1032 | Ga0055536_1012012 | |||
| 1033 | Ga0055536_1012314 | |||
| 1034 | Ga0055530_10003450 | |||
| 1035 | Ga0055530_10009909 | |||
| 1036 | Ga0055540_1000849 | |||
| 1037 | Ga0055540_1002831 | |||
| 1038 | Ga0055540_1008308 | |||
| 1039 | Ga0055531_10000573 | |||
| 1040 | Ga0055541_1000074 | |||
| 1041 | Ga0065714_10065199 | |||
| 1042 | Ga0065714_10067505 | |||
| 1043 | Ga0065714_10072768 | |||
| 1044 | Ga0065714_10077307 | |||
| 1045 | Ga0065714_10077484 | |||
| 1046 | Ga0065714_10081270 | |||
| 1047 | Ga0065704_10070645 | |||
| 1048 | Ga0065704_10093716 | |||
| 1049 | Ga0065704_10093739 | |||
| 1050 | Ga0065712_10005361 | |||
| 1051 | Ga0065712_10067808 | |||
| 1052 | Ga0065715_10002829 | |||
| 1053 | Ga0065707_10100167 | |||
| 1054 | Ga0070658_10031202 | |||
| 1055 | Ga0070683_100003158 | |||
| 1056 | Ga0070670_100005001 | |||
| 1057 | Ga0070670_100094465 | |||
| 1058 | Ga0070660_100009380 | |||
| 1059 | Ga0070689_100002206 | |||
| 1060 | Ga0070669_100005309 | |||
| 1061 | Ga0070659_100018251 | |||
| 1062 | Ga0070662_100002261 | |||
| 1063 | Ga0068853_100042334 | |||
| 1064 | Ga0070693_100008503 | |||
| 1065 | Ga0070665_100000865 | |||
| 1066 | Ga0070665_100041084 | |||
| 1067 | Ga0070664_100002637 | |||
| 1068 | Ga0068854_100028702 | |||
| 1069 | Ga0068856_100063831 | |||
| 1070 | Ga0068851_10000006 | |||
| 1071 | Ga0068860_100100040 | |||
| 1072 | Ga0075432_10007294 | |||
| 1073 | Ga0075432_10014552 | |||
| 1074 | Ga0075362_10022416 | |||
| 1075 | Ga0075436_100058307 | |||
| 1076 | Ga0099823_1000052 | |||
| 1077 | Ga0079104_1000202 | |||
| 1078 | Ga0079104_1003010 | |||
| 1079 | Ga0099826_10002165 | |||
| 1080 | Ga0105251_10000035 | |||
| 1081 | Ga0105251_10001730 | |||
| 1082 | Ga0105251_10024190 | |||
| 1083 | Ga0105251_10029612 | |||
| 1084 | Ga0105251_10029711 | |||
| 1085 | Ga0105251_10030994 | |||
| 1086 | Ga0105251_10033226 | |||
| 1087 | Ga0105251_10041566 | |||
| 1088 | Ga0105244_10001239 | |||
| 1089 | Ga0105244_10017260 | |||
| 1090 | Ga0105244_10023428 | |||
| 1091 | Ga0105244_10026959 | |||
| 1092 | Ga0105244_10032621 | |||
| 1093 | Ga0105244_10034773 | |||
| 1094 | Ga0105244_10035232 | |||
| 1095 | Ga0105250_10000056 | |||
| 1096 | Ga0105250_10014720 | |||
| 1097 | Ga0105250_10015060 | |||
| 1098 | Ga0105250_10015386 | |||
| 1099 | Ga0105250_10015561 | |||
| 1100 | Ga0105250_10015844 | |||
| 1101 | Ga0105250_10028354 | |||
| 1102 | Ga0105247_10061324 | |||
| 1103 | Ga0105243_10000133 | |||
| 1104 | Ga0105243_10013241 | |||
| 1105 | Ga0105243_10055268 | |||
| 1106 | Ga0105243_10065587 | |||
| 1107 | Ga0105243_10085452 | |||
| 1108 | Ga0105242_10002285 | |||
| 1109 | Ga0105248_10035793 | |||
| 1110 | Ga0105237_10005854 | |||
| 1111 | Ga0105239_10008909 | |||
| 1112 | Ga0105246_10001386 | |||
| 1113 | Ga0105246_10006579 | |||
| 1114 | Ga0105246_10056823 | |||
| 1115 | Ga0157345_1000466 | |||
| 1116 | Ga0157373_10058499 | |||
| 1117 | Ga0157373_10059460 | |||
| 1118 | Ga0157373_10060687 | |||
| 1119 | Ga0157373_10064824 | |||
| 1120 | Ga0157373_10065719 | |||
| 1121 | Ga0157371_10005665 | |||
| 1122 | Ga0157371_10035009 | |||
| 1123 | Ga0157370_10018287 | |||
| 1124 | Ga0157370_10081418 | |||
| 1125 | Ga0157369_10098005 | |||
| 1126 | Ga0157369_10101594 | |||
| 1127 | Ga0157369_10110445 | |||
| 1128 | Ga0157369_10121333 | |||
| 1129 | Ga0157369_10124194 | |||
| 1130 | Ga0157369_10142667 | |||
| 1131 | Ga0163162_10015613 | |||
| 1132 | Ga0163162_10062608 | |||
| 1133 | Ga0163162_10091796 | |||
| 1134 | Ga0157372_10128859 | |||
| 1135 | Ga0157375_10010253 | |||
| 1136 | Ga0163163_10023175 | |||
| 1137 | Ga0157380_10059801 | |||
| 1138 | Ga0182008_10009257 | |||
| 1139 | Ga0182008_10021127 | |||
| 1140 | Ga0182008_10026059 | |||
| 1141 | Ga0182008_10029299 | |||
| 1142 | Ga0182008_10033809 | |||
| 1143 | Ga0182006_1010175 | |||
| 1144 | Ga0182006_1013977 | |||
| 1145 | Ga0182006_1017585 | |||
| 1146 | Ga0182007_10012959 | |||
| 1147 | Ga0182007_10018219 | |||
| 1148 | Ga0182005_1005690 | |||
| 1149 | Ga0182005_1008456 | |||
| 1150 | Ga0182005_1008628 | |||
| 1151 | Ga0163161_10048991 | |||
| 1152 | Ga0163161_10050044 | |||
| 1153 | Ga0163161_10063375 | |||
| 1154 | Ga0163161_10066150 | |||
| 1155 | Ga0213872_10015263 | |||
| 1156 | Ga0209760_100055 | |||
| 1157 | Ga0209760_100084 | |||
| 1158 | Ga0209784_100015 | |||
| 1159 | Ga0209566_100012 | |||
| 1160 | Ga0209674_100027 | |||
| 1161 | Ga0209147_100019 | |||
| 1162 | Ga0209563_100031 | |||
| 1163 | Ga0207427_100004 | |||
| 1164 | Ga0207427_100007 | |||
| 1165 | Ga0209437_100006 | |||
| 1166 | Ga0209437_100028 | |||
| 1167 | Ga0209437_101295 | |||
| 1168 | Ga0209258_100296 | |||
| 1169 | Ga0209646_1000213 | |||
| 1170 | Ga0209677_100016 | |||
| 1171 | Ga0209759_1002967 | |||
| 1172 | Ga0209233_1000008 | |||
| 1173 | Ga0209233_1000059 | |||
| 1174 | Ga0209676_1000006 | |||
| 1175 | Ga0209676_1000010 | |||
| 1176 | Ga0209676_1000231 | |||
| 1177 | Ga0209676_1000270 | |||
| 1178 | Ga0209676_1015059 | |||
| 1179 | Ga0209050_1000019 | |||
| 1180 | Ga0209050_1000027 | |||
| 1181 | Ga0209050_1000065 | |||
| 1182 | Ga0209050_1008780 | |||
| 1183 | Ga0209051_1000238 | |||
| 1184 | Ga0209051_1000258 | |||
| 1185 | Ga0209051_1000265 | |||
| 1186 | Ga0209257_1000119 | |||
| 1187 | Ga0209257_1009506 | |||
| 1188 | Ga0207656_10000014 | |||
| 1189 | Ga0207696_1000022 | |||
| 1190 | Ga0207696_1000034 | |||
| 1191 | Ga0207696_1000179 | |||
| 1192 | Ga0207696_1000221 | |||
| 1193 | Ga0207696_1014999 | |||
| 1194 | Ga0207655_1000021 | |||
| 1195 | Ga0207655_1000437 | |||
| 1196 | Ga0207655_1001119 | |||
| 1197 | Ga0207655_1002144 | |||
| 1198 | Ga0207655_1002245 | |||
| 1199 | Ga0207655_1003145 | |||
| 1200 | Ga0207655_1004890 | |||
| 1201 | Ga0207655_1009294 | |||
| 1202 | Ga0207655_1011125 | |||
| 1203 | Ga0207655_1018538 | |||
| 1204 | Ga0207655_1019100 | |||
| 1205 | Ga0207655_1019516 | |||
| 1206 | Ga0207655_1026581 | |||
| 1207 | Ga0207713_1000014 | |||
| 1208 | Ga0207713_1000219 | |||
| 1209 | Ga0207713_1000322 | |||
| 1210 | Ga0207713_1000865 | |||
| 1211 | Ga0207713_1002208 | |||
| 1212 | Ga0207713_1002739 | |||
| 1213 | Ga0207713_1003423 | |||
| 1214 | Ga0207713_1018349 | |||
| 1215 | Ga0207713_1018515 | |||
| 1216 | Ga0207713_1024866 | |||
| 1217 | Ga0207713_1024878 | |||
| 1218 | Ga0207710_10005011 | |||
| 1219 | Ga0207671_10000019 | |||
| 1220 | Ga0207657_10017006 | |||
| 1221 | Ga0207649_10000004 | |||
| 1222 | Ga0207681_10003747 | |||
| 1223 | Ga0207650_10000863 | |||
| 1224 | Ga0207650_10001402 | |||
| 1225 | Ga0207706_10002341 | |||
| 1226 | Ga0207706_10020261 | |||
| 1227 | Ga0207709_10000013 | |||
| 1228 | Ga0207709_10001096 | |||
| 1229 | Ga0207709_10018226 | |||
| 1230 | Ga0207670_10002998 | |||
| 1231 | Ga0207704_10002399 | |||
| 1232 | Ga0207661_10008619 | |||
| 1233 | Ga0207679_10000019 | |||
| 1234 | Ga0209281_1000010 | |||
| 1235 | Ga0209281_1000049 | |||
| 1236 | Ga0209389_1000005 | |||
| 1237 | Ga0209371_1000239 | |||
| 1238 | Ga0209371_1000253 | |||
| 1239 | Ga0209995_1002313 | |||
| 1240 | Ga0207428_10053616 | |||
| 1241 | Ga0268266_10001168 | |||
| 1242 | Ga0268266_10043777 | |||
| 1243 | Ga0268266_10044230 | |||
| 1244 | Ga0268265_10020412 | |||
| 1245 | Ga0268264_10052167 | |||
| 1246 | Ga0307517_10089734 | |||
| 1247 | Ga0268256_1000199 | |||
| 1248 | Ga0268256_1000797 | |||
| 1249 | Ga0307511_10059086 | |||
| 1250 | Ga0316177_1066524 | |||
| 1251 | Ga0316179_1027375 | |||
| 1252 | Ga0316178_1076411 | |||
| 1253 | Ga0316181_1090496 | |||
| 1254 | Ga0307509_10120304 | |||
| 1255 | Ga0307408_100000047 | |||
| 1256 | Ga0307408_100008794 | |||
| 1257 | Ga0307408_100046273 | |||
| 1258 | Ga0307408_100050617 | |||
| 1259 | Ga0307408_100104467 | |||
| 1260 | Ga0307405_10002250 | |||
| 1261 | Ga0307405_10003033 | |||
| 1262 | Ga0307413_10015659 | |||
| 1263 | Ga0307406_10025698 | |||
| 1264 | Ga0307407_10022106 | |||
| 1265 | Ga0307412_10006998 | |||
| 1266 | Ga0307412_10010807 | |||
| 1267 | Ga0307412_10021728 | |||
| 1268 | Ga0307409_100043923 | |||
| 1269 | Ga0307414_10024247 | |||
| 1270 | Ga0307414_10047289 | |||
| 1271 | Ga0307411_10009125 | |||
| 1272 | Ga0307510_10062651 | |||
| 1273 | Ga0436364_0471212 | |||
| 1274 | Ga0400485_08592 | |||
| 1275 | Ga0436361_0690852 | |||
| 1276 | Ga0436361_1012736 | |||
| 1277 | Ga0439436_0001961 | |||
| 1278 | Ga0439438_001186 | |||
| 1279 | Ga0439438_001866 | |||
| 1280 | Ga0439438_004459 | |||
| 1281 | Ga0439438_008691 | |||
| 1282 | Ga0439438_009584 | |||
| 1283 | Ga0439438_009756 | |||
| 1284 | Ga0439438_010829 | |||
| 1285 | Ga0439447_006808 | |||
| 1286 | Ga0439466_0001022 | |||
| 1287 | Ga0439466_0002186 | |||
| 1288 | Ga0439466_0004468 | |||
| 1289 | Ga0439466_0016097 | |||
| 1290 | Ga0439432_001773 | |||
| 1291 | Ga0439432_002335 | |||
| 1292 | Ga0439432_002494 | |||
| 1293 | Ga0439432_002665 | |||
| 1294 | Ga0439432_003372 | |||
| 1295 | Ga0439451_001619 | |||
| 1296 | Ga0439451_002915 | |||
| 1297 | Ga0439452_000311 | |||
| 1298 | Ga0439452_001075 | |||
| 1299 | Ga0439452_004203 | |||
| 1300 | Ga0439452_006032 | |||
| 1301 | Ga0439452_007158 | |||
| 1302 | Ga0439456_000798 | |||
| 1303 | Ga0439456_001395 | |||
| 1304 | Ga0439463_000274 | |||
| 1305 | Ga0439463_002176 | |||
| 1306 | Ga0450911_000066 | |||
| 1307 | Ga0450911_001637 | |||
| 1308 | Ga0450911_003031 | |||
| 1309 | Ga0450923_003130 | |||
| 1310 | Ga0450902_000205 | |||
| 1311 | Ga0450903_002144 | |||
| 1312 | Ga0450903_004512 | |||
| 1313 | Ga0450904_000048 | |||
| 1314 | Ga0450904_001720 | |||
| 1315 | Ga0450905_001052 | |||
| 1316 | Ga0450906_002598 | |||
| 1317 | Ga0450907_000017 | |||
| 1318 | Ga0450910_001240 | |||
| 1319 | Ga0439446_0007580 | |||
| 1320 | Ga0439446_0011172 | |||
| 1321 | Ga0439434_0002739 | |||
| 1322 | Ga0439460_0004386 | |||
| 1323 | Ga0466972_0017593 | |||
| 1324 | Ga0453684_0059415 | |||
| 1325 | Ga0495617_004289 | |||
| 1326 | Ga0495617_006066 | |||
| 1327 | Ga0495617_011060 | |||
| 1328 | Ga0495617_013012 | |||
| 1329 | Ga0495617_014114 | |||
| 1330 | Ga0495617_015051 | |||
| 1331 | Ga0495627_000047 | |||
| 1332 | Ga0495627_008983 | |||
| 1333 | Ga0495627_012153 | |||
| 1334 | Ga0495627_020716 | |||
| 1335 | Ga0495627_023940 | |||
| 1336 | Ga0495592_0077085 | |||
| 1337 | Ga0495590_0008218 | |||
| 1338 | Ga0495590_0014644 | |||
| 1339 | Ga0495591_000019 | |||
| 1340 | Ga0495591_000226 | |||
| 1341 | Ga0495591_001090 | |||
| 1342 | Ga0495591_001827 | |||
| 1343 | Ga0495591_003767 | |||
| 1344 | Ga0495591_007755 | |||
| 1345 | Ga0495591_008398 | |||
| 1346 | Ga0495591_009279 | |||
| 1347 | Ga0495591_010510 | |||
| 1348 | Ga0495591_012388 | |||
| 1349 | Ga0495591_013155 | |||
| 1350 | Ga0495591_013246 | |||
| 1351 | Ga0495638_0024191 | |||
| 1352 | Ga0495638_0031234 | |||
| 1353 | Ga0495638_0039113 | |||
| 1354 | Ga0495638_0039262 | |||
| 1355 | Ga0495638_0039614 | |||
| 1356 | Ga0495638_0049146 | |||
| 1357 | Ga0495638_0067905 | |||
| 1358 | Ga0495653_0017574 | |||
| 1359 | Ga0495653_0054783 | |||
| 1360 | Ga0495650_0001450 | |||
| 1361 | Ga0495650_0001813 | |||
| 1362 | Ga0495650_0004844 | |||
| 1363 | Ga0495650_0016000 | |||
| 1364 | Ga0495650_0023168 | |||
| 1365 | Ga0495650_0028406 | |||
| 1366 | Ga0495605_0000016 | |||
| 1367 | Ga0495605_0000777 | |||
| 1368 | Ga0495605_0004046 | |||
| 1369 | Ga0495605_0008479 | |||
| 1370 | Ga0495605_0025995 | |||
| 1371 | Ga0495605_0041482 | |||
| 1372 | Ga0495639_0000070 | |||
| 1373 | Ga0495584_0014286 | |||
| 1374 | Ga0495584_0016726 | |||
| 1375 | Ga0495584_0018656 | |||
| 1376 | Ga0495584_0023881 | |||
| 1377 | Ga0495584_0024138 | |||
| 1378 | Ga0495584_0031098 | |||
| 1379 | Ga0495584_0031646 | |||
| 1380 | Ga0495584_0037181 | |||
| 1381 | Ga0495585_0004440 | |||
| 1382 | Ga0495585_0013778 | |||
| 1383 | Ga0495585_0027478 | |||
| 1384 | Ga0495585_0030514 | |||
| 1385 | Ga0495585_0030685 | |||
| 1386 | Ga0495585_0031930 | |||
| 1387 | Ga0495585_0039729 | |||
| 1388 | Ga0495585_0047438 | |||
| 1389 | Ga0495585_0052582 | |||
| 1390 | Ga0495585_0052698 | |||
| 1391 | Ga0495594_0000837 | |||
| 1392 | Ga0495594_0030349 | |||
| 1393 | Ga0495596_0002692 | |||
| 1394 | Ga0495596_0019628 | |||
| 1395 | Ga0495607_0000204 | |||
| 1396 | Ga0495607_0000573 | |||
| 1397 | Ga0495607_0001298 | |||
| 1398 | Ga0495607_0006581 | |||
| 1399 | Ga0495607_0008637 | |||
| 1400 | Ga0495607_0013688 | |||
| 1401 | Ga0495607_0018774 | |||
| 1402 | Ga0495607_0023427 | |||
| 1403 | Ga0495607_0026251 | |||
| 1404 | Ga0495607_0033681 | |||
| 1405 | Ga0495607_0035991 | |||
| 1406 | Ga0495583_0000819 | |||
| 1407 | Ga0495583_0002361 | |||
| 1408 | Ga0495583_0005593 | |||
| 1409 | Ga0495583_0006065 | |||
| 1410 | Ga0495583_0006950 | |||
| 1411 | Ga0495583_0017172 | |||
| 1412 | Ga0495583_0023932 | |||
| 1413 | Ga0495606_0000567 | |||
| 1414 | Ga0495606_0001124 | |||
| 1415 | Ga0495606_0001172 | |||
| 1416 | Ga0495606_0010245 | |||
| 1417 | Ga0495606_0027985 | |||
| 1418 | Ga0495606_0030072 | |||
| 1419 | Ga0495606_0032211 | |||
| 1420 | Ga0495606_0032296 | |||
| 1421 | Ga0495606_0034421 | |||
| 1422 | Ga0495606_0034592 | |||
| 1423 | Ga0495606_0034618 | |||
| 1424 | Ga0495606_0037921 | |||
| 1425 | Ga0495606_0041559 | |||
| 1426 | Ga0495610_0019353 | |||
| 1427 | Ga0495610_0026723 | |||
| 1428 | Ga0495610_0027144 | |||
| 1429 | Ga0495610_0029881 | |||
| 1430 | Ga0495610_0034836 | |||
| 1431 | Ga0495610_0035785 | |||
| 1432 | Ga0495616_0009067 | |||
| 1433 | Ga0495616_0014588 | |||
| 1434 | Ga0495616_0018151 | |||
| 1435 | Ga0495616_0019211 | |||
| 1436 | Ga0495616_0022493 | |||
| 1437 | Ga0495616_0025885 | |||
| 1438 | Ga0495620_0000013 | |||
| 1439 | Ga0495620_0000230 | |||
| 1440 | Ga0495620_0000463 | |||
| 1441 | Ga0495620_0005401 | |||
| 1442 | Ga0495620_0009905 | |||
| 1443 | Ga0495620_0018127 | |||
| 1444 | Ga0495620_0018392 | |||
| 1445 | Ga0495631_0000817 | |||
| 1446 | Ga0495631_0007145 | |||
| 1447 | Ga0495631_0022139 | |||
| 1448 | Ga0495632_0001080 | |||
| 1449 | Ga0495632_0001889 | |||
| 1450 | Ga0495632_0008466 | |||
| 1451 | Ga0495632_0013149 | |||
| 1452 | Ga0495632_0014175 | |||
| 1453 | Ga0495632_0014766 | |||
| 1454 | Ga0495632_0017841 | |||
| 1455 | Ga0495632_0019871 | |||
| 1456 | Ga0495632_0027027 | |||
| 1457 | Ga0495632_0030253 | |||
| 1458 | Ga0495632_0035658 | |||
| 1459 | Ga0495637_0000252 | |||
| 1460 | Ga0495637_0003456 | |||
| 1461 | Ga0495637_0013531 | |||
| 1462 | Ga0495637_0013717 | |||
| 1463 | Ga0495637_0014017 | |||
| 1464 | Ga0495637_0015810 | |||
| 1465 | Ga0495637_0017701 | |||
| 1466 | Ga0495637_0019871 | |||
| 1467 | Ga0495637_0021017 | |||
| 1468 | Ga0495637_0021079 | |||
| 1469 | Ga0495637_0022326 | |||
| 1470 | Ga0495637_0027075 | |||
| 1471 | Ga0495643_0000684 | |||
| 1472 | Ga0495643_0000830 | |||
| 1473 | Ga0495643_0013635 | |||
| 1474 | Ga0495643_0029268 | |||
| 1475 | Ga0495643_0030715 | |||
| 1476 | Ga0495644_0000921 | |||
| 1477 | Ga0495644_0019105 | |||
| 1478 | Ga0495648_0003089 | |||
| 1479 | Ga0495648_0004745 | |||
| 1480 | Ga0495648_0007885 | |||
| 1481 | Ga0495648_0024516 | |||
| 1482 | Ga0495648_0026355 | |||
| 1483 | Ga0495648_0029048 | |||
| 1484 | Ga0495648_0030971 | |||
| 1485 | Ga0495648_0035148 | |||
| 1486 | Ga0495648_0035794 | |||
| 1487 | Ga0495648_0038042 | |||
| 1488 | Ga0495648_0038974 | |||
| 1489 | Ga0495648_0047702 | |||
| 1490 | Ga0495648_0051342 | |||
| 1491 | Ga0495642_0001881 | |||
| 1492 | Ga0495642_0007894 | |||
| 1493 | Ga0495654_0001564 | |||
| 1494 | Ga0495654_0001684 | |||
| 1495 | Ga0495654_0007896 | |||
| 1496 | Ga0495654_0008686 | |||
| 1497 | Ga0495654_0013298 | |||
| 1498 | Ga0495654_0019502 | |||
| 1499 | Ga0495654_0020877 | |||
| 1500 | Ga0495654_0025380 | |||
| 1501 | Ga0495654_0026285 | |||
| 1502 | Ga0495654_0031179 | |||
| 1503 | Ga0495654_0044747 | |||
| 1504 | Ga0495609_0000070 | |||
| 1505 | Ga0495609_0000197 | |||
| 1506 | Ga0495609_0000707 | |||
| 1507 | Ga0495609_0013552 | |||
| 1508 | Ga0495609_0020115 | |||
| 1509 | Ga0495609_0030703 | |||
| 1510 | Ga0495597_0000010 | |||
| 1511 | Ga0495597_0003921 | |||
| 1512 | Ga0495597_0014114 | |||
| 1513 | Ga0495597_0021003 | |||
| 1514 | Ga0495597_0022478 | |||
| 1515 | Ga0495597_0027850 | |||
| 1516 | Ga0495597_0036148 | |||
| 1517 | Ga0495597_0041212 | |||
| 1518 | Ga0495622_0008343 | |||
| 1519 | Ga0495622_0012637 | |||
| 1520 | Ga0495622_0017017 | |||
| 1521 | Ga0495622_0020701 | |||
| 1522 | Ga0495633_0001527 | |||
| 1523 | Ga0495633_0012320 | |||
| 1524 | Ga0495633_0015599 | |||
| 1525 | Ga0495633_0024573 | |||
| 1526 | Ga0495656_0025268 | |||
| 1527 | Ga0495668_0000102 | |||
| 1528 | Ga0495668_0005367 | |||
| 1529 | Ga0495668_0006716 | |||
| 1530 | Ga0495668_0013510 | |||
| 1531 | Ga0495668_0015789 | |||
| 1532 | Ga0495668_0028248 | |||
| 1533 | Ga0495668_0036800 | |||
| 1534 | Ga0495634_0008019 | |||
| 1535 | Ga0495611_0002696 | |||
| 1536 | Ga0495611_0004966 | |||
| 1537 | Ga0495611_0021284 | |||
| 1538 | Ga0495625_0000354 | |||
| 1539 | Ga0495625_0021002 | |||
| 1540 | Ga0495625_0035765 | |||
| 1541 | Ga0495625_0048467 | |||
| 1542 | Ga0495625_0061054 | |||
| 1543 | Ga0495625_0063776 | |||
| 1544 | Ga0495625_0088802 | |||
| 1545 | Ga0495635_0013908 | |||
| 1546 | Ga0495659_0009675 | |||
| 1547 | Ga0495661_0000185 | |||
| 1548 | Ga0495661_0000329 | |||
| 1549 | Ga0495661_0000875 | |||
| 1550 | Ga0495661_0006179 | |||
| 1551 | Ga0495661_0027613 | |||
| 1552 | Ga0495661_0042076 | |||
| 1553 | Ga0495661_0045270 | |||
| 1554 | Ga0495661_0046877 | |||
| 1555 | Ga0495661_0054279 | |||
| 1556 | Ga0495588_0023759 | |||
| 1557 | Ga0495623_0013516 | |||
| 1558 | Ga0495623_0013934 | |||
| 1559 | Ga0495646_0012272 | |||
| 1560 | Ga0495646_0024614 | |||
| 1561 | Ga0495613_0048971 | |||
| 1562 | Ga0495624_0025535 | |||
| 1563 | Ga0495670_0003514 | |||
| 1564 | Ga0495670_0013746 | |||
| 1565 | Ga0495670_0022757 | |||
| 1566 | Ga0495670_0028476 | |||
| 1567 | Ga0495671_0001087 | |||
| 1568 | Ga0495671_0003824 | |||
| 1569 | Ga0495671_0016167 | |||
| 1570 | Ga0495671_0016777 | |||
| 1571 | Ga0495671_0025511 | |||
| 1572 | Ga0495671_0026078 | |||
| 1573 | Ga0495671_0026390 | |||
| 1574 | Ga0495671_0030656 | |||
| 1575 | Ga0495671_0032512 | |||
| 1576 | Ga0495671_0033113 | |||
| 1577 | Ga0495671_0038474 | |||
| 1578 | Ga0495649_0015223 | |||
| 1579 | Ga0495649_0025836 | |||
| 1580 | Ga0495649_0029287 | |||
| 1581 | Ga0495649_0029516 | |||
| 1582 | Ga0495649_0033712 | |||
| 1583 | Ga0495589_0002046 | |||
| 1584 | Ga0495589_0008932 | |||
| 1585 | Ga0495589_0016896 | |||
| 1586 | Ga0495589_0019754 | |||
| 1587 | Ga0495589_0024555 | |||
| 1588 | Ga0495589_0025402 | |||
| 1589 | Ga0495589_0030977 | |||
| 1590 | Ga0495600_0032163 | |||
| 1591 | Ga0495660_0001329 | |||
| 1592 | Ga0495660_0001815 | |||
| 1593 | Ga0495660_0002558 | |||
| 1594 | Ga0495660_0002643 | |||
| 1595 | Ga0495660_0009743 | |||
| 1596 | Ga0495660_0014666 | |||
| 1597 | Ga0495660_0019932 | |||
| 1598 | Ga0495660_0029277 | |||
| 1599 | Ga0495660_0030377 | |||
| 1600 | Ga0495660_0030681 | |||
| 1601 | Ga0495660_0032426 | |||
| 1602 | Ga0495660_0034972 | |||
| 1603 | Ga0495660_0050491 | |||
| 1604 | Ga0495604_0007388 | |||
| 1605 | Ga0495674_0041032 | |||
| 1606 | Ga0495672_0008936 | |||
| 1607 | Ga0495672_0008970 | |||
| 1608 | Ga0495672_0030800 | |||
| 1609 | Ga0495672_0033749 | |||
| 1610 | Ga0495672_0037045 | |||
| 1611 | Ga0495672_0037577 | |||
| 1612 | Ga0495672_0038553 | |||
| 1613 | Ga0495672_0039685 | |||
| 1614 | Ga0495672_0041440 | |||
| 1615 | Ga0495672_0043449 | |||
| 1616 | Ga0495672_0055233 | |||
| 1617 | Ga0495672_0070934 | |||
| 1618 | Ga0495676_0000081 | |||
| 1619 | Ga0495676_0038465 | |||
| 1620 | Ga0495676_0056133 | |||
| 1621 | Ga0495680_0013118 | |||
| 1622 | Ga0495680_0038945 | |||
| 1623 | Ga0495683_0001164 | |||
| 1624 | Ga0495683_0004135 | |||
| 1625 | Ga0495683_0010986 | |||
| 1626 | Ga0495683_0014129 | |||
| 1627 | Ga0495683_0018831 | |||
| 1628 | Ga0495683_0026962 | |||
| 1629 | Ga0495683_0031784 | |||
| 1630 | Ga0495683_0042993 | |||
| 1631 | Ga0495687_015170 | |||
| 1632 | Ga0495687_026899 | |||
| 1633 | Ga0495679_000186 | |||
| 1634 | Ga0495679_001415 | |||
| 1635 | Ga0495679_011118 | |||
| 1636 | Ga0495679_011313 | |||
| 1637 | Ga0495679_013926 | |||
| 1638 | Ga0495679_016933 | |||
| 1639 | Ga0495679_019871 | |||
| 1640 | Ga0495673_0002766 | |||
| 1641 | Ga0495673_0003770 | |||
| 1642 | Ga0495673_0004143 | |||
| 1643 | Ga0495673_0004983 | |||
| 1644 | Ga0495673_0015545 | |||
| 1645 | Ga0495673_0017336 | |||
| 1646 | Ga0495673_0021427 | |||
| 1647 | Ga0495673_0023430 | |||
| 1648 | Ga0495673_0024205 | |||
| 1649 | Ga0495673_0029484 | |||
| 1650 | Ga0495681_0003446 | |||
| 1651 | Ga0495681_0005569 | |||
| 1652 | Ga0495681_0013167 | |||
| 1653 | Ga0495681_0013239 | |||
| 1654 | Ga0495681_0014821 | |||
| 1655 | Ga0495681_0018271 | |||
| 1656 | Ga0495681_0020983 | |||
| 1657 | Ga0495681_0023901 | |||
| 1658 | Ga0495681_0025061 | |||
| 1659 | Ga0495681_0026051 | |||
| 1660 | Ga0495681_0030272 | |||
| 1661 | Ga0495681_0035455 | |||
| 1662 | Ga0495681_0037113 | |||
| 1663 | Ga0495684_0054293 | |||
| 1664 | Ga0495684_0055286 | |||
| 1665 | Ga0495686_0024039 | |||
| 1666 | Ga0495686_0029994 | |||
| 1667 | Ga0495686_0039727 | |||
| 1668 | Ga0495686_0047434 | |||
| 1669 | Ga0495686_0050001 | |||
| 1670 | Ga0495593_0010845 | |||
| 1671 | Ga0495602_0049015 | |||
| 1672 | Ga0495626_0000256 | |||
| 1673 | Ga0495626_0006620 | |||
| 1674 | Ga0495626_0022412 | |||
| 1675 | Ga0495626_0022847 | |||
| 1676 | Ga0495626_0023047 | |||
| 1677 | Ga0495626_0023143 | |||
| 1678 | Ga0495626_0029320 | |||
| 1679 | Ga0495626_0030483 | |||
| 1680 | Ga0495626_0031168 | |||
| 1681 | Ga0496102_0001116 | |||
| 1682 | Ga0496109_0088342 | |||
| 1683 | Ga0496110_0009288 | |||
| 1684 | Ga0496112_0064287 | |||
| 1685 | Ga0496114_0058865 | |||
| 1686 | Ga0496116_0001203 | |||
| 1687 | Ga0496116_0001581 | |||
| 1688 | Ga0496116_0021622 | |||
| 1689 | Ga0496116_0043131 | |||
| 1690 | Ga0496116_0043471 | |||
| 1691 | Ga0496117_0004257 | |||
| 1692 | Ga0496117_0007639 | |||
| 1693 | Ga0496117_0010279 | |||
| 1694 | Ga0496117_0023547 | |||
| 1695 | Ga0496117_0030347 | |||
| 1696 | Ga0496117_0030654 | |||
| 1697 | Ga0496117_0040041 | |||
| 1698 | Ga0496117_0047654 | |||
| 1699 | Ga0496117_0056878 | |||
| 1700 | Ga0496118_0003568 | |||
| 1701 | Ga0496118_0021945 | |||
| 1702 | Ga0496118_0022407 | |||
| 1703 | Ga0496118_0047692 | |||
| 1704 | Ga0496118_0053893 | |||
| 1705 | Ga0496118_0064422 | |||
| 1706 | Ga0496119_0000112 | |||
| 1707 | Ga0496119_0016434 | |||
| 1708 | Ga0496119_0038704 | |||
| 1709 | Ga0496120_0002916 | |||
| 1710 | Ga0496120_0027834 | |||
| 1711 | Ga0496120_0032211 | |||
| 1712 | Ga0496121_0002692 | |||
| 1713 | Ga0496121_0006107 | |||
| 1714 | Ga0496121_0016312 | |||
| 1715 | Ga0496121_0047549 | |||
| 1716 | Ga0496121_0062498 | |||
| 1717 | Ga0496121_0093954 | |||
| 1718 | Ga0496122_0004361 | |||
| 1719 | Ga0496122_0006408 | |||
| 1720 | Ga0496122_0018557 | |||
| 1721 | Ga0496122_0032232 | |||
| 1722 | Ga0496122_0052318 | |||
| 1723 | Ga0496122_0052827 | |||
| 1724 | Ga0496122_0067740 | |||
| 1725 | Ga0496123_0001624 | |||
| 1726 | Ga0496123_0001754 | |||
| 1727 | Ga0496123_0017632 | |||
| 1728 | Ga0496123_0018313 | |||
| 1729 | Ga0496124_0000222 | |||
| 1730 | Ga0496124_0005215 | |||
| 1731 | Ga0496124_0009753 | |||
| 1732 | Ga0496124_0012097 | |||
| 1733 | Ga0496124_0014447 | |||
| 1734 | Ga0496124_0022917 | |||
| 1735 | Ga0496124_0030541 | |||
| 1736 | Ga0496124_0079571 | |||
| 1737 | Ga0496125_0005002 | |||
| 1738 | Ga0496125_0008731 | |||
| 1739 | Ga0496125_0022704 | |||
| 1740 | Ga0496125_0061609 | |||
| 1741 | Ga0496125_0067505 | |||
| 1742 | Ga0496125_0077983 | |||
| 1743 | Ga0496125_0097696 | |||
| 1744 | Ga0496126_0038532 | |||
| 1745 | Ga0496126_0087683 | |||
| 1746 | Ga0495678_000031 | |||
| 1747 | Ga0495678_000508 | |||
| 1748 | Ga0495678_004164 | |||
| 1749 | Ga0495678_012976 | |||
| 1750 | Ga0495678_014044 | |||
| 1751 | Ga0495678_015906 | |||
| 1752 | Ga0495678_016154 | |||
| 1753 | Ga0495678_019192 | |||
| 1754 | Ga0495678_030980 | |||
| 1755 | Ga0495682_0000300 | |||
| 1756 | Ga0495682_0002873 | |||
| 1757 | Ga0495682_0011018 | |||
| 1758 | Ga0495682_0015154 | |||
| 1759 | Ga0501031_0012138 | |||
| 1760 | Ga0501032_0011897 | |||
| 1761 | Ga0501034_0000020 | |||
| 1762 | Ga0501034_0043201 | |||
| 1763 | Ga0501034_0057341 | |||
| 1764 | Ga0501036_0041298 | |||
| 1765 | Ga0501039_0005790 | |||
| 1766 | Ga0501067_0012697 | |||
| 1767 | Ga0501068_0019968 | |||
| 1768 | Ga0501070_0020222 | |||
| 1769 | Ga0501072_0005999 | |||
| 1770 | Ga0501072_0070726 | |||
| 1771 | Ga0501073_0004730 | |||
| 1772 | Ga0501073_0021468 | |||
| 1773 | Ga0501074_0013174 | |||
| 1774 | Ga0501074_0023761 | |||
| 1775 | Ga0501075_0017465 | |||
| 1776 | Ga0501077_0015602 | |||
| 1777 | Ga0501077_0022996 | |||
| 1778 | Ga0501083_0014595 | |||
| 1779 | Ga0501226_000006 | |||
| 1780 | Ga0500572_004618 | |||
| 1781 | Ga0500659_0036793 | |||
| 1782 | Ga0500577_0001698 | |||
| 1783 | Ga0500634_0005037 | |||
| 1784 | Ga0501084_0057279 | |||
| 1785 | Ga0501082_0017045 | |||
| 1786 | Ga0501082_0094459 | |||
| 1787 | 640488702 | |||
| 1788 | 2511254363 | |||
| 1789 | 2511263867 | |||
| 1790 | 2511272241 | |||
| 1791 | 2511275991 | |||
| 1792 | 2511289223 | |||
| 1793 | 2511295404 | |||
| 1794 | 2511299864 | |||
| 1795 | 2511313497 | |||
| 1796 | 2511319949 | |||
| 1797 | 2511326121 | |||
| 1798 | 2511332352 | |||
| 1799 | 2511339943 | |||
| 1800 | 2511342046 | |||
| 1801 | 2511352788 | |||
| 1802 | 2511355028 | |||
| 1803 | 2511361788 | |||
| 1804 | 2511367803 | |||
| 1805 | 2511414767 | |||
| 1806 | 2511826564 | |||
| 1807 | 2512324197 | |||
| 1808 | 2554813784 | |||
| 1809 | 2555671786 | |||
| 1810 | 2583794288 | |||
| 1811 | 2597859876 | |||
| 1812 | 2597862403 | |||
| 1813 | 2597868120 | |||
| 1814 | 2599330147 | |||
| 1815 | 2599354058 | |||
| 1816 | 2599360263 | |||
| 1817 | 2599366585 | |||
| 1818 | 2599373374 | |||
| 1819 | 2599379166 | |||
| 1820 | 2599385856 | |||
| 1821 | 2599392233 | |||
| 1822 | 2599396985 | |||
| 1823 | 2599403999 | |||
| 1824 | 2599448977 | |||
| 1825 | 2599460892 | |||
| 1826 | 2599470439 | |||
| 1827 | 2599482706 | |||
| 1828 | 2599489913 | |||
| 1829 | 2599503521 | |||
| 1830 | 2599508892 | |||
| 1831 | 2599511278 | |||
| 1832 | 2599517795 | |||
| 1833 | 2599613334 | |||
| 1834 | 2599771006 | |||
| 1835 | 2599803571 | |||
| 1836 | 2599879719 | |||
| 1837 | 2599886154 | |||
| 1838 | 2599890652 | |||
| 1839 | 2599897869 | |||
| 1840 | 2599929856 | |||
| 1841 | 2599944734 | |||
| 1842 | 2599948231 | |||
| 1843 | 2599956470 | |||
| 1844 | 2599960183 | |||
| 1845 | 2599969270 | |||
| 1846 | 2599975006 | |||
| 1847 | 2599980583 | |||
| 1848 | 2599983605 | |||
| 1849 | 2599990012 | |||
| 1850 | 2599995850 | |||
| 1851 | 2600000490 | |||
| 1852 | 2600005167 | |||
| 1853 | 2600014464 | |||
| 1854 | 2600017683 | |||
| 1855 | 2600025688 | |||
| 1856 | 2600028674 | |||
| 1857 | 2600033663 | |||
| 1858 | 2600040045 | |||
| 1859 | 2600047678 | |||
| 1860 | 2600053586 | |||
| 1861 | 2600059017 | |||
| 1862 | 2600068566 | |||
| 1863 | 2600070245 | |||
| 1864 | 2600077090 | |||
| 1865 | 2600213507 | |||
| 1866 | 2600357842 | |||
| 1867 | 2600365162 | |||
| 1868 | 2600446999 | |||
| 1869 | 2601625684 | |||
| 1870 | 2601690983 | |||
| 1871 | 2601773674 | |||
| 1872 | 2601796801 | |||
| 1873 | 2602010113 | |||
| 1874 | 2606073951 | |||
| 1875 | 2606126404 | |||
| 1876 | 2608381061 | |||
| 1877 | 2621301469 | |||
| 1878 | 2624482499 | |||
| 1879 | 2624490470 | |||
| 1880 | 2643842442 | |||
| 1881 | 2643868829 | |||
| 1882 | 2643955304 | |||
| 1883 | 2644023656 | |||
| 1884 | 2644187101 | |||
| 1885 | 2644286961 | |||
| 1886 | 2644624086 | |||
| 1887 | 2652546128 | |||
| 1888 | 2671089962 | |||
| 1889 | 2671096640 | |||
| 1890 | 2671125400 | |||
| 1891 | 2671770861 | |||
| 1892 | 2677897571 | |||
| 1893 | 2678264906 | |||
| 1894 | 2715750493 | |||
| 1895 | 2715755107 | |||
| 1896 | 2718635702 | |||
| 1897 | 2723247293 | |||
| 1898 | 2729147679 | |||
| 1899 | 2738673690 | |||
| 1900 | 2738691503 | |||
| 1901 | 2738752083 | |||
| 1902 | 2738809176 | |||
| 1903 | 2738861124 | |||
| 1904 | 2738896536 | |||
| 1905 | 2739196602 | |||
| 1906 | 2739257581 | |||
| 1907 | 2739267278 | |||
| 1908 | 2739288289 | |||
| 1909 | 2739293382 | |||
| 1910 | 2739315616 | |||
| 1911 | 2743739417 | |||
| 1912 | 2745005362 | |||
| 1913 | 2765585654 | |||
| 1914 | 2774122982 | |||
| 1915 | 2774133384 | |||
| 1916 | 2784262742 | |||
| 1917 | 2784315340 | |||
| 1918 | 2794595780 | |||
| 1919 | 2807406964 | |||
| 1920 | 2807455296 | |||
| 1921 | 2808854656 | |||
| 1922 | 2808907320 | |||
| 1923 | 2808921701 | |||
| 1924 | 2808930470 | |||
| 1925 | 2808934764 | |||
| 1926 | 2808943658 | |||
| 1927 | 2808943822 | |||
| 1928 | 2808952592 | |||
| 1929 | 2808960507 | |||
| 1930 | 2808963161 | |||
| 1931 | 2808975329 | |||
| 1932 | 2808991032 | |||
| 1933 | 2808998049 | |||
| 1934 | 2809218372 | |||
| 1935 | 2812371000 | |||
| 1936 | 2817489176 | |||
| 1937 | 2819656178 | |||
| 1938 | 2819701733 | |||
| 1939 | 2823422610 | |||
| 1940 | 2825656196 | |||
| 1941 | 2826585796 | |||
| 1942 | 2834029083 | |||
| 1943 | 2842806077 | |||
| 1944 | 2842820694 | |||
| 1945 | 2842828790 | |||
| 1946 | 2842837354 | |||
| 1947 | 2842842524 | |||
| 1948 | 2842845146 | |||
| 1949 | 2842853274 | |||
| 1950 | 2842856599 | |||
| 1951 | 2844665945 | |||
| 1952 | 2852615427 | |||
| 1953 | 2852660761 | |||
| 1954 | 2852670395 | |||
| 1955 | 2860341350 | |||
| 1956 | 2860869107 | |||
| 1957 | 2878034427 | |||
| 1958 | 2880235060 | |||
| 1959 | 2904521447 | |||
| 1960 | 2904553099 | |||
| 1961 | 2908447909 | |||
| 1962 | 2912967902 | |||
| 1963 | 2913041507 | |||
| 1964 | 2917075657 | |||
| 1965 | 2919066513 | |||
| 1966 | 2919159316 | |||
| 1967 | 2919388499 | |||
| 1968 | 2919459450 | |||
| 1969 | 2919484440 | |||
| 1970 | 2919490182 | |||
| 1971 | 2919504954 | |||
| 1972 | 2919701665 | |||
| 1973 | 2923158502 | |||
| 1974 | 2923525107 | |||
| 1975 | 2923591323 | |||
| 1976 | 2926066631 | |||
| 1977 | 2929148846 | |||
| 1978 | 2929191102 | |||
| 1979 | 2931373731 | |||
| 1980 | 2931392113 | |||
| 1981 | 2931397088 | |||
| 1982 | 2935356646 | |||
| 1983 | 2939637068 | |||
| 1984 | 2939655998 | |||
| 1985 | 2945929474 | |||
| 1986 | 2945965754 | |||
| 1987 | 2946029344 | |||
| 1988 | 2969309203 | |||
| 1989 | 2974289427 | |||
| 1990 | 2984287667 | |||
| 1991 | 2988730423 | |||
| 1992 | 2990200339 | |||
| 1993 | 2998144490 | |||
| 1994 | 3007253671 | |||
| 1995 | 3007317555 | |||
| 1996 | 3007424861 | |||
| 1997 | 3007516280 | |||
| 1998 | 3007618126 | |||
| 1999 | 3007623203 | |||
| 2000 | 3007720207 | |||
| 2001 | 3007858530 | |||
| 2002 | 3007865942 | |||
| 2003 | 3007867809 | |||
| 2004 | 3007874904 | |||
| 2005 | 637322197 | |||
| 2006 | 651176751 | |||
| 2007 | 8011356578 | |||
| 2008 | 8015692592 | |||
| 2009 | 8019771569 | |||
| 2010 | 8019780797 | |||
| 2011 | 8029996393 | |||
| 2012 | 8034966225 | |||
| 2013 | 8052498851 | |||
| 2014 | 8054286217 | |||
| 2015 | 8054348465 | |||
| 2016 | 8054504692 | |||
| 2017 | 8054933279 | |||
| 2018 | 8055775824 | |||
| 2019 | 8055819134 | |||
| 2020 | 8055884110 | |||
| 2021 | 8056117477 | |||
| 2022 | 8056124824 | |||
| 2023 | 8056130776 | |||
| 2024 | 8056133004 | |||
| 2025 | 8056138619 | |||
| 2026 | 8056144553 | |||
| 2027 | 8056149218 | |||
| 2028 | 8056155466 | |||
| 2029 | 8056166793 | |||
| 2030 | 8056172086 | |||
| 2031 | 8056172759 | |||
| 2032 | 8056183390 | |||
| 2033 | 8056572567 | |||
| 2034 | 8057804675 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tm7-assembly1.cif.gz_B | processed aspartate decarboxylase mutant with asn72 mutated to ala | 0.9217 | 571 | 604 |
| 4d7z-assembly1.cif.gz_B | e. coli l-aspartate-alpha-decarboxylase mutant n72q to a resolution of 1.9 angstroms | 0.9203 | 571 | 604 |
| 3plx-assembly1.cif.gz_B | the crystal structure of aspartate alpha-decarboxylase from campylobacter jejuni subsp. jejuni nctc 11168 | 0.9173 | 571 | 604 |
| 5ls7-assembly1.cif.gz_D | complex of wild type e. coli alpha aspartate decarboxylase with its processing factor panz | 0.9133 | 571 | 604 |
| 1uhe-assembly1.cif.gz_A | crystal structure of aspartate decarboxylase, isoaspargine complex | 0.888 | 571 | 604 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3plxB00 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.9173 | 571 | 604 | 2.40.40.20 |
| 2v45A01 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains | 0.9032 | 2 | 56 | 2.20.25.90 |
| af_P96281_14_94_2.40.40.20 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.8991 | 570 | 615 | 2.40.40.20 |
| af_L0T2Z1_2_58_2.20.25.90 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains | 0.8979 | 2 | 55 | 2.20.25.90 |
| 2vpzE01 | Mainly Beta;Single Sheet;N-terminal domain of TfIIb;ADC-like domains | 0.895 | 2 | 59 | 2.20.25.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B8LFW2-F1-model_v4 | Dehydrogenase | 0.9799 | 2 | 418 |
GO:0016491
GO:0046872 GO:0051539 |
| AF-A0A5C7W6B1-F1-model_v4 | Molybdopterin oxidoreductase family protein | 0.9799 | 2 | 414 |
GO:0016491
GO:0046872 GO:0051539 |
| AF-A0A2N1WK21-F1-model_v4 | deleted | 0.9786 | 44 | 387 |
|
| AF-S6UTW2-F1-model_v4 | Oxidoreductase, molybdopterin-binding protein | 0.9718 | 2 | 478 |
GO:0016491
GO:0046872 GO:0051539 |
| AF-A0A356VIE5-F1-model_v4 | deleted | 0.9702 | 2 | 318 |
|