F488306

General Info

Members Datasets Scaffolds Average Seq Length
1018 586 2036 405

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100013974|Ga0070711_1000139742
Length 448
Sequence MAASHRSGRGHERRENGASQPASEERGKRHGLLLCARSRVVPMMVGPVVIVGAGHAGFQLAASLRQDGFAEPIALINDEGHLPYQRPPLSKAYLKGTGGSDSLMFRPDKFYSDQHIDLITDCAAAIDRSARKVTLASGAVLDYQHLVLATGARNRLLDIPNANLEAVRYLRTLDESEALRHLLAPDLRVVVIGAGFIGLEFAATARAKGLEVDVVELAPRVMARAVTAEISEFSQARHTSAGIRIHLGVQVTSIEADGTKVAGVSLSDGRHIPADLVVVGVGVLPNVELASAAGLPVASGIIVDDHLLTADQNISAVGDCALYASPRFGGSLRLESVQNATDHARCVAARLTGNAKVYDGLPWFWSDQGPDKLQMVGLTTGYDRVVVRGDREQGAFSAFCYRGEQLLGIESVNRAGDHMFGRRLLVAGGSITPEEAADASFDLKRALG

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
62 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
63 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
64 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
94 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
95 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
96 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
153 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
156 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
163 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
168 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
198 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
199 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
213 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
247 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
329 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
335 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
336 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
337 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
338 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
339 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
340 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
341 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
342 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
343 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
344 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
345 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
346 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
347 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
348 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
349 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
352 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
353 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
354 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
355 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
356 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
357 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
358 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
359 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
360 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
361 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
362 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
363 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
364 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
365 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
366 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
367 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
368 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
369 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
370 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
371 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
372 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
373 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
374 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
375 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
376 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
377 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
378 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
379 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
380 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
381 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
382 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
383 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
384 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
385 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
386 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
387 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
388 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
389 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
390 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
391 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
392 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
393 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
394 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
395 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
396 2791355199
397 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
398 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
399 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
400 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
401 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
402 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
403 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
404 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
405 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
406 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
407 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
408 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
409 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
410 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
411 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
412 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
413 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
414 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
415 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
416 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
417 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
418 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
419 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
420 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
421 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
422 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
423 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
424 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
425 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
426 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
427 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
428 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
429 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
430 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
431 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
432 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
433 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
434 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
435 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
436 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
437 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
438 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
439 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
440 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
441 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
442 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
443 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
444 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
445 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
446 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
447 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
448 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
449 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
450 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
451 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
452 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
453 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
454 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
455 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
456 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
457 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
458 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
459 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
460 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
461 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
462 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
463 2904699407
464 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
465 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
466 2906610324
467 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
468 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
469 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
470 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
471 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
472 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
473 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
474 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
475 2922368715
476 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
477 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
478 2922425934
479 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
480 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
481 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
482 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
483 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
484 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
485 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
486 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
487 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
488 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
489 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
490 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
491 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
492 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
493 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
494 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
495 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
496 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
497 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
498 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
499 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
500 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
501 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
502 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
503 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
504 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
505 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
506 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
507 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
508 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
509 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
510 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
511 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
512 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
513 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
514 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
515 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
516 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
517 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
518 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
519 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
520 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
521 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
522 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
523 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
524 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
525 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
526 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
527 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
528 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
529 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
530 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
531 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
532 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
533 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
534 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
535 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
536 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
537 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
538 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
539 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
540 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
541 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
542 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
543 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
544 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
545 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
546 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
547 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
548 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
549 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
550 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
551 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
552 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
553 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
554 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
555 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
556 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
557 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
558 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
559 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
560 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
561 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
562 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
563 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
564 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
565 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
566 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
567 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
568 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
569 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
570 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
571 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
572 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
573 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
574 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
575 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
576 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
577 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
578 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
579 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
580 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
581 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
582 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
583 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
584 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
585 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
586 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.49
Metatranscriptomes 0.1
Isolates 22.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.86
Nodule 18.37
Rhizoplane 5.99
Rhizosphere 54.52
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100013974 3300005439 Bacteria 5050
2 JGI24740J21852_10004915 3300001979 Bacteria 5689
3 JGI24739J22299_10002391 3300001989 Bacteria 7241
4 JGI24737J22298_10008032 3300001990 Bacteria 3546
5 JGI25153J46596_10005337 3300003215 Bacteria 6755
6 rootL2_10160148 3300003322 Bacteria 2053
7 JGI25160J50197_1011835 3300003354 Bacteria 3064
8 JGI25404J52841_10009163 3300003659 Bacteria 2115
9 Ga0055531_10006567 3300003794 Bacteria 6572
10 Ga0055543_1000462 3300004625 Bacteria 24016
11 Ga0055543_1001763 3300004625 Bacteria 8077
12 Ga0065165_1000799 3300005262 Bacteria 42051
13 Ga0065165_1002416 3300005262 Bacteria 15929
14 Ga0065165_1002642 3300005262 Bacteria 14515
15 Ga0065165_1006433 3300005262 Bacteria 6161
16 Ga0070658_10048283 3300005327 Bacteria 3446
17 Ga0070683_100005122 3300005329 Bacteria 10899
18 Ga0070680_100009353 3300005336 Bacteria 7529
19 Ga0070680_100162926 3300005336 Bacteria 1874
20 Ga0068868_100053615 3300005338 Bacteria 3177
21 Ga0070660_100018873 3300005339 Bacteria 5048
22 Ga0070668_100026976 3300005347 Bacteria 4360
23 Ga0070668_100082935 3300005347 Bacteria 2515
24 Ga0070668_100229075 3300005347 Bacteria 1535
25 Ga0070675_100167579 3300005354 Bacteria 1893
26 Ga0070671_100019025 3300005355 Bacteria 5586
27 Ga0070671_100154588 3300005355 Bacteria 1938
28 Ga0070674_100011327 3300005356 Bacteria 5427
29 Ga0070673_100042244 3300005364 Bacteria 3514
30 Ga0070688_100028924 3300005365 Bacteria 3313
31 Ga0070659_100065131 3300005366 Bacteria 2886
32 Ga0070667_100053462 3300005367 Bacteria 3408
33 Ga0070709_10001228 3300005434 Bacteria 14056
34 Ga0070709_10115955 3300005434 Bacteria 1807
35 Ga0070709_10160673 3300005434 Bacteria 1562
36 Ga0070714_100006930 3300005435 Bacteria 8786
37 Ga0070714_100012311 3300005435 Bacteria 6825
38 Ga0070714_100083680 3300005435 Bacteria 2783
39 Ga0070714_100264909 3300005435 Bacteria 1592
40 Ga0070713_100019837 3300005436 Bacteria 5145
41 Ga0070713_100099622 3300005436 Bacteria 2514
42 Ga0070713_100155497 3300005436 Bacteria 2038
43 Ga0070713_100252074 3300005436 Bacteria 1610
44 Ga0070713_100340281 3300005436 Bacteria 1390
45 Ga0070710_10000929 3300005437 Bacteria 13965
46 Ga0070711_100005942 3300005439 Bacteria 7326
47 Ga0070711_100015536 3300005439 Bacteria 4819
48 Ga0070711_100039484 3300005439 Bacteria 3180
49 Ga0070711_100043582 3300005439 Bacteria 3040
50 Ga0070711_100072675 3300005439 Bacteria 2427
51 Ga0070663_100008307 3300005455 Bacteria 6379
52 Ga0070663_100010106 3300005455 Bacteria 5870
53 Ga0070663_100015280 3300005455 Bacteria 4951
54 Ga0070663_100035288 3300005455 Bacteria 3469
55 Ga0070663_100080401 3300005455 Bacteria 2393
56 Ga0070662_100010158 3300005457 Bacteria 6169
57 Ga0070681_10037204 3300005458 Bacteria 4885
58 Ga0070681_10076829 3300005458 Bacteria 3297
59 Ga0070681_10088746 3300005458 Bacteria 3043
60 Ga0070681_10094083 3300005458 Bacteria 2945
61 Ga0070707_100312288 3300005468 Bacteria 1528
62 Ga0070699_100171307 3300005518 Bacteria 1924
63 Ga0070679_100032475 3300005530 Bacteria 5164
64 Ga0070679_100058920 3300005530 Bacteria 3827
65 Ga0070679_100094456 3300005530 Bacteria 2977
66 Ga0070684_100015626 3300005535 Bacteria 6190
67 Ga0070684_100017917 3300005535 Bacteria 5821
68 Ga0070684_100033654 3300005535 Bacteria 4377
69 Ga0068853_100007930 3300005539 Bacteria 8513
70 Ga0068853_100022387 3300005539 Bacteria 5278
71 Ga0068853_100137259 3300005539 Bacteria 2193
72 Ga0068853_100210070 3300005539 Bacteria 1774
73 Ga0068853_100268660 3300005539 Bacteria 1570
74 Ga0070665_100016320 3300005548 Bacteria 7448
75 Ga0070665_100051187 3300005548 Bacteria 4142
76 Ga0068855_100012869 3300005563 Bacteria 10096
77 Ga0068855_100021640 3300005563 Bacteria 7714
78 Ga0068855_100059343 3300005563 Bacteria 4476
79 Ga0068857_100015877 3300005577 Bacteria 6590
80 Ga0068857_100050153 3300005577 Bacteria 3703
81 Ga0068856_100001803 3300005614 Bacteria 22366
82 Ga0068856_100001867 3300005614 Bacteria 21986
83 Ga0068856_100019754 3300005614 Bacteria 6537
84 Ga0068852_100014573 3300005616 Bacteria 6058
85 Ga0068852_100063882 3300005616 Bacteria 3207
86 Ga0068859_100053671 3300005617 Bacteria 4054
87 Ga0068851_10000250 3300005834 Bacteria 25377
88 Ga0068851_10042123 3300005834 Bacteria 2298
89 Ga0068863_100231921 3300005841 Bacteria 1781
90 Ga0068863_100294077 3300005841 Bacteria 1574
91 Ga0068858_100018788 3300005842 Bacteria 6466
92 Ga0068860_100005407 3300005843 Bacteria 12960
93 Ga0068860_100123813 3300005843 Bacteria 2478
94 Ga0068862_100057926 3300005844 Bacteria 3323
95 Ga0081455_10002800 3300005937 Bacteria 20533
96 Ga0081455_10008855 3300005937 Bacteria 10411
97 Ga0081455_10037499 3300005937 Bacteria 4304
98 Ga0081455_10056307 3300005937 Bacteria 3340
99 Ga0081455_10061238 3300005937 Bacteria 3168
100 Ga0081455_10108720 3300005937 Bacteria 2208
101 Ga0081540_1000178 3300005983 Bacteria 66386
102 Ga0081540_1001968 3300005983 Bacteria 17139
103 Ga0081540_1011207 3300005983 Bacteria 6010
104 Ga0081540_1012098 3300005983 Bacteria 5709
105 Ga0081540_1018972 3300005983 Bacteria 4200
106 Ga0081540_1019008 3300005983 Bacteria 4194
107 Ga0081540_1021450 3300005983 Bacteria 3845
108 Ga0081540_1021620 3300005983 Bacteria 3823
109 Ga0081540_1040971 3300005983 Bacteria 2407
110 Ga0081540_1043139 3300005983 Bacteria 2318
111 Ga0081539_10000220 3300005985 Bacteria 133834
112 Ga0070717_10005875 3300006028 Bacteria 8987
113 Ga0070717_10012278 3300006028 Bacteria 6529
114 Ga0070717_10058625 3300006028 Bacteria 3184
115 Ga0070717_10094177 3300006028 Bacteria 2533
116 Ga0075365_10018146 3300006038 Bacteria 4320
117 Ga0075368_10011128 3300006042 Bacteria 3269
118 Ga0075363_100018753 3300006048 Bacteria 3451
119 Ga0075363_100072104 3300006048 Bacteria 1878
120 Ga0070715_10003054 3300006163 Bacteria 5249
121 Ga0070716_100004705 3300006173 Bacteria 6546
122 Ga0070716_100012347 3300006173 Bacteria 4328
123 Ga0070712_100005481 3300006175 Bacteria 7854
124 Ga0070712_100006535 3300006175 Bacteria 7235
125 Ga0070712_100044651 3300006175 Bacteria 3056
126 Ga0070712_100054530 3300006175 Bacteria 2795
127 Ga0075370_10003000 3300006353 Bacteria 7950
128 Ga0075370_10042424 3300006353 Bacteria 2570
129 Ga0068871_100080431 3300006358 Bacteria 2698
130 Ga0097620_100053665 3300006931 Bacteria 4054
131 Ga0099825_1030562 3300006941 Bacteria 2374
132 Ga0099824_1004802 3300006942 Bacteria 19329
133 Ga0099824_1020023 3300006942 Bacteria 5032
134 Ga0099822_1001244 3300006943 Bacteria 29011
135 Ga0099823_1042587 3300006944 Bacteria 3170
136 Ga0099794_10005646 3300007265 Bacteria 5036
137 Ga0099794_10007699 3300007265 Bacteria 4440
138 Ga0099794_10101182 3300007265 Bacteria 1438
139 Ga0099795_10002778 3300007788 Bacteria 4209
140 Ga0105240_10016329 3300009093 Bacteria 10056
141 Ga0105240_10016971 3300009093 Bacteria 9835
142 Ga0105240_10075310 3300009093 Bacteria 4163
143 Ga0111539_10083826 3300009094 Bacteria 3748
144 Ga0111539_10135696 3300009094 Bacteria 2882
145 Ga0105245_10051090 3300009098 Bacteria 3706
146 Ga0105245_10171978 3300009098 Bacteria 2063
147 Ga0105245_10310676 3300009098 Bacteria 1550
148 Ga0105247_10033772 3300009101 Bacteria 3114
149 Ga0114129_10090903 3300009147 Bacteria 4230
150 Ga0105243_10142575 3300009148 Bacteria 2046
151 Ga0105241_10005015 3300009174 Bacteria 9775
152 Ga0105241_10039748 3300009174 Bacteria 3550
153 Ga0105241_10085631 3300009174 Bacteria 2477
154 Ga0105248_10077527 3300009177 Bacteria 3736
155 Ga0105248_10078907 3300009177 Bacteria 3700
156 Ga0105248_10244393 3300009177 Bacteria 2020
157 Ga0105248_10267166 3300009177 Bacteria 1926
158 Ga0105237_10037283 3300009545 Bacteria 4916
159 Ga0105237_10058475 3300009545 Bacteria 3858
160 Ga0105237_10064196 3300009545 Bacteria 3668
161 Ga0105237_10205408 3300009545 Bacteria 1970
162 Ga0105238_10002659 3300009551 Bacteria 17766
163 Ga0105238_10006063 3300009551 Bacteria 11992
164 Ga0105238_10009836 3300009551 Bacteria 9579
165 Ga0105238_10298165 3300009551 Bacteria 1595
166 Ga0105238_10407541 3300009551 Bacteria 1353
167 Ga0099796_10011117 3300010159 Bacteria 2500
168 Ga0099796_10013869 3300010159 Bacteria 2313
169 Ga0105239_10003585 3300010375 Bacteria 18979
170 Ga0105239_10003896 3300010375 Bacteria 18087
171 Ga0105239_10017767 3300010375 Bacteria 7867
172 Ga0105239_10021644 3300010375 Bacteria 7089
173 Ga0105239_10027720 3300010375 Bacteria 6233
174 Ga0105239_10059197 3300010375 Bacteria 4205
175 Ga0105239_10103968 3300010375 Bacteria 3144
176 Ga0105239_10431802 3300010375 Bacteria 1493
177 Ga0105246_10027867 3300011119 Bacteria 3707
178 Ga0157373_10052924 3300013100 Bacteria 2887
179 Ga0157370_10059165 3300013104 Bacteria 3642
180 Ga0157370_10202043 3300013104 Bacteria 1843
181 Ga0157369_10030087 3300013105 Bacteria 5992
182 Ga0157369_10047249 3300013105 Bacteria 4675
183 Ga0157374_10087900 3300013296 Bacteria 2959
184 Ga0157374_10199027 3300013296 Bacteria 1961
185 Ga0157378_10004346 3300013297 Bacteria 12466
186 Ga0157378_10078233 3300013297 Bacteria 2983
187 Ga0163162_10069584 3300013306 Bacteria 3571
188 Ga0157375_10054992 3300013308 Bacteria 3922
189 Ga0157375_10121305 3300013308 Bacteria 2724
190 Ga0157375_10214264 3300013308 Bacteria 2084
191 Ga0163163_10052220 3300014325 Bacteria 4032
192 Ga0163163_10160664 3300014325 Bacteria 2292
193 Ga0163163_10185491 3300014325 Bacteria 2128
194 Ga0157377_10015118 3300014745 Bacteria 3939
195 Ga0157379_10026231 3300014968 Bacteria 5186
196 Ga0157379_10287761 3300014968 Bacteria 1496
197 Ga0157376_10037246 3300014969 Bacteria 3946
198 Ga0163161_10039459 3300017792 Bacteria 3390
199 Ga0197907_10707499 3300020069 Bacteria 1816
200 Ga0214544_1000001 3300021320 Bacteria 783667
201 Ga0214542_1000037 3300021321 Bacteria 159256
202 Ga0214542_1000879 3300021321 Bacteria 58206
203 Ga0214545_1000003 3300021324 Bacteria 720274
204 Ga0214543_1000002 3300021327 Bacteria 712733
205 Ga0213874_10003673 3300021377 Bacteria 3433
206 Ga0213876_10005607 3300021384 Bacteria 6890
207 Ga0213875_10000382 3300021388 Bacteria 39987
208 Ga0213875_10000390 3300021388 Bacteria 39140
209 Ga0213875_10003220 3300021388 Bacteria 9371
210 Ga0213871_10003817 3300021441 Bacteria 2951
211 Ga0209148_1000462 3300025254 Bacteria 43711
212 Ga0209233_1002214 3300025261 Bacteria 7295
213 Ga0209455_1009328 3300025272 Bacteria 2588
214 Ga0209455_1014740 3300025272 Bacteria 1754
215 Ga0209564_1005201 3300025295 Bacteria 7533
216 Ga0209758_1000011 3300025297 Bacteria 1049685
217 Ga0209758_1000845 3300025297 Bacteria 42737
218 Ga0209758_1003253 3300025297 Bacteria 15067
219 Ga0209758_1008620 3300025297 Bacteria 6550
220 Ga0209758_1032205 3300025297 Bacteria 2133
221 Ga0209256_1008471 3300025299 Bacteria 4761
222 Ga0209256_1012600 3300025299 Bacteria 3213
223 Ga0207426_1000228 3300025302 Bacteria 129261
224 Ga0207426_1000270 3300025302 Bacteria 108404
225 Ga0207426_1000292 3300025302 Bacteria 99342
226 Ga0207426_1010723 3300025302 Bacteria 3540
227 Ga0209257_1001242 3300025304 Bacteria 31529
228 Ga0209257_1018129 3300025304 Bacteria 2730
229 Ga0207656_10029312 3300025321 Bacteria 2266
230 Ga0207653_10032516 3300025885 Bacteria 1688
231 Ga0207692_10001555 3300025898 Bacteria 8634
232 Ga0207692_10029149 3300025898 Bacteria 2620
233 Ga0207688_10031893 3300025901 Bacteria 2910
234 Ga0207647_10000496 3300025904 Bacteria 31496
235 Ga0207647_10017643 3300025904 Bacteria 4850
236 Ga0207699_10000605 3300025906 Bacteria 17554
237 Ga0207699_10002358 3300025906 Bacteria 8919
238 Ga0207699_10008980 3300025906 Bacteria 4955
239 Ga0207699_10063547 3300025906 Bacteria 2230
240 Ga0207705_10097865 3300025909 Bacteria 2155
241 Ga0207705_10158797 3300025909 Bacteria 1698
242 Ga0207654_10000634 3300025911 Bacteria 19851
243 Ga0207707_10002844 3300025912 Bacteria 15450
244 Ga0207707_10007520 3300025912 Bacteria 9493
245 Ga0207707_10008335 3300025912 Bacteria 8992
246 Ga0207707_10133882 3300025912 Bacteria 2167
247 Ga0207707_10161806 3300025912 Bacteria 1957
248 Ga0207695_10000006 3300025913 Bacteria 1135309
249 Ga0207695_10000008 3300025913 Bacteria 1058268
250 Ga0207695_10002936 3300025913 Bacteria 24601
251 Ga0207695_10011660 3300025913 Bacteria 10622
252 Ga0207695_10046333 3300025913 Bacteria 4609
253 Ga0207695_10068273 3300025913 Bacteria 3642
254 Ga0207695_10089987 3300025913 Bacteria 3085
255 Ga0207671_10060370 3300025914 Bacteria 2813
256 Ga0207671_10088927 3300025914 Bacteria 2324
257 Ga0207693_10000085 3300025915 Bacteria 83879
258 Ga0207693_10005576 3300025915 Bacteria 10474
259 Ga0207693_10009623 3300025915 Bacteria 7870
260 Ga0207693_10020299 3300025915 Bacteria 5286
261 Ga0207693_10059873 3300025915 Bacteria 2983
262 Ga0207693_10060930 3300025915 Bacteria 2956
263 Ga0207693_10070878 3300025915 Bacteria 2727
264 Ga0207693_10264604 3300025915 Bacteria 1348
265 Ga0207663_10000739 3300025916 Bacteria 14580
266 Ga0207663_10003946 3300025916 Bacteria 7338
267 Ga0207663_10009965 3300025916 Bacteria 5032
268 Ga0207660_10023909 3300025917 Bacteria 4131
269 Ga0207660_10068885 3300025917 Bacteria 2568
270 Ga0207662_10106494 3300025918 Bacteria 1744
271 Ga0207657_10003303 3300025919 Bacteria 17242
272 Ga0207657_10016929 3300025919 Bacteria 7015
273 Ga0207649_10027939 3300025920 Bacteria 3317
274 Ga0207652_10026123 3300025921 Bacteria 4860
275 Ga0207652_10045400 3300025921 Bacteria 3746
276 Ga0207652_10115771 3300025921 Bacteria 2381
277 Ga0207646_10258566 3300025922 Bacteria 1574
278 Ga0207694_10000119 3300025924 Bacteria 83771
279 Ga0207694_10003295 3300025924 Bacteria 12847
280 Ga0207694_10005677 3300025924 Bacteria 9572
281 Ga0207694_10180364 3300025924 Bacteria 1712
282 Ga0207694_10241511 3300025924 Bacteria 1476
283 Ga0207687_10018479 3300025927 Bacteria 4603
284 Ga0207687_10062646 3300025927 Bacteria 2631
285 Ga0207687_10076825 3300025927 Bacteria 2400
286 Ga0207700_10003531 3300025928 Bacteria 9108
287 Ga0207700_10011210 3300025928 Bacteria 5706
288 Ga0207700_10011837 3300025928 Bacteria 5587
289 Ga0207700_10045438 3300025928 Bacteria 3241
290 Ga0207700_10069649 3300025928 Bacteria 2701
291 Ga0207664_10005139 3300025929 Bacteria 8917
292 Ga0207664_10159233 3300025929 Bacteria 1924
293 Ga0207644_10155132 3300025931 Bacteria 1775
294 Ga0207690_10164031 3300025932 Bacteria 1659
295 Ga0207706_10041553 3300025933 Bacteria 4076
296 Ga0207665_10000066 3300025939 Bacteria 68434
297 Ga0207665_10004190 3300025939 Bacteria 9594
298 Ga0207665_10042629 3300025939 Bacteria 3034
299 Ga0207665_10209318 3300025939 Bacteria 1424
300 Ga0207691_10059114 3300025940 Bacteria 3486
301 Ga0207689_10013332 3300025942 Bacteria 7013
302 Ga0207661_10000917 3300025944 Bacteria 19380
303 Ga0207661_10023556 3300025944 Bacteria 4653
304 Ga0207661_10046472 3300025944 Bacteria 3443
305 Ga0207667_10003981 3300025949 Bacteria 18159
306 Ga0207667_10021239 3300025949 Bacteria 7197
307 Ga0207667_10033464 3300025949 Bacteria 5525
308 Ga0207667_10201110 3300025949 Bacteria 2044
309 Ga0207651_10207135 3300025960 Bacteria 1576
310 Ga0207677_10098362 3300026023 Bacteria 2146
311 Ga0207703_10026127 3300026035 Bacteria 4594
312 Ga0207703_10128295 3300026035 Bacteria 2187
313 Ga0207703_10205158 3300026035 Bacteria 1754
314 Ga0207639_10004828 3300026041 Bacteria 9091
315 Ga0207639_10005470 3300026041 Bacteria 8583
316 Ga0207639_10058471 3300026041 Bacteria 2965
317 Ga0207639_10158117 3300026041 Bacteria 1906
318 Ga0207678_10010709 3300026067 Bacteria 8055
319 Ga0207678_10020027 3300026067 Bacteria 5877
320 Ga0207678_10026116 3300026067 Bacteria 5096
321 Ga0207678_10047784 3300026067 Bacteria 3700
322 Ga0207678_10055282 3300026067 Bacteria 3419
323 Ga0207702_10000002 3300026078 Bacteria 491507
324 Ga0207702_10001708 3300026078 Bacteria 21655
325 Ga0207702_10008470 3300026078 Bacteria 8673
326 Ga0207702_10111571 3300026078 Bacteria 2432
327 Ga0207702_10301380 3300026078 Bacteria 1521
328 Ga0207641_10296379 3300026088 Bacteria 1526
329 Ga0207648_10010213 3300026089 Bacteria 8930
330 Ga0207674_10006543 3300026116 Bacteria 13703
331 Ga0207674_10009969 3300026116 Bacteria 10811
332 Ga0207674_10023678 3300026116 Bacteria 6573
333 Ga0207675_100069671 3300026118 Bacteria 3287
334 Ga0207675_100377031 3300026118 Bacteria 1394
335 Ga0207683_10117952 3300026121 Bacteria 2380
336 Ga0207698_10029719 3300026142 Bacteria 3918
337 Ga0207698_10124851 3300026142 Bacteria 2187
338 Ga0209389_1000001 3300027296 Bacteria 463799
339 Ga0209389_1000014 3300027296 Bacteria 188621
340 Ga0209589_1000011 3300027357 Bacteria 236981
341 Ga0209589_1000020 3300027357 Bacteria 188617
342 Ga0209489_100012 3300027361 Bacteria 236981
343 Ga0209489_100060 3300027361 Bacteria 147091
344 Ga0209489_101114 3300027361 Bacteria 54578
345 Ga0209700_100007 3300027363 Bacteria 454608
346 Ga0209700_100019 3300027363 Bacteria 236981
347 Ga0209179_1002935 3300027512 Bacteria 2382
348 Ga0209588_1005193 3300027671 Bacteria 3717
349 Ga0209813_10006595 3300027866 Bacteria 2873
350 Ga0268266_10014609 3300028379 Bacteria 6747
351 Ga0268266_10055520 3300028379 Bacteria 3405
352 Ga0268266_10163085 3300028379 Bacteria 2018
353 Ga0268266_10200158 3300028379 Bacteria 1828
354 Ga0268265_10017139 3300028380 Bacteria 4991
355 Ga0268264_10000030 3300028381 Bacteria 418542
356 Ga0265337_1007120 3300028556 Bacteria 4223
357 Ga0265319_1017390 3300028563 Bacteria 2734
358 Ga0265334_10007339 3300028573 Bacteria 4730
359 Ga0265323_10001453 3300028653 Bacteria 11630
360 Ga0265336_10000251 3300028666 Bacteria 38092
361 Ga0307517_10000386 3300028786 Bacteria 75442
362 Ga0307515_10017392 3300028794 Bacteria 13100
363 Ga0265338_10000582 3300028800 Bacteria 64301
364 Ga0265324_10011228 3300029957 Bacteria 3419
365 Ga0265330_10007549 3300031235 Bacteria 5291
366 Ga0265330_10009772 3300031235 Bacteria 4545
367 Ga0265332_10047350 3300031238 Bacteria 1850
368 Ga0265325_10015246 3300031241 Bacteria 4325
369 Ga0265339_10012020 3300031249 Bacteria 5306
370 Ga0265339_10016403 3300031249 Bacteria 4416
371 Ga0265339_10065301 3300031249 Bacteria 1951
372 Ga0265331_10046688 3300031250 Bacteria 2087
373 Ga0307513_10216665 3300031456 Bacteria 1740
374 Ga0307509_10029551 3300031507 Bacteria 6080
375 Ga0307509_10099121 3300031507 Bacteria 2956
376 Ga0307508_10023817 3300031616 Bacteria 5559
377 Ga0307508_10078529 3300031616 Bacteria 2881
378 Ga0307508_10099956 3300031616 Bacteria 2495
379 Ga0307508_10100608 3300031616 Bacteria 2485
380 Ga0265314_10010113 3300031711 Bacteria 7906
381 Ga0265314_10017398 3300031711 Bacteria 5645
382 Ga0265342_10002383 3300031712 Bacteria 16284
383 Ga0307516_10010095 3300031730 Bacteria 10442
384 Ga0307516_10038399 3300031730 Bacteria 4779
385 Ga0307516_10180578 3300031730 Bacteria 1844
386 Ga0307516_10183224 3300031730 Bacteria 1826
387 Ga0307415_100150974 3300032126 Bacteria 1788
388 Ga0307510_10017574 3300033180 Bacteria 8432
389 Ga0307510_10055165 3300033180 Bacteria 4153
390 Ga0307510_10151640 3300033180 Bacteria 1935
391 Ga0315911_1000002 3300033442 Bacteria 926833
392 Ga0373926_0034888 3300035083 Bacteria 1783
393 Ga0373934_0007901 3300035086 Bacteria 3958
394 Ga0373936_0014396 3300035113 Bacteria 3023
395 Ga0373953_0000506 3300035117 Bacteria 10848
396 Ga0373954_0000386 3300035118 Bacteria 16413
397 Ga0373954_0014978 3300035118 Bacteria 3462
398 Ga0373956_0005816 3300035119 Bacteria 4931
399 Ga0373956_0013430 3300035119 Bacteria 3406
400 Ga0373943_0002708 3300035170 Bacteria 8046
401 Ga0373943_0040646 3300035170 Bacteria 2246
402 Ga0373946_0005868 3300035171 Bacteria 4447
403 Ga0373946_0020617 3300035171 Bacteria 2549
404 Ga0373955_0000286 3300035172 Bacteria 20971
405 Ga0373955_0059552 3300035172 Bacteria 2103
406 Ga0373931_0005603 3300035691 Bacteria 5822
407 Ga0373935_0001308 3300035692 Bacteria 13756
408 Ga0373927_0018861 3300035695 Bacteria 4526
409 Ga0373927_0053411 3300035695 Bacteria 2614
410 Ga0373927_0094628 3300035695 Bacteria 1941
411 Ga0373933_0000525 3300035724 Bacteria 23898
412 Ga0373933_0000952 3300035724 Bacteria 17650
413 Ga0373947_0012265 3300035725 Bacteria 4910
414 Ga0373947_0042908 3300035725 Bacteria 2700
415 Ga0373947_0196609 3300035725 Bacteria 1318
416 Ga0373937_0001493 3300036401 Bacteria 19622
417 Ga0373925_0007302 3300037068 Bacteria 8072
418 Ga0395899_0058078 3300037312 Bacteria 2854
419 Ga0395900_0001070 3300037418 Bacteria 34841
420 Ga0395898_0005530 3300037466 Bacteria 13635
421 Ga0395898_0017205 3300037466 Bacteria 7384
422 Ga0395898_0038983 3300037466 Bacteria 4705
423 Ga0395898_0096005 3300037466 Bacteria 2848
424 Ga0395898_0147538 3300037466 Bacteria 2251
425 Ga0395905_0007330 3300037471 Bacteria 10988
426 Ga0395905_0102640 3300037471 Bacteria 2685
427 Ga0436364_0042928 3300037853 Bacteria 71182
428 Ga0436364_0108855 3300037853 Bacteria 36564
429 Ga0436364_0346617 3300037853 Bacteria 24321
430 Ga0436364_0817898 3300037853 Bacteria 3234
431 Ga0436364_1343008 3300037853 Bacteria 2668
432 Ga0395901_0014261 3300038443 Bacteria 8091
433 Ga0395901_0015950 3300038443 Bacteria 7653
434 Ga0395901_0124736 3300038443 Bacteria 2706
435 Ga0395901_0129939 3300038443 Bacteria 2647
436 Ga0395901_0185322 3300038443 Bacteria 2183
437 Ga0436365_0064270 3300039437 Bacteria 1714
438 Ga0436365_0161372 3300039437 Bacteria 1921
439 Ga0436365_0234716 3300039437 Bacteria 3747
440 Ga0436365_0369560 3300039437 Bacteria 2372
441 Ga0436365_0383201 3300039437 Bacteria 1661
442 Ga0436365_0677006 3300039437 Bacteria 6765
443 Ga0436365_1301574 3300039437 Bacteria 3498
444 Ga0436365_1424648 3300039437 Bacteria 18159
445 Ga0436360_0078764 3300039438 Bacteria 6661
446 Ga0436360_0466793 3300039438 Bacteria 2383
447 Ga0436361_1169803 3300039447 Bacteria 4792
448 Ga0436363_0383878 3300039450 Bacteria 1576
449 Ga0436363_0693677 3300039450 Bacteria 3554
450 Ga0436362_0187516 3300039453 Bacteria 1755
451 Ga0436362_0618850 3300039453 Bacteria 7570
452 Ga0451841_0603492 3300041498 Bacteria 1342
453 Ga0439459_0021517 3300042438 Bacteria 1240
454 Ga0466972_0000113 3300044658 Bacteria 69042
455 Ga0466966_0000094 3300044684 Bacteria 54427
456 Ga0466961_0000118 3300044693 Bacteria 52882
457 Ga0466961_0134432 3300044693 Bacteria 1550
458 Ga0466970_0058039 3300044765 Bacteria 2071
459 Ga0495592_0001573 3300046454 Bacteria 15952
460 Ga0495592_0021108 3300046454 Bacteria 4952
461 Ga0495592_0041596 3300046454 Bacteria 3444
462 Ga0495592_0059415 3300046454 Bacteria 2816
463 Ga0495592_0118930 3300046454 Bacteria 1861
464 Ga0495592_0184676 3300046454 Bacteria 1418
465 Ga0495603_0030969 3300046455 Bacteria 3221
466 Ga0495603_0082601 3300046455 Bacteria 1882
467 Ga0495590_0034179 3300046457 Bacteria 1776
468 Ga0495629_0000133 3300046459 Bacteria 64806
469 Ga0495629_0010755 3300046459 Bacteria 6656
470 Ga0495629_0018014 3300046459 Bacteria 5061
471 Ga0495629_0048075 3300046459 Bacteria 2991
472 Ga0495638_0007773 3300046460 Bacteria 7657
473 Ga0495638_0092624 3300046460 Bacteria 1819
474 Ga0495641_0003044 3300046461 Bacteria 12816
475 Ga0495651_0009251 3300046462 Bacteria 7559
476 Ga0495653_0001313 3300046463 Bacteria 19271
477 Ga0495653_0081656 3300046463 Bacteria 2388
478 Ga0495580_0006086 3300046472 Bacteria 9874
479 Ga0495580_0172160 3300046472 Bacteria 1497
480 Ga0495582_0000016 3300046473 Bacteria 100714
481 Ga0495582_0013313 3300046473 Bacteria 4529
482 Ga0495605_0031333 3300046474 Bacteria 2717
483 Ga0495639_0000014 3300046475 Bacteria 82866
484 Ga0495639_0031073 3300046475 Bacteria 2376
485 Ga0495662_0000086 3300046476 Bacteria 33465
486 Ga0495664_0004447 3300046477 Bacteria 7671
487 Ga0495664_0007306 3300046477 Bacteria 6130
488 Ga0495664_0145578 3300046477 Bacteria 1437
489 Ga0495594_0000051 3300046499 Bacteria 52030
490 Ga0495594_0112428 3300046499 Bacteria 1536
491 Ga0495607_0103073 3300046501 Bacteria 1525
492 Ga0495606_0016667 3300046507 Bacteria 5590
493 Ga0495608_0003757 3300046511 Bacteria 10900
494 Ga0495616_0026879 3300046513 Bacteria 3057
495 Ga0495616_0049990 3300046513 Bacteria 2093
496 Ga0495616_0090587 3300046513 Bacteria 1448
497 Ga0495618_0114154 3300046514 Bacteria 1729
498 Ga0495628_0004462 3300046516 Bacteria 12408
499 Ga0495628_0007774 3300046516 Bacteria 9242
500 Ga0495628_0010553 3300046516 Bacteria 7841
501 Ga0495628_0184958 3300046516 Bacteria 1575
502 Ga0495643_0019976 3300046522 Bacteria 3869
503 Ga0495648_0001270 3300046524 Bacteria 25160
504 Ga0495648_0022088 3300046524 Bacteria 4391
505 Ga0495666_0020761 3300046526 Bacteria 3252
506 Ga0495652_0008371 3300046529 Bacteria 9446
507 Ga0495652_0036434 3300046529 Bacteria 4278
508 Ga0495652_0056592 3300046529 Bacteria 3329
509 Ga0495652_0121007 3300046529 Bacteria 2088
510 Ga0495665_0000477 3300046531 Bacteria 20160
511 Ga0495640_0001817 3300046533 Bacteria 16924
512 Ga0495640_0007412 3300046533 Bacteria 8626
513 Ga0495640_0011794 3300046533 Bacteria 6706
514 Ga0495640_0015035 3300046533 Bacteria 5832
515 Ga0495587_0000862 3300046536 Bacteria 20057
516 Ga0495587_0008087 3300046536 Bacteria 6782
517 Ga0495609_0026863 3300046538 Bacteria 2634
518 Ga0495609_0077158 3300046538 Bacteria 1459
519 Ga0495597_0025529 3300046542 Bacteria 2720
520 Ga0495645_0024663 3300046543 Bacteria 4364
521 Ga0495645_0099885 3300046543 Bacteria 2064
522 Ga0495622_0006671 3300046557 Bacteria 5354
523 Ga0495622_0012877 3300046557 Bacteria 3878
524 Ga0495667_0000424 3300046559 Bacteria 27001
525 Ga0495667_0015829 3300046559 Bacteria 5098
526 Ga0495667_0058901 3300046559 Bacteria 2521
527 Ga0495656_0002167 3300046615 Bacteria 6489
528 Ga0495668_0019915 3300046616 Bacteria 3860
529 Ga0495668_0080465 3300046616 Bacteria 1788
530 Ga0495634_0003306 3300046642 Bacteria 12988
531 Ga0495634_0006805 3300046642 Bacteria 8651
532 Ga0495625_0061107 3300046660 Bacteria 2667
533 Ga0495625_0070923 3300046660 Bacteria 2446
534 Ga0495635_0000792 3300046663 Bacteria 20615
535 Ga0495635_0002703 3300046663 Bacteria 12140
536 Ga0495635_0005278 3300046663 Bacteria 8985
537 Ga0495635_0026165 3300046663 Bacteria 4063
538 Ga0495659_0011741 3300046664 Bacteria 2825
539 Ga0495657_0001449 3300046675 Bacteria 20519
540 Ga0495657_0013673 3300046675 Bacteria 5978
541 Ga0495657_0022741 3300046675 Bacteria 4486
542 Ga0495599_0000879 3300046678 Bacteria 16765
543 Ga0495599_0013798 3300046678 Bacteria 4999
544 Ga0495599_0048778 3300046678 Bacteria 2655
545 Ga0495623_0002249 3300046679 Bacteria 12858
546 Ga0495646_0002245 3300046680 Bacteria 11802
547 Ga0495646_0032854 3300046680 Bacteria 3227
548 Ga0495646_0105597 3300046680 Bacteria 1609
549 Ga0495658_0001354 3300046683 Bacteria 12855
550 Ga0495658_0044624 3300046683 Bacteria 2485
551 Ga0495658_0048318 3300046683 Bacteria 2399
552 Ga0495613_0006655 3300046689 Bacteria 8632
553 Ga0495613_0024354 3300046689 Bacteria 4510
554 Ga0495624_0000138 3300046690 Bacteria 52220
555 Ga0495624_0010671 3300046690 Bacteria 6327
556 Ga0495671_0053471 3300046692 Bacteria 2004
557 Ga0495649_0042779 3300046694 Bacteria 2474
558 Ga0495600_0000337 3300046809 Bacteria 25017
559 Ga0495600_0005193 3300046809 Bacteria 7827
560 Ga0495600_0151690 3300046809 Bacteria 1500
561 Ga0495581_0000001 3300047315 Bacteria 104278
562 Ga0495581_0023521 3300047315 Bacteria 3570
563 Ga0495581_0081996 3300047315 Bacteria 1868
564 Ga0495604_0001626 3300047317 Bacteria 18533
565 Ga0495604_0017599 3300047317 Bacteria 5722
566 Ga0495604_0169005 3300047317 Bacteria 1539
567 Ga0495674_0002545 3300047319 Bacteria 17760
568 Ga0495674_0018873 3300047319 Bacteria 6414
569 Ga0495674_0145940 3300047319 Bacteria 1986
570 Ga0495674_0311730 3300047319 Bacteria 1284
571 Ga0495672_0007184 3300047320 Bacteria 8418
572 Ga0495672_0031356 3300047320 Bacteria 3319
573 Ga0495676_0003317 3300047321 Bacteria 14549
574 Ga0495676_0143571 3300047321 Bacteria 1708
575 Ga0495680_0002491 3300047322 Bacteria 18828
576 Ga0495680_0005089 3300047322 Bacteria 12405
577 Ga0495680_0156052 3300047322 Bacteria 1660
578 Ga0495687_014891 3300047443 Bacteria 3975
579 Ga0495675_0012328 3300047444 Bacteria 5380
580 Ga0495675_0024995 3300047444 Bacteria 3809
581 Ga0495675_0035435 3300047444 Bacteria 3187
582 Ga0495673_0069111 3300047469 Bacteria 1491
583 Ga0495673_0090619 3300047469 Unclassified 1250
584 Ga0495684_0001407 3300047471 Bacteria 19272
585 Ga0495684_0005971 3300047471 Bacteria 9460
586 Ga0495593_0000003 3300047673 Bacteria 120744
587 Ga0495593_0002446 3300047673 Bacteria 11170
588 Ga0495602_0007241 3300048088 Bacteria 11617
589 Ga0495602_0019961 3300048088 Bacteria 6634
590 Ga0495602_0039312 3300048088 Bacteria 4359
591 Ga0495602_0115379 3300048088 Bacteria 2173
592 Ga0495614_0006055 3300048089 Bacteria 5438
593 Ga0496100_0007585 3300048903 Bacteria 5998
594 Ga0496100_0042150 3300048903 Bacteria 2914
595 Ga0496100_0119453 3300048903 Bacteria 1842
596 Ga0496101_0127876 3300048904 Bacteria 1927
597 Ga0496102_0014231 3300048905 Bacteria 6913
598 Ga0496102_0018355 3300048905 Bacteria 6145
599 Ga0496102_0083203 3300048905 Bacteria 2953
600 Ga0496103_0022816 3300048906 Bacteria 3770
601 Ga0496104_0022932 3300048907 Bacteria 5736
602 Ga0496104_0024758 3300048907 Bacteria 5526
603 Ga0496104_0036043 3300048907 Bacteria 4621
604 Ga0496104_0073880 3300048907 Bacteria 3244
605 Ga0496104_0130155 3300048907 Bacteria 2417
606 Ga0496104_0203556 3300048907 Bacteria 1891
607 Ga0496105_0002092 3300048908 Bacteria 14435
608 Ga0496105_0011739 3300048908 Bacteria 6932
609 Ga0496105_0041425 3300048908 Bacteria 3796
610 Ga0496105_0044963 3300048908 Bacteria 3643
611 Ga0496105_0050731 3300048908 Bacteria 3428
612 Ga0496105_0267569 3300048908 Bacteria 1381
613 Ga0496106_0001202 3300048909 Bacteria 19326
614 Ga0496106_0011446 3300048909 Bacteria 6562
615 Ga0496106_0015453 3300048909 Bacteria 5650
616 Ga0496106_0018182 3300048909 Bacteria 5199
617 Ga0496106_0068108 3300048909 Bacteria 2715
618 Ga0496106_0265684 3300048909 Bacteria 1373
619 Ga0496107_0002624 3300048910 Bacteria 11754
620 Ga0496107_0009825 3300048910 Bacteria 6636
621 Ga0496107_0011885 3300048910 Bacteria 6082
622 Ga0496108_0001960 3300048911 Bacteria 16479
623 Ga0496108_0018478 3300048911 Bacteria 5708
624 Ga0496108_0050815 3300048911 Bacteria 3472
625 Ga0496108_0180764 3300048911 Bacteria 1826
626 Ga0496109_0000432 3300048912 Bacteria 36461
627 Ga0496109_0010188 3300048912 Bacteria 8024
628 Ga0496109_0055955 3300048912 Bacteria 3599
629 Ga0496109_0234299 3300048912 Bacteria 1728
630 Ga0496110_0012555 3300048913 Bacteria 6968
631 Ga0496110_0027219 3300048913 Bacteria 4900
632 Ga0496110_0029803 3300048913 Bacteria 4701
633 Ga0496110_0187050 3300048913 Bacteria 1881
634 Ga0496110_0211027 3300048913 Bacteria 1765
635 Ga0496111_0013188 3300048914 Bacteria 5620
636 Ga0496111_0039393 3300048914 Bacteria 3388
637 Ga0496111_0091744 3300048914 Bacteria 2226
638 Ga0496112_0015915 3300048915 Bacteria 7029
639 Ga0496112_0033682 3300048915 Bacteria 4980
640 Ga0496112_0061568 3300048915 Bacteria 3700
641 Ga0496112_0100707 3300048915 Bacteria 2859
642 Ga0496112_0112903 3300048915 Bacteria 2688
643 Ga0496112_0194315 3300048915 Bacteria 1990
644 Ga0496112_0206592 3300048915 Bacteria 1922
645 Ga0496113_0014649 3300048916 Bacteria 5359
646 Ga0496113_0032600 3300048916 Bacteria 3786
647 Ga0496114_0008432 3300048917 Bacteria 8162
648 Ga0496115_0009310 3300048918 Bacteria 7298
649 Ga0496115_0033310 3300048918 Bacteria 4067
650 Ga0496115_0063699 3300048918 Bacteria 2975
651 Ga0496115_0078069 3300048918 Bacteria 2693
652 Ga0496115_0133099 3300048918 Bacteria 2050
653 Ga0496118_0019947 3300048921 Bacteria 5966
654 Ga0496118_0029396 3300048921 Bacteria 4609
655 Ga0496118_0036940 3300048921 Bacteria 3940
656 Ga0496118_0134801 3300048921 Bacteria 1578
657 Ga0496119_0013953 3300048922 Bacteria 6336
658 Ga0496120_0007436 3300048923 Bacteria 8144
659 Ga0496121_0000041 3300048924 Bacteria 346686
660 Ga0496121_0003563 3300048924 Bacteria 22031
661 Ga0496121_0005352 3300048924 Bacteria 16504
662 Ga0496121_0009890 3300048924 Bacteria 10868
663 Ga0496121_0028205 3300048924 Bacteria 5231
664 Ga0496121_0039020 3300048924 Bacteria 4193
665 Ga0496121_0071909 3300048924 Bacteria 2780
666 Ga0496121_0100982 3300048924 Bacteria 2226
667 Ga0496121_0111107 3300048924 Bacteria 2091
668 Ga0496122_0030990 3300048925 Bacteria 4464
669 Ga0496124_0000624 3300048927 Bacteria 58976
670 Ga0496124_0040676 3300048927 Bacteria 4019
671 Ga0496125_0036744 3300048928 Bacteria 4270
672 Ga0496125_0040200 3300048928 Bacteria 4014
673 Ga0496125_0053440 3300048928 Bacteria 3311
674 Ga0496125_0075947 3300048928 Bacteria 2597
675 Ga0496125_0092232 3300048928 Bacteria 2265
676 Ga0496126_0002321 3300048929 Bacteria 26096
677 Ga0496126_0008801 3300048929 Bacteria 10829
678 Ga0496126_0010022 3300048929 Bacteria 10000
679 Ga0496126_0015516 3300048929 Bacteria 7659
680 Ga0496126_0018293 3300048929 Bacteria 6951
681 Ga0496126_0029558 3300048929 Bacteria 5204
682 Ga0496126_0030071 3300048929 Bacteria 5153
683 Ga0496126_0032840 3300048929 Bacteria 4885
684 Ga0496126_0051884 3300048929 Bacteria 3732
685 Ga0496126_0198822 3300048929 Bacteria 1694
686 Ga0496126_0206653 3300048929 Bacteria 1655
687 Ga0496126_0255689 3300048929 Bacteria 1458
688 Ga0496126_0351501 3300048929 Bacteria 1205
689 Ga0501032_0005102 3300049569 Bacteria 9799
690 Ga0501032_0076754 3300049569 Bacteria 2224
691 Ga0501033_0001834 3300049570 Bacteria 18512
692 Ga0501033_0051989 3300049570 Bacteria 3036
693 Ga0501034_0001471 3300049571 Bacteria 31174
694 Ga0501034_0134384 3300049571 Bacteria 2455
695 Ga0501034_0444984 3300049571 Bacteria 1214
696 Ga0501036_0050117 3300049572 Bacteria 3536
697 Ga0501036_0053755 3300049572 Bacteria 3410
698 Ga0501037_0005747 3300049573 Bacteria 9056
699 Ga0501037_0086729 3300049573 Bacteria 2265
700 Ga0501038_0002435 3300049574 Bacteria 17326
701 Ga0501038_0014916 3300049574 Bacteria 7074
702 Ga0501038_0042310 3300049574 Bacteria 3967
703 Ga0501039_0010117 3300049575 Bacteria 7185
704 Ga0501040_0054616 3300049576 Bacteria 2738
705 Ga0501042_0045227 3300049578 Bacteria 3137
706 Ga0501043_0019449 3300049579 Bacteria 5330
707 Ga0501043_0020212 3300049579 Bacteria 5228
708 Ga0501043_0061463 3300049579 Bacteria 2950
709 Ga0501046_0007012 3300049580 Bacteria 9927
710 Ga0501046_0073620 3300049580 Bacteria 2651
711 Ga0501046_0075087 3300049580 Bacteria 2621
712 Ga0501047_0014876 3300049581 Bacteria 7407
713 Ga0501047_0082968 3300049581 Bacteria 3081
714 Ga0501047_0140691 3300049581 Bacteria 2292
715 Ga0501048_0006412 3300049582 Bacteria 8942
716 Ga0501068_0024706 3300049584 Bacteria 3529
717 Ga0501074_0149427 3300049590 Bacteria 1670
718 Ga0501076_0100259 3300049592 Bacteria 2333
719 Ga0501079_0236102 3300049741 Bacteria 1428
720 Ga0501080_0088666 3300049742 Bacteria 2874
721 Ga0501080_0108978 3300049742 Bacteria 2566
722 Ga0501080_0130979 3300049742 Bacteria 2322
723 Ga0501035_0002268 3300049822 Bacteria 18995
724 Ga0501035_0026433 3300049822 Bacteria 5310
725 Ga0501035_0055661 3300049822 Bacteria 3531
726 Ga0501044_0007852 3300049823 Bacteria 11732
727 Ga0501044_0020966 3300049823 Bacteria 6978
728 Ga0501044_0060417 3300049823 Bacteria 3881
729 Ga0501045_0032361 3300049824 Bacteria 3789
730 nmdc:mga0yw44_23996_c1 3300050492 Bacteria 3444
731 nmdc:mga0yw44_31714_c1 3300050492 Bacteria 3075
732 nmdc:mga0yw44_5423_c1 3300050492 Bacteria 6024
733 nmdc:mga06z11_27907_c1 3300050494 Bacteria 2703
734 nmdc:mga0rr50_147154_c1 3300050513 Bacteria 1900
735 nmdc:mga0a205_317757_c1 3300050515 Bacteria 1428
736 nmdc:mga0sz30_14368_c1 3300050516 Bacteria 1556
737 nmdc:mga0sz30_64384_c1 3300050516 Bacteria 1570
738 Ga0495601_0054028 3300053077 Bacteria 2540
739 Ga0495601_0112208 3300053077 Bacteria 1766
740 Ga0500635_0015520 3300053080 Bacteria 2251
741 Ga0495595_0001668 3300053084 Bacteria 8691
742 Ga0495595_0003281 3300053084 Bacteria 6426
743 Ga0495595_0011648 3300053084 Bacteria 3680
744 Ga0495619_0025449 3300053085 Bacteria 3801
745 Ga0495619_0076189 3300053085 Bacteria 2251
746 Ga0495619_0159548 3300053085 Bacteria 1557
747 Ga0500643_001180 3300053087 Bacteria 15589
748 Ga0500647_0036075 3300053091 Bacteria 2363
749 Ga0500647_0095598 3300053091 Bacteria 1421
750 Ga0500583_0079752 3300053092 Bacteria 1579
751 Ga0500566_0000062 3300053094 Bacteria 51144
752 Ga0500566_0000112 3300053094 Bacteria 41687
753 Ga0500566_0002624 3300053094 Bacteria 10704
754 Ga0500640_000394 3300053095 Bacteria 10451
755 Ga0500554_001136 3300053102 Bacteria 5151
756 Ga0500556_0000750 3300053104 Bacteria 19347
757 Ga0500557_000003 3300053105 Bacteria 228429
758 Ga0500562_023587 3300053108 Bacteria 1606
759 Ga0500572_000239 3300053111 Bacteria 19483
760 Ga0500572_000775 3300053111 Bacteria 10244
761 Ga0500591_066690 3300053115 Bacteria 1642
762 Ga0500595_017745 3300053119 Bacteria 2620
763 Ga0500595_031296 3300053119 Bacteria 1786
764 Ga0500614_021021 3300053123 Bacteria 1511
765 Ga0500642_0002011 3300053130 Bacteria 5902
766 Ga0500642_0025721 3300053130 Bacteria 2394
767 Ga0500642_0121700 3300053130 Bacteria 1221
768 Ga0500559_0001790 3300053136 Bacteria 11801
769 Ga0500559_0004994 3300053136 Bacteria 6162
770 Ga0500603_001625 3300053150 Bacteria 5069
771 Ga0500616_0006635 3300053153 Bacteria 7533
772 Ga0500622_0025785 3300053156 Bacteria 3104
773 Ga0500627_0051117 3300053158 Bacteria 1802
774 Ga0500630_003625 3300053159 Bacteria 7477
775 Ga0500638_001061 3300053162 Bacteria 8066
776 Ga0500639_000061 3300053163 Bacteria 49500
777 Ga0500636_0000284 3300053177 Bacteria 28033
778 Ga0500636_0023548 3300053177 Bacteria 3640
779 Ga0500637_0000098 3300053178 Bacteria 31362
780 Ga0500625_000220 3300053729 Bacteria 13001
781 Ga0500596_000699 3300053735 Bacteria 6539
782 Ga0500596_000998 3300053735 Bacteria 5669
783 Ga0500596_003937 3300053735 Bacteria 2773
784 Ga0500601_000233 3300053737 Bacteria 10949
785 Ga0500601_001561 3300053737 Bacteria 2483
786 Ga0501084_0076301 3300054114 Bacteria 2809
787 2507507555 2507262055 Bacteria 8048963
788 2508541673 2508501009 Bacteria 7784016
789 2508692788 2508501042 Bacteria 8719808
790 2509152953 2508501128 Bacteria 8613869
791 2511394850 2511231028 Bacteria 8046582
792 2513621750 2513237092 Bacteria 8341956
793 2513636808 2513237094 Bacteria 8789602
794 2513651250 2513237095 Bacteria 8976980
795 2513654195 2513237096 Bacteria 8722461
796 2513674875 2513237098 Bacteria 9902361
797 2513697138 2513237101 Bacteria 7952346
798 2513704455 2513237102 Bacteria 7703324
799 2513720784 2513237104 Bacteria 10034502
800 2513856950 2513237137 Bacteria 9558895
801 2513878752 2513237139 Bacteria 8737671
802 2513894154 2513237141 Bacteria 8496279
803 2513918535 2513237145 Bacteria 8979722
804 2514011818 2513237161 Bacteria 8871253
805 2517104275 2517093001 Bacteria 9002274
806 2517891229 2517572143 Bacteria 9484767
807 2524468253 2524023210 Bacteria 9029266
808 2524533576 2524023228 Bacteria 10118060
809 2528848869 2528768022 Bacteria 10457665
810 2530646710 2529292951 Bacteria 6916614
811 2563055992 2562617112 Bacteria 10918404
812 2617346909 2617270735 Bacteria 9163226
813 2617372839 2617270741 Bacteria 8201522
814 2671123164 2667528175 Bacteria 7532676
815 2713472194 2711768613 Bacteria 11048459
816 2723843588 2721755755 Bacteria 8322773
817 2728749927 2728368998 Bacteria 8720350
818 2745080874 2744054633 Bacteria 8678936
819 2793060982 2791355196 Bacteria 7323613
820 2793066584 2791355197 Bacteria 8420563
821 2793083894
822 2805921401 2802429603 Bacteria 8777136
823 2818236671 2816332527 Bacteria 8933356
824 2824602891 2824600985 Bacteria 8488197
825 2824611886 2824609381 Bacteria 8672835
826 2824621477 2824617872 Bacteria 8814715
827 2824630589 2824626560 Bacteria 8813858
828 2824638707 2824635225 Bacteria 8785348
829 2824650098 2824644064 Bacteria 8743947
830 2824660923 2824653114 Bacteria 8493680
831 2824664500 2824661429 Bacteria 9877870
832 2824672213 2824671348 Bacteria 8369588
833 2824682162 2824679649 Bacteria 8248951
834 2824688904 2824687955 Bacteria 8360029
835 2824697741 2824696289 Bacteria 8335049
836 2824709247 2824704595 Bacteria 9667483
837 2824719056 2824714736 Bacteria 8717648
838 2824730391 2824723954 Bacteria 8758240
839 2824733921 2824732956 Bacteria 7810675
840 2824748354 2824746037 Bacteria 7911610
841 2824758020 2824753945 Bacteria 9787441
842 2824766445 2824763712 Bacteria 9792355
843 2824776572 2824773399 Bacteria 8360218
844 2838129330 2838122688 Bacteria 8803140
845 2841948014 2841941048 Bacteria 8688029
846 2841953588 2841949485 Bacteria 8680857
847 2841962805 2841957949 Bacteria 8652217
848 2841973007 2841966195 Bacteria 8673214
849 2841978315 2841974524 Bacteria 8931498
850 2841990535 2841983080 Bacteria 8395090
851 2842040756 2842038055 Bacteria 8002051
852 2842046298 2842045827 Bacteria 8006841
853 2844320136 2844315083 Bacteria 8138177
854 2847933258 2847930680 Bacteria 9342022
855 2847937431 2847930680 Bacteria 9342022
856 2847947855 2847939898 Bacteria 8606328
857 2849078290 2849076700 Bacteria 7039503
858 2857512666 2857509624 Bacteria 7472071
859 2874598670 2874590934 Bacteria 8299676
860 2874607203 2874604998 Bacteria 7834745
861 2874614456 2874612657 Bacteria 8252029
862 2874628187 2874620515 Bacteria 8290088
863 2874630210 2874628541 Bacteria 8630250
864 2874652125 2874645413 Bacteria 8214782
865 2876768198 2876761206 Bacteria 10111113
866 2876778709 2876771140 Bacteria 8287509
867 2876818316 2876808645 Bacteria 8824342
868 2876823513 2876818435 Bacteria 8274608
869 2879082502 2879074833 Bacteria 8279565
870 2879107821 2879099564 Bacteria 10442239
871 2879114093 2879110137 Bacteria 8907982
872 2879131718 2879127579 Bacteria 8294491
873 2879150054 2879142872 Bacteria 8267021
874 2881371350 2881364244 Bacteria 7710352
875 2881672204 2881665667 Bacteria 8175609
876 2885370076 2885366525 Bacteria 8326213
877 2885383123 2885374607 Bacteria 8927485
878 2885391947 2885383462 Bacteria 9473874
879 2885415622 2885409591 Bacteria 9235467
880 2888385573 2888378607 Bacteria 9652610
881 2888392676 2888388044 Bacteria 7304136
882 2888425703 2888419890 Bacteria 7857137
883 2889037906 2889033259 Bacteria 9099371
884 2903731270 2903727486 Bacteria 8281579
885 2903753330 2903748898 Bacteria 9972761
886 2903774854 2903768456 Bacteria 9749579
887 2904674195 2904666416 Bacteria 8226587
888 2904694150 2904690495 Bacteria 9412302
889 2904701134
890 2904711857 2904711408 Bacteria 9771557
891 2906609961 2906602504 Bacteria 8295279
892 2906616413
893 2906627716 2906626472 Bacteria 8826946
894 2906638132 2906635258 Bacteria 8601019
895 2906649617 2906643746 Bacteria 8722424
896 2906662807 2906660503 Bacteria 8595048
897 2908741558 2908739725 Bacteria 8628932
898 2908758996 2908756301 Bacteria 8864324
899 2908781286 2908775508 Bacteria 8092255
900 2922361843 2922361189 Bacteria 7436256
901 2922372293
902 2922386925 2922386360 Bacteria 7017218
903 2922396961 2922393267 Bacteria 8285685
904 2922431582
905 2929621141 2929615660 Bacteria 9193770
906 2929626028 2929624759 Bacteria 9339455
907 2932785092 2932784394 Bacteria 9704911
908 2932795036 2932794094 Bacteria 7915132
909 2932805564 2932801729 Bacteria 7987968
910 2932810120 2932809354 Bacteria 9135765
911 2932821693 2932818245 Bacteria 9955613
912 2932828929 2932828146 Bacteria 9745859
913 2933582990 2933577622 Bacteria 9116884
914 2935609938 2935608549 Bacteria 8203142
915 2935619652 2935616580 Bacteria 9032984
916 2935636117 2935630451 Bacteria 8169952
917 2935638147 2935630451 Bacteria 8169952
918 2935638632 2935638405 Bacteria 10015038
919 2935652031 2935648319 Bacteria 8801166
920 2935659996 2935656913 Bacteria 8965014
921 2935666516 2935665750 Bacteria 9571747
922 2935676441 2935675223 Bacteria 9928132
923 2935691043 2935684952 Bacteria 9590419
924 2935694523 2935694250 Bacteria 9291695
925 2935703638 2935703347 Bacteria 10242284
926 2935718424 2935713505 Bacteria 9608509
927 2935727596 2935722832 Bacteria 9608746
928 2935736299 2935732158 Bacteria 9706831
929 2935745679 2935741537 Bacteria 9707219
930 2935756060 2935750917 Bacteria 9590372
931 2935760680 2935760218 Bacteria 9817913
932 2935776097 2935769743 Bacteria 7878163
933 2935785148 2935777560 Bacteria 8077691
934 2935791890 2935785616 Bacteria 7962367
935 2935800300 2935793552 Bacteria 8012592
936 2935801776 2935801545 Bacteria 9301974
937 2935814809 2935810662 Bacteria 9401221
938 2935823098 2935819856 Bacteria 8261050
939 2935827761 2935819856 Bacteria 8261050
940 2935828126 2935827899 Bacteria 10038562
941 2935842331 2935837841 Bacteria 9454360
942 2935848680 2935847175 Bacteria 8228321
943 2935855075 2935847175 Bacteria 8228321
944 2935858033 2935855204 Bacteria 9035059
945 2935867937 2935864058 Bacteria 9784707
946 2935874039 2935873716 Bacteria 9632195
947 2935885765 2935883170 Bacteria 7964738
948 2935909515 2935908558 Bacteria 8568796
949 2935917239 2935916978 Bacteria 9113783
950 2935926996 2935926038 Bacteria 8601059
951 2935937160 2935934488 Bacteria 8602579
952 2935944537 2935942939 Bacteria 8599779
953 2935952974 2935951376 Bacteria 8602333
954 2935962833 2935959822 Bacteria 7869783
955 2935969814 2935967501 Bacteria 8603075
956 2935976411 2935975950 Bacteria 8347125
957 2935987141 2935984226 Bacteria 8302647
958 2935993036 2935992306 Bacteria 9802711
959 2936002948 2936002035 Bacteria 9362176
960 2936014412 2936011229 Bacteria 8801034
961 2936023748 2936019824 Bacteria 8804134
962 2936031391 2936028420 Bacteria 8965941
963 2936040548 2936037263 Bacteria 9446081
964 2936049518 2936046547 Bacteria 8903709
965 2936061266 2936055302 Bacteria 8785755
966 2940561965 2940556831 Bacteria 9590747
967 2941512748 2941507105 Bacteria 8166816
968 2941514780 2941507105 Bacteria 8166816
969 2941520685 2941515067 Bacteria 8166720
970 2941522762 2941515067 Bacteria 8166720
971 2941528699 2941523033 Bacteria 8169134
972 2941530673 2941523033 Bacteria 8169134
973 2941531318 2941531003 Bacteria 7653939
974 2941542380 2941538514 Bacteria 9402094
975 3005481375 3005474847 Bacteria 9259049
976 3005485515 3005483717 Bacteria 7877331
977 3005508329 3005506211 Bacteria 6943378
978 3005588171 3005587118 Bacteria 7794411
979 3005600435 3005594810 Bacteria 8716512
980 3005715916 3005710791 Bacteria 7622528
981 3005723271 3005718088 Bacteria 8283608
982 8006933195 8006926726 Bacteria 6749210
983 8006939332 8006933436 Bacteria 10410654
984 8006968863 8006964411 Bacteria 8966052
985 8006978989 8006973647 Bacteria 10679141
986 8006984543 8006984368 Bacteria 9651211
987 8006997169 8006994254 Bacteria 8309700
988 8016520534 8016511872 Bacteria 9921665
989 8016528575 8016522445 Bacteria 8156687
990 8016555150 8016548790 Bacteria 8155074
991 8016563519 8016557553 Bacteria 8154380
992 8016572076 8016566248 Bacteria 8158151
993 8016594487 8016583857 Bacteria 10421953
994 8016601259 8016595262 Bacteria 8149947
995 8016609174 8016603502 Bacteria 8731218
996 8016615728 8016613128 Bacteria 8794220
997 8016625500 8016622563 Bacteria 7999408
998 8016639056 8016630954 Bacteria 9217207
999 8017065041 8017057580 Bacteria 10023680
1000 8019533520 8019530166 Bacteria 8155624
1001 8019546157 8019538911 Bacteria 7872763
1002 8019552550 8019547302 Bacteria 7996444
1003 8019575303 8019565922 Bacteria 9639779
1004 8019592197 8019586578 Bacteria 10212056
1005 8019599087 8019597564 Bacteria 10041141
1006 8019609273 8019608314 Bacteria 10042931
1007 8019633182 8019629233 Bacteria 8687553
1008 8019646714 8019638758 Bacteria 9062356
1009 8019649487 8019648815 Bacteria 10014479
1010 8019661057 8019659431 Bacteria 8577854
1011 8019670621 8019668869 Bacteria 8791617
1012 8019685614 8019678201 Bacteria 8863603
1013 8019691185 8019687851 Bacteria 8712826
1014 8055744997 8055742211 Bacteria 9226248
1015 8056677519 8056673599 Bacteria 7871253
1016 8056687300 8056681323 Bacteria 8472857
1017 8056690686 8056689827 Bacteria 6712655
1018 8056974950 8056967851 Bacteria 9038162
1019 Ga0070711_100013974
1020 JGI24740J21852_10004915
1021 JGI24739J22299_10002391
1022 JGI24737J22298_10008032
1023 JGI25153J46596_10005337
1024 rootL2_10160148
1025 JGI25160J50197_1011835
1026 JGI25404J52841_10009163
1027 Ga0055531_10006567
1028 Ga0055543_1000462
1029 Ga0055543_1001763
1030 Ga0065165_1000799
1031 Ga0065165_1002416
1032 Ga0065165_1002642
1033 Ga0065165_1006433
1034 Ga0070658_10048283
1035 Ga0070683_100005122
1036 Ga0070680_100009353
1037 Ga0070680_100162926
1038 Ga0068868_100053615
1039 Ga0070660_100018873
1040 Ga0070668_100026976
1041 Ga0070668_100082935
1042 Ga0070668_100229075
1043 Ga0070675_100167579
1044 Ga0070671_100019025
1045 Ga0070671_100154588
1046 Ga0070674_100011327
1047 Ga0070673_100042244
1048 Ga0070688_100028924
1049 Ga0070659_100065131
1050 Ga0070667_100053462
1051 Ga0070709_10001228
1052 Ga0070709_10115955
1053 Ga0070709_10160673
1054 Ga0070714_100006930
1055 Ga0070714_100012311
1056 Ga0070714_100083680
1057 Ga0070714_100264909
1058 Ga0070713_100019837
1059 Ga0070713_100099622
1060 Ga0070713_100155497
1061 Ga0070713_100252074
1062 Ga0070713_100340281
1063 Ga0070710_10000929
1064 Ga0070711_100005942
1065 Ga0070711_100015536
1066 Ga0070711_100039484
1067 Ga0070711_100043582
1068 Ga0070711_100072675
1069 Ga0070663_100008307
1070 Ga0070663_100010106
1071 Ga0070663_100015280
1072 Ga0070663_100035288
1073 Ga0070663_100080401
1074 Ga0070662_100010158
1075 Ga0070681_10037204
1076 Ga0070681_10076829
1077 Ga0070681_10088746
1078 Ga0070681_10094083
1079 Ga0070707_100312288
1080 Ga0070699_100171307
1081 Ga0070679_100032475
1082 Ga0070679_100058920
1083 Ga0070679_100094456
1084 Ga0070684_100015626
1085 Ga0070684_100017917
1086 Ga0070684_100033654
1087 Ga0068853_100007930
1088 Ga0068853_100022387
1089 Ga0068853_100137259
1090 Ga0068853_100210070
1091 Ga0068853_100268660
1092 Ga0070665_100016320
1093 Ga0070665_100051187
1094 Ga0068855_100012869
1095 Ga0068855_100021640
1096 Ga0068855_100059343
1097 Ga0068857_100015877
1098 Ga0068857_100050153
1099 Ga0068856_100001803
1100 Ga0068856_100001867
1101 Ga0068856_100019754
1102 Ga0068852_100014573
1103 Ga0068852_100063882
1104 Ga0068859_100053671
1105 Ga0068851_10000250
1106 Ga0068851_10042123
1107 Ga0068863_100231921
1108 Ga0068863_100294077
1109 Ga0068858_100018788
1110 Ga0068860_100005407
1111 Ga0068860_100123813
1112 Ga0068862_100057926
1113 Ga0081455_10002800
1114 Ga0081455_10008855
1115 Ga0081455_10037499
1116 Ga0081455_10056307
1117 Ga0081455_10061238
1118 Ga0081455_10108720
1119 Ga0081540_1000178
1120 Ga0081540_1001968
1121 Ga0081540_1011207
1122 Ga0081540_1012098
1123 Ga0081540_1018972
1124 Ga0081540_1019008
1125 Ga0081540_1021450
1126 Ga0081540_1021620
1127 Ga0081540_1040971
1128 Ga0081540_1043139
1129 Ga0081539_10000220
1130 Ga0070717_10005875
1131 Ga0070717_10012278
1132 Ga0070717_10058625
1133 Ga0070717_10094177
1134 Ga0075365_10018146
1135 Ga0075368_10011128
1136 Ga0075363_100018753
1137 Ga0075363_100072104
1138 Ga0070715_10003054
1139 Ga0070716_100004705
1140 Ga0070716_100012347
1141 Ga0070712_100005481
1142 Ga0070712_100006535
1143 Ga0070712_100044651
1144 Ga0070712_100054530
1145 Ga0075370_10003000
1146 Ga0075370_10042424
1147 Ga0068871_100080431
1148 Ga0097620_100053665
1149 Ga0099825_1030562
1150 Ga0099824_1004802
1151 Ga0099824_1020023
1152 Ga0099822_1001244
1153 Ga0099823_1042587
1154 Ga0099794_10005646
1155 Ga0099794_10007699
1156 Ga0099794_10101182
1157 Ga0099795_10002778
1158 Ga0105240_10016329
1159 Ga0105240_10016971
1160 Ga0105240_10075310
1161 Ga0111539_10083826
1162 Ga0111539_10135696
1163 Ga0105245_10051090
1164 Ga0105245_10171978
1165 Ga0105245_10310676
1166 Ga0105247_10033772
1167 Ga0114129_10090903
1168 Ga0105243_10142575
1169 Ga0105241_10005015
1170 Ga0105241_10039748
1171 Ga0105241_10085631
1172 Ga0105248_10077527
1173 Ga0105248_10078907
1174 Ga0105248_10244393
1175 Ga0105248_10267166
1176 Ga0105237_10037283
1177 Ga0105237_10058475
1178 Ga0105237_10064196
1179 Ga0105237_10205408
1180 Ga0105238_10002659
1181 Ga0105238_10006063
1182 Ga0105238_10009836
1183 Ga0105238_10298165
1184 Ga0105238_10407541
1185 Ga0099796_10011117
1186 Ga0099796_10013869
1187 Ga0105239_10003585
1188 Ga0105239_10003896
1189 Ga0105239_10017767
1190 Ga0105239_10021644
1191 Ga0105239_10027720
1192 Ga0105239_10059197
1193 Ga0105239_10103968
1194 Ga0105239_10431802
1195 Ga0105246_10027867
1196 Ga0157373_10052924
1197 Ga0157370_10059165
1198 Ga0157370_10202043
1199 Ga0157369_10030087
1200 Ga0157369_10047249
1201 Ga0157374_10087900
1202 Ga0157374_10199027
1203 Ga0157378_10004346
1204 Ga0157378_10078233
1205 Ga0163162_10069584
1206 Ga0157375_10054992
1207 Ga0157375_10121305
1208 Ga0157375_10214264
1209 Ga0163163_10052220
1210 Ga0163163_10160664
1211 Ga0163163_10185491
1212 Ga0157377_10015118
1213 Ga0157379_10026231
1214 Ga0157379_10287761
1215 Ga0157376_10037246
1216 Ga0163161_10039459
1217 Ga0197907_10707499
1218 Ga0214544_1000001
1219 Ga0214542_1000037
1220 Ga0214542_1000879
1221 Ga0214545_1000003
1222 Ga0214543_1000002
1223 Ga0213874_10003673
1224 Ga0213876_10005607
1225 Ga0213875_10000382
1226 Ga0213875_10000390
1227 Ga0213875_10003220
1228 Ga0213871_10003817
1229 Ga0209148_1000462
1230 Ga0209233_1002214
1231 Ga0209455_1009328
1232 Ga0209455_1014740
1233 Ga0209564_1005201
1234 Ga0209758_1000011
1235 Ga0209758_1000845
1236 Ga0209758_1003253
1237 Ga0209758_1008620
1238 Ga0209758_1032205
1239 Ga0209256_1008471
1240 Ga0209256_1012600
1241 Ga0207426_1000228
1242 Ga0207426_1000270
1243 Ga0207426_1000292
1244 Ga0207426_1010723
1245 Ga0209257_1001242
1246 Ga0209257_1018129
1247 Ga0207656_10029312
1248 Ga0207653_10032516
1249 Ga0207692_10001555
1250 Ga0207692_10029149
1251 Ga0207688_10031893
1252 Ga0207647_10000496
1253 Ga0207647_10017643
1254 Ga0207699_10000605
1255 Ga0207699_10002358
1256 Ga0207699_10008980
1257 Ga0207699_10063547
1258 Ga0207705_10097865
1259 Ga0207705_10158797
1260 Ga0207654_10000634
1261 Ga0207707_10002844
1262 Ga0207707_10007520
1263 Ga0207707_10008335
1264 Ga0207707_10133882
1265 Ga0207707_10161806
1266 Ga0207695_10000006
1267 Ga0207695_10000008
1268 Ga0207695_10002936
1269 Ga0207695_10011660
1270 Ga0207695_10046333
1271 Ga0207695_10068273
1272 Ga0207695_10089987
1273 Ga0207671_10060370
1274 Ga0207671_10088927
1275 Ga0207693_10000085
1276 Ga0207693_10005576
1277 Ga0207693_10009623
1278 Ga0207693_10020299
1279 Ga0207693_10059873
1280 Ga0207693_10060930
1281 Ga0207693_10070878
1282 Ga0207693_10264604
1283 Ga0207663_10000739
1284 Ga0207663_10003946
1285 Ga0207663_10009965
1286 Ga0207660_10023909
1287 Ga0207660_10068885
1288 Ga0207662_10106494
1289 Ga0207657_10003303
1290 Ga0207657_10016929
1291 Ga0207649_10027939
1292 Ga0207652_10026123
1293 Ga0207652_10045400
1294 Ga0207652_10115771
1295 Ga0207646_10258566
1296 Ga0207694_10000119
1297 Ga0207694_10003295
1298 Ga0207694_10005677
1299 Ga0207694_10180364
1300 Ga0207694_10241511
1301 Ga0207687_10018479
1302 Ga0207687_10062646
1303 Ga0207687_10076825
1304 Ga0207700_10003531
1305 Ga0207700_10011210
1306 Ga0207700_10011837
1307 Ga0207700_10045438
1308 Ga0207700_10069649
1309 Ga0207664_10005139
1310 Ga0207664_10159233
1311 Ga0207644_10155132
1312 Ga0207690_10164031
1313 Ga0207706_10041553
1314 Ga0207665_10000066
1315 Ga0207665_10004190
1316 Ga0207665_10042629
1317 Ga0207665_10209318
1318 Ga0207691_10059114
1319 Ga0207689_10013332
1320 Ga0207661_10000917
1321 Ga0207661_10023556
1322 Ga0207661_10046472
1323 Ga0207667_10003981
1324 Ga0207667_10021239
1325 Ga0207667_10033464
1326 Ga0207667_10201110
1327 Ga0207651_10207135
1328 Ga0207677_10098362
1329 Ga0207703_10026127
1330 Ga0207703_10128295
1331 Ga0207703_10205158
1332 Ga0207639_10004828
1333 Ga0207639_10005470
1334 Ga0207639_10058471
1335 Ga0207639_10158117
1336 Ga0207678_10010709
1337 Ga0207678_10020027
1338 Ga0207678_10026116
1339 Ga0207678_10047784
1340 Ga0207678_10055282
1341 Ga0207702_10000002
1342 Ga0207702_10001708
1343 Ga0207702_10008470
1344 Ga0207702_10111571
1345 Ga0207702_10301380
1346 Ga0207641_10296379
1347 Ga0207648_10010213
1348 Ga0207674_10006543
1349 Ga0207674_10009969
1350 Ga0207674_10023678
1351 Ga0207675_100069671
1352 Ga0207675_100377031
1353 Ga0207683_10117952
1354 Ga0207698_10029719
1355 Ga0207698_10124851
1356 Ga0209389_1000001
1357 Ga0209389_1000014
1358 Ga0209589_1000011
1359 Ga0209589_1000020
1360 Ga0209489_100012
1361 Ga0209489_100060
1362 Ga0209489_101114
1363 Ga0209700_100007
1364 Ga0209700_100019
1365 Ga0209179_1002935
1366 Ga0209588_1005193
1367 Ga0209813_10006595
1368 Ga0268266_10014609
1369 Ga0268266_10055520
1370 Ga0268266_10163085
1371 Ga0268266_10200158
1372 Ga0268265_10017139
1373 Ga0268264_10000030
1374 Ga0265337_1007120
1375 Ga0265319_1017390
1376 Ga0265334_10007339
1377 Ga0265323_10001453
1378 Ga0265336_10000251
1379 Ga0307517_10000386
1380 Ga0307515_10017392
1381 Ga0265338_10000582
1382 Ga0265324_10011228
1383 Ga0265330_10007549
1384 Ga0265330_10009772
1385 Ga0265332_10047350
1386 Ga0265325_10015246
1387 Ga0265339_10012020
1388 Ga0265339_10016403
1389 Ga0265339_10065301
1390 Ga0265331_10046688
1391 Ga0307513_10216665
1392 Ga0307509_10029551
1393 Ga0307509_10099121
1394 Ga0307508_10023817
1395 Ga0307508_10078529
1396 Ga0307508_10099956
1397 Ga0307508_10100608
1398 Ga0265314_10010113
1399 Ga0265314_10017398
1400 Ga0265342_10002383
1401 Ga0307516_10010095
1402 Ga0307516_10038399
1403 Ga0307516_10180578
1404 Ga0307516_10183224
1405 Ga0307415_100150974
1406 Ga0307510_10017574
1407 Ga0307510_10055165
1408 Ga0307510_10151640
1409 Ga0315911_1000002
1410 Ga0373926_0034888
1411 Ga0373934_0007901
1412 Ga0373936_0014396
1413 Ga0373953_0000506
1414 Ga0373954_0000386
1415 Ga0373954_0014978
1416 Ga0373956_0005816
1417 Ga0373956_0013430
1418 Ga0373943_0002708
1419 Ga0373943_0040646
1420 Ga0373946_0005868
1421 Ga0373946_0020617
1422 Ga0373955_0000286
1423 Ga0373955_0059552
1424 Ga0373931_0005603
1425 Ga0373935_0001308
1426 Ga0373927_0018861
1427 Ga0373927_0053411
1428 Ga0373927_0094628
1429 Ga0373933_0000525
1430 Ga0373933_0000952
1431 Ga0373947_0012265
1432 Ga0373947_0042908
1433 Ga0373947_0196609
1434 Ga0373937_0001493
1435 Ga0373925_0007302
1436 Ga0395899_0058078
1437 Ga0395900_0001070
1438 Ga0395898_0005530
1439 Ga0395898_0017205
1440 Ga0395898_0038983
1441 Ga0395898_0096005
1442 Ga0395898_0147538
1443 Ga0395905_0007330
1444 Ga0395905_0102640
1445 Ga0436364_0042928
1446 Ga0436364_0108855
1447 Ga0436364_0346617
1448 Ga0436364_0817898
1449 Ga0436364_1343008
1450 Ga0395901_0014261
1451 Ga0395901_0015950
1452 Ga0395901_0124736
1453 Ga0395901_0129939
1454 Ga0395901_0185322
1455 Ga0436365_0064270
1456 Ga0436365_0161372
1457 Ga0436365_0234716
1458 Ga0436365_0369560
1459 Ga0436365_0383201
1460 Ga0436365_0677006
1461 Ga0436365_1301574
1462 Ga0436365_1424648
1463 Ga0436360_0078764
1464 Ga0436360_0466793
1465 Ga0436361_1169803
1466 Ga0436363_0383878
1467 Ga0436363_0693677
1468 Ga0436362_0187516
1469 Ga0436362_0618850
1470 Ga0451841_0603492
1471 Ga0439459_0021517
1472 Ga0466972_0000113
1473 Ga0466966_0000094
1474 Ga0466961_0000118
1475 Ga0466961_0134432
1476 Ga0466970_0058039
1477 Ga0495592_0001573
1478 Ga0495592_0021108
1479 Ga0495592_0041596
1480 Ga0495592_0059415
1481 Ga0495592_0118930
1482 Ga0495592_0184676
1483 Ga0495603_0030969
1484 Ga0495603_0082601
1485 Ga0495590_0034179
1486 Ga0495629_0000133
1487 Ga0495629_0010755
1488 Ga0495629_0018014
1489 Ga0495629_0048075
1490 Ga0495638_0007773
1491 Ga0495638_0092624
1492 Ga0495641_0003044
1493 Ga0495651_0009251
1494 Ga0495653_0001313
1495 Ga0495653_0081656
1496 Ga0495580_0006086
1497 Ga0495580_0172160
1498 Ga0495582_0000016
1499 Ga0495582_0013313
1500 Ga0495605_0031333
1501 Ga0495639_0000014
1502 Ga0495639_0031073
1503 Ga0495662_0000086
1504 Ga0495664_0004447
1505 Ga0495664_0007306
1506 Ga0495664_0145578
1507 Ga0495594_0000051
1508 Ga0495594_0112428
1509 Ga0495607_0103073
1510 Ga0495606_0016667
1511 Ga0495608_0003757
1512 Ga0495616_0026879
1513 Ga0495616_0049990
1514 Ga0495616_0090587
1515 Ga0495618_0114154
1516 Ga0495628_0004462
1517 Ga0495628_0007774
1518 Ga0495628_0010553
1519 Ga0495628_0184958
1520 Ga0495643_0019976
1521 Ga0495648_0001270
1522 Ga0495648_0022088
1523 Ga0495666_0020761
1524 Ga0495652_0008371
1525 Ga0495652_0036434
1526 Ga0495652_0056592
1527 Ga0495652_0121007
1528 Ga0495665_0000477
1529 Ga0495640_0001817
1530 Ga0495640_0007412
1531 Ga0495640_0011794
1532 Ga0495640_0015035
1533 Ga0495587_0000862
1534 Ga0495587_0008087
1535 Ga0495609_0026863
1536 Ga0495609_0077158
1537 Ga0495597_0025529
1538 Ga0495645_0024663
1539 Ga0495645_0099885
1540 Ga0495622_0006671
1541 Ga0495622_0012877
1542 Ga0495667_0000424
1543 Ga0495667_0015829
1544 Ga0495667_0058901
1545 Ga0495656_0002167
1546 Ga0495668_0019915
1547 Ga0495668_0080465
1548 Ga0495634_0003306
1549 Ga0495634_0006805
1550 Ga0495625_0061107
1551 Ga0495625_0070923
1552 Ga0495635_0000792
1553 Ga0495635_0002703
1554 Ga0495635_0005278
1555 Ga0495635_0026165
1556 Ga0495659_0011741
1557 Ga0495657_0001449
1558 Ga0495657_0013673
1559 Ga0495657_0022741
1560 Ga0495599_0000879
1561 Ga0495599_0013798
1562 Ga0495599_0048778
1563 Ga0495623_0002249
1564 Ga0495646_0002245
1565 Ga0495646_0032854
1566 Ga0495646_0105597
1567 Ga0495658_0001354
1568 Ga0495658_0044624
1569 Ga0495658_0048318
1570 Ga0495613_0006655
1571 Ga0495613_0024354
1572 Ga0495624_0000138
1573 Ga0495624_0010671
1574 Ga0495671_0053471
1575 Ga0495649_0042779
1576 Ga0495600_0000337
1577 Ga0495600_0005193
1578 Ga0495600_0151690
1579 Ga0495581_0000001
1580 Ga0495581_0023521
1581 Ga0495581_0081996
1582 Ga0495604_0001626
1583 Ga0495604_0017599
1584 Ga0495604_0169005
1585 Ga0495674_0002545
1586 Ga0495674_0018873
1587 Ga0495674_0145940
1588 Ga0495674_0311730
1589 Ga0495672_0007184
1590 Ga0495672_0031356
1591 Ga0495676_0003317
1592 Ga0495676_0143571
1593 Ga0495680_0002491
1594 Ga0495680_0005089
1595 Ga0495680_0156052
1596 Ga0495687_014891
1597 Ga0495675_0012328
1598 Ga0495675_0024995
1599 Ga0495675_0035435
1600 Ga0495673_0069111
1601 Ga0495673_0090619
1602 Ga0495684_0001407
1603 Ga0495684_0005971
1604 Ga0495593_0000003
1605 Ga0495593_0002446
1606 Ga0495602_0007241
1607 Ga0495602_0019961
1608 Ga0495602_0039312
1609 Ga0495602_0115379
1610 Ga0495614_0006055
1611 Ga0496100_0007585
1612 Ga0496100_0042150
1613 Ga0496100_0119453
1614 Ga0496101_0127876
1615 Ga0496102_0014231
1616 Ga0496102_0018355
1617 Ga0496102_0083203
1618 Ga0496103_0022816
1619 Ga0496104_0022932
1620 Ga0496104_0024758
1621 Ga0496104_0036043
1622 Ga0496104_0073880
1623 Ga0496104_0130155
1624 Ga0496104_0203556
1625 Ga0496105_0002092
1626 Ga0496105_0011739
1627 Ga0496105_0041425
1628 Ga0496105_0044963
1629 Ga0496105_0050731
1630 Ga0496105_0267569
1631 Ga0496106_0001202
1632 Ga0496106_0011446
1633 Ga0496106_0015453
1634 Ga0496106_0018182
1635 Ga0496106_0068108
1636 Ga0496106_0265684
1637 Ga0496107_0002624
1638 Ga0496107_0009825
1639 Ga0496107_0011885
1640 Ga0496108_0001960
1641 Ga0496108_0018478
1642 Ga0496108_0050815
1643 Ga0496108_0180764
1644 Ga0496109_0000432
1645 Ga0496109_0010188
1646 Ga0496109_0055955
1647 Ga0496109_0234299
1648 Ga0496110_0012555
1649 Ga0496110_0027219
1650 Ga0496110_0029803
1651 Ga0496110_0187050
1652 Ga0496110_0211027
1653 Ga0496111_0013188
1654 Ga0496111_0039393
1655 Ga0496111_0091744
1656 Ga0496112_0015915
1657 Ga0496112_0033682
1658 Ga0496112_0061568
1659 Ga0496112_0100707
1660 Ga0496112_0112903
1661 Ga0496112_0194315
1662 Ga0496112_0206592
1663 Ga0496113_0014649
1664 Ga0496113_0032600
1665 Ga0496114_0008432
1666 Ga0496115_0009310
1667 Ga0496115_0033310
1668 Ga0496115_0063699
1669 Ga0496115_0078069
1670 Ga0496115_0133099
1671 Ga0496118_0019947
1672 Ga0496118_0029396
1673 Ga0496118_0036940
1674 Ga0496118_0134801
1675 Ga0496119_0013953
1676 Ga0496120_0007436
1677 Ga0496121_0000041
1678 Ga0496121_0003563
1679 Ga0496121_0005352
1680 Ga0496121_0009890
1681 Ga0496121_0028205
1682 Ga0496121_0039020
1683 Ga0496121_0071909
1684 Ga0496121_0100982
1685 Ga0496121_0111107
1686 Ga0496122_0030990
1687 Ga0496124_0000624
1688 Ga0496124_0040676
1689 Ga0496125_0036744
1690 Ga0496125_0040200
1691 Ga0496125_0053440
1692 Ga0496125_0075947
1693 Ga0496125_0092232
1694 Ga0496126_0002321
1695 Ga0496126_0008801
1696 Ga0496126_0010022
1697 Ga0496126_0015516
1698 Ga0496126_0018293
1699 Ga0496126_0029558
1700 Ga0496126_0030071
1701 Ga0496126_0032840
1702 Ga0496126_0051884
1703 Ga0496126_0198822
1704 Ga0496126_0206653
1705 Ga0496126_0255689
1706 Ga0496126_0351501
1707 Ga0501032_0005102
1708 Ga0501032_0076754
1709 Ga0501033_0001834
1710 Ga0501033_0051989
1711 Ga0501034_0001471
1712 Ga0501034_0134384
1713 Ga0501034_0444984
1714 Ga0501036_0050117
1715 Ga0501036_0053755
1716 Ga0501037_0005747
1717 Ga0501037_0086729
1718 Ga0501038_0002435
1719 Ga0501038_0014916
1720 Ga0501038_0042310
1721 Ga0501039_0010117
1722 Ga0501040_0054616
1723 Ga0501042_0045227
1724 Ga0501043_0019449
1725 Ga0501043_0020212
1726 Ga0501043_0061463
1727 Ga0501046_0007012
1728 Ga0501046_0073620
1729 Ga0501046_0075087
1730 Ga0501047_0014876
1731 Ga0501047_0082968
1732 Ga0501047_0140691
1733 Ga0501048_0006412
1734 Ga0501068_0024706
1735 Ga0501074_0149427
1736 Ga0501076_0100259
1737 Ga0501079_0236102
1738 Ga0501080_0088666
1739 Ga0501080_0108978
1740 Ga0501080_0130979
1741 Ga0501035_0002268
1742 Ga0501035_0026433
1743 Ga0501035_0055661
1744 Ga0501044_0007852
1745 Ga0501044_0020966
1746 Ga0501044_0060417
1747 Ga0501045_0032361
1748 nmdc:mga0yw44_23996_c1
1749 nmdc:mga0yw44_31714_c1
1750 nmdc:mga0yw44_5423_c1
1751 nmdc:mga06z11_27907_c1
1752 nmdc:mga0rr50_147154_c1
1753 nmdc:mga0a205_317757_c1
1754 nmdc:mga0sz30_14368_c1
1755 nmdc:mga0sz30_64384_c1
1756 Ga0495601_0054028
1757 Ga0495601_0112208
1758 Ga0500635_0015520
1759 Ga0495595_0001668
1760 Ga0495595_0003281
1761 Ga0495595_0011648
1762 Ga0495619_0025449
1763 Ga0495619_0076189
1764 Ga0495619_0159548
1765 Ga0500643_001180
1766 Ga0500647_0036075
1767 Ga0500647_0095598
1768 Ga0500583_0079752
1769 Ga0500566_0000062
1770 Ga0500566_0000112
1771 Ga0500566_0002624
1772 Ga0500640_000394
1773 Ga0500554_001136
1774 Ga0500556_0000750
1775 Ga0500557_000003
1776 Ga0500562_023587
1777 Ga0500572_000239
1778 Ga0500572_000775
1779 Ga0500591_066690
1780 Ga0500595_017745
1781 Ga0500595_031296
1782 Ga0500614_021021
1783 Ga0500642_0002011
1784 Ga0500642_0025721
1785 Ga0500642_0121700
1786 Ga0500559_0001790
1787 Ga0500559_0004994
1788 Ga0500603_001625
1789 Ga0500616_0006635
1790 Ga0500622_0025785
1791 Ga0500627_0051117
1792 Ga0500630_003625
1793 Ga0500638_001061
1794 Ga0500639_000061
1795 Ga0500636_0000284
1796 Ga0500636_0023548
1797 Ga0500637_0000098
1798 Ga0500625_000220
1799 Ga0500596_000699
1800 Ga0500596_000998
1801 Ga0500596_003937
1802 Ga0500601_000233
1803 Ga0500601_001561
1804 Ga0501084_0076301
1805 2507507555
1806 2508541673
1807 2508692788
1808 2509152953
1809 2511394850
1810 2513621750
1811 2513636808
1812 2513651250
1813 2513654195
1814 2513674875
1815 2513697138
1816 2513704455
1817 2513720784
1818 2513856950
1819 2513878752
1820 2513894154
1821 2513918535
1822 2514011818
1823 2517104275
1824 2517891229
1825 2524468253
1826 2524533576
1827 2528848869
1828 2530646710
1829 2563055992
1830 2617346909
1831 2617372839
1832 2671123164
1833 2713472194
1834 2723843588
1835 2728749927
1836 2745080874
1837 2793060982
1838 2793066584
1839 2793083894
1840 2805921401
1841 2818236671
1842 2824602891
1843 2824611886
1844 2824621477
1845 2824630589
1846 2824638707
1847 2824650098
1848 2824660923
1849 2824664500
1850 2824672213
1851 2824682162
1852 2824688904
1853 2824697741
1854 2824709247
1855 2824719056
1856 2824730391
1857 2824733921
1858 2824748354
1859 2824758020
1860 2824766445
1861 2824776572
1862 2838129330
1863 2841948014
1864 2841953588
1865 2841962805
1866 2841973007
1867 2841978315
1868 2841990535
1869 2842040756
1870 2842046298
1871 2844320136
1872 2847933258
1873 2847937431
1874 2847947855
1875 2849078290
1876 2857512666
1877 2874598670
1878 2874607203
1879 2874614456
1880 2874628187
1881 2874630210
1882 2874652125
1883 2876768198
1884 2876778709
1885 2876818316
1886 2876823513
1887 2879082502
1888 2879107821
1889 2879114093
1890 2879131718
1891 2879150054
1892 2881371350
1893 2881672204
1894 2885370076
1895 2885383123
1896 2885391947
1897 2885415622
1898 2888385573
1899 2888392676
1900 2888425703
1901 2889037906
1902 2903731270
1903 2903753330
1904 2903774854
1905 2904674195
1906 2904694150
1907 2904701134
1908 2904711857
1909 2906609961
1910 2906616413
1911 2906627716
1912 2906638132
1913 2906649617
1914 2906662807
1915 2908741558
1916 2908758996
1917 2908781286
1918 2922361843
1919 2922372293
1920 2922386925
1921 2922396961
1922 2922431582
1923 2929621141
1924 2929626028
1925 2932785092
1926 2932795036
1927 2932805564
1928 2932810120
1929 2932821693
1930 2932828929
1931 2933582990
1932 2935609938
1933 2935619652
1934 2935636117
1935 2935638147
1936 2935638632
1937 2935652031
1938 2935659996
1939 2935666516
1940 2935676441
1941 2935691043
1942 2935694523
1943 2935703638
1944 2935718424
1945 2935727596
1946 2935736299
1947 2935745679
1948 2935756060
1949 2935760680
1950 2935776097
1951 2935785148
1952 2935791890
1953 2935800300
1954 2935801776
1955 2935814809
1956 2935823098
1957 2935827761
1958 2935828126
1959 2935842331
1960 2935848680
1961 2935855075
1962 2935858033
1963 2935867937
1964 2935874039
1965 2935885765
1966 2935909515
1967 2935917239
1968 2935926996
1969 2935937160
1970 2935944537
1971 2935952974
1972 2935962833
1973 2935969814
1974 2935976411
1975 2935987141
1976 2935993036
1977 2936002948
1978 2936014412
1979 2936023748
1980 2936031391
1981 2936040548
1982 2936049518
1983 2936061266
1984 2940561965
1985 2941512748
1986 2941514780
1987 2941520685
1988 2941522762
1989 2941528699
1990 2941530673
1991 2941531318
1992 2941542380
1993 3005481375
1994 3005485515
1995 3005508329
1996 3005588171
1997 3005600435
1998 3005715916
1999 3005723271
2000 8006933195
2001 8006939332
2002 8006968863
2003 8006978989
2004 8006984543
2005 8006997169
2006 8016520534
2007 8016528575
2008 8016555150
2009 8016563519
2010 8016572076
2011 8016594487
2012 8016601259
2013 8016609174
2014 8016615728
2015 8016625500
2016 8016639056
2017 8017065041
2018 8019533520
2019 8019546157
2020 8019552550
2021 8019575303
2022 8019592197
2023 8019599087
2024 8019609273
2025 8019633182
2026 8019646714
2027 8019649487
2028 8019661057
2029 8019670621
2030 8019685614
2031 8019691185
2032 8055744997
2033 8056677519
2034 8056687300
2035 8056690686
2036 8056974950

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14759

Reductase_C

Reductase C-terminal

363

447

0.99

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

188

269

0.97

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

46

344

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c0i-assembly1.cif.gz_A crystal structure of d-amino acid oxidase in complex with two anthranylate molecules 1.003 167 195
1sez-assembly1.cif.gz_A crystal structure of protoporphyrinogen ix oxidase 0.9967 167 201
6lqc-assembly1.cif.gz_A crystal structure of cyclohexylamine oxidase from erythrobacteraceae bacterium 0.9919 169 201
3fg2-assembly1.cif.gz_P crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris 0.9868 26 422
1q1r-assembly1.cif.gz_A crystal structure of putidaredoxin reductase from pseudomonas putida 0.9749 27 421
ID Description Score Start End Superfamily
af_Q5VQP1_29_415_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9992 169 202 3.50.50.60
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.991 168 201 3.50.50.60
3fg2P02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9891 137 255 3.50.50.60
af_A0A1D6LYX0_29_117_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9868 167 228 3.50.50.60
af_A0A1D6HRY4_17_247_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9838 168 198 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A840GUG1-F1-model_v4 3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase subunit (EC 1.18.1.3) 0.9929 27 422 GO:0005737
GO:0016651
GO:0051213
AF-B3QHG5-F1-model_v4 deleted 0.9886 27 422
AF-A0A431R372-F1-model_v4 deleted 0.988 27 217
AF-A0A6M6JJ77-F1-model_v4 FAD-dependent oxidoreductase 0.9873 28 421 GO:0005737
GO:0016651
AF-A0A2G8MD65-F1-model_v4 deleted 0.9853 178 421

Map