F488306
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1018 | 586 | 2036 | 405 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100013974|Ga0070711_1000139742 |
| Length | 448 |
| Sequence | MAASHRSGRGHERRENGASQPASEERGKRHGLLLCARSRVVPMMVGPVVIVGAGHAGFQLAASLRQDGFAEPIALINDEGHLPYQRPPLSKAYLKGTGGSDSLMFRPDKFYSDQHIDLITDCAAAIDRSARKVTLASGAVLDYQHLVLATGARNRLLDIPNANLEAVRYLRTLDESEALRHLLAPDLRVVVIGAGFIGLEFAATARAKGLEVDVVELAPRVMARAVTAEISEFSQARHTSAGIRIHLGVQVTSIEADGTKVAGVSLSDGRHIPADLVVVGVGVLPNVELASAAGLPVASGIIVDDHLLTADQNISAVGDCALYASPRFGGSLRLESVQNATDHARCVAARLTGNAKVYDGLPWFWSDQGPDKLQMVGLTTGYDRVVVRGDREQGAFSAFCYRGEQLLGIESVNRAGDHMFGRRLLVAGGSITPEEAADASFDLKRALG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 53 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 62 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 63 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 64 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 65 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 66 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 94 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 95 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 96 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 97 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 98 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 99 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 100 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 156 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 163 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 166 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 168 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 177 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 178 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 184 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 185 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 186 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 198 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 199 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 209 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 213 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 216 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 217 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 297 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 298 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 299 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 300 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 327 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 332 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 335 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 336 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 337 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 338 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 339 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 340 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 341 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 342 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 343 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 344 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 345 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 346 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 347 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 348 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 349 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 352 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 354 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 355 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 356 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 358 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 359 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 360 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 361 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 363 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 364 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 365 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 366 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 367 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 368 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 369 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 370 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 371 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 372 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 373 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 374 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 375 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 376 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 377 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 378 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 379 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 380 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 381 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 382 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 383 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 384 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 385 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 386 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 387 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 388 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 389 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 390 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 391 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 392 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 393 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 394 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 395 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 396 | 2791355199 | |||
| 397 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 398 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 399 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 400 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 401 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 402 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 403 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 404 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 405 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 406 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 407 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 408 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 409 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 410 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 411 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 412 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 413 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 414 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 415 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 416 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 417 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 418 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 419 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 420 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 421 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 422 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 423 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 424 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 425 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 426 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 427 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 428 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 429 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 430 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 431 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 432 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 433 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 434 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 435 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 436 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 437 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 438 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 439 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 440 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 441 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 442 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 443 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 444 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 445 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 446 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 447 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 448 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 449 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 450 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 451 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 452 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 453 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 454 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 455 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 456 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 457 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 458 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 459 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 460 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 461 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 462 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 463 | 2904699407 | |||
| 464 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 465 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 466 | 2906610324 | |||
| 467 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 468 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 469 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 470 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 471 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 472 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 473 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 474 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 475 | 2922368715 | |||
| 476 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 477 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 478 | 2922425934 | |||
| 479 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 480 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 481 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 482 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 483 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 484 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 485 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 486 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 487 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 488 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 489 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 490 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 491 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 492 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 493 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 494 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 495 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 496 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 497 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 498 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 499 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 500 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 501 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 502 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 503 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 504 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 505 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 506 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 507 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 508 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 509 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 510 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 511 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 512 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 513 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 514 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 515 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 516 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 517 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 518 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 519 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 520 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 521 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 522 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 523 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 524 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 525 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 526 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 527 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 528 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 529 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 530 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 531 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 532 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 533 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 534 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 535 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 536 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 537 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 538 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 539 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 540 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 541 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 542 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 543 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 544 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 545 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 546 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 547 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 548 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 549 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 550 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 551 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 552 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 553 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 554 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 555 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 556 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 557 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 558 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 559 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 560 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 561 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 562 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 563 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 564 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 565 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 566 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 567 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 568 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 569 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 570 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 571 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 572 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 573 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 574 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 575 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 576 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 577 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 578 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 579 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 580 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 581 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 582 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 583 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 584 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 585 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 586 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.49 |
| Metatranscriptomes | 0.1 |
| Isolates | 22.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.86 |
| Nodule | 18.37 |
| Rhizoplane | 5.99 |
| Rhizosphere | 54.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070711_100013974 | 3300005439 | Bacteria | 5050 |
| 2 | JGI24740J21852_10004915 | 3300001979 | Bacteria | 5689 |
| 3 | JGI24739J22299_10002391 | 3300001989 | Bacteria | 7241 |
| 4 | JGI24737J22298_10008032 | 3300001990 | Bacteria | 3546 |
| 5 | JGI25153J46596_10005337 | 3300003215 | Bacteria | 6755 |
| 6 | rootL2_10160148 | 3300003322 | Bacteria | 2053 |
| 7 | JGI25160J50197_1011835 | 3300003354 | Bacteria | 3064 |
| 8 | JGI25404J52841_10009163 | 3300003659 | Bacteria | 2115 |
| 9 | Ga0055531_10006567 | 3300003794 | Bacteria | 6572 |
| 10 | Ga0055543_1000462 | 3300004625 | Bacteria | 24016 |
| 11 | Ga0055543_1001763 | 3300004625 | Bacteria | 8077 |
| 12 | Ga0065165_1000799 | 3300005262 | Bacteria | 42051 |
| 13 | Ga0065165_1002416 | 3300005262 | Bacteria | 15929 |
| 14 | Ga0065165_1002642 | 3300005262 | Bacteria | 14515 |
| 15 | Ga0065165_1006433 | 3300005262 | Bacteria | 6161 |
| 16 | Ga0070658_10048283 | 3300005327 | Bacteria | 3446 |
| 17 | Ga0070683_100005122 | 3300005329 | Bacteria | 10899 |
| 18 | Ga0070680_100009353 | 3300005336 | Bacteria | 7529 |
| 19 | Ga0070680_100162926 | 3300005336 | Bacteria | 1874 |
| 20 | Ga0068868_100053615 | 3300005338 | Bacteria | 3177 |
| 21 | Ga0070660_100018873 | 3300005339 | Bacteria | 5048 |
| 22 | Ga0070668_100026976 | 3300005347 | Bacteria | 4360 |
| 23 | Ga0070668_100082935 | 3300005347 | Bacteria | 2515 |
| 24 | Ga0070668_100229075 | 3300005347 | Bacteria | 1535 |
| 25 | Ga0070675_100167579 | 3300005354 | Bacteria | 1893 |
| 26 | Ga0070671_100019025 | 3300005355 | Bacteria | 5586 |
| 27 | Ga0070671_100154588 | 3300005355 | Bacteria | 1938 |
| 28 | Ga0070674_100011327 | 3300005356 | Bacteria | 5427 |
| 29 | Ga0070673_100042244 | 3300005364 | Bacteria | 3514 |
| 30 | Ga0070688_100028924 | 3300005365 | Bacteria | 3313 |
| 31 | Ga0070659_100065131 | 3300005366 | Bacteria | 2886 |
| 32 | Ga0070667_100053462 | 3300005367 | Bacteria | 3408 |
| 33 | Ga0070709_10001228 | 3300005434 | Bacteria | 14056 |
| 34 | Ga0070709_10115955 | 3300005434 | Bacteria | 1807 |
| 35 | Ga0070709_10160673 | 3300005434 | Bacteria | 1562 |
| 36 | Ga0070714_100006930 | 3300005435 | Bacteria | 8786 |
| 37 | Ga0070714_100012311 | 3300005435 | Bacteria | 6825 |
| 38 | Ga0070714_100083680 | 3300005435 | Bacteria | 2783 |
| 39 | Ga0070714_100264909 | 3300005435 | Bacteria | 1592 |
| 40 | Ga0070713_100019837 | 3300005436 | Bacteria | 5145 |
| 41 | Ga0070713_100099622 | 3300005436 | Bacteria | 2514 |
| 42 | Ga0070713_100155497 | 3300005436 | Bacteria | 2038 |
| 43 | Ga0070713_100252074 | 3300005436 | Bacteria | 1610 |
| 44 | Ga0070713_100340281 | 3300005436 | Bacteria | 1390 |
| 45 | Ga0070710_10000929 | 3300005437 | Bacteria | 13965 |
| 46 | Ga0070711_100005942 | 3300005439 | Bacteria | 7326 |
| 47 | Ga0070711_100015536 | 3300005439 | Bacteria | 4819 |
| 48 | Ga0070711_100039484 | 3300005439 | Bacteria | 3180 |
| 49 | Ga0070711_100043582 | 3300005439 | Bacteria | 3040 |
| 50 | Ga0070711_100072675 | 3300005439 | Bacteria | 2427 |
| 51 | Ga0070663_100008307 | 3300005455 | Bacteria | 6379 |
| 52 | Ga0070663_100010106 | 3300005455 | Bacteria | 5870 |
| 53 | Ga0070663_100015280 | 3300005455 | Bacteria | 4951 |
| 54 | Ga0070663_100035288 | 3300005455 | Bacteria | 3469 |
| 55 | Ga0070663_100080401 | 3300005455 | Bacteria | 2393 |
| 56 | Ga0070662_100010158 | 3300005457 | Bacteria | 6169 |
| 57 | Ga0070681_10037204 | 3300005458 | Bacteria | 4885 |
| 58 | Ga0070681_10076829 | 3300005458 | Bacteria | 3297 |
| 59 | Ga0070681_10088746 | 3300005458 | Bacteria | 3043 |
| 60 | Ga0070681_10094083 | 3300005458 | Bacteria | 2945 |
| 61 | Ga0070707_100312288 | 3300005468 | Bacteria | 1528 |
| 62 | Ga0070699_100171307 | 3300005518 | Bacteria | 1924 |
| 63 | Ga0070679_100032475 | 3300005530 | Bacteria | 5164 |
| 64 | Ga0070679_100058920 | 3300005530 | Bacteria | 3827 |
| 65 | Ga0070679_100094456 | 3300005530 | Bacteria | 2977 |
| 66 | Ga0070684_100015626 | 3300005535 | Bacteria | 6190 |
| 67 | Ga0070684_100017917 | 3300005535 | Bacteria | 5821 |
| 68 | Ga0070684_100033654 | 3300005535 | Bacteria | 4377 |
| 69 | Ga0068853_100007930 | 3300005539 | Bacteria | 8513 |
| 70 | Ga0068853_100022387 | 3300005539 | Bacteria | 5278 |
| 71 | Ga0068853_100137259 | 3300005539 | Bacteria | 2193 |
| 72 | Ga0068853_100210070 | 3300005539 | Bacteria | 1774 |
| 73 | Ga0068853_100268660 | 3300005539 | Bacteria | 1570 |
| 74 | Ga0070665_100016320 | 3300005548 | Bacteria | 7448 |
| 75 | Ga0070665_100051187 | 3300005548 | Bacteria | 4142 |
| 76 | Ga0068855_100012869 | 3300005563 | Bacteria | 10096 |
| 77 | Ga0068855_100021640 | 3300005563 | Bacteria | 7714 |
| 78 | Ga0068855_100059343 | 3300005563 | Bacteria | 4476 |
| 79 | Ga0068857_100015877 | 3300005577 | Bacteria | 6590 |
| 80 | Ga0068857_100050153 | 3300005577 | Bacteria | 3703 |
| 81 | Ga0068856_100001803 | 3300005614 | Bacteria | 22366 |
| 82 | Ga0068856_100001867 | 3300005614 | Bacteria | 21986 |
| 83 | Ga0068856_100019754 | 3300005614 | Bacteria | 6537 |
| 84 | Ga0068852_100014573 | 3300005616 | Bacteria | 6058 |
| 85 | Ga0068852_100063882 | 3300005616 | Bacteria | 3207 |
| 86 | Ga0068859_100053671 | 3300005617 | Bacteria | 4054 |
| 87 | Ga0068851_10000250 | 3300005834 | Bacteria | 25377 |
| 88 | Ga0068851_10042123 | 3300005834 | Bacteria | 2298 |
| 89 | Ga0068863_100231921 | 3300005841 | Bacteria | 1781 |
| 90 | Ga0068863_100294077 | 3300005841 | Bacteria | 1574 |
| 91 | Ga0068858_100018788 | 3300005842 | Bacteria | 6466 |
| 92 | Ga0068860_100005407 | 3300005843 | Bacteria | 12960 |
| 93 | Ga0068860_100123813 | 3300005843 | Bacteria | 2478 |
| 94 | Ga0068862_100057926 | 3300005844 | Bacteria | 3323 |
| 95 | Ga0081455_10002800 | 3300005937 | Bacteria | 20533 |
| 96 | Ga0081455_10008855 | 3300005937 | Bacteria | 10411 |
| 97 | Ga0081455_10037499 | 3300005937 | Bacteria | 4304 |
| 98 | Ga0081455_10056307 | 3300005937 | Bacteria | 3340 |
| 99 | Ga0081455_10061238 | 3300005937 | Bacteria | 3168 |
| 100 | Ga0081455_10108720 | 3300005937 | Bacteria | 2208 |
| 101 | Ga0081540_1000178 | 3300005983 | Bacteria | 66386 |
| 102 | Ga0081540_1001968 | 3300005983 | Bacteria | 17139 |
| 103 | Ga0081540_1011207 | 3300005983 | Bacteria | 6010 |
| 104 | Ga0081540_1012098 | 3300005983 | Bacteria | 5709 |
| 105 | Ga0081540_1018972 | 3300005983 | Bacteria | 4200 |
| 106 | Ga0081540_1019008 | 3300005983 | Bacteria | 4194 |
| 107 | Ga0081540_1021450 | 3300005983 | Bacteria | 3845 |
| 108 | Ga0081540_1021620 | 3300005983 | Bacteria | 3823 |
| 109 | Ga0081540_1040971 | 3300005983 | Bacteria | 2407 |
| 110 | Ga0081540_1043139 | 3300005983 | Bacteria | 2318 |
| 111 | Ga0081539_10000220 | 3300005985 | Bacteria | 133834 |
| 112 | Ga0070717_10005875 | 3300006028 | Bacteria | 8987 |
| 113 | Ga0070717_10012278 | 3300006028 | Bacteria | 6529 |
| 114 | Ga0070717_10058625 | 3300006028 | Bacteria | 3184 |
| 115 | Ga0070717_10094177 | 3300006028 | Bacteria | 2533 |
| 116 | Ga0075365_10018146 | 3300006038 | Bacteria | 4320 |
| 117 | Ga0075368_10011128 | 3300006042 | Bacteria | 3269 |
| 118 | Ga0075363_100018753 | 3300006048 | Bacteria | 3451 |
| 119 | Ga0075363_100072104 | 3300006048 | Bacteria | 1878 |
| 120 | Ga0070715_10003054 | 3300006163 | Bacteria | 5249 |
| 121 | Ga0070716_100004705 | 3300006173 | Bacteria | 6546 |
| 122 | Ga0070716_100012347 | 3300006173 | Bacteria | 4328 |
| 123 | Ga0070712_100005481 | 3300006175 | Bacteria | 7854 |
| 124 | Ga0070712_100006535 | 3300006175 | Bacteria | 7235 |
| 125 | Ga0070712_100044651 | 3300006175 | Bacteria | 3056 |
| 126 | Ga0070712_100054530 | 3300006175 | Bacteria | 2795 |
| 127 | Ga0075370_10003000 | 3300006353 | Bacteria | 7950 |
| 128 | Ga0075370_10042424 | 3300006353 | Bacteria | 2570 |
| 129 | Ga0068871_100080431 | 3300006358 | Bacteria | 2698 |
| 130 | Ga0097620_100053665 | 3300006931 | Bacteria | 4054 |
| 131 | Ga0099825_1030562 | 3300006941 | Bacteria | 2374 |
| 132 | Ga0099824_1004802 | 3300006942 | Bacteria | 19329 |
| 133 | Ga0099824_1020023 | 3300006942 | Bacteria | 5032 |
| 134 | Ga0099822_1001244 | 3300006943 | Bacteria | 29011 |
| 135 | Ga0099823_1042587 | 3300006944 | Bacteria | 3170 |
| 136 | Ga0099794_10005646 | 3300007265 | Bacteria | 5036 |
| 137 | Ga0099794_10007699 | 3300007265 | Bacteria | 4440 |
| 138 | Ga0099794_10101182 | 3300007265 | Bacteria | 1438 |
| 139 | Ga0099795_10002778 | 3300007788 | Bacteria | 4209 |
| 140 | Ga0105240_10016329 | 3300009093 | Bacteria | 10056 |
| 141 | Ga0105240_10016971 | 3300009093 | Bacteria | 9835 |
| 142 | Ga0105240_10075310 | 3300009093 | Bacteria | 4163 |
| 143 | Ga0111539_10083826 | 3300009094 | Bacteria | 3748 |
| 144 | Ga0111539_10135696 | 3300009094 | Bacteria | 2882 |
| 145 | Ga0105245_10051090 | 3300009098 | Bacteria | 3706 |
| 146 | Ga0105245_10171978 | 3300009098 | Bacteria | 2063 |
| 147 | Ga0105245_10310676 | 3300009098 | Bacteria | 1550 |
| 148 | Ga0105247_10033772 | 3300009101 | Bacteria | 3114 |
| 149 | Ga0114129_10090903 | 3300009147 | Bacteria | 4230 |
| 150 | Ga0105243_10142575 | 3300009148 | Bacteria | 2046 |
| 151 | Ga0105241_10005015 | 3300009174 | Bacteria | 9775 |
| 152 | Ga0105241_10039748 | 3300009174 | Bacteria | 3550 |
| 153 | Ga0105241_10085631 | 3300009174 | Bacteria | 2477 |
| 154 | Ga0105248_10077527 | 3300009177 | Bacteria | 3736 |
| 155 | Ga0105248_10078907 | 3300009177 | Bacteria | 3700 |
| 156 | Ga0105248_10244393 | 3300009177 | Bacteria | 2020 |
| 157 | Ga0105248_10267166 | 3300009177 | Bacteria | 1926 |
| 158 | Ga0105237_10037283 | 3300009545 | Bacteria | 4916 |
| 159 | Ga0105237_10058475 | 3300009545 | Bacteria | 3858 |
| 160 | Ga0105237_10064196 | 3300009545 | Bacteria | 3668 |
| 161 | Ga0105237_10205408 | 3300009545 | Bacteria | 1970 |
| 162 | Ga0105238_10002659 | 3300009551 | Bacteria | 17766 |
| 163 | Ga0105238_10006063 | 3300009551 | Bacteria | 11992 |
| 164 | Ga0105238_10009836 | 3300009551 | Bacteria | 9579 |
| 165 | Ga0105238_10298165 | 3300009551 | Bacteria | 1595 |
| 166 | Ga0105238_10407541 | 3300009551 | Bacteria | 1353 |
| 167 | Ga0099796_10011117 | 3300010159 | Bacteria | 2500 |
| 168 | Ga0099796_10013869 | 3300010159 | Bacteria | 2313 |
| 169 | Ga0105239_10003585 | 3300010375 | Bacteria | 18979 |
| 170 | Ga0105239_10003896 | 3300010375 | Bacteria | 18087 |
| 171 | Ga0105239_10017767 | 3300010375 | Bacteria | 7867 |
| 172 | Ga0105239_10021644 | 3300010375 | Bacteria | 7089 |
| 173 | Ga0105239_10027720 | 3300010375 | Bacteria | 6233 |
| 174 | Ga0105239_10059197 | 3300010375 | Bacteria | 4205 |
| 175 | Ga0105239_10103968 | 3300010375 | Bacteria | 3144 |
| 176 | Ga0105239_10431802 | 3300010375 | Bacteria | 1493 |
| 177 | Ga0105246_10027867 | 3300011119 | Bacteria | 3707 |
| 178 | Ga0157373_10052924 | 3300013100 | Bacteria | 2887 |
| 179 | Ga0157370_10059165 | 3300013104 | Bacteria | 3642 |
| 180 | Ga0157370_10202043 | 3300013104 | Bacteria | 1843 |
| 181 | Ga0157369_10030087 | 3300013105 | Bacteria | 5992 |
| 182 | Ga0157369_10047249 | 3300013105 | Bacteria | 4675 |
| 183 | Ga0157374_10087900 | 3300013296 | Bacteria | 2959 |
| 184 | Ga0157374_10199027 | 3300013296 | Bacteria | 1961 |
| 185 | Ga0157378_10004346 | 3300013297 | Bacteria | 12466 |
| 186 | Ga0157378_10078233 | 3300013297 | Bacteria | 2983 |
| 187 | Ga0163162_10069584 | 3300013306 | Bacteria | 3571 |
| 188 | Ga0157375_10054992 | 3300013308 | Bacteria | 3922 |
| 189 | Ga0157375_10121305 | 3300013308 | Bacteria | 2724 |
| 190 | Ga0157375_10214264 | 3300013308 | Bacteria | 2084 |
| 191 | Ga0163163_10052220 | 3300014325 | Bacteria | 4032 |
| 192 | Ga0163163_10160664 | 3300014325 | Bacteria | 2292 |
| 193 | Ga0163163_10185491 | 3300014325 | Bacteria | 2128 |
| 194 | Ga0157377_10015118 | 3300014745 | Bacteria | 3939 |
| 195 | Ga0157379_10026231 | 3300014968 | Bacteria | 5186 |
| 196 | Ga0157379_10287761 | 3300014968 | Bacteria | 1496 |
| 197 | Ga0157376_10037246 | 3300014969 | Bacteria | 3946 |
| 198 | Ga0163161_10039459 | 3300017792 | Bacteria | 3390 |
| 199 | Ga0197907_10707499 | 3300020069 | Bacteria | 1816 |
| 200 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 201 | Ga0214542_1000037 | 3300021321 | Bacteria | 159256 |
| 202 | Ga0214542_1000879 | 3300021321 | Bacteria | 58206 |
| 203 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 204 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 205 | Ga0213874_10003673 | 3300021377 | Bacteria | 3433 |
| 206 | Ga0213876_10005607 | 3300021384 | Bacteria | 6890 |
| 207 | Ga0213875_10000382 | 3300021388 | Bacteria | 39987 |
| 208 | Ga0213875_10000390 | 3300021388 | Bacteria | 39140 |
| 209 | Ga0213875_10003220 | 3300021388 | Bacteria | 9371 |
| 210 | Ga0213871_10003817 | 3300021441 | Bacteria | 2951 |
| 211 | Ga0209148_1000462 | 3300025254 | Bacteria | 43711 |
| 212 | Ga0209233_1002214 | 3300025261 | Bacteria | 7295 |
| 213 | Ga0209455_1009328 | 3300025272 | Bacteria | 2588 |
| 214 | Ga0209455_1014740 | 3300025272 | Bacteria | 1754 |
| 215 | Ga0209564_1005201 | 3300025295 | Bacteria | 7533 |
| 216 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 217 | Ga0209758_1000845 | 3300025297 | Bacteria | 42737 |
| 218 | Ga0209758_1003253 | 3300025297 | Bacteria | 15067 |
| 219 | Ga0209758_1008620 | 3300025297 | Bacteria | 6550 |
| 220 | Ga0209758_1032205 | 3300025297 | Bacteria | 2133 |
| 221 | Ga0209256_1008471 | 3300025299 | Bacteria | 4761 |
| 222 | Ga0209256_1012600 | 3300025299 | Bacteria | 3213 |
| 223 | Ga0207426_1000228 | 3300025302 | Bacteria | 129261 |
| 224 | Ga0207426_1000270 | 3300025302 | Bacteria | 108404 |
| 225 | Ga0207426_1000292 | 3300025302 | Bacteria | 99342 |
| 226 | Ga0207426_1010723 | 3300025302 | Bacteria | 3540 |
| 227 | Ga0209257_1001242 | 3300025304 | Bacteria | 31529 |
| 228 | Ga0209257_1018129 | 3300025304 | Bacteria | 2730 |
| 229 | Ga0207656_10029312 | 3300025321 | Bacteria | 2266 |
| 230 | Ga0207653_10032516 | 3300025885 | Bacteria | 1688 |
| 231 | Ga0207692_10001555 | 3300025898 | Bacteria | 8634 |
| 232 | Ga0207692_10029149 | 3300025898 | Bacteria | 2620 |
| 233 | Ga0207688_10031893 | 3300025901 | Bacteria | 2910 |
| 234 | Ga0207647_10000496 | 3300025904 | Bacteria | 31496 |
| 235 | Ga0207647_10017643 | 3300025904 | Bacteria | 4850 |
| 236 | Ga0207699_10000605 | 3300025906 | Bacteria | 17554 |
| 237 | Ga0207699_10002358 | 3300025906 | Bacteria | 8919 |
| 238 | Ga0207699_10008980 | 3300025906 | Bacteria | 4955 |
| 239 | Ga0207699_10063547 | 3300025906 | Bacteria | 2230 |
| 240 | Ga0207705_10097865 | 3300025909 | Bacteria | 2155 |
| 241 | Ga0207705_10158797 | 3300025909 | Bacteria | 1698 |
| 242 | Ga0207654_10000634 | 3300025911 | Bacteria | 19851 |
| 243 | Ga0207707_10002844 | 3300025912 | Bacteria | 15450 |
| 244 | Ga0207707_10007520 | 3300025912 | Bacteria | 9493 |
| 245 | Ga0207707_10008335 | 3300025912 | Bacteria | 8992 |
| 246 | Ga0207707_10133882 | 3300025912 | Bacteria | 2167 |
| 247 | Ga0207707_10161806 | 3300025912 | Bacteria | 1957 |
| 248 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 249 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 250 | Ga0207695_10002936 | 3300025913 | Bacteria | 24601 |
| 251 | Ga0207695_10011660 | 3300025913 | Bacteria | 10622 |
| 252 | Ga0207695_10046333 | 3300025913 | Bacteria | 4609 |
| 253 | Ga0207695_10068273 | 3300025913 | Bacteria | 3642 |
| 254 | Ga0207695_10089987 | 3300025913 | Bacteria | 3085 |
| 255 | Ga0207671_10060370 | 3300025914 | Bacteria | 2813 |
| 256 | Ga0207671_10088927 | 3300025914 | Bacteria | 2324 |
| 257 | Ga0207693_10000085 | 3300025915 | Bacteria | 83879 |
| 258 | Ga0207693_10005576 | 3300025915 | Bacteria | 10474 |
| 259 | Ga0207693_10009623 | 3300025915 | Bacteria | 7870 |
| 260 | Ga0207693_10020299 | 3300025915 | Bacteria | 5286 |
| 261 | Ga0207693_10059873 | 3300025915 | Bacteria | 2983 |
| 262 | Ga0207693_10060930 | 3300025915 | Bacteria | 2956 |
| 263 | Ga0207693_10070878 | 3300025915 | Bacteria | 2727 |
| 264 | Ga0207693_10264604 | 3300025915 | Bacteria | 1348 |
| 265 | Ga0207663_10000739 | 3300025916 | Bacteria | 14580 |
| 266 | Ga0207663_10003946 | 3300025916 | Bacteria | 7338 |
| 267 | Ga0207663_10009965 | 3300025916 | Bacteria | 5032 |
| 268 | Ga0207660_10023909 | 3300025917 | Bacteria | 4131 |
| 269 | Ga0207660_10068885 | 3300025917 | Bacteria | 2568 |
| 270 | Ga0207662_10106494 | 3300025918 | Bacteria | 1744 |
| 271 | Ga0207657_10003303 | 3300025919 | Bacteria | 17242 |
| 272 | Ga0207657_10016929 | 3300025919 | Bacteria | 7015 |
| 273 | Ga0207649_10027939 | 3300025920 | Bacteria | 3317 |
| 274 | Ga0207652_10026123 | 3300025921 | Bacteria | 4860 |
| 275 | Ga0207652_10045400 | 3300025921 | Bacteria | 3746 |
| 276 | Ga0207652_10115771 | 3300025921 | Bacteria | 2381 |
| 277 | Ga0207646_10258566 | 3300025922 | Bacteria | 1574 |
| 278 | Ga0207694_10000119 | 3300025924 | Bacteria | 83771 |
| 279 | Ga0207694_10003295 | 3300025924 | Bacteria | 12847 |
| 280 | Ga0207694_10005677 | 3300025924 | Bacteria | 9572 |
| 281 | Ga0207694_10180364 | 3300025924 | Bacteria | 1712 |
| 282 | Ga0207694_10241511 | 3300025924 | Bacteria | 1476 |
| 283 | Ga0207687_10018479 | 3300025927 | Bacteria | 4603 |
| 284 | Ga0207687_10062646 | 3300025927 | Bacteria | 2631 |
| 285 | Ga0207687_10076825 | 3300025927 | Bacteria | 2400 |
| 286 | Ga0207700_10003531 | 3300025928 | Bacteria | 9108 |
| 287 | Ga0207700_10011210 | 3300025928 | Bacteria | 5706 |
| 288 | Ga0207700_10011837 | 3300025928 | Bacteria | 5587 |
| 289 | Ga0207700_10045438 | 3300025928 | Bacteria | 3241 |
| 290 | Ga0207700_10069649 | 3300025928 | Bacteria | 2701 |
| 291 | Ga0207664_10005139 | 3300025929 | Bacteria | 8917 |
| 292 | Ga0207664_10159233 | 3300025929 | Bacteria | 1924 |
| 293 | Ga0207644_10155132 | 3300025931 | Bacteria | 1775 |
| 294 | Ga0207690_10164031 | 3300025932 | Bacteria | 1659 |
| 295 | Ga0207706_10041553 | 3300025933 | Bacteria | 4076 |
| 296 | Ga0207665_10000066 | 3300025939 | Bacteria | 68434 |
| 297 | Ga0207665_10004190 | 3300025939 | Bacteria | 9594 |
| 298 | Ga0207665_10042629 | 3300025939 | Bacteria | 3034 |
| 299 | Ga0207665_10209318 | 3300025939 | Bacteria | 1424 |
| 300 | Ga0207691_10059114 | 3300025940 | Bacteria | 3486 |
| 301 | Ga0207689_10013332 | 3300025942 | Bacteria | 7013 |
| 302 | Ga0207661_10000917 | 3300025944 | Bacteria | 19380 |
| 303 | Ga0207661_10023556 | 3300025944 | Bacteria | 4653 |
| 304 | Ga0207661_10046472 | 3300025944 | Bacteria | 3443 |
| 305 | Ga0207667_10003981 | 3300025949 | Bacteria | 18159 |
| 306 | Ga0207667_10021239 | 3300025949 | Bacteria | 7197 |
| 307 | Ga0207667_10033464 | 3300025949 | Bacteria | 5525 |
| 308 | Ga0207667_10201110 | 3300025949 | Bacteria | 2044 |
| 309 | Ga0207651_10207135 | 3300025960 | Bacteria | 1576 |
| 310 | Ga0207677_10098362 | 3300026023 | Bacteria | 2146 |
| 311 | Ga0207703_10026127 | 3300026035 | Bacteria | 4594 |
| 312 | Ga0207703_10128295 | 3300026035 | Bacteria | 2187 |
| 313 | Ga0207703_10205158 | 3300026035 | Bacteria | 1754 |
| 314 | Ga0207639_10004828 | 3300026041 | Bacteria | 9091 |
| 315 | Ga0207639_10005470 | 3300026041 | Bacteria | 8583 |
| 316 | Ga0207639_10058471 | 3300026041 | Bacteria | 2965 |
| 317 | Ga0207639_10158117 | 3300026041 | Bacteria | 1906 |
| 318 | Ga0207678_10010709 | 3300026067 | Bacteria | 8055 |
| 319 | Ga0207678_10020027 | 3300026067 | Bacteria | 5877 |
| 320 | Ga0207678_10026116 | 3300026067 | Bacteria | 5096 |
| 321 | Ga0207678_10047784 | 3300026067 | Bacteria | 3700 |
| 322 | Ga0207678_10055282 | 3300026067 | Bacteria | 3419 |
| 323 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 324 | Ga0207702_10001708 | 3300026078 | Bacteria | 21655 |
| 325 | Ga0207702_10008470 | 3300026078 | Bacteria | 8673 |
| 326 | Ga0207702_10111571 | 3300026078 | Bacteria | 2432 |
| 327 | Ga0207702_10301380 | 3300026078 | Bacteria | 1521 |
| 328 | Ga0207641_10296379 | 3300026088 | Bacteria | 1526 |
| 329 | Ga0207648_10010213 | 3300026089 | Bacteria | 8930 |
| 330 | Ga0207674_10006543 | 3300026116 | Bacteria | 13703 |
| 331 | Ga0207674_10009969 | 3300026116 | Bacteria | 10811 |
| 332 | Ga0207674_10023678 | 3300026116 | Bacteria | 6573 |
| 333 | Ga0207675_100069671 | 3300026118 | Bacteria | 3287 |
| 334 | Ga0207675_100377031 | 3300026118 | Bacteria | 1394 |
| 335 | Ga0207683_10117952 | 3300026121 | Bacteria | 2380 |
| 336 | Ga0207698_10029719 | 3300026142 | Bacteria | 3918 |
| 337 | Ga0207698_10124851 | 3300026142 | Bacteria | 2187 |
| 338 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 339 | Ga0209389_1000014 | 3300027296 | Bacteria | 188621 |
| 340 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 341 | Ga0209589_1000020 | 3300027357 | Bacteria | 188617 |
| 342 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 343 | Ga0209489_100060 | 3300027361 | Bacteria | 147091 |
| 344 | Ga0209489_101114 | 3300027361 | Bacteria | 54578 |
| 345 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 346 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 347 | Ga0209179_1002935 | 3300027512 | Bacteria | 2382 |
| 348 | Ga0209588_1005193 | 3300027671 | Bacteria | 3717 |
| 349 | Ga0209813_10006595 | 3300027866 | Bacteria | 2873 |
| 350 | Ga0268266_10014609 | 3300028379 | Bacteria | 6747 |
| 351 | Ga0268266_10055520 | 3300028379 | Bacteria | 3405 |
| 352 | Ga0268266_10163085 | 3300028379 | Bacteria | 2018 |
| 353 | Ga0268266_10200158 | 3300028379 | Bacteria | 1828 |
| 354 | Ga0268265_10017139 | 3300028380 | Bacteria | 4991 |
| 355 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 356 | Ga0265337_1007120 | 3300028556 | Bacteria | 4223 |
| 357 | Ga0265319_1017390 | 3300028563 | Bacteria | 2734 |
| 358 | Ga0265334_10007339 | 3300028573 | Bacteria | 4730 |
| 359 | Ga0265323_10001453 | 3300028653 | Bacteria | 11630 |
| 360 | Ga0265336_10000251 | 3300028666 | Bacteria | 38092 |
| 361 | Ga0307517_10000386 | 3300028786 | Bacteria | 75442 |
| 362 | Ga0307515_10017392 | 3300028794 | Bacteria | 13100 |
| 363 | Ga0265338_10000582 | 3300028800 | Bacteria | 64301 |
| 364 | Ga0265324_10011228 | 3300029957 | Bacteria | 3419 |
| 365 | Ga0265330_10007549 | 3300031235 | Bacteria | 5291 |
| 366 | Ga0265330_10009772 | 3300031235 | Bacteria | 4545 |
| 367 | Ga0265332_10047350 | 3300031238 | Bacteria | 1850 |
| 368 | Ga0265325_10015246 | 3300031241 | Bacteria | 4325 |
| 369 | Ga0265339_10012020 | 3300031249 | Bacteria | 5306 |
| 370 | Ga0265339_10016403 | 3300031249 | Bacteria | 4416 |
| 371 | Ga0265339_10065301 | 3300031249 | Bacteria | 1951 |
| 372 | Ga0265331_10046688 | 3300031250 | Bacteria | 2087 |
| 373 | Ga0307513_10216665 | 3300031456 | Bacteria | 1740 |
| 374 | Ga0307509_10029551 | 3300031507 | Bacteria | 6080 |
| 375 | Ga0307509_10099121 | 3300031507 | Bacteria | 2956 |
| 376 | Ga0307508_10023817 | 3300031616 | Bacteria | 5559 |
| 377 | Ga0307508_10078529 | 3300031616 | Bacteria | 2881 |
| 378 | Ga0307508_10099956 | 3300031616 | Bacteria | 2495 |
| 379 | Ga0307508_10100608 | 3300031616 | Bacteria | 2485 |
| 380 | Ga0265314_10010113 | 3300031711 | Bacteria | 7906 |
| 381 | Ga0265314_10017398 | 3300031711 | Bacteria | 5645 |
| 382 | Ga0265342_10002383 | 3300031712 | Bacteria | 16284 |
| 383 | Ga0307516_10010095 | 3300031730 | Bacteria | 10442 |
| 384 | Ga0307516_10038399 | 3300031730 | Bacteria | 4779 |
| 385 | Ga0307516_10180578 | 3300031730 | Bacteria | 1844 |
| 386 | Ga0307516_10183224 | 3300031730 | Bacteria | 1826 |
| 387 | Ga0307415_100150974 | 3300032126 | Bacteria | 1788 |
| 388 | Ga0307510_10017574 | 3300033180 | Bacteria | 8432 |
| 389 | Ga0307510_10055165 | 3300033180 | Bacteria | 4153 |
| 390 | Ga0307510_10151640 | 3300033180 | Bacteria | 1935 |
| 391 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 392 | Ga0373926_0034888 | 3300035083 | Bacteria | 1783 |
| 393 | Ga0373934_0007901 | 3300035086 | Bacteria | 3958 |
| 394 | Ga0373936_0014396 | 3300035113 | Bacteria | 3023 |
| 395 | Ga0373953_0000506 | 3300035117 | Bacteria | 10848 |
| 396 | Ga0373954_0000386 | 3300035118 | Bacteria | 16413 |
| 397 | Ga0373954_0014978 | 3300035118 | Bacteria | 3462 |
| 398 | Ga0373956_0005816 | 3300035119 | Bacteria | 4931 |
| 399 | Ga0373956_0013430 | 3300035119 | Bacteria | 3406 |
| 400 | Ga0373943_0002708 | 3300035170 | Bacteria | 8046 |
| 401 | Ga0373943_0040646 | 3300035170 | Bacteria | 2246 |
| 402 | Ga0373946_0005868 | 3300035171 | Bacteria | 4447 |
| 403 | Ga0373946_0020617 | 3300035171 | Bacteria | 2549 |
| 404 | Ga0373955_0000286 | 3300035172 | Bacteria | 20971 |
| 405 | Ga0373955_0059552 | 3300035172 | Bacteria | 2103 |
| 406 | Ga0373931_0005603 | 3300035691 | Bacteria | 5822 |
| 407 | Ga0373935_0001308 | 3300035692 | Bacteria | 13756 |
| 408 | Ga0373927_0018861 | 3300035695 | Bacteria | 4526 |
| 409 | Ga0373927_0053411 | 3300035695 | Bacteria | 2614 |
| 410 | Ga0373927_0094628 | 3300035695 | Bacteria | 1941 |
| 411 | Ga0373933_0000525 | 3300035724 | Bacteria | 23898 |
| 412 | Ga0373933_0000952 | 3300035724 | Bacteria | 17650 |
| 413 | Ga0373947_0012265 | 3300035725 | Bacteria | 4910 |
| 414 | Ga0373947_0042908 | 3300035725 | Bacteria | 2700 |
| 415 | Ga0373947_0196609 | 3300035725 | Bacteria | 1318 |
| 416 | Ga0373937_0001493 | 3300036401 | Bacteria | 19622 |
| 417 | Ga0373925_0007302 | 3300037068 | Bacteria | 8072 |
| 418 | Ga0395899_0058078 | 3300037312 | Bacteria | 2854 |
| 419 | Ga0395900_0001070 | 3300037418 | Bacteria | 34841 |
| 420 | Ga0395898_0005530 | 3300037466 | Bacteria | 13635 |
| 421 | Ga0395898_0017205 | 3300037466 | Bacteria | 7384 |
| 422 | Ga0395898_0038983 | 3300037466 | Bacteria | 4705 |
| 423 | Ga0395898_0096005 | 3300037466 | Bacteria | 2848 |
| 424 | Ga0395898_0147538 | 3300037466 | Bacteria | 2251 |
| 425 | Ga0395905_0007330 | 3300037471 | Bacteria | 10988 |
| 426 | Ga0395905_0102640 | 3300037471 | Bacteria | 2685 |
| 427 | Ga0436364_0042928 | 3300037853 | Bacteria | 71182 |
| 428 | Ga0436364_0108855 | 3300037853 | Bacteria | 36564 |
| 429 | Ga0436364_0346617 | 3300037853 | Bacteria | 24321 |
| 430 | Ga0436364_0817898 | 3300037853 | Bacteria | 3234 |
| 431 | Ga0436364_1343008 | 3300037853 | Bacteria | 2668 |
| 432 | Ga0395901_0014261 | 3300038443 | Bacteria | 8091 |
| 433 | Ga0395901_0015950 | 3300038443 | Bacteria | 7653 |
| 434 | Ga0395901_0124736 | 3300038443 | Bacteria | 2706 |
| 435 | Ga0395901_0129939 | 3300038443 | Bacteria | 2647 |
| 436 | Ga0395901_0185322 | 3300038443 | Bacteria | 2183 |
| 437 | Ga0436365_0064270 | 3300039437 | Bacteria | 1714 |
| 438 | Ga0436365_0161372 | 3300039437 | Bacteria | 1921 |
| 439 | Ga0436365_0234716 | 3300039437 | Bacteria | 3747 |
| 440 | Ga0436365_0369560 | 3300039437 | Bacteria | 2372 |
| 441 | Ga0436365_0383201 | 3300039437 | Bacteria | 1661 |
| 442 | Ga0436365_0677006 | 3300039437 | Bacteria | 6765 |
| 443 | Ga0436365_1301574 | 3300039437 | Bacteria | 3498 |
| 444 | Ga0436365_1424648 | 3300039437 | Bacteria | 18159 |
| 445 | Ga0436360_0078764 | 3300039438 | Bacteria | 6661 |
| 446 | Ga0436360_0466793 | 3300039438 | Bacteria | 2383 |
| 447 | Ga0436361_1169803 | 3300039447 | Bacteria | 4792 |
| 448 | Ga0436363_0383878 | 3300039450 | Bacteria | 1576 |
| 449 | Ga0436363_0693677 | 3300039450 | Bacteria | 3554 |
| 450 | Ga0436362_0187516 | 3300039453 | Bacteria | 1755 |
| 451 | Ga0436362_0618850 | 3300039453 | Bacteria | 7570 |
| 452 | Ga0451841_0603492 | 3300041498 | Bacteria | 1342 |
| 453 | Ga0439459_0021517 | 3300042438 | Bacteria | 1240 |
| 454 | Ga0466972_0000113 | 3300044658 | Bacteria | 69042 |
| 455 | Ga0466966_0000094 | 3300044684 | Bacteria | 54427 |
| 456 | Ga0466961_0000118 | 3300044693 | Bacteria | 52882 |
| 457 | Ga0466961_0134432 | 3300044693 | Bacteria | 1550 |
| 458 | Ga0466970_0058039 | 3300044765 | Bacteria | 2071 |
| 459 | Ga0495592_0001573 | 3300046454 | Bacteria | 15952 |
| 460 | Ga0495592_0021108 | 3300046454 | Bacteria | 4952 |
| 461 | Ga0495592_0041596 | 3300046454 | Bacteria | 3444 |
| 462 | Ga0495592_0059415 | 3300046454 | Bacteria | 2816 |
| 463 | Ga0495592_0118930 | 3300046454 | Bacteria | 1861 |
| 464 | Ga0495592_0184676 | 3300046454 | Bacteria | 1418 |
| 465 | Ga0495603_0030969 | 3300046455 | Bacteria | 3221 |
| 466 | Ga0495603_0082601 | 3300046455 | Bacteria | 1882 |
| 467 | Ga0495590_0034179 | 3300046457 | Bacteria | 1776 |
| 468 | Ga0495629_0000133 | 3300046459 | Bacteria | 64806 |
| 469 | Ga0495629_0010755 | 3300046459 | Bacteria | 6656 |
| 470 | Ga0495629_0018014 | 3300046459 | Bacteria | 5061 |
| 471 | Ga0495629_0048075 | 3300046459 | Bacteria | 2991 |
| 472 | Ga0495638_0007773 | 3300046460 | Bacteria | 7657 |
| 473 | Ga0495638_0092624 | 3300046460 | Bacteria | 1819 |
| 474 | Ga0495641_0003044 | 3300046461 | Bacteria | 12816 |
| 475 | Ga0495651_0009251 | 3300046462 | Bacteria | 7559 |
| 476 | Ga0495653_0001313 | 3300046463 | Bacteria | 19271 |
| 477 | Ga0495653_0081656 | 3300046463 | Bacteria | 2388 |
| 478 | Ga0495580_0006086 | 3300046472 | Bacteria | 9874 |
| 479 | Ga0495580_0172160 | 3300046472 | Bacteria | 1497 |
| 480 | Ga0495582_0000016 | 3300046473 | Bacteria | 100714 |
| 481 | Ga0495582_0013313 | 3300046473 | Bacteria | 4529 |
| 482 | Ga0495605_0031333 | 3300046474 | Bacteria | 2717 |
| 483 | Ga0495639_0000014 | 3300046475 | Bacteria | 82866 |
| 484 | Ga0495639_0031073 | 3300046475 | Bacteria | 2376 |
| 485 | Ga0495662_0000086 | 3300046476 | Bacteria | 33465 |
| 486 | Ga0495664_0004447 | 3300046477 | Bacteria | 7671 |
| 487 | Ga0495664_0007306 | 3300046477 | Bacteria | 6130 |
| 488 | Ga0495664_0145578 | 3300046477 | Bacteria | 1437 |
| 489 | Ga0495594_0000051 | 3300046499 | Bacteria | 52030 |
| 490 | Ga0495594_0112428 | 3300046499 | Bacteria | 1536 |
| 491 | Ga0495607_0103073 | 3300046501 | Bacteria | 1525 |
| 492 | Ga0495606_0016667 | 3300046507 | Bacteria | 5590 |
| 493 | Ga0495608_0003757 | 3300046511 | Bacteria | 10900 |
| 494 | Ga0495616_0026879 | 3300046513 | Bacteria | 3057 |
| 495 | Ga0495616_0049990 | 3300046513 | Bacteria | 2093 |
| 496 | Ga0495616_0090587 | 3300046513 | Bacteria | 1448 |
| 497 | Ga0495618_0114154 | 3300046514 | Bacteria | 1729 |
| 498 | Ga0495628_0004462 | 3300046516 | Bacteria | 12408 |
| 499 | Ga0495628_0007774 | 3300046516 | Bacteria | 9242 |
| 500 | Ga0495628_0010553 | 3300046516 | Bacteria | 7841 |
| 501 | Ga0495628_0184958 | 3300046516 | Bacteria | 1575 |
| 502 | Ga0495643_0019976 | 3300046522 | Bacteria | 3869 |
| 503 | Ga0495648_0001270 | 3300046524 | Bacteria | 25160 |
| 504 | Ga0495648_0022088 | 3300046524 | Bacteria | 4391 |
| 505 | Ga0495666_0020761 | 3300046526 | Bacteria | 3252 |
| 506 | Ga0495652_0008371 | 3300046529 | Bacteria | 9446 |
| 507 | Ga0495652_0036434 | 3300046529 | Bacteria | 4278 |
| 508 | Ga0495652_0056592 | 3300046529 | Bacteria | 3329 |
| 509 | Ga0495652_0121007 | 3300046529 | Bacteria | 2088 |
| 510 | Ga0495665_0000477 | 3300046531 | Bacteria | 20160 |
| 511 | Ga0495640_0001817 | 3300046533 | Bacteria | 16924 |
| 512 | Ga0495640_0007412 | 3300046533 | Bacteria | 8626 |
| 513 | Ga0495640_0011794 | 3300046533 | Bacteria | 6706 |
| 514 | Ga0495640_0015035 | 3300046533 | Bacteria | 5832 |
| 515 | Ga0495587_0000862 | 3300046536 | Bacteria | 20057 |
| 516 | Ga0495587_0008087 | 3300046536 | Bacteria | 6782 |
| 517 | Ga0495609_0026863 | 3300046538 | Bacteria | 2634 |
| 518 | Ga0495609_0077158 | 3300046538 | Bacteria | 1459 |
| 519 | Ga0495597_0025529 | 3300046542 | Bacteria | 2720 |
| 520 | Ga0495645_0024663 | 3300046543 | Bacteria | 4364 |
| 521 | Ga0495645_0099885 | 3300046543 | Bacteria | 2064 |
| 522 | Ga0495622_0006671 | 3300046557 | Bacteria | 5354 |
| 523 | Ga0495622_0012877 | 3300046557 | Bacteria | 3878 |
| 524 | Ga0495667_0000424 | 3300046559 | Bacteria | 27001 |
| 525 | Ga0495667_0015829 | 3300046559 | Bacteria | 5098 |
| 526 | Ga0495667_0058901 | 3300046559 | Bacteria | 2521 |
| 527 | Ga0495656_0002167 | 3300046615 | Bacteria | 6489 |
| 528 | Ga0495668_0019915 | 3300046616 | Bacteria | 3860 |
| 529 | Ga0495668_0080465 | 3300046616 | Bacteria | 1788 |
| 530 | Ga0495634_0003306 | 3300046642 | Bacteria | 12988 |
| 531 | Ga0495634_0006805 | 3300046642 | Bacteria | 8651 |
| 532 | Ga0495625_0061107 | 3300046660 | Bacteria | 2667 |
| 533 | Ga0495625_0070923 | 3300046660 | Bacteria | 2446 |
| 534 | Ga0495635_0000792 | 3300046663 | Bacteria | 20615 |
| 535 | Ga0495635_0002703 | 3300046663 | Bacteria | 12140 |
| 536 | Ga0495635_0005278 | 3300046663 | Bacteria | 8985 |
| 537 | Ga0495635_0026165 | 3300046663 | Bacteria | 4063 |
| 538 | Ga0495659_0011741 | 3300046664 | Bacteria | 2825 |
| 539 | Ga0495657_0001449 | 3300046675 | Bacteria | 20519 |
| 540 | Ga0495657_0013673 | 3300046675 | Bacteria | 5978 |
| 541 | Ga0495657_0022741 | 3300046675 | Bacteria | 4486 |
| 542 | Ga0495599_0000879 | 3300046678 | Bacteria | 16765 |
| 543 | Ga0495599_0013798 | 3300046678 | Bacteria | 4999 |
| 544 | Ga0495599_0048778 | 3300046678 | Bacteria | 2655 |
| 545 | Ga0495623_0002249 | 3300046679 | Bacteria | 12858 |
| 546 | Ga0495646_0002245 | 3300046680 | Bacteria | 11802 |
| 547 | Ga0495646_0032854 | 3300046680 | Bacteria | 3227 |
| 548 | Ga0495646_0105597 | 3300046680 | Bacteria | 1609 |
| 549 | Ga0495658_0001354 | 3300046683 | Bacteria | 12855 |
| 550 | Ga0495658_0044624 | 3300046683 | Bacteria | 2485 |
| 551 | Ga0495658_0048318 | 3300046683 | Bacteria | 2399 |
| 552 | Ga0495613_0006655 | 3300046689 | Bacteria | 8632 |
| 553 | Ga0495613_0024354 | 3300046689 | Bacteria | 4510 |
| 554 | Ga0495624_0000138 | 3300046690 | Bacteria | 52220 |
| 555 | Ga0495624_0010671 | 3300046690 | Bacteria | 6327 |
| 556 | Ga0495671_0053471 | 3300046692 | Bacteria | 2004 |
| 557 | Ga0495649_0042779 | 3300046694 | Bacteria | 2474 |
| 558 | Ga0495600_0000337 | 3300046809 | Bacteria | 25017 |
| 559 | Ga0495600_0005193 | 3300046809 | Bacteria | 7827 |
| 560 | Ga0495600_0151690 | 3300046809 | Bacteria | 1500 |
| 561 | Ga0495581_0000001 | 3300047315 | Bacteria | 104278 |
| 562 | Ga0495581_0023521 | 3300047315 | Bacteria | 3570 |
| 563 | Ga0495581_0081996 | 3300047315 | Bacteria | 1868 |
| 564 | Ga0495604_0001626 | 3300047317 | Bacteria | 18533 |
| 565 | Ga0495604_0017599 | 3300047317 | Bacteria | 5722 |
| 566 | Ga0495604_0169005 | 3300047317 | Bacteria | 1539 |
| 567 | Ga0495674_0002545 | 3300047319 | Bacteria | 17760 |
| 568 | Ga0495674_0018873 | 3300047319 | Bacteria | 6414 |
| 569 | Ga0495674_0145940 | 3300047319 | Bacteria | 1986 |
| 570 | Ga0495674_0311730 | 3300047319 | Bacteria | 1284 |
| 571 | Ga0495672_0007184 | 3300047320 | Bacteria | 8418 |
| 572 | Ga0495672_0031356 | 3300047320 | Bacteria | 3319 |
| 573 | Ga0495676_0003317 | 3300047321 | Bacteria | 14549 |
| 574 | Ga0495676_0143571 | 3300047321 | Bacteria | 1708 |
| 575 | Ga0495680_0002491 | 3300047322 | Bacteria | 18828 |
| 576 | Ga0495680_0005089 | 3300047322 | Bacteria | 12405 |
| 577 | Ga0495680_0156052 | 3300047322 | Bacteria | 1660 |
| 578 | Ga0495687_014891 | 3300047443 | Bacteria | 3975 |
| 579 | Ga0495675_0012328 | 3300047444 | Bacteria | 5380 |
| 580 | Ga0495675_0024995 | 3300047444 | Bacteria | 3809 |
| 581 | Ga0495675_0035435 | 3300047444 | Bacteria | 3187 |
| 582 | Ga0495673_0069111 | 3300047469 | Bacteria | 1491 |
| 583 | Ga0495673_0090619 | 3300047469 | Unclassified | 1250 |
| 584 | Ga0495684_0001407 | 3300047471 | Bacteria | 19272 |
| 585 | Ga0495684_0005971 | 3300047471 | Bacteria | 9460 |
| 586 | Ga0495593_0000003 | 3300047673 | Bacteria | 120744 |
| 587 | Ga0495593_0002446 | 3300047673 | Bacteria | 11170 |
| 588 | Ga0495602_0007241 | 3300048088 | Bacteria | 11617 |
| 589 | Ga0495602_0019961 | 3300048088 | Bacteria | 6634 |
| 590 | Ga0495602_0039312 | 3300048088 | Bacteria | 4359 |
| 591 | Ga0495602_0115379 | 3300048088 | Bacteria | 2173 |
| 592 | Ga0495614_0006055 | 3300048089 | Bacteria | 5438 |
| 593 | Ga0496100_0007585 | 3300048903 | Bacteria | 5998 |
| 594 | Ga0496100_0042150 | 3300048903 | Bacteria | 2914 |
| 595 | Ga0496100_0119453 | 3300048903 | Bacteria | 1842 |
| 596 | Ga0496101_0127876 | 3300048904 | Bacteria | 1927 |
| 597 | Ga0496102_0014231 | 3300048905 | Bacteria | 6913 |
| 598 | Ga0496102_0018355 | 3300048905 | Bacteria | 6145 |
| 599 | Ga0496102_0083203 | 3300048905 | Bacteria | 2953 |
| 600 | Ga0496103_0022816 | 3300048906 | Bacteria | 3770 |
| 601 | Ga0496104_0022932 | 3300048907 | Bacteria | 5736 |
| 602 | Ga0496104_0024758 | 3300048907 | Bacteria | 5526 |
| 603 | Ga0496104_0036043 | 3300048907 | Bacteria | 4621 |
| 604 | Ga0496104_0073880 | 3300048907 | Bacteria | 3244 |
| 605 | Ga0496104_0130155 | 3300048907 | Bacteria | 2417 |
| 606 | Ga0496104_0203556 | 3300048907 | Bacteria | 1891 |
| 607 | Ga0496105_0002092 | 3300048908 | Bacteria | 14435 |
| 608 | Ga0496105_0011739 | 3300048908 | Bacteria | 6932 |
| 609 | Ga0496105_0041425 | 3300048908 | Bacteria | 3796 |
| 610 | Ga0496105_0044963 | 3300048908 | Bacteria | 3643 |
| 611 | Ga0496105_0050731 | 3300048908 | Bacteria | 3428 |
| 612 | Ga0496105_0267569 | 3300048908 | Bacteria | 1381 |
| 613 | Ga0496106_0001202 | 3300048909 | Bacteria | 19326 |
| 614 | Ga0496106_0011446 | 3300048909 | Bacteria | 6562 |
| 615 | Ga0496106_0015453 | 3300048909 | Bacteria | 5650 |
| 616 | Ga0496106_0018182 | 3300048909 | Bacteria | 5199 |
| 617 | Ga0496106_0068108 | 3300048909 | Bacteria | 2715 |
| 618 | Ga0496106_0265684 | 3300048909 | Bacteria | 1373 |
| 619 | Ga0496107_0002624 | 3300048910 | Bacteria | 11754 |
| 620 | Ga0496107_0009825 | 3300048910 | Bacteria | 6636 |
| 621 | Ga0496107_0011885 | 3300048910 | Bacteria | 6082 |
| 622 | Ga0496108_0001960 | 3300048911 | Bacteria | 16479 |
| 623 | Ga0496108_0018478 | 3300048911 | Bacteria | 5708 |
| 624 | Ga0496108_0050815 | 3300048911 | Bacteria | 3472 |
| 625 | Ga0496108_0180764 | 3300048911 | Bacteria | 1826 |
| 626 | Ga0496109_0000432 | 3300048912 | Bacteria | 36461 |
| 627 | Ga0496109_0010188 | 3300048912 | Bacteria | 8024 |
| 628 | Ga0496109_0055955 | 3300048912 | Bacteria | 3599 |
| 629 | Ga0496109_0234299 | 3300048912 | Bacteria | 1728 |
| 630 | Ga0496110_0012555 | 3300048913 | Bacteria | 6968 |
| 631 | Ga0496110_0027219 | 3300048913 | Bacteria | 4900 |
| 632 | Ga0496110_0029803 | 3300048913 | Bacteria | 4701 |
| 633 | Ga0496110_0187050 | 3300048913 | Bacteria | 1881 |
| 634 | Ga0496110_0211027 | 3300048913 | Bacteria | 1765 |
| 635 | Ga0496111_0013188 | 3300048914 | Bacteria | 5620 |
| 636 | Ga0496111_0039393 | 3300048914 | Bacteria | 3388 |
| 637 | Ga0496111_0091744 | 3300048914 | Bacteria | 2226 |
| 638 | Ga0496112_0015915 | 3300048915 | Bacteria | 7029 |
| 639 | Ga0496112_0033682 | 3300048915 | Bacteria | 4980 |
| 640 | Ga0496112_0061568 | 3300048915 | Bacteria | 3700 |
| 641 | Ga0496112_0100707 | 3300048915 | Bacteria | 2859 |
| 642 | Ga0496112_0112903 | 3300048915 | Bacteria | 2688 |
| 643 | Ga0496112_0194315 | 3300048915 | Bacteria | 1990 |
| 644 | Ga0496112_0206592 | 3300048915 | Bacteria | 1922 |
| 645 | Ga0496113_0014649 | 3300048916 | Bacteria | 5359 |
| 646 | Ga0496113_0032600 | 3300048916 | Bacteria | 3786 |
| 647 | Ga0496114_0008432 | 3300048917 | Bacteria | 8162 |
| 648 | Ga0496115_0009310 | 3300048918 | Bacteria | 7298 |
| 649 | Ga0496115_0033310 | 3300048918 | Bacteria | 4067 |
| 650 | Ga0496115_0063699 | 3300048918 | Bacteria | 2975 |
| 651 | Ga0496115_0078069 | 3300048918 | Bacteria | 2693 |
| 652 | Ga0496115_0133099 | 3300048918 | Bacteria | 2050 |
| 653 | Ga0496118_0019947 | 3300048921 | Bacteria | 5966 |
| 654 | Ga0496118_0029396 | 3300048921 | Bacteria | 4609 |
| 655 | Ga0496118_0036940 | 3300048921 | Bacteria | 3940 |
| 656 | Ga0496118_0134801 | 3300048921 | Bacteria | 1578 |
| 657 | Ga0496119_0013953 | 3300048922 | Bacteria | 6336 |
| 658 | Ga0496120_0007436 | 3300048923 | Bacteria | 8144 |
| 659 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 660 | Ga0496121_0003563 | 3300048924 | Bacteria | 22031 |
| 661 | Ga0496121_0005352 | 3300048924 | Bacteria | 16504 |
| 662 | Ga0496121_0009890 | 3300048924 | Bacteria | 10868 |
| 663 | Ga0496121_0028205 | 3300048924 | Bacteria | 5231 |
| 664 | Ga0496121_0039020 | 3300048924 | Bacteria | 4193 |
| 665 | Ga0496121_0071909 | 3300048924 | Bacteria | 2780 |
| 666 | Ga0496121_0100982 | 3300048924 | Bacteria | 2226 |
| 667 | Ga0496121_0111107 | 3300048924 | Bacteria | 2091 |
| 668 | Ga0496122_0030990 | 3300048925 | Bacteria | 4464 |
| 669 | Ga0496124_0000624 | 3300048927 | Bacteria | 58976 |
| 670 | Ga0496124_0040676 | 3300048927 | Bacteria | 4019 |
| 671 | Ga0496125_0036744 | 3300048928 | Bacteria | 4270 |
| 672 | Ga0496125_0040200 | 3300048928 | Bacteria | 4014 |
| 673 | Ga0496125_0053440 | 3300048928 | Bacteria | 3311 |
| 674 | Ga0496125_0075947 | 3300048928 | Bacteria | 2597 |
| 675 | Ga0496125_0092232 | 3300048928 | Bacteria | 2265 |
| 676 | Ga0496126_0002321 | 3300048929 | Bacteria | 26096 |
| 677 | Ga0496126_0008801 | 3300048929 | Bacteria | 10829 |
| 678 | Ga0496126_0010022 | 3300048929 | Bacteria | 10000 |
| 679 | Ga0496126_0015516 | 3300048929 | Bacteria | 7659 |
| 680 | Ga0496126_0018293 | 3300048929 | Bacteria | 6951 |
| 681 | Ga0496126_0029558 | 3300048929 | Bacteria | 5204 |
| 682 | Ga0496126_0030071 | 3300048929 | Bacteria | 5153 |
| 683 | Ga0496126_0032840 | 3300048929 | Bacteria | 4885 |
| 684 | Ga0496126_0051884 | 3300048929 | Bacteria | 3732 |
| 685 | Ga0496126_0198822 | 3300048929 | Bacteria | 1694 |
| 686 | Ga0496126_0206653 | 3300048929 | Bacteria | 1655 |
| 687 | Ga0496126_0255689 | 3300048929 | Bacteria | 1458 |
| 688 | Ga0496126_0351501 | 3300048929 | Bacteria | 1205 |
| 689 | Ga0501032_0005102 | 3300049569 | Bacteria | 9799 |
| 690 | Ga0501032_0076754 | 3300049569 | Bacteria | 2224 |
| 691 | Ga0501033_0001834 | 3300049570 | Bacteria | 18512 |
| 692 | Ga0501033_0051989 | 3300049570 | Bacteria | 3036 |
| 693 | Ga0501034_0001471 | 3300049571 | Bacteria | 31174 |
| 694 | Ga0501034_0134384 | 3300049571 | Bacteria | 2455 |
| 695 | Ga0501034_0444984 | 3300049571 | Bacteria | 1214 |
| 696 | Ga0501036_0050117 | 3300049572 | Bacteria | 3536 |
| 697 | Ga0501036_0053755 | 3300049572 | Bacteria | 3410 |
| 698 | Ga0501037_0005747 | 3300049573 | Bacteria | 9056 |
| 699 | Ga0501037_0086729 | 3300049573 | Bacteria | 2265 |
| 700 | Ga0501038_0002435 | 3300049574 | Bacteria | 17326 |
| 701 | Ga0501038_0014916 | 3300049574 | Bacteria | 7074 |
| 702 | Ga0501038_0042310 | 3300049574 | Bacteria | 3967 |
| 703 | Ga0501039_0010117 | 3300049575 | Bacteria | 7185 |
| 704 | Ga0501040_0054616 | 3300049576 | Bacteria | 2738 |
| 705 | Ga0501042_0045227 | 3300049578 | Bacteria | 3137 |
| 706 | Ga0501043_0019449 | 3300049579 | Bacteria | 5330 |
| 707 | Ga0501043_0020212 | 3300049579 | Bacteria | 5228 |
| 708 | Ga0501043_0061463 | 3300049579 | Bacteria | 2950 |
| 709 | Ga0501046_0007012 | 3300049580 | Bacteria | 9927 |
| 710 | Ga0501046_0073620 | 3300049580 | Bacteria | 2651 |
| 711 | Ga0501046_0075087 | 3300049580 | Bacteria | 2621 |
| 712 | Ga0501047_0014876 | 3300049581 | Bacteria | 7407 |
| 713 | Ga0501047_0082968 | 3300049581 | Bacteria | 3081 |
| 714 | Ga0501047_0140691 | 3300049581 | Bacteria | 2292 |
| 715 | Ga0501048_0006412 | 3300049582 | Bacteria | 8942 |
| 716 | Ga0501068_0024706 | 3300049584 | Bacteria | 3529 |
| 717 | Ga0501074_0149427 | 3300049590 | Bacteria | 1670 |
| 718 | Ga0501076_0100259 | 3300049592 | Bacteria | 2333 |
| 719 | Ga0501079_0236102 | 3300049741 | Bacteria | 1428 |
| 720 | Ga0501080_0088666 | 3300049742 | Bacteria | 2874 |
| 721 | Ga0501080_0108978 | 3300049742 | Bacteria | 2566 |
| 722 | Ga0501080_0130979 | 3300049742 | Bacteria | 2322 |
| 723 | Ga0501035_0002268 | 3300049822 | Bacteria | 18995 |
| 724 | Ga0501035_0026433 | 3300049822 | Bacteria | 5310 |
| 725 | Ga0501035_0055661 | 3300049822 | Bacteria | 3531 |
| 726 | Ga0501044_0007852 | 3300049823 | Bacteria | 11732 |
| 727 | Ga0501044_0020966 | 3300049823 | Bacteria | 6978 |
| 728 | Ga0501044_0060417 | 3300049823 | Bacteria | 3881 |
| 729 | Ga0501045_0032361 | 3300049824 | Bacteria | 3789 |
| 730 | nmdc:mga0yw44_23996_c1 | 3300050492 | Bacteria | 3444 |
| 731 | nmdc:mga0yw44_31714_c1 | 3300050492 | Bacteria | 3075 |
| 732 | nmdc:mga0yw44_5423_c1 | 3300050492 | Bacteria | 6024 |
| 733 | nmdc:mga06z11_27907_c1 | 3300050494 | Bacteria | 2703 |
| 734 | nmdc:mga0rr50_147154_c1 | 3300050513 | Bacteria | 1900 |
| 735 | nmdc:mga0a205_317757_c1 | 3300050515 | Bacteria | 1428 |
| 736 | nmdc:mga0sz30_14368_c1 | 3300050516 | Bacteria | 1556 |
| 737 | nmdc:mga0sz30_64384_c1 | 3300050516 | Bacteria | 1570 |
| 738 | Ga0495601_0054028 | 3300053077 | Bacteria | 2540 |
| 739 | Ga0495601_0112208 | 3300053077 | Bacteria | 1766 |
| 740 | Ga0500635_0015520 | 3300053080 | Bacteria | 2251 |
| 741 | Ga0495595_0001668 | 3300053084 | Bacteria | 8691 |
| 742 | Ga0495595_0003281 | 3300053084 | Bacteria | 6426 |
| 743 | Ga0495595_0011648 | 3300053084 | Bacteria | 3680 |
| 744 | Ga0495619_0025449 | 3300053085 | Bacteria | 3801 |
| 745 | Ga0495619_0076189 | 3300053085 | Bacteria | 2251 |
| 746 | Ga0495619_0159548 | 3300053085 | Bacteria | 1557 |
| 747 | Ga0500643_001180 | 3300053087 | Bacteria | 15589 |
| 748 | Ga0500647_0036075 | 3300053091 | Bacteria | 2363 |
| 749 | Ga0500647_0095598 | 3300053091 | Bacteria | 1421 |
| 750 | Ga0500583_0079752 | 3300053092 | Bacteria | 1579 |
| 751 | Ga0500566_0000062 | 3300053094 | Bacteria | 51144 |
| 752 | Ga0500566_0000112 | 3300053094 | Bacteria | 41687 |
| 753 | Ga0500566_0002624 | 3300053094 | Bacteria | 10704 |
| 754 | Ga0500640_000394 | 3300053095 | Bacteria | 10451 |
| 755 | Ga0500554_001136 | 3300053102 | Bacteria | 5151 |
| 756 | Ga0500556_0000750 | 3300053104 | Bacteria | 19347 |
| 757 | Ga0500557_000003 | 3300053105 | Bacteria | 228429 |
| 758 | Ga0500562_023587 | 3300053108 | Bacteria | 1606 |
| 759 | Ga0500572_000239 | 3300053111 | Bacteria | 19483 |
| 760 | Ga0500572_000775 | 3300053111 | Bacteria | 10244 |
| 761 | Ga0500591_066690 | 3300053115 | Bacteria | 1642 |
| 762 | Ga0500595_017745 | 3300053119 | Bacteria | 2620 |
| 763 | Ga0500595_031296 | 3300053119 | Bacteria | 1786 |
| 764 | Ga0500614_021021 | 3300053123 | Bacteria | 1511 |
| 765 | Ga0500642_0002011 | 3300053130 | Bacteria | 5902 |
| 766 | Ga0500642_0025721 | 3300053130 | Bacteria | 2394 |
| 767 | Ga0500642_0121700 | 3300053130 | Bacteria | 1221 |
| 768 | Ga0500559_0001790 | 3300053136 | Bacteria | 11801 |
| 769 | Ga0500559_0004994 | 3300053136 | Bacteria | 6162 |
| 770 | Ga0500603_001625 | 3300053150 | Bacteria | 5069 |
| 771 | Ga0500616_0006635 | 3300053153 | Bacteria | 7533 |
| 772 | Ga0500622_0025785 | 3300053156 | Bacteria | 3104 |
| 773 | Ga0500627_0051117 | 3300053158 | Bacteria | 1802 |
| 774 | Ga0500630_003625 | 3300053159 | Bacteria | 7477 |
| 775 | Ga0500638_001061 | 3300053162 | Bacteria | 8066 |
| 776 | Ga0500639_000061 | 3300053163 | Bacteria | 49500 |
| 777 | Ga0500636_0000284 | 3300053177 | Bacteria | 28033 |
| 778 | Ga0500636_0023548 | 3300053177 | Bacteria | 3640 |
| 779 | Ga0500637_0000098 | 3300053178 | Bacteria | 31362 |
| 780 | Ga0500625_000220 | 3300053729 | Bacteria | 13001 |
| 781 | Ga0500596_000699 | 3300053735 | Bacteria | 6539 |
| 782 | Ga0500596_000998 | 3300053735 | Bacteria | 5669 |
| 783 | Ga0500596_003937 | 3300053735 | Bacteria | 2773 |
| 784 | Ga0500601_000233 | 3300053737 | Bacteria | 10949 |
| 785 | Ga0500601_001561 | 3300053737 | Bacteria | 2483 |
| 786 | Ga0501084_0076301 | 3300054114 | Bacteria | 2809 |
| 787 | 2507507555 | 2507262055 | Bacteria | 8048963 |
| 788 | 2508541673 | 2508501009 | Bacteria | 7784016 |
| 789 | 2508692788 | 2508501042 | Bacteria | 8719808 |
| 790 | 2509152953 | 2508501128 | Bacteria | 8613869 |
| 791 | 2511394850 | 2511231028 | Bacteria | 8046582 |
| 792 | 2513621750 | 2513237092 | Bacteria | 8341956 |
| 793 | 2513636808 | 2513237094 | Bacteria | 8789602 |
| 794 | 2513651250 | 2513237095 | Bacteria | 8976980 |
| 795 | 2513654195 | 2513237096 | Bacteria | 8722461 |
| 796 | 2513674875 | 2513237098 | Bacteria | 9902361 |
| 797 | 2513697138 | 2513237101 | Bacteria | 7952346 |
| 798 | 2513704455 | 2513237102 | Bacteria | 7703324 |
| 799 | 2513720784 | 2513237104 | Bacteria | 10034502 |
| 800 | 2513856950 | 2513237137 | Bacteria | 9558895 |
| 801 | 2513878752 | 2513237139 | Bacteria | 8737671 |
| 802 | 2513894154 | 2513237141 | Bacteria | 8496279 |
| 803 | 2513918535 | 2513237145 | Bacteria | 8979722 |
| 804 | 2514011818 | 2513237161 | Bacteria | 8871253 |
| 805 | 2517104275 | 2517093001 | Bacteria | 9002274 |
| 806 | 2517891229 | 2517572143 | Bacteria | 9484767 |
| 807 | 2524468253 | 2524023210 | Bacteria | 9029266 |
| 808 | 2524533576 | 2524023228 | Bacteria | 10118060 |
| 809 | 2528848869 | 2528768022 | Bacteria | 10457665 |
| 810 | 2530646710 | 2529292951 | Bacteria | 6916614 |
| 811 | 2563055992 | 2562617112 | Bacteria | 10918404 |
| 812 | 2617346909 | 2617270735 | Bacteria | 9163226 |
| 813 | 2617372839 | 2617270741 | Bacteria | 8201522 |
| 814 | 2671123164 | 2667528175 | Bacteria | 7532676 |
| 815 | 2713472194 | 2711768613 | Bacteria | 11048459 |
| 816 | 2723843588 | 2721755755 | Bacteria | 8322773 |
| 817 | 2728749927 | 2728368998 | Bacteria | 8720350 |
| 818 | 2745080874 | 2744054633 | Bacteria | 8678936 |
| 819 | 2793060982 | 2791355196 | Bacteria | 7323613 |
| 820 | 2793066584 | 2791355197 | Bacteria | 8420563 |
| 821 | 2793083894 | |||
| 822 | 2805921401 | 2802429603 | Bacteria | 8777136 |
| 823 | 2818236671 | 2816332527 | Bacteria | 8933356 |
| 824 | 2824602891 | 2824600985 | Bacteria | 8488197 |
| 825 | 2824611886 | 2824609381 | Bacteria | 8672835 |
| 826 | 2824621477 | 2824617872 | Bacteria | 8814715 |
| 827 | 2824630589 | 2824626560 | Bacteria | 8813858 |
| 828 | 2824638707 | 2824635225 | Bacteria | 8785348 |
| 829 | 2824650098 | 2824644064 | Bacteria | 8743947 |
| 830 | 2824660923 | 2824653114 | Bacteria | 8493680 |
| 831 | 2824664500 | 2824661429 | Bacteria | 9877870 |
| 832 | 2824672213 | 2824671348 | Bacteria | 8369588 |
| 833 | 2824682162 | 2824679649 | Bacteria | 8248951 |
| 834 | 2824688904 | 2824687955 | Bacteria | 8360029 |
| 835 | 2824697741 | 2824696289 | Bacteria | 8335049 |
| 836 | 2824709247 | 2824704595 | Bacteria | 9667483 |
| 837 | 2824719056 | 2824714736 | Bacteria | 8717648 |
| 838 | 2824730391 | 2824723954 | Bacteria | 8758240 |
| 839 | 2824733921 | 2824732956 | Bacteria | 7810675 |
| 840 | 2824748354 | 2824746037 | Bacteria | 7911610 |
| 841 | 2824758020 | 2824753945 | Bacteria | 9787441 |
| 842 | 2824766445 | 2824763712 | Bacteria | 9792355 |
| 843 | 2824776572 | 2824773399 | Bacteria | 8360218 |
| 844 | 2838129330 | 2838122688 | Bacteria | 8803140 |
| 845 | 2841948014 | 2841941048 | Bacteria | 8688029 |
| 846 | 2841953588 | 2841949485 | Bacteria | 8680857 |
| 847 | 2841962805 | 2841957949 | Bacteria | 8652217 |
| 848 | 2841973007 | 2841966195 | Bacteria | 8673214 |
| 849 | 2841978315 | 2841974524 | Bacteria | 8931498 |
| 850 | 2841990535 | 2841983080 | Bacteria | 8395090 |
| 851 | 2842040756 | 2842038055 | Bacteria | 8002051 |
| 852 | 2842046298 | 2842045827 | Bacteria | 8006841 |
| 853 | 2844320136 | 2844315083 | Bacteria | 8138177 |
| 854 | 2847933258 | 2847930680 | Bacteria | 9342022 |
| 855 | 2847937431 | 2847930680 | Bacteria | 9342022 |
| 856 | 2847947855 | 2847939898 | Bacteria | 8606328 |
| 857 | 2849078290 | 2849076700 | Bacteria | 7039503 |
| 858 | 2857512666 | 2857509624 | Bacteria | 7472071 |
| 859 | 2874598670 | 2874590934 | Bacteria | 8299676 |
| 860 | 2874607203 | 2874604998 | Bacteria | 7834745 |
| 861 | 2874614456 | 2874612657 | Bacteria | 8252029 |
| 862 | 2874628187 | 2874620515 | Bacteria | 8290088 |
| 863 | 2874630210 | 2874628541 | Bacteria | 8630250 |
| 864 | 2874652125 | 2874645413 | Bacteria | 8214782 |
| 865 | 2876768198 | 2876761206 | Bacteria | 10111113 |
| 866 | 2876778709 | 2876771140 | Bacteria | 8287509 |
| 867 | 2876818316 | 2876808645 | Bacteria | 8824342 |
| 868 | 2876823513 | 2876818435 | Bacteria | 8274608 |
| 869 | 2879082502 | 2879074833 | Bacteria | 8279565 |
| 870 | 2879107821 | 2879099564 | Bacteria | 10442239 |
| 871 | 2879114093 | 2879110137 | Bacteria | 8907982 |
| 872 | 2879131718 | 2879127579 | Bacteria | 8294491 |
| 873 | 2879150054 | 2879142872 | Bacteria | 8267021 |
| 874 | 2881371350 | 2881364244 | Bacteria | 7710352 |
| 875 | 2881672204 | 2881665667 | Bacteria | 8175609 |
| 876 | 2885370076 | 2885366525 | Bacteria | 8326213 |
| 877 | 2885383123 | 2885374607 | Bacteria | 8927485 |
| 878 | 2885391947 | 2885383462 | Bacteria | 9473874 |
| 879 | 2885415622 | 2885409591 | Bacteria | 9235467 |
| 880 | 2888385573 | 2888378607 | Bacteria | 9652610 |
| 881 | 2888392676 | 2888388044 | Bacteria | 7304136 |
| 882 | 2888425703 | 2888419890 | Bacteria | 7857137 |
| 883 | 2889037906 | 2889033259 | Bacteria | 9099371 |
| 884 | 2903731270 | 2903727486 | Bacteria | 8281579 |
| 885 | 2903753330 | 2903748898 | Bacteria | 9972761 |
| 886 | 2903774854 | 2903768456 | Bacteria | 9749579 |
| 887 | 2904674195 | 2904666416 | Bacteria | 8226587 |
| 888 | 2904694150 | 2904690495 | Bacteria | 9412302 |
| 889 | 2904701134 | |||
| 890 | 2904711857 | 2904711408 | Bacteria | 9771557 |
| 891 | 2906609961 | 2906602504 | Bacteria | 8295279 |
| 892 | 2906616413 | |||
| 893 | 2906627716 | 2906626472 | Bacteria | 8826946 |
| 894 | 2906638132 | 2906635258 | Bacteria | 8601019 |
| 895 | 2906649617 | 2906643746 | Bacteria | 8722424 |
| 896 | 2906662807 | 2906660503 | Bacteria | 8595048 |
| 897 | 2908741558 | 2908739725 | Bacteria | 8628932 |
| 898 | 2908758996 | 2908756301 | Bacteria | 8864324 |
| 899 | 2908781286 | 2908775508 | Bacteria | 8092255 |
| 900 | 2922361843 | 2922361189 | Bacteria | 7436256 |
| 901 | 2922372293 | |||
| 902 | 2922386925 | 2922386360 | Bacteria | 7017218 |
| 903 | 2922396961 | 2922393267 | Bacteria | 8285685 |
| 904 | 2922431582 | |||
| 905 | 2929621141 | 2929615660 | Bacteria | 9193770 |
| 906 | 2929626028 | 2929624759 | Bacteria | 9339455 |
| 907 | 2932785092 | 2932784394 | Bacteria | 9704911 |
| 908 | 2932795036 | 2932794094 | Bacteria | 7915132 |
| 909 | 2932805564 | 2932801729 | Bacteria | 7987968 |
| 910 | 2932810120 | 2932809354 | Bacteria | 9135765 |
| 911 | 2932821693 | 2932818245 | Bacteria | 9955613 |
| 912 | 2932828929 | 2932828146 | Bacteria | 9745859 |
| 913 | 2933582990 | 2933577622 | Bacteria | 9116884 |
| 914 | 2935609938 | 2935608549 | Bacteria | 8203142 |
| 915 | 2935619652 | 2935616580 | Bacteria | 9032984 |
| 916 | 2935636117 | 2935630451 | Bacteria | 8169952 |
| 917 | 2935638147 | 2935630451 | Bacteria | 8169952 |
| 918 | 2935638632 | 2935638405 | Bacteria | 10015038 |
| 919 | 2935652031 | 2935648319 | Bacteria | 8801166 |
| 920 | 2935659996 | 2935656913 | Bacteria | 8965014 |
| 921 | 2935666516 | 2935665750 | Bacteria | 9571747 |
| 922 | 2935676441 | 2935675223 | Bacteria | 9928132 |
| 923 | 2935691043 | 2935684952 | Bacteria | 9590419 |
| 924 | 2935694523 | 2935694250 | Bacteria | 9291695 |
| 925 | 2935703638 | 2935703347 | Bacteria | 10242284 |
| 926 | 2935718424 | 2935713505 | Bacteria | 9608509 |
| 927 | 2935727596 | 2935722832 | Bacteria | 9608746 |
| 928 | 2935736299 | 2935732158 | Bacteria | 9706831 |
| 929 | 2935745679 | 2935741537 | Bacteria | 9707219 |
| 930 | 2935756060 | 2935750917 | Bacteria | 9590372 |
| 931 | 2935760680 | 2935760218 | Bacteria | 9817913 |
| 932 | 2935776097 | 2935769743 | Bacteria | 7878163 |
| 933 | 2935785148 | 2935777560 | Bacteria | 8077691 |
| 934 | 2935791890 | 2935785616 | Bacteria | 7962367 |
| 935 | 2935800300 | 2935793552 | Bacteria | 8012592 |
| 936 | 2935801776 | 2935801545 | Bacteria | 9301974 |
| 937 | 2935814809 | 2935810662 | Bacteria | 9401221 |
| 938 | 2935823098 | 2935819856 | Bacteria | 8261050 |
| 939 | 2935827761 | 2935819856 | Bacteria | 8261050 |
| 940 | 2935828126 | 2935827899 | Bacteria | 10038562 |
| 941 | 2935842331 | 2935837841 | Bacteria | 9454360 |
| 942 | 2935848680 | 2935847175 | Bacteria | 8228321 |
| 943 | 2935855075 | 2935847175 | Bacteria | 8228321 |
| 944 | 2935858033 | 2935855204 | Bacteria | 9035059 |
| 945 | 2935867937 | 2935864058 | Bacteria | 9784707 |
| 946 | 2935874039 | 2935873716 | Bacteria | 9632195 |
| 947 | 2935885765 | 2935883170 | Bacteria | 7964738 |
| 948 | 2935909515 | 2935908558 | Bacteria | 8568796 |
| 949 | 2935917239 | 2935916978 | Bacteria | 9113783 |
| 950 | 2935926996 | 2935926038 | Bacteria | 8601059 |
| 951 | 2935937160 | 2935934488 | Bacteria | 8602579 |
| 952 | 2935944537 | 2935942939 | Bacteria | 8599779 |
| 953 | 2935952974 | 2935951376 | Bacteria | 8602333 |
| 954 | 2935962833 | 2935959822 | Bacteria | 7869783 |
| 955 | 2935969814 | 2935967501 | Bacteria | 8603075 |
| 956 | 2935976411 | 2935975950 | Bacteria | 8347125 |
| 957 | 2935987141 | 2935984226 | Bacteria | 8302647 |
| 958 | 2935993036 | 2935992306 | Bacteria | 9802711 |
| 959 | 2936002948 | 2936002035 | Bacteria | 9362176 |
| 960 | 2936014412 | 2936011229 | Bacteria | 8801034 |
| 961 | 2936023748 | 2936019824 | Bacteria | 8804134 |
| 962 | 2936031391 | 2936028420 | Bacteria | 8965941 |
| 963 | 2936040548 | 2936037263 | Bacteria | 9446081 |
| 964 | 2936049518 | 2936046547 | Bacteria | 8903709 |
| 965 | 2936061266 | 2936055302 | Bacteria | 8785755 |
| 966 | 2940561965 | 2940556831 | Bacteria | 9590747 |
| 967 | 2941512748 | 2941507105 | Bacteria | 8166816 |
| 968 | 2941514780 | 2941507105 | Bacteria | 8166816 |
| 969 | 2941520685 | 2941515067 | Bacteria | 8166720 |
| 970 | 2941522762 | 2941515067 | Bacteria | 8166720 |
| 971 | 2941528699 | 2941523033 | Bacteria | 8169134 |
| 972 | 2941530673 | 2941523033 | Bacteria | 8169134 |
| 973 | 2941531318 | 2941531003 | Bacteria | 7653939 |
| 974 | 2941542380 | 2941538514 | Bacteria | 9402094 |
| 975 | 3005481375 | 3005474847 | Bacteria | 9259049 |
| 976 | 3005485515 | 3005483717 | Bacteria | 7877331 |
| 977 | 3005508329 | 3005506211 | Bacteria | 6943378 |
| 978 | 3005588171 | 3005587118 | Bacteria | 7794411 |
| 979 | 3005600435 | 3005594810 | Bacteria | 8716512 |
| 980 | 3005715916 | 3005710791 | Bacteria | 7622528 |
| 981 | 3005723271 | 3005718088 | Bacteria | 8283608 |
| 982 | 8006933195 | 8006926726 | Bacteria | 6749210 |
| 983 | 8006939332 | 8006933436 | Bacteria | 10410654 |
| 984 | 8006968863 | 8006964411 | Bacteria | 8966052 |
| 985 | 8006978989 | 8006973647 | Bacteria | 10679141 |
| 986 | 8006984543 | 8006984368 | Bacteria | 9651211 |
| 987 | 8006997169 | 8006994254 | Bacteria | 8309700 |
| 988 | 8016520534 | 8016511872 | Bacteria | 9921665 |
| 989 | 8016528575 | 8016522445 | Bacteria | 8156687 |
| 990 | 8016555150 | 8016548790 | Bacteria | 8155074 |
| 991 | 8016563519 | 8016557553 | Bacteria | 8154380 |
| 992 | 8016572076 | 8016566248 | Bacteria | 8158151 |
| 993 | 8016594487 | 8016583857 | Bacteria | 10421953 |
| 994 | 8016601259 | 8016595262 | Bacteria | 8149947 |
| 995 | 8016609174 | 8016603502 | Bacteria | 8731218 |
| 996 | 8016615728 | 8016613128 | Bacteria | 8794220 |
| 997 | 8016625500 | 8016622563 | Bacteria | 7999408 |
| 998 | 8016639056 | 8016630954 | Bacteria | 9217207 |
| 999 | 8017065041 | 8017057580 | Bacteria | 10023680 |
| 1000 | 8019533520 | 8019530166 | Bacteria | 8155624 |
| 1001 | 8019546157 | 8019538911 | Bacteria | 7872763 |
| 1002 | 8019552550 | 8019547302 | Bacteria | 7996444 |
| 1003 | 8019575303 | 8019565922 | Bacteria | 9639779 |
| 1004 | 8019592197 | 8019586578 | Bacteria | 10212056 |
| 1005 | 8019599087 | 8019597564 | Bacteria | 10041141 |
| 1006 | 8019609273 | 8019608314 | Bacteria | 10042931 |
| 1007 | 8019633182 | 8019629233 | Bacteria | 8687553 |
| 1008 | 8019646714 | 8019638758 | Bacteria | 9062356 |
| 1009 | 8019649487 | 8019648815 | Bacteria | 10014479 |
| 1010 | 8019661057 | 8019659431 | Bacteria | 8577854 |
| 1011 | 8019670621 | 8019668869 | Bacteria | 8791617 |
| 1012 | 8019685614 | 8019678201 | Bacteria | 8863603 |
| 1013 | 8019691185 | 8019687851 | Bacteria | 8712826 |
| 1014 | 8055744997 | 8055742211 | Bacteria | 9226248 |
| 1015 | 8056677519 | 8056673599 | Bacteria | 7871253 |
| 1016 | 8056687300 | 8056681323 | Bacteria | 8472857 |
| 1017 | 8056690686 | 8056689827 | Bacteria | 6712655 |
| 1018 | 8056974950 | 8056967851 | Bacteria | 9038162 |
| 1019 | Ga0070711_100013974 | |||
| 1020 | JGI24740J21852_10004915 | |||
| 1021 | JGI24739J22299_10002391 | |||
| 1022 | JGI24737J22298_10008032 | |||
| 1023 | JGI25153J46596_10005337 | |||
| 1024 | rootL2_10160148 | |||
| 1025 | JGI25160J50197_1011835 | |||
| 1026 | JGI25404J52841_10009163 | |||
| 1027 | Ga0055531_10006567 | |||
| 1028 | Ga0055543_1000462 | |||
| 1029 | Ga0055543_1001763 | |||
| 1030 | Ga0065165_1000799 | |||
| 1031 | Ga0065165_1002416 | |||
| 1032 | Ga0065165_1002642 | |||
| 1033 | Ga0065165_1006433 | |||
| 1034 | Ga0070658_10048283 | |||
| 1035 | Ga0070683_100005122 | |||
| 1036 | Ga0070680_100009353 | |||
| 1037 | Ga0070680_100162926 | |||
| 1038 | Ga0068868_100053615 | |||
| 1039 | Ga0070660_100018873 | |||
| 1040 | Ga0070668_100026976 | |||
| 1041 | Ga0070668_100082935 | |||
| 1042 | Ga0070668_100229075 | |||
| 1043 | Ga0070675_100167579 | |||
| 1044 | Ga0070671_100019025 | |||
| 1045 | Ga0070671_100154588 | |||
| 1046 | Ga0070674_100011327 | |||
| 1047 | Ga0070673_100042244 | |||
| 1048 | Ga0070688_100028924 | |||
| 1049 | Ga0070659_100065131 | |||
| 1050 | Ga0070667_100053462 | |||
| 1051 | Ga0070709_10001228 | |||
| 1052 | Ga0070709_10115955 | |||
| 1053 | Ga0070709_10160673 | |||
| 1054 | Ga0070714_100006930 | |||
| 1055 | Ga0070714_100012311 | |||
| 1056 | Ga0070714_100083680 | |||
| 1057 | Ga0070714_100264909 | |||
| 1058 | Ga0070713_100019837 | |||
| 1059 | Ga0070713_100099622 | |||
| 1060 | Ga0070713_100155497 | |||
| 1061 | Ga0070713_100252074 | |||
| 1062 | Ga0070713_100340281 | |||
| 1063 | Ga0070710_10000929 | |||
| 1064 | Ga0070711_100005942 | |||
| 1065 | Ga0070711_100015536 | |||
| 1066 | Ga0070711_100039484 | |||
| 1067 | Ga0070711_100043582 | |||
| 1068 | Ga0070711_100072675 | |||
| 1069 | Ga0070663_100008307 | |||
| 1070 | Ga0070663_100010106 | |||
| 1071 | Ga0070663_100015280 | |||
| 1072 | Ga0070663_100035288 | |||
| 1073 | Ga0070663_100080401 | |||
| 1074 | Ga0070662_100010158 | |||
| 1075 | Ga0070681_10037204 | |||
| 1076 | Ga0070681_10076829 | |||
| 1077 | Ga0070681_10088746 | |||
| 1078 | Ga0070681_10094083 | |||
| 1079 | Ga0070707_100312288 | |||
| 1080 | Ga0070699_100171307 | |||
| 1081 | Ga0070679_100032475 | |||
| 1082 | Ga0070679_100058920 | |||
| 1083 | Ga0070679_100094456 | |||
| 1084 | Ga0070684_100015626 | |||
| 1085 | Ga0070684_100017917 | |||
| 1086 | Ga0070684_100033654 | |||
| 1087 | Ga0068853_100007930 | |||
| 1088 | Ga0068853_100022387 | |||
| 1089 | Ga0068853_100137259 | |||
| 1090 | Ga0068853_100210070 | |||
| 1091 | Ga0068853_100268660 | |||
| 1092 | Ga0070665_100016320 | |||
| 1093 | Ga0070665_100051187 | |||
| 1094 | Ga0068855_100012869 | |||
| 1095 | Ga0068855_100021640 | |||
| 1096 | Ga0068855_100059343 | |||
| 1097 | Ga0068857_100015877 | |||
| 1098 | Ga0068857_100050153 | |||
| 1099 | Ga0068856_100001803 | |||
| 1100 | Ga0068856_100001867 | |||
| 1101 | Ga0068856_100019754 | |||
| 1102 | Ga0068852_100014573 | |||
| 1103 | Ga0068852_100063882 | |||
| 1104 | Ga0068859_100053671 | |||
| 1105 | Ga0068851_10000250 | |||
| 1106 | Ga0068851_10042123 | |||
| 1107 | Ga0068863_100231921 | |||
| 1108 | Ga0068863_100294077 | |||
| 1109 | Ga0068858_100018788 | |||
| 1110 | Ga0068860_100005407 | |||
| 1111 | Ga0068860_100123813 | |||
| 1112 | Ga0068862_100057926 | |||
| 1113 | Ga0081455_10002800 | |||
| 1114 | Ga0081455_10008855 | |||
| 1115 | Ga0081455_10037499 | |||
| 1116 | Ga0081455_10056307 | |||
| 1117 | Ga0081455_10061238 | |||
| 1118 | Ga0081455_10108720 | |||
| 1119 | Ga0081540_1000178 | |||
| 1120 | Ga0081540_1001968 | |||
| 1121 | Ga0081540_1011207 | |||
| 1122 | Ga0081540_1012098 | |||
| 1123 | Ga0081540_1018972 | |||
| 1124 | Ga0081540_1019008 | |||
| 1125 | Ga0081540_1021450 | |||
| 1126 | Ga0081540_1021620 | |||
| 1127 | Ga0081540_1040971 | |||
| 1128 | Ga0081540_1043139 | |||
| 1129 | Ga0081539_10000220 | |||
| 1130 | Ga0070717_10005875 | |||
| 1131 | Ga0070717_10012278 | |||
| 1132 | Ga0070717_10058625 | |||
| 1133 | Ga0070717_10094177 | |||
| 1134 | Ga0075365_10018146 | |||
| 1135 | Ga0075368_10011128 | |||
| 1136 | Ga0075363_100018753 | |||
| 1137 | Ga0075363_100072104 | |||
| 1138 | Ga0070715_10003054 | |||
| 1139 | Ga0070716_100004705 | |||
| 1140 | Ga0070716_100012347 | |||
| 1141 | Ga0070712_100005481 | |||
| 1142 | Ga0070712_100006535 | |||
| 1143 | Ga0070712_100044651 | |||
| 1144 | Ga0070712_100054530 | |||
| 1145 | Ga0075370_10003000 | |||
| 1146 | Ga0075370_10042424 | |||
| 1147 | Ga0068871_100080431 | |||
| 1148 | Ga0097620_100053665 | |||
| 1149 | Ga0099825_1030562 | |||
| 1150 | Ga0099824_1004802 | |||
| 1151 | Ga0099824_1020023 | |||
| 1152 | Ga0099822_1001244 | |||
| 1153 | Ga0099823_1042587 | |||
| 1154 | Ga0099794_10005646 | |||
| 1155 | Ga0099794_10007699 | |||
| 1156 | Ga0099794_10101182 | |||
| 1157 | Ga0099795_10002778 | |||
| 1158 | Ga0105240_10016329 | |||
| 1159 | Ga0105240_10016971 | |||
| 1160 | Ga0105240_10075310 | |||
| 1161 | Ga0111539_10083826 | |||
| 1162 | Ga0111539_10135696 | |||
| 1163 | Ga0105245_10051090 | |||
| 1164 | Ga0105245_10171978 | |||
| 1165 | Ga0105245_10310676 | |||
| 1166 | Ga0105247_10033772 | |||
| 1167 | Ga0114129_10090903 | |||
| 1168 | Ga0105243_10142575 | |||
| 1169 | Ga0105241_10005015 | |||
| 1170 | Ga0105241_10039748 | |||
| 1171 | Ga0105241_10085631 | |||
| 1172 | Ga0105248_10077527 | |||
| 1173 | Ga0105248_10078907 | |||
| 1174 | Ga0105248_10244393 | |||
| 1175 | Ga0105248_10267166 | |||
| 1176 | Ga0105237_10037283 | |||
| 1177 | Ga0105237_10058475 | |||
| 1178 | Ga0105237_10064196 | |||
| 1179 | Ga0105237_10205408 | |||
| 1180 | Ga0105238_10002659 | |||
| 1181 | Ga0105238_10006063 | |||
| 1182 | Ga0105238_10009836 | |||
| 1183 | Ga0105238_10298165 | |||
| 1184 | Ga0105238_10407541 | |||
| 1185 | Ga0099796_10011117 | |||
| 1186 | Ga0099796_10013869 | |||
| 1187 | Ga0105239_10003585 | |||
| 1188 | Ga0105239_10003896 | |||
| 1189 | Ga0105239_10017767 | |||
| 1190 | Ga0105239_10021644 | |||
| 1191 | Ga0105239_10027720 | |||
| 1192 | Ga0105239_10059197 | |||
| 1193 | Ga0105239_10103968 | |||
| 1194 | Ga0105239_10431802 | |||
| 1195 | Ga0105246_10027867 | |||
| 1196 | Ga0157373_10052924 | |||
| 1197 | Ga0157370_10059165 | |||
| 1198 | Ga0157370_10202043 | |||
| 1199 | Ga0157369_10030087 | |||
| 1200 | Ga0157369_10047249 | |||
| 1201 | Ga0157374_10087900 | |||
| 1202 | Ga0157374_10199027 | |||
| 1203 | Ga0157378_10004346 | |||
| 1204 | Ga0157378_10078233 | |||
| 1205 | Ga0163162_10069584 | |||
| 1206 | Ga0157375_10054992 | |||
| 1207 | Ga0157375_10121305 | |||
| 1208 | Ga0157375_10214264 | |||
| 1209 | Ga0163163_10052220 | |||
| 1210 | Ga0163163_10160664 | |||
| 1211 | Ga0163163_10185491 | |||
| 1212 | Ga0157377_10015118 | |||
| 1213 | Ga0157379_10026231 | |||
| 1214 | Ga0157379_10287761 | |||
| 1215 | Ga0157376_10037246 | |||
| 1216 | Ga0163161_10039459 | |||
| 1217 | Ga0197907_10707499 | |||
| 1218 | Ga0214544_1000001 | |||
| 1219 | Ga0214542_1000037 | |||
| 1220 | Ga0214542_1000879 | |||
| 1221 | Ga0214545_1000003 | |||
| 1222 | Ga0214543_1000002 | |||
| 1223 | Ga0213874_10003673 | |||
| 1224 | Ga0213876_10005607 | |||
| 1225 | Ga0213875_10000382 | |||
| 1226 | Ga0213875_10000390 | |||
| 1227 | Ga0213875_10003220 | |||
| 1228 | Ga0213871_10003817 | |||
| 1229 | Ga0209148_1000462 | |||
| 1230 | Ga0209233_1002214 | |||
| 1231 | Ga0209455_1009328 | |||
| 1232 | Ga0209455_1014740 | |||
| 1233 | Ga0209564_1005201 | |||
| 1234 | Ga0209758_1000011 | |||
| 1235 | Ga0209758_1000845 | |||
| 1236 | Ga0209758_1003253 | |||
| 1237 | Ga0209758_1008620 | |||
| 1238 | Ga0209758_1032205 | |||
| 1239 | Ga0209256_1008471 | |||
| 1240 | Ga0209256_1012600 | |||
| 1241 | Ga0207426_1000228 | |||
| 1242 | Ga0207426_1000270 | |||
| 1243 | Ga0207426_1000292 | |||
| 1244 | Ga0207426_1010723 | |||
| 1245 | Ga0209257_1001242 | |||
| 1246 | Ga0209257_1018129 | |||
| 1247 | Ga0207656_10029312 | |||
| 1248 | Ga0207653_10032516 | |||
| 1249 | Ga0207692_10001555 | |||
| 1250 | Ga0207692_10029149 | |||
| 1251 | Ga0207688_10031893 | |||
| 1252 | Ga0207647_10000496 | |||
| 1253 | Ga0207647_10017643 | |||
| 1254 | Ga0207699_10000605 | |||
| 1255 | Ga0207699_10002358 | |||
| 1256 | Ga0207699_10008980 | |||
| 1257 | Ga0207699_10063547 | |||
| 1258 | Ga0207705_10097865 | |||
| 1259 | Ga0207705_10158797 | |||
| 1260 | Ga0207654_10000634 | |||
| 1261 | Ga0207707_10002844 | |||
| 1262 | Ga0207707_10007520 | |||
| 1263 | Ga0207707_10008335 | |||
| 1264 | Ga0207707_10133882 | |||
| 1265 | Ga0207707_10161806 | |||
| 1266 | Ga0207695_10000006 | |||
| 1267 | Ga0207695_10000008 | |||
| 1268 | Ga0207695_10002936 | |||
| 1269 | Ga0207695_10011660 | |||
| 1270 | Ga0207695_10046333 | |||
| 1271 | Ga0207695_10068273 | |||
| 1272 | Ga0207695_10089987 | |||
| 1273 | Ga0207671_10060370 | |||
| 1274 | Ga0207671_10088927 | |||
| 1275 | Ga0207693_10000085 | |||
| 1276 | Ga0207693_10005576 | |||
| 1277 | Ga0207693_10009623 | |||
| 1278 | Ga0207693_10020299 | |||
| 1279 | Ga0207693_10059873 | |||
| 1280 | Ga0207693_10060930 | |||
| 1281 | Ga0207693_10070878 | |||
| 1282 | Ga0207693_10264604 | |||
| 1283 | Ga0207663_10000739 | |||
| 1284 | Ga0207663_10003946 | |||
| 1285 | Ga0207663_10009965 | |||
| 1286 | Ga0207660_10023909 | |||
| 1287 | Ga0207660_10068885 | |||
| 1288 | Ga0207662_10106494 | |||
| 1289 | Ga0207657_10003303 | |||
| 1290 | Ga0207657_10016929 | |||
| 1291 | Ga0207649_10027939 | |||
| 1292 | Ga0207652_10026123 | |||
| 1293 | Ga0207652_10045400 | |||
| 1294 | Ga0207652_10115771 | |||
| 1295 | Ga0207646_10258566 | |||
| 1296 | Ga0207694_10000119 | |||
| 1297 | Ga0207694_10003295 | |||
| 1298 | Ga0207694_10005677 | |||
| 1299 | Ga0207694_10180364 | |||
| 1300 | Ga0207694_10241511 | |||
| 1301 | Ga0207687_10018479 | |||
| 1302 | Ga0207687_10062646 | |||
| 1303 | Ga0207687_10076825 | |||
| 1304 | Ga0207700_10003531 | |||
| 1305 | Ga0207700_10011210 | |||
| 1306 | Ga0207700_10011837 | |||
| 1307 | Ga0207700_10045438 | |||
| 1308 | Ga0207700_10069649 | |||
| 1309 | Ga0207664_10005139 | |||
| 1310 | Ga0207664_10159233 | |||
| 1311 | Ga0207644_10155132 | |||
| 1312 | Ga0207690_10164031 | |||
| 1313 | Ga0207706_10041553 | |||
| 1314 | Ga0207665_10000066 | |||
| 1315 | Ga0207665_10004190 | |||
| 1316 | Ga0207665_10042629 | |||
| 1317 | Ga0207665_10209318 | |||
| 1318 | Ga0207691_10059114 | |||
| 1319 | Ga0207689_10013332 | |||
| 1320 | Ga0207661_10000917 | |||
| 1321 | Ga0207661_10023556 | |||
| 1322 | Ga0207661_10046472 | |||
| 1323 | Ga0207667_10003981 | |||
| 1324 | Ga0207667_10021239 | |||
| 1325 | Ga0207667_10033464 | |||
| 1326 | Ga0207667_10201110 | |||
| 1327 | Ga0207651_10207135 | |||
| 1328 | Ga0207677_10098362 | |||
| 1329 | Ga0207703_10026127 | |||
| 1330 | Ga0207703_10128295 | |||
| 1331 | Ga0207703_10205158 | |||
| 1332 | Ga0207639_10004828 | |||
| 1333 | Ga0207639_10005470 | |||
| 1334 | Ga0207639_10058471 | |||
| 1335 | Ga0207639_10158117 | |||
| 1336 | Ga0207678_10010709 | |||
| 1337 | Ga0207678_10020027 | |||
| 1338 | Ga0207678_10026116 | |||
| 1339 | Ga0207678_10047784 | |||
| 1340 | Ga0207678_10055282 | |||
| 1341 | Ga0207702_10000002 | |||
| 1342 | Ga0207702_10001708 | |||
| 1343 | Ga0207702_10008470 | |||
| 1344 | Ga0207702_10111571 | |||
| 1345 | Ga0207702_10301380 | |||
| 1346 | Ga0207641_10296379 | |||
| 1347 | Ga0207648_10010213 | |||
| 1348 | Ga0207674_10006543 | |||
| 1349 | Ga0207674_10009969 | |||
| 1350 | Ga0207674_10023678 | |||
| 1351 | Ga0207675_100069671 | |||
| 1352 | Ga0207675_100377031 | |||
| 1353 | Ga0207683_10117952 | |||
| 1354 | Ga0207698_10029719 | |||
| 1355 | Ga0207698_10124851 | |||
| 1356 | Ga0209389_1000001 | |||
| 1357 | Ga0209389_1000014 | |||
| 1358 | Ga0209589_1000011 | |||
| 1359 | Ga0209589_1000020 | |||
| 1360 | Ga0209489_100012 | |||
| 1361 | Ga0209489_100060 | |||
| 1362 | Ga0209489_101114 | |||
| 1363 | Ga0209700_100007 | |||
| 1364 | Ga0209700_100019 | |||
| 1365 | Ga0209179_1002935 | |||
| 1366 | Ga0209588_1005193 | |||
| 1367 | Ga0209813_10006595 | |||
| 1368 | Ga0268266_10014609 | |||
| 1369 | Ga0268266_10055520 | |||
| 1370 | Ga0268266_10163085 | |||
| 1371 | Ga0268266_10200158 | |||
| 1372 | Ga0268265_10017139 | |||
| 1373 | Ga0268264_10000030 | |||
| 1374 | Ga0265337_1007120 | |||
| 1375 | Ga0265319_1017390 | |||
| 1376 | Ga0265334_10007339 | |||
| 1377 | Ga0265323_10001453 | |||
| 1378 | Ga0265336_10000251 | |||
| 1379 | Ga0307517_10000386 | |||
| 1380 | Ga0307515_10017392 | |||
| 1381 | Ga0265338_10000582 | |||
| 1382 | Ga0265324_10011228 | |||
| 1383 | Ga0265330_10007549 | |||
| 1384 | Ga0265330_10009772 | |||
| 1385 | Ga0265332_10047350 | |||
| 1386 | Ga0265325_10015246 | |||
| 1387 | Ga0265339_10012020 | |||
| 1388 | Ga0265339_10016403 | |||
| 1389 | Ga0265339_10065301 | |||
| 1390 | Ga0265331_10046688 | |||
| 1391 | Ga0307513_10216665 | |||
| 1392 | Ga0307509_10029551 | |||
| 1393 | Ga0307509_10099121 | |||
| 1394 | Ga0307508_10023817 | |||
| 1395 | Ga0307508_10078529 | |||
| 1396 | Ga0307508_10099956 | |||
| 1397 | Ga0307508_10100608 | |||
| 1398 | Ga0265314_10010113 | |||
| 1399 | Ga0265314_10017398 | |||
| 1400 | Ga0265342_10002383 | |||
| 1401 | Ga0307516_10010095 | |||
| 1402 | Ga0307516_10038399 | |||
| 1403 | Ga0307516_10180578 | |||
| 1404 | Ga0307516_10183224 | |||
| 1405 | Ga0307415_100150974 | |||
| 1406 | Ga0307510_10017574 | |||
| 1407 | Ga0307510_10055165 | |||
| 1408 | Ga0307510_10151640 | |||
| 1409 | Ga0315911_1000002 | |||
| 1410 | Ga0373926_0034888 | |||
| 1411 | Ga0373934_0007901 | |||
| 1412 | Ga0373936_0014396 | |||
| 1413 | Ga0373953_0000506 | |||
| 1414 | Ga0373954_0000386 | |||
| 1415 | Ga0373954_0014978 | |||
| 1416 | Ga0373956_0005816 | |||
| 1417 | Ga0373956_0013430 | |||
| 1418 | Ga0373943_0002708 | |||
| 1419 | Ga0373943_0040646 | |||
| 1420 | Ga0373946_0005868 | |||
| 1421 | Ga0373946_0020617 | |||
| 1422 | Ga0373955_0000286 | |||
| 1423 | Ga0373955_0059552 | |||
| 1424 | Ga0373931_0005603 | |||
| 1425 | Ga0373935_0001308 | |||
| 1426 | Ga0373927_0018861 | |||
| 1427 | Ga0373927_0053411 | |||
| 1428 | Ga0373927_0094628 | |||
| 1429 | Ga0373933_0000525 | |||
| 1430 | Ga0373933_0000952 | |||
| 1431 | Ga0373947_0012265 | |||
| 1432 | Ga0373947_0042908 | |||
| 1433 | Ga0373947_0196609 | |||
| 1434 | Ga0373937_0001493 | |||
| 1435 | Ga0373925_0007302 | |||
| 1436 | Ga0395899_0058078 | |||
| 1437 | Ga0395900_0001070 | |||
| 1438 | Ga0395898_0005530 | |||
| 1439 | Ga0395898_0017205 | |||
| 1440 | Ga0395898_0038983 | |||
| 1441 | Ga0395898_0096005 | |||
| 1442 | Ga0395898_0147538 | |||
| 1443 | Ga0395905_0007330 | |||
| 1444 | Ga0395905_0102640 | |||
| 1445 | Ga0436364_0042928 | |||
| 1446 | Ga0436364_0108855 | |||
| 1447 | Ga0436364_0346617 | |||
| 1448 | Ga0436364_0817898 | |||
| 1449 | Ga0436364_1343008 | |||
| 1450 | Ga0395901_0014261 | |||
| 1451 | Ga0395901_0015950 | |||
| 1452 | Ga0395901_0124736 | |||
| 1453 | Ga0395901_0129939 | |||
| 1454 | Ga0395901_0185322 | |||
| 1455 | Ga0436365_0064270 | |||
| 1456 | Ga0436365_0161372 | |||
| 1457 | Ga0436365_0234716 | |||
| 1458 | Ga0436365_0369560 | |||
| 1459 | Ga0436365_0383201 | |||
| 1460 | Ga0436365_0677006 | |||
| 1461 | Ga0436365_1301574 | |||
| 1462 | Ga0436365_1424648 | |||
| 1463 | Ga0436360_0078764 | |||
| 1464 | Ga0436360_0466793 | |||
| 1465 | Ga0436361_1169803 | |||
| 1466 | Ga0436363_0383878 | |||
| 1467 | Ga0436363_0693677 | |||
| 1468 | Ga0436362_0187516 | |||
| 1469 | Ga0436362_0618850 | |||
| 1470 | Ga0451841_0603492 | |||
| 1471 | Ga0439459_0021517 | |||
| 1472 | Ga0466972_0000113 | |||
| 1473 | Ga0466966_0000094 | |||
| 1474 | Ga0466961_0000118 | |||
| 1475 | Ga0466961_0134432 | |||
| 1476 | Ga0466970_0058039 | |||
| 1477 | Ga0495592_0001573 | |||
| 1478 | Ga0495592_0021108 | |||
| 1479 | Ga0495592_0041596 | |||
| 1480 | Ga0495592_0059415 | |||
| 1481 | Ga0495592_0118930 | |||
| 1482 | Ga0495592_0184676 | |||
| 1483 | Ga0495603_0030969 | |||
| 1484 | Ga0495603_0082601 | |||
| 1485 | Ga0495590_0034179 | |||
| 1486 | Ga0495629_0000133 | |||
| 1487 | Ga0495629_0010755 | |||
| 1488 | Ga0495629_0018014 | |||
| 1489 | Ga0495629_0048075 | |||
| 1490 | Ga0495638_0007773 | |||
| 1491 | Ga0495638_0092624 | |||
| 1492 | Ga0495641_0003044 | |||
| 1493 | Ga0495651_0009251 | |||
| 1494 | Ga0495653_0001313 | |||
| 1495 | Ga0495653_0081656 | |||
| 1496 | Ga0495580_0006086 | |||
| 1497 | Ga0495580_0172160 | |||
| 1498 | Ga0495582_0000016 | |||
| 1499 | Ga0495582_0013313 | |||
| 1500 | Ga0495605_0031333 | |||
| 1501 | Ga0495639_0000014 | |||
| 1502 | Ga0495639_0031073 | |||
| 1503 | Ga0495662_0000086 | |||
| 1504 | Ga0495664_0004447 | |||
| 1505 | Ga0495664_0007306 | |||
| 1506 | Ga0495664_0145578 | |||
| 1507 | Ga0495594_0000051 | |||
| 1508 | Ga0495594_0112428 | |||
| 1509 | Ga0495607_0103073 | |||
| 1510 | Ga0495606_0016667 | |||
| 1511 | Ga0495608_0003757 | |||
| 1512 | Ga0495616_0026879 | |||
| 1513 | Ga0495616_0049990 | |||
| 1514 | Ga0495616_0090587 | |||
| 1515 | Ga0495618_0114154 | |||
| 1516 | Ga0495628_0004462 | |||
| 1517 | Ga0495628_0007774 | |||
| 1518 | Ga0495628_0010553 | |||
| 1519 | Ga0495628_0184958 | |||
| 1520 | Ga0495643_0019976 | |||
| 1521 | Ga0495648_0001270 | |||
| 1522 | Ga0495648_0022088 | |||
| 1523 | Ga0495666_0020761 | |||
| 1524 | Ga0495652_0008371 | |||
| 1525 | Ga0495652_0036434 | |||
| 1526 | Ga0495652_0056592 | |||
| 1527 | Ga0495652_0121007 | |||
| 1528 | Ga0495665_0000477 | |||
| 1529 | Ga0495640_0001817 | |||
| 1530 | Ga0495640_0007412 | |||
| 1531 | Ga0495640_0011794 | |||
| 1532 | Ga0495640_0015035 | |||
| 1533 | Ga0495587_0000862 | |||
| 1534 | Ga0495587_0008087 | |||
| 1535 | Ga0495609_0026863 | |||
| 1536 | Ga0495609_0077158 | |||
| 1537 | Ga0495597_0025529 | |||
| 1538 | Ga0495645_0024663 | |||
| 1539 | Ga0495645_0099885 | |||
| 1540 | Ga0495622_0006671 | |||
| 1541 | Ga0495622_0012877 | |||
| 1542 | Ga0495667_0000424 | |||
| 1543 | Ga0495667_0015829 | |||
| 1544 | Ga0495667_0058901 | |||
| 1545 | Ga0495656_0002167 | |||
| 1546 | Ga0495668_0019915 | |||
| 1547 | Ga0495668_0080465 | |||
| 1548 | Ga0495634_0003306 | |||
| 1549 | Ga0495634_0006805 | |||
| 1550 | Ga0495625_0061107 | |||
| 1551 | Ga0495625_0070923 | |||
| 1552 | Ga0495635_0000792 | |||
| 1553 | Ga0495635_0002703 | |||
| 1554 | Ga0495635_0005278 | |||
| 1555 | Ga0495635_0026165 | |||
| 1556 | Ga0495659_0011741 | |||
| 1557 | Ga0495657_0001449 | |||
| 1558 | Ga0495657_0013673 | |||
| 1559 | Ga0495657_0022741 | |||
| 1560 | Ga0495599_0000879 | |||
| 1561 | Ga0495599_0013798 | |||
| 1562 | Ga0495599_0048778 | |||
| 1563 | Ga0495623_0002249 | |||
| 1564 | Ga0495646_0002245 | |||
| 1565 | Ga0495646_0032854 | |||
| 1566 | Ga0495646_0105597 | |||
| 1567 | Ga0495658_0001354 | |||
| 1568 | Ga0495658_0044624 | |||
| 1569 | Ga0495658_0048318 | |||
| 1570 | Ga0495613_0006655 | |||
| 1571 | Ga0495613_0024354 | |||
| 1572 | Ga0495624_0000138 | |||
| 1573 | Ga0495624_0010671 | |||
| 1574 | Ga0495671_0053471 | |||
| 1575 | Ga0495649_0042779 | |||
| 1576 | Ga0495600_0000337 | |||
| 1577 | Ga0495600_0005193 | |||
| 1578 | Ga0495600_0151690 | |||
| 1579 | Ga0495581_0000001 | |||
| 1580 | Ga0495581_0023521 | |||
| 1581 | Ga0495581_0081996 | |||
| 1582 | Ga0495604_0001626 | |||
| 1583 | Ga0495604_0017599 | |||
| 1584 | Ga0495604_0169005 | |||
| 1585 | Ga0495674_0002545 | |||
| 1586 | Ga0495674_0018873 | |||
| 1587 | Ga0495674_0145940 | |||
| 1588 | Ga0495674_0311730 | |||
| 1589 | Ga0495672_0007184 | |||
| 1590 | Ga0495672_0031356 | |||
| 1591 | Ga0495676_0003317 | |||
| 1592 | Ga0495676_0143571 | |||
| 1593 | Ga0495680_0002491 | |||
| 1594 | Ga0495680_0005089 | |||
| 1595 | Ga0495680_0156052 | |||
| 1596 | Ga0495687_014891 | |||
| 1597 | Ga0495675_0012328 | |||
| 1598 | Ga0495675_0024995 | |||
| 1599 | Ga0495675_0035435 | |||
| 1600 | Ga0495673_0069111 | |||
| 1601 | Ga0495673_0090619 | |||
| 1602 | Ga0495684_0001407 | |||
| 1603 | Ga0495684_0005971 | |||
| 1604 | Ga0495593_0000003 | |||
| 1605 | Ga0495593_0002446 | |||
| 1606 | Ga0495602_0007241 | |||
| 1607 | Ga0495602_0019961 | |||
| 1608 | Ga0495602_0039312 | |||
| 1609 | Ga0495602_0115379 | |||
| 1610 | Ga0495614_0006055 | |||
| 1611 | Ga0496100_0007585 | |||
| 1612 | Ga0496100_0042150 | |||
| 1613 | Ga0496100_0119453 | |||
| 1614 | Ga0496101_0127876 | |||
| 1615 | Ga0496102_0014231 | |||
| 1616 | Ga0496102_0018355 | |||
| 1617 | Ga0496102_0083203 | |||
| 1618 | Ga0496103_0022816 | |||
| 1619 | Ga0496104_0022932 | |||
| 1620 | Ga0496104_0024758 | |||
| 1621 | Ga0496104_0036043 | |||
| 1622 | Ga0496104_0073880 | |||
| 1623 | Ga0496104_0130155 | |||
| 1624 | Ga0496104_0203556 | |||
| 1625 | Ga0496105_0002092 | |||
| 1626 | Ga0496105_0011739 | |||
| 1627 | Ga0496105_0041425 | |||
| 1628 | Ga0496105_0044963 | |||
| 1629 | Ga0496105_0050731 | |||
| 1630 | Ga0496105_0267569 | |||
| 1631 | Ga0496106_0001202 | |||
| 1632 | Ga0496106_0011446 | |||
| 1633 | Ga0496106_0015453 | |||
| 1634 | Ga0496106_0018182 | |||
| 1635 | Ga0496106_0068108 | |||
| 1636 | Ga0496106_0265684 | |||
| 1637 | Ga0496107_0002624 | |||
| 1638 | Ga0496107_0009825 | |||
| 1639 | Ga0496107_0011885 | |||
| 1640 | Ga0496108_0001960 | |||
| 1641 | Ga0496108_0018478 | |||
| 1642 | Ga0496108_0050815 | |||
| 1643 | Ga0496108_0180764 | |||
| 1644 | Ga0496109_0000432 | |||
| 1645 | Ga0496109_0010188 | |||
| 1646 | Ga0496109_0055955 | |||
| 1647 | Ga0496109_0234299 | |||
| 1648 | Ga0496110_0012555 | |||
| 1649 | Ga0496110_0027219 | |||
| 1650 | Ga0496110_0029803 | |||
| 1651 | Ga0496110_0187050 | |||
| 1652 | Ga0496110_0211027 | |||
| 1653 | Ga0496111_0013188 | |||
| 1654 | Ga0496111_0039393 | |||
| 1655 | Ga0496111_0091744 | |||
| 1656 | Ga0496112_0015915 | |||
| 1657 | Ga0496112_0033682 | |||
| 1658 | Ga0496112_0061568 | |||
| 1659 | Ga0496112_0100707 | |||
| 1660 | Ga0496112_0112903 | |||
| 1661 | Ga0496112_0194315 | |||
| 1662 | Ga0496112_0206592 | |||
| 1663 | Ga0496113_0014649 | |||
| 1664 | Ga0496113_0032600 | |||
| 1665 | Ga0496114_0008432 | |||
| 1666 | Ga0496115_0009310 | |||
| 1667 | Ga0496115_0033310 | |||
| 1668 | Ga0496115_0063699 | |||
| 1669 | Ga0496115_0078069 | |||
| 1670 | Ga0496115_0133099 | |||
| 1671 | Ga0496118_0019947 | |||
| 1672 | Ga0496118_0029396 | |||
| 1673 | Ga0496118_0036940 | |||
| 1674 | Ga0496118_0134801 | |||
| 1675 | Ga0496119_0013953 | |||
| 1676 | Ga0496120_0007436 | |||
| 1677 | Ga0496121_0000041 | |||
| 1678 | Ga0496121_0003563 | |||
| 1679 | Ga0496121_0005352 | |||
| 1680 | Ga0496121_0009890 | |||
| 1681 | Ga0496121_0028205 | |||
| 1682 | Ga0496121_0039020 | |||
| 1683 | Ga0496121_0071909 | |||
| 1684 | Ga0496121_0100982 | |||
| 1685 | Ga0496121_0111107 | |||
| 1686 | Ga0496122_0030990 | |||
| 1687 | Ga0496124_0000624 | |||
| 1688 | Ga0496124_0040676 | |||
| 1689 | Ga0496125_0036744 | |||
| 1690 | Ga0496125_0040200 | |||
| 1691 | Ga0496125_0053440 | |||
| 1692 | Ga0496125_0075947 | |||
| 1693 | Ga0496125_0092232 | |||
| 1694 | Ga0496126_0002321 | |||
| 1695 | Ga0496126_0008801 | |||
| 1696 | Ga0496126_0010022 | |||
| 1697 | Ga0496126_0015516 | |||
| 1698 | Ga0496126_0018293 | |||
| 1699 | Ga0496126_0029558 | |||
| 1700 | Ga0496126_0030071 | |||
| 1701 | Ga0496126_0032840 | |||
| 1702 | Ga0496126_0051884 | |||
| 1703 | Ga0496126_0198822 | |||
| 1704 | Ga0496126_0206653 | |||
| 1705 | Ga0496126_0255689 | |||
| 1706 | Ga0496126_0351501 | |||
| 1707 | Ga0501032_0005102 | |||
| 1708 | Ga0501032_0076754 | |||
| 1709 | Ga0501033_0001834 | |||
| 1710 | Ga0501033_0051989 | |||
| 1711 | Ga0501034_0001471 | |||
| 1712 | Ga0501034_0134384 | |||
| 1713 | Ga0501034_0444984 | |||
| 1714 | Ga0501036_0050117 | |||
| 1715 | Ga0501036_0053755 | |||
| 1716 | Ga0501037_0005747 | |||
| 1717 | Ga0501037_0086729 | |||
| 1718 | Ga0501038_0002435 | |||
| 1719 | Ga0501038_0014916 | |||
| 1720 | Ga0501038_0042310 | |||
| 1721 | Ga0501039_0010117 | |||
| 1722 | Ga0501040_0054616 | |||
| 1723 | Ga0501042_0045227 | |||
| 1724 | Ga0501043_0019449 | |||
| 1725 | Ga0501043_0020212 | |||
| 1726 | Ga0501043_0061463 | |||
| 1727 | Ga0501046_0007012 | |||
| 1728 | Ga0501046_0073620 | |||
| 1729 | Ga0501046_0075087 | |||
| 1730 | Ga0501047_0014876 | |||
| 1731 | Ga0501047_0082968 | |||
| 1732 | Ga0501047_0140691 | |||
| 1733 | Ga0501048_0006412 | |||
| 1734 | Ga0501068_0024706 | |||
| 1735 | Ga0501074_0149427 | |||
| 1736 | Ga0501076_0100259 | |||
| 1737 | Ga0501079_0236102 | |||
| 1738 | Ga0501080_0088666 | |||
| 1739 | Ga0501080_0108978 | |||
| 1740 | Ga0501080_0130979 | |||
| 1741 | Ga0501035_0002268 | |||
| 1742 | Ga0501035_0026433 | |||
| 1743 | Ga0501035_0055661 | |||
| 1744 | Ga0501044_0007852 | |||
| 1745 | Ga0501044_0020966 | |||
| 1746 | Ga0501044_0060417 | |||
| 1747 | Ga0501045_0032361 | |||
| 1748 | nmdc:mga0yw44_23996_c1 | |||
| 1749 | nmdc:mga0yw44_31714_c1 | |||
| 1750 | nmdc:mga0yw44_5423_c1 | |||
| 1751 | nmdc:mga06z11_27907_c1 | |||
| 1752 | nmdc:mga0rr50_147154_c1 | |||
| 1753 | nmdc:mga0a205_317757_c1 | |||
| 1754 | nmdc:mga0sz30_14368_c1 | |||
| 1755 | nmdc:mga0sz30_64384_c1 | |||
| 1756 | Ga0495601_0054028 | |||
| 1757 | Ga0495601_0112208 | |||
| 1758 | Ga0500635_0015520 | |||
| 1759 | Ga0495595_0001668 | |||
| 1760 | Ga0495595_0003281 | |||
| 1761 | Ga0495595_0011648 | |||
| 1762 | Ga0495619_0025449 | |||
| 1763 | Ga0495619_0076189 | |||
| 1764 | Ga0495619_0159548 | |||
| 1765 | Ga0500643_001180 | |||
| 1766 | Ga0500647_0036075 | |||
| 1767 | Ga0500647_0095598 | |||
| 1768 | Ga0500583_0079752 | |||
| 1769 | Ga0500566_0000062 | |||
| 1770 | Ga0500566_0000112 | |||
| 1771 | Ga0500566_0002624 | |||
| 1772 | Ga0500640_000394 | |||
| 1773 | Ga0500554_001136 | |||
| 1774 | Ga0500556_0000750 | |||
| 1775 | Ga0500557_000003 | |||
| 1776 | Ga0500562_023587 | |||
| 1777 | Ga0500572_000239 | |||
| 1778 | Ga0500572_000775 | |||
| 1779 | Ga0500591_066690 | |||
| 1780 | Ga0500595_017745 | |||
| 1781 | Ga0500595_031296 | |||
| 1782 | Ga0500614_021021 | |||
| 1783 | Ga0500642_0002011 | |||
| 1784 | Ga0500642_0025721 | |||
| 1785 | Ga0500642_0121700 | |||
| 1786 | Ga0500559_0001790 | |||
| 1787 | Ga0500559_0004994 | |||
| 1788 | Ga0500603_001625 | |||
| 1789 | Ga0500616_0006635 | |||
| 1790 | Ga0500622_0025785 | |||
| 1791 | Ga0500627_0051117 | |||
| 1792 | Ga0500630_003625 | |||
| 1793 | Ga0500638_001061 | |||
| 1794 | Ga0500639_000061 | |||
| 1795 | Ga0500636_0000284 | |||
| 1796 | Ga0500636_0023548 | |||
| 1797 | Ga0500637_0000098 | |||
| 1798 | Ga0500625_000220 | |||
| 1799 | Ga0500596_000699 | |||
| 1800 | Ga0500596_000998 | |||
| 1801 | Ga0500596_003937 | |||
| 1802 | Ga0500601_000233 | |||
| 1803 | Ga0500601_001561 | |||
| 1804 | Ga0501084_0076301 | |||
| 1805 | 2507507555 | |||
| 1806 | 2508541673 | |||
| 1807 | 2508692788 | |||
| 1808 | 2509152953 | |||
| 1809 | 2511394850 | |||
| 1810 | 2513621750 | |||
| 1811 | 2513636808 | |||
| 1812 | 2513651250 | |||
| 1813 | 2513654195 | |||
| 1814 | 2513674875 | |||
| 1815 | 2513697138 | |||
| 1816 | 2513704455 | |||
| 1817 | 2513720784 | |||
| 1818 | 2513856950 | |||
| 1819 | 2513878752 | |||
| 1820 | 2513894154 | |||
| 1821 | 2513918535 | |||
| 1822 | 2514011818 | |||
| 1823 | 2517104275 | |||
| 1824 | 2517891229 | |||
| 1825 | 2524468253 | |||
| 1826 | 2524533576 | |||
| 1827 | 2528848869 | |||
| 1828 | 2530646710 | |||
| 1829 | 2563055992 | |||
| 1830 | 2617346909 | |||
| 1831 | 2617372839 | |||
| 1832 | 2671123164 | |||
| 1833 | 2713472194 | |||
| 1834 | 2723843588 | |||
| 1835 | 2728749927 | |||
| 1836 | 2745080874 | |||
| 1837 | 2793060982 | |||
| 1838 | 2793066584 | |||
| 1839 | 2793083894 | |||
| 1840 | 2805921401 | |||
| 1841 | 2818236671 | |||
| 1842 | 2824602891 | |||
| 1843 | 2824611886 | |||
| 1844 | 2824621477 | |||
| 1845 | 2824630589 | |||
| 1846 | 2824638707 | |||
| 1847 | 2824650098 | |||
| 1848 | 2824660923 | |||
| 1849 | 2824664500 | |||
| 1850 | 2824672213 | |||
| 1851 | 2824682162 | |||
| 1852 | 2824688904 | |||
| 1853 | 2824697741 | |||
| 1854 | 2824709247 | |||
| 1855 | 2824719056 | |||
| 1856 | 2824730391 | |||
| 1857 | 2824733921 | |||
| 1858 | 2824748354 | |||
| 1859 | 2824758020 | |||
| 1860 | 2824766445 | |||
| 1861 | 2824776572 | |||
| 1862 | 2838129330 | |||
| 1863 | 2841948014 | |||
| 1864 | 2841953588 | |||
| 1865 | 2841962805 | |||
| 1866 | 2841973007 | |||
| 1867 | 2841978315 | |||
| 1868 | 2841990535 | |||
| 1869 | 2842040756 | |||
| 1870 | 2842046298 | |||
| 1871 | 2844320136 | |||
| 1872 | 2847933258 | |||
| 1873 | 2847937431 | |||
| 1874 | 2847947855 | |||
| 1875 | 2849078290 | |||
| 1876 | 2857512666 | |||
| 1877 | 2874598670 | |||
| 1878 | 2874607203 | |||
| 1879 | 2874614456 | |||
| 1880 | 2874628187 | |||
| 1881 | 2874630210 | |||
| 1882 | 2874652125 | |||
| 1883 | 2876768198 | |||
| 1884 | 2876778709 | |||
| 1885 | 2876818316 | |||
| 1886 | 2876823513 | |||
| 1887 | 2879082502 | |||
| 1888 | 2879107821 | |||
| 1889 | 2879114093 | |||
| 1890 | 2879131718 | |||
| 1891 | 2879150054 | |||
| 1892 | 2881371350 | |||
| 1893 | 2881672204 | |||
| 1894 | 2885370076 | |||
| 1895 | 2885383123 | |||
| 1896 | 2885391947 | |||
| 1897 | 2885415622 | |||
| 1898 | 2888385573 | |||
| 1899 | 2888392676 | |||
| 1900 | 2888425703 | |||
| 1901 | 2889037906 | |||
| 1902 | 2903731270 | |||
| 1903 | 2903753330 | |||
| 1904 | 2903774854 | |||
| 1905 | 2904674195 | |||
| 1906 | 2904694150 | |||
| 1907 | 2904701134 | |||
| 1908 | 2904711857 | |||
| 1909 | 2906609961 | |||
| 1910 | 2906616413 | |||
| 1911 | 2906627716 | |||
| 1912 | 2906638132 | |||
| 1913 | 2906649617 | |||
| 1914 | 2906662807 | |||
| 1915 | 2908741558 | |||
| 1916 | 2908758996 | |||
| 1917 | 2908781286 | |||
| 1918 | 2922361843 | |||
| 1919 | 2922372293 | |||
| 1920 | 2922386925 | |||
| 1921 | 2922396961 | |||
| 1922 | 2922431582 | |||
| 1923 | 2929621141 | |||
| 1924 | 2929626028 | |||
| 1925 | 2932785092 | |||
| 1926 | 2932795036 | |||
| 1927 | 2932805564 | |||
| 1928 | 2932810120 | |||
| 1929 | 2932821693 | |||
| 1930 | 2932828929 | |||
| 1931 | 2933582990 | |||
| 1932 | 2935609938 | |||
| 1933 | 2935619652 | |||
| 1934 | 2935636117 | |||
| 1935 | 2935638147 | |||
| 1936 | 2935638632 | |||
| 1937 | 2935652031 | |||
| 1938 | 2935659996 | |||
| 1939 | 2935666516 | |||
| 1940 | 2935676441 | |||
| 1941 | 2935691043 | |||
| 1942 | 2935694523 | |||
| 1943 | 2935703638 | |||
| 1944 | 2935718424 | |||
| 1945 | 2935727596 | |||
| 1946 | 2935736299 | |||
| 1947 | 2935745679 | |||
| 1948 | 2935756060 | |||
| 1949 | 2935760680 | |||
| 1950 | 2935776097 | |||
| 1951 | 2935785148 | |||
| 1952 | 2935791890 | |||
| 1953 | 2935800300 | |||
| 1954 | 2935801776 | |||
| 1955 | 2935814809 | |||
| 1956 | 2935823098 | |||
| 1957 | 2935827761 | |||
| 1958 | 2935828126 | |||
| 1959 | 2935842331 | |||
| 1960 | 2935848680 | |||
| 1961 | 2935855075 | |||
| 1962 | 2935858033 | |||
| 1963 | 2935867937 | |||
| 1964 | 2935874039 | |||
| 1965 | 2935885765 | |||
| 1966 | 2935909515 | |||
| 1967 | 2935917239 | |||
| 1968 | 2935926996 | |||
| 1969 | 2935937160 | |||
| 1970 | 2935944537 | |||
| 1971 | 2935952974 | |||
| 1972 | 2935962833 | |||
| 1973 | 2935969814 | |||
| 1974 | 2935976411 | |||
| 1975 | 2935987141 | |||
| 1976 | 2935993036 | |||
| 1977 | 2936002948 | |||
| 1978 | 2936014412 | |||
| 1979 | 2936023748 | |||
| 1980 | 2936031391 | |||
| 1981 | 2936040548 | |||
| 1982 | 2936049518 | |||
| 1983 | 2936061266 | |||
| 1984 | 2940561965 | |||
| 1985 | 2941512748 | |||
| 1986 | 2941514780 | |||
| 1987 | 2941520685 | |||
| 1988 | 2941522762 | |||
| 1989 | 2941528699 | |||
| 1990 | 2941530673 | |||
| 1991 | 2941531318 | |||
| 1992 | 2941542380 | |||
| 1993 | 3005481375 | |||
| 1994 | 3005485515 | |||
| 1995 | 3005508329 | |||
| 1996 | 3005588171 | |||
| 1997 | 3005600435 | |||
| 1998 | 3005715916 | |||
| 1999 | 3005723271 | |||
| 2000 | 8006933195 | |||
| 2001 | 8006939332 | |||
| 2002 | 8006968863 | |||
| 2003 | 8006978989 | |||
| 2004 | 8006984543 | |||
| 2005 | 8006997169 | |||
| 2006 | 8016520534 | |||
| 2007 | 8016528575 | |||
| 2008 | 8016555150 | |||
| 2009 | 8016563519 | |||
| 2010 | 8016572076 | |||
| 2011 | 8016594487 | |||
| 2012 | 8016601259 | |||
| 2013 | 8016609174 | |||
| 2014 | 8016615728 | |||
| 2015 | 8016625500 | |||
| 2016 | 8016639056 | |||
| 2017 | 8017065041 | |||
| 2018 | 8019533520 | |||
| 2019 | 8019546157 | |||
| 2020 | 8019552550 | |||
| 2021 | 8019575303 | |||
| 2022 | 8019592197 | |||
| 2023 | 8019599087 | |||
| 2024 | 8019609273 | |||
| 2025 | 8019633182 | |||
| 2026 | 8019646714 | |||
| 2027 | 8019649487 | |||
| 2028 | 8019661057 | |||
| 2029 | 8019670621 | |||
| 2030 | 8019685614 | |||
| 2031 | 8019691185 | |||
| 2032 | 8055744997 | |||
| 2033 | 8056677519 | |||
| 2034 | 8056687300 | |||
| 2035 | 8056690686 | |||
| 2036 | 8056974950 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c0i-assembly1.cif.gz_A | crystal structure of d-amino acid oxidase in complex with two anthranylate molecules | 1.003 | 167 | 195 |
| 1sez-assembly1.cif.gz_A | crystal structure of protoporphyrinogen ix oxidase | 0.9967 | 167 | 201 |
| 6lqc-assembly1.cif.gz_A | crystal structure of cyclohexylamine oxidase from erythrobacteraceae bacterium | 0.9919 | 169 | 201 |
| 3fg2-assembly1.cif.gz_P | crystal structure of ferredoxin reductase for the cyp199a2 system from rhodopseudomonas palustris | 0.9868 | 26 | 422 |
| 1q1r-assembly1.cif.gz_A | crystal structure of putidaredoxin reductase from pseudomonas putida | 0.9749 | 27 | 421 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5VQP1_29_415_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9992 | 169 | 202 | 3.50.50.60 |
| af_Q0D7W4_71_358_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.991 | 168 | 201 | 3.50.50.60 |
| 3fg2P02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9891 | 137 | 255 | 3.50.50.60 |
| af_A0A1D6LYX0_29_117_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9868 | 167 | 228 | 3.50.50.60 |
| af_A0A1D6HRY4_17_247_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9838 | 168 | 198 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840GUG1-F1-model_v4 | 3-phenylpropionate/trans-cinnamate dioxygenase ferredoxin reductase subunit (EC 1.18.1.3) | 0.9929 | 27 | 422 |
GO:0005737
GO:0016651 GO:0051213 |
| AF-B3QHG5-F1-model_v4 | deleted | 0.9886 | 27 | 422 |
|
| AF-A0A431R372-F1-model_v4 | deleted | 0.988 | 27 | 217 |
|
| AF-A0A6M6JJ77-F1-model_v4 | FAD-dependent oxidoreductase | 0.9873 | 28 | 421 |
GO:0005737
GO:0016651 |
| AF-A0A2G8MD65-F1-model_v4 | deleted | 0.9853 | 178 | 421 |
|