F488312

General Info

Members Datasets Scaffolds Average Seq Length
1018 315 2037 150

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10263899|Ga0163162_102638992
Length 147
Sequence MDTTTKADGLMEKKPKNIFVQGKIDPVFIGESIQKHSTKTSIGGHSIFLGQVRADRINEKEMTAIEYKMHEIREAIFAKYPLTCMHVYHSLGRVAAGEICLFVFTSSKHRKAAIDACEETVEKIKNELPIWGKELFEDETYQWKVNQ

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
117 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
118 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
119 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
205 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
206 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
207 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
208 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
209 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
210 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
213 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
214 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
215 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
216 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
217 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
218 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
219 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
224 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
225 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
265 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
278 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
279 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
280 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
281 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
287 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
295 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
296 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
297 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
298 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
301 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
302 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
303 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
304 2738541278 Niastella sp. CF465 Isolate Unclassified
305 2739367651 Pedobacter sp. OK291 Isolate Unclassified
306 2739367656 Pedobacter sp. CF523 Isolate Unclassified
307 2818991444 Filimonas endophytica 3197 Isolate Unclassified
308 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
309 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
310 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
311 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
312 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
313 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
314 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
315 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 0
Isolates 1.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.95
Nodule 0
Rhizoplane 0.88
Rhizosphere 93.03
Stem 0
Stem Tuber 0
Unclassified 24.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10263899 3300013306 Unclassified 1854
2 JGI25150J39212_1000001 3300002774 Bacteria 1318726
3 JGI25151J46595_10000001 3300003187 Bacteria 887211
4 JGI25153J46596_10000001 3300003215 Bacteria 748985
5 rootH1_10053600 3300003316 Bacteria 2284
6 rootH2_10190875 3300003320 Bacteria 1321
7 rootL2_10264365 3300003322 Unclassified 2201
8 rootL2_10293189 3300003322 Bacteria 1714
9 rootH1_10000181 3300003316 Bacteria 14072
10 rootH1_10000181 3300003323 Bacteria 24625
11 rootH1_10054153 3300003323 Bacteria 2722
12 rootH1_10150505 3300003323 Bacteria 1842
13 rootH1_10244305 3300003323 Bacteria 1983
14 Ga0055536_1000049 3300003781 Bacteria 113328
15 Ga0055530_10002378 3300003791 Bacteria 12196
16 Ga0065714_10105041 3300005288 Unclassified 1573
17 Ga0065714_10143233 3300005288 Unclassified 1156
18 Ga0065714_10166575 3300005288 Bacteria 1025
19 Ga0065714_10274671 3300005288 Bacteria 733
20 Ga0065714_10415037 3300005288 Bacteria 568
21 Ga0065704_10090452 3300005289 Bacteria 2786
22 Ga0065704_10091501 3300005289 Unclassified 2713
23 Ga0065704_10225333 3300005289 Bacteria 1060
24 Ga0065704_10407427 3300005289 Bacteria 745
25 Ga0065712_10029553 3300005290 Unclassified 1352
26 Ga0065712_10105332 3300005290 Bacteria 1942
27 Ga0065712_10112518 3300005290 Unclassified 1796
28 Ga0065712_10184667 3300005290 Bacteria 1159
29 Ga0065712_10341352 3300005290 Bacteria 800
30 Ga0065712_10451977 3300005290 Unclassified 674
31 Ga0065712_10624182 3300005290 Unclassified 557
32 Ga0065715_10342428 3300005293 Unclassified 965
33 Ga0065715_10794894 3300005293 Bacteria 612
34 Ga0065707_10213588 3300005295 Unclassified 1255
35 Ga0065707_11014821 3300005295 Bacteria 535
36 Ga0070658_10356901 3300005327 Unclassified 1252
37 Ga0070658_10666312 3300005327 Bacteria 903
38 Ga0070658_11026603 3300005327 Bacteria 717
39 Ga0070658_11537467 3300005327 Unclassified 577
40 Ga0070676_10006273 3300005328 Bacteria 6350
41 Ga0070676_10006346 3300005328 Bacteria 6317
42 Ga0070676_10014248 3300005328 Unclassified 4369
43 Ga0070676_10035984 3300005328 Unclassified 2850
44 Ga0070676_10082262 3300005328 Bacteria 1956
45 Ga0070676_10184920 3300005328 Bacteria 1357
46 Ga0070683_100000884 3300005329 Bacteria 22238
47 Ga0070683_100002198 3300005329 Bacteria 15442
48 Ga0070683_100006866 3300005329 Bacteria 9564
49 Ga0070683_100029414 3300005329 Bacteria 4973
50 Ga0070683_100330631 3300005329 Unclassified 1451
51 Ga0070683_100767271 3300005329 Unclassified 924
52 Ga0070683_101118224 3300005329 Unclassified 757
53 Ga0070690_100030587 3300005330 Unclassified 3347
54 Ga0070690_100138734 3300005330 Unclassified 1649
55 Ga0070690_100903427 3300005330 Unclassified 691
56 Ga0070670_100038715 3300005331 Bacteria 4100
57 Ga0070670_100071381 3300005331 Unclassified 2981
58 Ga0070670_100079675 3300005331 Unclassified 2815
59 Ga0070670_100090886 3300005331 Bacteria 2624
60 Ga0070670_100136497 3300005331 Bacteria 2120
61 Ga0070670_100161718 3300005331 Bacteria 1940
62 Ga0070670_100170053 3300005331 Bacteria 1890
63 Ga0070670_100179924 3300005331 Bacteria 1836
64 Ga0070670_100188955 3300005331 Bacteria 1789
65 Ga0070670_100433475 3300005331 Bacteria 1163
66 Ga0070670_100705587 3300005331 Bacteria 907
67 Ga0070670_100849121 3300005331 Bacteria 826
68 Ga0070670_101098515 3300005331 Unclassified 725
69 Ga0070670_101989193 3300005331 Bacteria 535
70 Ga0070677_10093803 3300005333 Bacteria 1311
71 Ga0070677_10104953 3300005333 Unclassified 1252
72 Ga0068869_100032681 3300005334 Unclassified 3668
73 Ga0068869_100079604 3300005334 Unclassified 2442
74 Ga0068869_100346436 3300005334 Unclassified 1210
75 Ga0068869_100403661 3300005334 Bacteria 1124
76 Ga0068869_100420282 3300005334 Bacteria 1103
77 Ga0068869_101392285 3300005334 Unclassified 620
78 Ga0070666_10009022 3300005335 Bacteria 6212
79 Ga0070666_10150195 3300005335 Bacteria 1625
80 Ga0070666_10349275 3300005335 Unclassified 1058
81 Ga0070666_10894214 3300005335 Bacteria 656
82 Ga0070680_100023470 3300005336 Bacteria 4919
83 Ga0070682_100002796 3300005337 Bacteria 9669
84 Ga0070682_100009802 3300005337 Bacteria 5423
85 Ga0070682_100574770 3300005337 Bacteria 886
86 Ga0070682_100980691 3300005337 Unclassified 700
87 Ga0070682_101203970 3300005337 Unclassified 639
88 Ga0068868_100019618 3300005338 Bacteria 5067
89 Ga0068868_100024597 3300005338 Bacteria 4572
90 Ga0068868_100029146 3300005338 Bacteria 4227
91 Ga0068868_100139554 3300005338 Bacteria 1989
92 Ga0068868_100360934 3300005338 Bacteria 1246
93 Ga0068868_100390339 3300005338 Unclassified 1199
94 Ga0068868_100509856 3300005338 Bacteria 1055
95 Ga0070660_100025895 3300005339 Bacteria 4363
96 Ga0070660_100165681 3300005339 Bacteria 1783
97 Ga0070689_100008890 3300005340 Bacteria 7101
98 Ga0070689_100056139 3300005340 Bacteria 3053
99 Ga0070689_100066838 3300005340 Bacteria 2801
100 Ga0070689_100170158 3300005340 Bacteria 1765
101 Ga0070689_100885230 3300005340 Bacteria 789
102 Ga0070689_100973196 3300005340 Bacteria 754
103 Ga0070689_101517759 3300005340 Bacteria 607
104 Ga0070691_10001334 3300005341 Bacteria 10499
105 Ga0070687_100217812 3300005343 Bacteria 1167
106 Ga0070687_100815374 3300005343 Bacteria 662
107 Ga0070661_100001199 3300005344 Bacteria 18295
108 Ga0070661_100169617 3300005344 Bacteria 1657
109 Ga0070661_100290147 3300005344 Bacteria 1271
110 Ga0070661_101088717 3300005344 Unclassified 665
111 Ga0070661_101362213 3300005344 Bacteria 596
112 Ga0070668_100005828 3300005347 Bacteria 9138
113 Ga0070668_100050217 3300005347 Bacteria 3211
114 Ga0070668_100211590 3300005347 Bacteria 1595
115 Ga0070668_101331949 3300005347 Bacteria 653
116 Ga0070669_100021823 3300005353 Bacteria 4578
117 Ga0070669_100038346 3300005353 Unclassified 3478
118 Ga0070669_100038810 3300005353 Bacteria 3458
119 Ga0070669_100137279 3300005353 Bacteria 1882
120 Ga0070669_100206513 3300005353 Bacteria 1548
121 Ga0070675_100055610 3300005354 Bacteria 3258
122 Ga0070675_100075014 3300005354 Bacteria 2811
123 Ga0070675_100256189 3300005354 Bacteria 1532
124 Ga0070675_100421802 3300005354 Bacteria 1193
125 Ga0070675_100665980 3300005354 Unclassified 946
126 Ga0070675_100682108 3300005354 Bacteria 935
127 Ga0070675_101797255 3300005354 Unclassified 565
128 Ga0070671_100104453 3300005355 Bacteria 2377
129 Ga0070671_100157818 3300005355 Bacteria 1917
130 Ga0070671_100322607 3300005355 Bacteria 1316
131 Ga0070671_100351174 3300005355 Bacteria 1259
132 Ga0070671_100514063 3300005355 Bacteria 1031
133 Ga0070671_100809958 3300005355 Bacteria 816
134 Ga0070671_100851802 3300005355 Unclassified 795
135 Ga0070674_100002262 3300005356 Bacteria 10628
136 Ga0070674_100220221 3300005356 Unclassified 1476
137 Ga0070674_101633353 3300005356 Bacteria 582
138 Ga0070673_100017076 3300005364 Bacteria 5149
139 Ga0070673_100028166 3300005364 Bacteria 4175
140 Ga0070673_100034436 3300005364 Bacteria 3833
141 Ga0070673_100222754 3300005364 Unclassified 1633
142 Ga0070673_100341093 3300005364 Bacteria 1328
143 Ga0070673_100393675 3300005364 Bacteria 1237
144 Ga0070673_100425301 3300005364 Bacteria 1191
145 Ga0070688_100065171 3300005365 Bacteria 2314
146 Ga0070688_100094197 3300005365 Unclassified 1963
147 Ga0070688_100112375 3300005365 Bacteria 1814
148 Ga0070688_100259140 3300005365 Bacteria 1241
149 Ga0070688_100459320 3300005365 Bacteria 953
150 Ga0070688_100818293 3300005365 Bacteria 729
151 Ga0070688_100897212 3300005365 Bacteria 699
152 Ga0070659_100002681 3300005366 Bacteria 12650
153 Ga0070659_100374152 3300005366 Bacteria 1199
154 Ga0070667_100008921 3300005367 Bacteria 8299
155 Ga0070667_100044780 3300005367 Bacteria 3718
156 Ga0070667_100285969 3300005367 Bacteria 1482
157 Ga0070667_100322357 3300005367 Bacteria 1394
158 Ga0070667_100387567 3300005367 Bacteria 1270
159 Ga0070667_100454645 3300005367 Bacteria 1170
160 Ga0070667_100941170 3300005367 Unclassified 805
161 Ga0070667_101099550 3300005367 Bacteria 743
162 Ga0070667_101117632 3300005367 Bacteria 737
163 Ga0070700_100212574 3300005441 Bacteria 1365
164 Ga0070700_100311240 3300005441 Bacteria 1153
165 Ga0070708_101545923 3300005445 Unclassified 618
166 Ga0070663_100130815 3300005455 Bacteria 1906
167 Ga0070663_100179024 3300005455 Bacteria 1643
168 Ga0070663_100382812 3300005455 Unclassified 1146
169 Ga0070663_100612015 3300005455 Unclassified 917
170 Ga0070678_100068363 3300005456 Unclassified 2648
171 Ga0070678_100280384 3300005456 Bacteria 1409
172 Ga0070678_100994860 3300005456 Unclassified 770
173 Ga0070678_101557452 3300005456 Bacteria 620
174 Ga0070662_100080932 3300005457 Bacteria 2419
175 Ga0070681_10103173 3300005458 Bacteria 2796
176 Ga0068867_100003798 3300005459 Bacteria 10626
177 Ga0068867_100015472 3300005459 Bacteria 5411
178 Ga0068867_100088556 3300005459 Bacteria 2346
179 Ga0068867_100228530 3300005459 Unclassified 1503
180 Ga0068867_100258565 3300005459 Bacteria 1419
181 Ga0068867_100328520 3300005459 Bacteria 1269
182 Ga0068867_100445586 3300005459 Bacteria 1102
183 Ga0068867_100771679 3300005459 Bacteria 855
184 Ga0068867_101230353 3300005459 Unclassified 689
185 Ga0068867_101815760 3300005459 Bacteria 573
186 Ga0070685_10024684 3300005466 Bacteria 3303
187 Ga0070685_10064012 3300005466 Unclassified 2161
188 Ga0070685_10130977 3300005466 Bacteria 1568
189 Ga0070685_10369176 3300005466 Bacteria 986
190 Ga0070685_10476729 3300005466 Bacteria 879
191 Ga0070685_11014295 3300005466 Bacteria 623
192 Ga0070698_100000645 3300005471 Bacteria 37282
193 Ga0070698_100008979 3300005471 Bacteria 10751
194 Ga0070698_100019854 3300005471 Bacteria 7049
195 Ga0070698_100140783 3300005471 Bacteria 2363
196 Ga0070698_100326179 3300005471 Unclassified 1466
197 Ga0070699_101620087 3300005518 Bacteria 593
198 Ga0070679_100141159 3300005530 Bacteria 2388
199 Ga0070684_100000298 3300005535 Bacteria 34479
200 Ga0070684_100000731 3300005535 Bacteria 22754
201 Ga0070684_100022231 3300005535 Bacteria 5286
202 Ga0070684_100255794 3300005535 Unclassified 1601
203 Ga0068853_100003450 3300005539 Bacteria 12095
204 Ga0068853_100052550 3300005539 Unclassified 3509
205 Ga0068853_100066002 3300005539 Bacteria 3142
206 Ga0068853_100914221 3300005539 Bacteria 843
207 Ga0070672_100027429 3300005543 Bacteria 4247
208 Ga0070672_100041352 3300005543 Unclassified 3543
209 Ga0070672_100051699 3300005543 Bacteria 3206
210 Ga0070672_100215575 3300005543 Bacteria 1609
211 Ga0070672_100691284 3300005543 Bacteria 893
212 Ga0070672_101250206 3300005543 Bacteria 662
213 Ga0070672_101251864 3300005543 Unclassified 662
214 Ga0070672_101354764 3300005543 Bacteria 636
215 Ga0070672_101393976 3300005543 Unclassified 627
216 Ga0070693_100020989 3300005547 Bacteria 3453
217 Ga0070693_100478637 3300005547 Unclassified 879
218 Ga0070665_100016621 3300005548 Bacteria 7373
219 Ga0070665_100057795 3300005548 Unclassified 3889
220 Ga0070665_101017656 3300005548 Bacteria 841
221 Ga0070665_101097011 3300005548 Unclassified 807
222 Ga0070665_101677084 3300005548 Bacteria 643
223 Ga0070704_100517298 3300005549 Unclassified 1038
224 Ga0070704_100735393 3300005549 Unclassified 877
225 Ga0068855_100063789 3300005563 Bacteria 4298
226 Ga0068855_100306408 3300005563 Bacteria 1758
227 Ga0068855_100496220 3300005563 Bacteria 1327
228 Ga0070664_100000884 3300005564 Bacteria 23265
229 Ga0070664_100073067 3300005564 Unclassified 2942
230 Ga0070664_100114267 3300005564 Unclassified 2358
231 Ga0070664_100167746 3300005564 Bacteria 1946
232 Ga0070664_100208954 3300005564 Unclassified 1744
233 Ga0070664_100295760 3300005564 Bacteria 1462
234 Ga0070664_100407187 3300005564 Bacteria 1244
235 Ga0070664_100452610 3300005564 Unclassified 1179
236 Ga0068857_100001112 3300005577 Bacteria 20920
237 Ga0068857_100210581 3300005577 Bacteria 1774
238 Ga0068857_100264695 3300005577 Bacteria 1579
239 Ga0068857_100367708 3300005577 Unclassified 1334
240 Ga0068857_100509685 3300005577 Bacteria 1130
241 Ga0068857_101046206 3300005577 Bacteria 787
242 Ga0068854_100048477 3300005578 Bacteria 3031
243 Ga0068854_100224693 3300005578 Bacteria 1487
244 Ga0068854_100460605 3300005578 Bacteria 1064
245 Ga0068854_102037084 3300005578 Bacteria 529
246 Ga0068856_100030139 3300005614 Bacteria 5303
247 Ga0070702_100404723 3300005615 Unclassified 977
248 Ga0070702_101511161 3300005615 Unclassified 553
249 Ga0068852_100072020 3300005616 Bacteria 3036
250 Ga0068852_100131631 3300005616 Bacteria 2304
251 Ga0068852_100139480 3300005616 Bacteria 2242
252 Ga0068852_100223628 3300005616 Bacteria 1791
253 Ga0068852_100457373 3300005616 Unclassified 1265
254 Ga0068852_100895315 3300005616 Unclassified 904
255 Ga0068852_101179371 3300005616 Bacteria 787
256 Ga0068859_100004404 3300005617 Bacteria 14371
257 Ga0068859_100075284 3300005617 Bacteria 3416
258 Ga0068859_100108016 3300005617 Bacteria 2844
259 Ga0068859_100124092 3300005617 Unclassified 2650
260 Ga0068859_100214701 3300005617 Bacteria 2011
261 Ga0068859_100229380 3300005617 Unclassified 1945
262 Ga0068859_100304305 3300005617 Bacteria 1688
263 Ga0068859_100304908 3300005617 Bacteria 1686
264 Ga0068859_100671669 3300005617 Unclassified 1127
265 Ga0068859_100693113 3300005617 Bacteria 1109
266 Ga0068859_101083943 3300005617 Bacteria 881
267 Ga0068859_101604169 3300005617 Bacteria 718
268 Ga0068864_100004501 3300005618 Bacteria 11462
269 Ga0068864_100053139 3300005618 Bacteria 3493
270 Ga0068864_100093526 3300005618 Unclassified 2656
271 Ga0068864_100245416 3300005618 Unclassified 1660
272 Ga0068864_100254652 3300005618 Bacteria 1631
273 Ga0068864_100271715 3300005618 Bacteria 1580
274 Ga0068864_100373124 3300005618 Bacteria 1350
275 Ga0068864_100445220 3300005618 Bacteria 1238
276 Ga0068864_100945805 3300005618 Bacteria 852
277 Ga0068866_10105036 3300005718 Bacteria 1565
278 Ga0068866_10341620 3300005718 Bacteria 948
279 Ga0068866_10471334 3300005718 Bacteria 825
280 Ga0068861_100002289 3300005719 Bacteria 12425
281 Ga0068861_100004874 3300005719 Bacteria 9030
282 Ga0068861_100056095 3300005719 Bacteria 3006
283 Ga0068861_100266584 3300005719 Bacteria 1469
284 Ga0068861_100643567 3300005719 Bacteria 978
285 Ga0068861_101214280 3300005719 Bacteria 730
286 Ga0068851_10007629 3300005834 Unclassified 4975
287 Ga0068851_10045339 3300005834 Bacteria 2222
288 Ga0068851_10408476 3300005834 Unclassified 800
289 Ga0068870_10007133 3300005840 Bacteria 4970
290 Ga0068870_10039824 3300005840 Bacteria 2433
291 Ga0068870_10186277 3300005840 Unclassified 1249
292 Ga0068863_100021002 3300005841 Bacteria 6236
293 Ga0068863_100112697 3300005841 Unclassified 2590
294 Ga0068863_100131005 3300005841 Unclassified 2395
295 Ga0068863_100251085 3300005841 Unclassified 1709
296 Ga0068863_100297431 3300005841 Unclassified 1565
297 Ga0068863_100310402 3300005841 Unclassified 1531
298 Ga0068863_100597451 3300005841 Bacteria 1092
299 Ga0068863_100843924 3300005841 Bacteria 915
300 Ga0068863_100947352 3300005841 Bacteria 862
301 Ga0068863_100953563 3300005841 Bacteria 859
302 Ga0068863_101000882 3300005841 Bacteria 838
303 Ga0068863_101544605 3300005841 Bacteria 673
304 Ga0068858_100035184 3300005842 Bacteria 4645
305 Ga0068858_100129440 3300005842 Unclassified 2366
306 Ga0068858_100426769 3300005842 Unclassified 1275
307 Ga0068858_100477133 3300005842 Bacteria 1203
308 Ga0068858_100717233 3300005842 Bacteria 973
309 Ga0068858_102145998 3300005842 Unclassified 552
310 Ga0068860_100039308 3300005843 Bacteria 4525
311 Ga0068860_100066104 3300005843 Bacteria 3434
312 Ga0068860_100215946 3300005843 Bacteria 1861
313 Ga0068860_100216549 3300005843 Bacteria 1859
314 Ga0068860_100332966 3300005843 Unclassified 1491
315 Ga0068860_100362646 3300005843 Unclassified 1428
316 Ga0068860_100436720 3300005843 Bacteria 1300
317 Ga0068860_100440244 3300005843 Bacteria 1294
318 Ga0068860_100522898 3300005843 Bacteria 1186
319 Ga0068860_102133210 3300005843 Bacteria 581
320 Ga0068860_102198580 3300005843 Unclassified 573
321 Ga0068862_100008657 3300005844 Bacteria 8417
322 Ga0068862_100050350 3300005844 Unclassified 3560
323 Ga0068862_100154765 3300005844 Bacteria 2043
324 Ga0068862_100246618 3300005844 Bacteria 1626
325 Ga0068862_100368944 3300005844 Unclassified 1336
326 Ga0068862_100763185 3300005844 Unclassified 942
327 Ga0075366_10028830 3300006195 Bacteria 3259
328 Ga0075366_10090286 3300006195 Bacteria 1835
329 Ga0075366_10409239 3300006195 Bacteria 835
330 Ga0097621_100006252 3300006237 Bacteria 8451
331 Ga0097621_100036651 3300006237 Unclassified 3924
332 Ga0097621_100150295 3300006237 Bacteria 1997
333 Ga0097621_100418028 3300006237 Bacteria 1203
334 Ga0097621_100493333 3300006237 Bacteria 1108
335 Ga0097621_100964397 3300006237 Bacteria 796
336 Ga0097621_101449434 3300006237 Bacteria 651
337 Ga0097621_101937953 3300006237 Bacteria 562
338 Ga0068871_100028294 3300006358 Bacteria 4393
339 Ga0068871_100094846 3300006358 Bacteria 2491
340 Ga0068871_100359833 3300006358 Bacteria 1289
341 Ga0068871_100376721 3300006358 Bacteria 1260
342 Ga0068871_100686995 3300006358 Unclassified 937
343 Ga0068871_100955658 3300006358 Bacteria 796
344 Ga0068871_101984683 3300006358 Bacteria 554
345 Ga0075428_100006620 3300006844 Bacteria 12891
346 Ga0075428_100120899 3300006844 Bacteria 2852
347 Ga0075431_100302401 3300006847 Bacteria 1616
348 Ga0075431_100544290 3300006847 Bacteria 1149
349 Ga0075431_100827605 3300006847 Bacteria 898
350 Ga0075434_100542930 3300006871 Bacteria 1182
351 Ga0075429_100006687 3300006880 Bacteria 9994
352 Ga0068865_100007780 3300006881 Bacteria 6608
353 Ga0068865_100136220 3300006881 Bacteria 1846
354 Ga0068865_100522607 3300006881 Unclassified 993
355 Ga0068865_100685092 3300006881 Bacteria 874
356 Ga0068865_101421373 3300006881 Bacteria 620
357 Ga0097620_100004404 3300006931 Bacteria 14371
358 Ga0097620_100075283 3300006931 Bacteria 3416
359 Ga0097620_100108014 3300006931 Bacteria 2844
360 Ga0097620_100124090 3300006931 Unclassified 2650
361 Ga0097620_100214718 3300006931 Bacteria 2011
362 Ga0097620_100229387 3300006931 Unclassified 1945
363 Ga0097620_100304303 3300006931 Bacteria 1688
364 Ga0097620_100304931 3300006931 Bacteria 1686
365 Ga0097620_100671662 3300006931 Unclassified 1127
366 Ga0097620_100693110 3300006931 Bacteria 1109
367 Ga0097620_101084175 3300006931 Bacteria 881
368 Ga0097620_101604142 3300006931 Bacteria 718
369 Ga0105251_10137987 3300009011 Unclassified 1104
370 Ga0105240_10128066 3300009093 Bacteria 3048
371 Ga0105240_10781773 3300009093 Bacteria 1035
372 Ga0111539_10013360 3300009094 Bacteria 10262
373 Ga0111539_10032439 3300009094 Bacteria 6342
374 Ga0111539_10067124 3300009094 Bacteria 4236
375 Ga0111539_10220240 3300009094 Bacteria 2210
376 Ga0111539_10246021 3300009094 Bacteria 2082
377 Ga0111539_11103185 3300009094 Bacteria 922
378 Ga0111539_11709038 3300009094 Unclassified 730
379 Ga0105245_10567915 3300009098 Bacteria 1158
380 Ga0105245_11409426 3300009098 Unclassified 747
381 Ga0105247_10000726 3300009101 Bacteria 25632
382 Ga0105247_10247903 3300009101 Unclassified 1216
383 Ga0105247_10262322 3300009101 Bacteria 1185
384 Ga0114129_10003569 3300009147 Bacteria 21902
385 Ga0114129_10114463 3300009147 Bacteria 3719
386 Ga0114129_10247648 3300009147 Unclassified 2393
387 Ga0114129_12124285 3300009147 Bacteria 677
388 Ga0105243_11259514 3300009148 Bacteria 755
389 Ga0105243_12064240 3300009148 Bacteria 605
390 Ga0105241_10039119 3300009174 Bacteria 3577
391 Ga0105241_10070874 3300009174 Bacteria 2705
392 Ga0105241_10210813 3300009174 Bacteria 1628
393 Ga0105241_10515675 3300009174 Unclassified 1068
394 Ga0105241_10557781 3300009174 Bacteria 1029
395 Ga0105241_10633758 3300009174 Unclassified 969
396 Ga0105242_10025664 3300009176 Unclassified 4665
397 Ga0105242_10041753 3300009176 Bacteria 3701
398 Ga0105242_10064334 3300009176 Unclassified 3023
399 Ga0105242_10077674 3300009176 Bacteria 2770
400 Ga0105242_10145021 3300009176 Bacteria 2064
401 Ga0105242_10177261 3300009176 Unclassified 1878
402 Ga0105242_10518059 3300009176 Bacteria 1137
403 Ga0105242_10654933 3300009176 Unclassified 1022
404 Ga0105242_10675525 3300009176 Bacteria 1007
405 Ga0105242_10833908 3300009176 Bacteria 916
406 Ga0105242_11039062 3300009176 Bacteria 829
407 Ga0105242_11119214 3300009176 Bacteria 802
408 Ga0105248_10184560 3300009177 Bacteria 2351
409 Ga0105248_11053959 3300009177 Bacteria 919
410 Ga0105237_10012365 3300009545 Bacteria 8995
411 Ga0105237_10145977 3300009545 Bacteria 2361
412 Ga0105237_11610442 3300009545 Bacteria 656
413 Ga0105238_11282734 3300009551 Bacteria 758
414 Ga0105249_10001240 3300009553 Bacteria 22411
415 Ga0105249_10010036 3300009553 Bacteria 8310
416 Ga0105249_10015498 3300009553 Bacteria 6747
417 Ga0105249_10020990 3300009553 Bacteria 5844
418 Ga0105249_10068305 3300009553 Bacteria 3277
419 Ga0105249_10154060 3300009553 Bacteria 2215
420 Ga0105249_10196662 3300009553 Unclassified 1971
421 Ga0105249_10385708 3300009553 Bacteria 1428
422 Ga0105249_10410106 3300009553 Bacteria 1387
423 Ga0105249_10505328 3300009553 Bacteria 1254
424 Ga0105239_10006184 3300010375 Bacteria 13934
425 Ga0105239_10120110 3300010375 Unclassified 2918
426 Ga0105239_10156948 3300010375 Bacteria 2541
427 Ga0105239_10319849 3300010375 Unclassified 1750
428 Ga0105239_10606324 3300010375 Bacteria 1249
429 Ga0105239_11922873 3300010375 Bacteria 686
430 Ga0105246_10087749 3300011119 Bacteria 2233
431 Ga0105246_10187786 3300011119 Bacteria 1597
432 Ga0105246_10549492 3300011119 Bacteria 989
433 Ga0105246_10562040 3300011119 Bacteria 979
434 Ga0105246_10645339 3300011119 Bacteria 921
435 Ga0105246_10683687 3300011119 Bacteria 897
436 Ga0157373_10025044 3300013100 Bacteria 4320
437 Ga0157373_10050175 3300013100 Unclassified 2972
438 Ga0157373_10066048 3300013100 Bacteria 2560
439 Ga0157373_10295262 3300013100 Bacteria 1150
440 Ga0157373_10938817 3300013100 Bacteria 643
441 Ga0157371_10000119 3300013102 Bacteria 120350
442 Ga0157371_10003679 3300013102 Bacteria 13763
443 Ga0157371_10015182 3300013102 Bacteria 5783
444 Ga0157371_10028476 3300013102 Bacteria 4045
445 Ga0157371_10081579 3300013102 Unclassified 2290
446 Ga0157371_10406661 3300013102 Bacteria 996
447 Ga0157371_10450674 3300013102 Unclassified 946
448 Ga0157370_10030052 3300013104 Bacteria 5325
449 Ga0157370_10033654 3300013104 Bacteria 4996
450 Ga0157370_10265726 3300013104 Bacteria 1585
451 Ga0157370_10416454 3300013104 Bacteria 1236
452 Ga0157370_10459668 3300013104 Unclassified 1170
453 Ga0157370_10503203 3300013104 Bacteria 1112
454 Ga0157370_10507602 3300013104 Bacteria 1107
455 Ga0157370_10575848 3300013104 Bacteria 1032
456 Ga0157370_10735814 3300013104 Bacteria 899
457 Ga0157370_10842792 3300013104 Bacteria 833
458 Ga0157369_10000015 3300013105 Bacteria 262917
459 Ga0157369_10322555 3300013105 Bacteria 1606
460 Ga0157369_10411950 3300013105 Bacteria 1402
461 Ga0157369_10421462 3300013105 Bacteria 1384
462 Ga0157374_10000955 3300013296 Bacteria 25080
463 Ga0157374_10055794 3300013296 Bacteria 3688
464 Ga0157374_10200871 3300013296 Bacteria 1952
465 Ga0157374_10275185 3300013296 Bacteria 1661
466 Ga0157374_10369768 3300013296 Bacteria 1427
467 Ga0157374_10447887 3300013296 Bacteria 1292
468 Ga0157374_11544754 3300013296 Unclassified 687
469 Ga0157374_11657892 3300013296 Unclassified 664
470 Ga0157378_10002905 3300013297 Bacteria 15257
471 Ga0157378_10066840 3300013297 Bacteria 3220
472 Ga0157378_10082393 3300013297 Bacteria 2909
473 Ga0157378_10092687 3300013297 Unclassified 2749
474 Ga0157378_10170532 3300013297 Bacteria 2040
475 Ga0157378_10190987 3300013297 Bacteria 1932
476 Ga0157378_10237149 3300013297 Bacteria 1741
477 Ga0157378_10333369 3300013297 Bacteria 1477
478 Ga0157378_10661608 3300013297 Bacteria 1061
479 Ga0157378_10962941 3300013297 Bacteria 886
480 Ga0157378_11549208 3300013297 Bacteria 708
481 Ga0163162_10000705 3300013306 Bacteria 30921
482 Ga0163162_10042164 3300013306 Bacteria 4566
483 Ga0163162_10068699 3300013306 Unclassified 3595
484 Ga0163162_10166333 3300013306 Bacteria 2329
485 Ga0163162_10173453 3300013306 Bacteria 2281
486 Ga0163162_10244214 3300013306 Unclassified 1927
487 Ga0163162_10317383 3300013306 Unclassified 1691
488 Ga0163162_10318254 3300013306 Bacteria 1688
489 Ga0163162_10410055 3300013306 Bacteria 1488
490 Ga0163162_10492466 3300013306 Bacteria 1357
491 Ga0163162_10803852 3300013306 Bacteria 1058
492 Ga0163162_10803864 3300013306 Bacteria 1058
493 Ga0163162_10857042 3300013306 Bacteria 1023
494 Ga0163162_10985075 3300013306 Unclassified 953
495 Ga0157372_10053750 3300013307 Bacteria 4491
496 Ga0157372_10188694 3300013307 Unclassified 2387
497 Ga0157372_10206085 3300013307 Bacteria 2279
498 Ga0157372_10381973 3300013307 Unclassified 1641
499 Ga0157372_10387543 3300013307 Bacteria 1628
500 Ga0157372_10702646 3300013307 Bacteria 1177
501 Ga0157375_10002578 3300013308 Bacteria 15745
502 Ga0157375_10018939 3300013308 Bacteria 6250
503 Ga0157375_10042379 3300013308 Bacteria 4406
504 Ga0157375_10072939 3300013308 Bacteria 3451
505 Ga0157375_10296600 3300013308 Unclassified 1780
506 Ga0157375_10409309 3300013308 Bacteria 1523
507 Ga0157375_10416386 3300013308 Unclassified 1510
508 Ga0157375_10524470 3300013308 Bacteria 1347
509 Ga0157375_10579078 3300013308 Bacteria 1283
510 Ga0157375_10686151 3300013308 Unclassified 1178
511 Ga0157375_10706200 3300013308 Bacteria 1162
512 Ga0157375_10804328 3300013308 Bacteria 1089
513 Ga0157375_11207623 3300013308 Bacteria 887
514 Ga0157375_11327413 3300013308 Bacteria 846
515 Ga0157375_11342922 3300013308 Bacteria 841
516 Ga0163163_10000075 3300014325 Bacteria 109545
517 Ga0163163_10003651 3300014325 Bacteria 13084
518 Ga0163163_10051116 3300014325 Unclassified 4074
519 Ga0163163_10057069 3300014325 Unclassified 3860
520 Ga0163163_10235166 3300014325 Unclassified 1882
521 Ga0163163_12347744 3300014325 Unclassified 592
522 Ga0163163_12364570 3300014325 Bacteria 590
523 Ga0163163_12691298 3300014325 Bacteria 554
524 Ga0157380_10015138 3300014326 Bacteria 5661
525 Ga0157380_10022281 3300014326 Bacteria 4766
526 Ga0157380_10029842 3300014326 Bacteria 4170
527 Ga0157380_10127062 3300014326 Bacteria 2169
528 Ga0157380_10158898 3300014326 Bacteria 1962
529 Ga0157380_10614001 3300014326 Unclassified 1078
530 Ga0157380_11189433 3300014326 Bacteria 805
531 Ga0157380_11429565 3300014326 Bacteria 743
532 Ga0157380_12043816 3300014326 Unclassified 635
533 Ga0157380_12119135 3300014326 Bacteria 625
534 Ga0182008_10389072 3300014497 Bacteria 747
535 Ga0157377_10040530 3300014745 Bacteria 2579
536 Ga0157377_10161590 3300014745 Unclassified 1393
537 Ga0157377_10270941 3300014745 Bacteria 1109
538 Ga0157377_10394916 3300014745 Bacteria 940
539 Ga0157379_10040212 3300014968 Bacteria 4172
540 Ga0157379_10119098 3300014968 Bacteria 2375
541 Ga0157379_10241637 3300014968 Bacteria 1638
542 Ga0157379_10477251 3300014968 Unclassified 1154
543 Ga0157379_10548316 3300014968 Bacteria 1076
544 Ga0157379_10797736 3300014968 Bacteria 891
545 Ga0157379_11044122 3300014968 Unclassified 781
546 Ga0157376_10018590 3300014969 Bacteria 5333
547 Ga0157376_10093092 3300014969 Bacteria 2615
548 Ga0157376_10127726 3300014969 Bacteria 2264
549 Ga0157376_10181832 3300014969 Unclassified 1923
550 Ga0157376_10262818 3300014969 Bacteria 1618
551 Ga0157376_10277377 3300014969 Bacteria 1577
552 Ga0157376_10309012 3300014969 Unclassified 1499
553 Ga0157376_10498432 3300014969 Unclassified 1196
554 Ga0157376_11702982 3300014969 Unclassified 666
555 Ga0182006_1000091 3300015261 Bacteria 109227
556 Ga0182006_1000957 3300015261 Bacteria 19179
557 Ga0182006_1001651 3300015261 Bacteria 13150
558 Ga0182007_10000010 3300015262 Bacteria 286070
559 Ga0182007_10148461 3300015262 Bacteria 796
560 Ga0163161_10000046 3300017792 Bacteria 127211
561 Ga0163161_10000890 3300017792 Bacteria 23195
562 Ga0163161_10002168 3300017792 Bacteria 14151
563 Ga0163161_10004792 3300017792 Bacteria 9423
564 Ga0163161_10231168 3300017792 Unclassified 1435
565 Ga0163161_10277361 3300017792 Unclassified 1314
566 Ga0163161_10335287 3300017792 Bacteria 1199
567 Ga0163161_10410025 3300017792 Unclassified 1088
568 Ga0163161_11143908 3300017792 Unclassified 671
569 Ga0207425_1000002 3300025245 Bacteria 1362590
570 Ga0209646_1009276 3300025246 Bacteria 1563
571 Ga0209129_1000002 3300025258 Bacteria 1359086
572 Ga0207666_1014067 3300025271 Unclassified 1128
573 Ga0209676_1000001 3300025292 Bacteria 1852142
574 Ga0209025_1000004 3300025294 Bacteria 1361782
575 Ga0209758_1000006 3300025297 Bacteria 1359562
576 Ga0209050_1000258 3300025298 Bacteria 113741
577 Ga0207697_10044155 3300025315 Archaea 1833
578 Ga0207697_10064655 3300025315 Unclassified 1526
579 Ga0207697_10190333 3300025315 Bacteria 901
580 Ga0207656_10060635 3300025321 Bacteria 1659
581 Ga0207656_10185330 3300025321 Bacteria 1000
582 Ga0207656_10253863 3300025321 Bacteria 862
583 Ga0207682_10065085 3300025893 Bacteria 1534
584 Ga0207682_10139110 3300025893 Bacteria 1089
585 Ga0207642_10027412 3300025899 Unclassified 2331
586 Ga0207642_10038175 3300025899 Bacteria 2076
587 Ga0207642_10633404 3300025899 Bacteria 669
588 Ga0207710_10000852 3300025900 Bacteria 16442
589 Ga0207688_10013484 3300025901 Unclassified 4442
590 Ga0207680_10029382 3300025903 Unclassified 3087
591 Ga0207680_10220506 3300025903 Unclassified 1300
592 Ga0207680_10801572 3300025903 Bacteria 675
593 Ga0207680_11050456 3300025903 Bacteria 583
594 Ga0207647_10088228 3300025904 Bacteria 1852
595 Ga0207685_10282761 3300025905 Bacteria 815
596 Ga0207645_10001934 3300025907 Bacteria 16720
597 Ga0207645_10005381 3300025907 Bacteria 9293
598 Ga0207645_10026908 3300025907 Bacteria 3716
599 Ga0207645_10048324 3300025907 Bacteria 2717
600 Ga0207645_10874100 3300025907 Bacteria 611
601 Ga0207643_10005138 3300025908 Bacteria 7002
602 Ga0207643_10008586 3300025908 Bacteria 5480
603 Ga0207643_10030001 3300025908 Bacteria 3025
604 Ga0207705_10549346 3300025909 Bacteria 898
605 Ga0207705_10828653 3300025909 Bacteria 718
606 Ga0207654_10093825 3300025911 Bacteria 1836
607 Ga0207654_10228348 3300025911 Bacteria 1238
608 Ga0207707_10068501 3300025912 Bacteria 3092
609 Ga0207695_10071967 3300025913 Bacteria 3530
610 Ga0207695_10634553 3300025913 Bacteria 949
611 Ga0207671_10099919 3300025914 Bacteria 2196
612 Ga0207671_10356189 3300025914 Bacteria 1161
613 Ga0207660_10003834 3300025917 Bacteria 9803
614 Ga0207662_10021709 3300025918 Unclassified 3673
615 Ga0207662_10238866 3300025918 Bacteria 1189
616 Ga0207662_10952016 3300025918 Bacteria 609
617 Ga0207657_10039267 3300025919 Bacteria 4209
618 Ga0207657_10043943 3300025919 Bacteria 3932
619 Ga0207649_10005426 3300025920 Bacteria 6902
620 Ga0207649_10788019 3300025920 Bacteria 741
621 Ga0207652_10018838 3300025921 Bacteria 5665
622 Ga0207646_10763564 3300025922 Bacteria 862
623 Ga0207681_10020255 3300025923 Unclassified 4212
624 Ga0207681_10063936 3300025923 Unclassified 2539
625 Ga0207681_10103637 3300025923 Bacteria 2056
626 Ga0207681_10258980 3300025923 Bacteria 1361
627 Ga0207681_10357531 3300025923 Unclassified 1170
628 Ga0207650_10022251 3300025925 Unclassified 4485
629 Ga0207650_10057288 3300025925 Unclassified 2898
630 Ga0207650_10109524 3300025925 Unclassified 2136
631 Ga0207650_10140545 3300025925 Bacteria 1898
632 Ga0207650_10215846 3300025925 Bacteria 1542
633 Ga0207650_10287669 3300025925 Unclassified 1339
634 Ga0207650_10297257 3300025925 Unclassified 1318
635 Ga0207650_10459995 3300025925 Bacteria 1060
636 Ga0207650_10512948 3300025925 Unclassified 1003
637 Ga0207659_10028420 3300025926 Bacteria 3801
638 Ga0207659_10050201 3300025926 Bacteria 2963
639 Ga0207659_10183573 3300025926 Bacteria 1659
640 Ga0207659_11500238 3300025926 Unclassified 577
641 Ga0207687_10902367 3300025927 Bacteria 756
642 Ga0207644_10037282 3300025931 Bacteria 3420
643 Ga0207644_10048838 3300025931 Unclassified 3028
644 Ga0207644_10261815 3300025931 Bacteria 1383
645 Ga0207644_10351113 3300025931 Bacteria 1198
646 Ga0207644_10439415 3300025931 Unclassified 1071
647 Ga0207644_10690339 3300025931 Unclassified 851
648 Ga0207690_10033205 3300025932 Bacteria 3317
649 Ga0207690_10058128 3300025932 Bacteria 2615
650 Ga0207706_10027723 3300025933 Bacteria 5064
651 Ga0207706_10106909 3300025933 Unclassified 2462
652 Ga0207706_10177720 3300025933 Unclassified 1870
653 Ga0207706_10583464 3300025933 Bacteria 961
654 Ga0207686_10005406 3300025934 Bacteria 6849
655 Ga0207686_10170855 3300025934 Unclassified 1533
656 Ga0207686_10632322 3300025934 Bacteria 845
657 Ga0207670_10018985 3300025936 Bacteria 4191
658 Ga0207670_10147113 3300025936 Bacteria 1744
659 Ga0207670_10300209 3300025936 Bacteria 1257
660 Ga0207670_10318353 3300025936 Bacteria 1223
661 Ga0207670_10391754 3300025936 Bacteria 1109
662 Ga0207670_10491663 3300025936 Unclassified 995
663 Ga0207670_11770861 3300025936 Unclassified 525
664 Ga0207669_10053289 3300025937 Bacteria 2436
665 Ga0207669_11392892 3300025937 Bacteria 597
666 Ga0207669_11625856 3300025937 Bacteria 551
667 Ga0207704_10020737 3300025938 Unclassified 3484
668 Ga0207704_10066559 3300025938 Unclassified 2262
669 Ga0207704_10106051 3300025938 Bacteria 1887
670 Ga0207704_10304916 3300025938 Bacteria 1221
671 Ga0207704_10477007 3300025938 Bacteria 1001
672 Ga0207704_11560944 3300025938 Bacteria 567
673 Ga0207691_10009095 3300025940 Bacteria 9534
674 Ga0207691_10014205 3300025940 Bacteria 7596
675 Ga0207691_10077842 3300025940 Unclassified 2986
676 Ga0207691_10090652 3300025940 Bacteria 2740
677 Ga0207691_10113912 3300025940 Bacteria 2403
678 Ga0207691_10142374 3300025940 Bacteria 2112
679 Ga0207691_10201402 3300025940 Unclassified 1732
680 Ga0207691_10525217 3300025940 Bacteria 1004
681 Ga0207691_10928239 3300025940 Bacteria 728
682 Ga0207691_10949161 3300025940 Bacteria 719
683 Ga0207691_11099161 3300025940 Bacteria 661
684 Ga0207689_10015791 3300025942 Bacteria 6393
685 Ga0207689_10015930 3300025942 Bacteria 6365
686 Ga0207689_10022578 3300025942 Bacteria 5288
687 Ga0207689_10049068 3300025942 Unclassified 3483
688 Ga0207689_10063806 3300025942 Unclassified 3031
689 Ga0207689_10067860 3300025942 Unclassified 2930
690 Ga0207689_10104803 3300025942 Unclassified 2324
691 Ga0207689_10395491 3300025942 Bacteria 1152
692 Ga0207661_10000738 3300025944 Bacteria 21229
693 Ga0207661_10014684 3300025944 Bacteria 5745
694 Ga0207661_10043248 3300025944 Bacteria 3555
695 Ga0207661_10047130 3300025944 Bacteria 3420
696 Ga0207661_10301127 3300025944 Bacteria 1437
697 Ga0207661_10522603 3300025944 Bacteria 1086
698 Ga0207679_10000902 3300025945 Bacteria 18967
699 Ga0207679_10032681 3300025945 Bacteria 3656
700 Ga0207679_10125874 3300025945 Bacteria 2048
701 Ga0207679_10362698 3300025945 Bacteria 1266
702 Ga0207679_10859078 3300025945 Bacteria 829
703 Ga0207679_11008555 3300025945 Unclassified 763
704 Ga0207667_10096088 3300025949 Bacteria 3058
705 Ga0207667_10183389 3300025949 Bacteria 2149
706 Ga0207651_10044105 3300025960 Bacteria 2982
707 Ga0207651_10077993 3300025960 Bacteria 2374
708 Ga0207651_10114790 3300025960 Unclassified 2029
709 Ga0207651_10140712 3300025960 Bacteria 1863
710 Ga0207651_10363019 3300025960 Unclassified 1223
711 Ga0207651_10639825 3300025960 Bacteria 933
712 Ga0207651_10642254 3300025960 Bacteria 931
713 Ga0207651_10702776 3300025960 Unclassified 891
714 Ga0207651_10949936 3300025960 Bacteria 767
715 Ga0207651_10981146 3300025960 Unclassified 754
716 Ga0207712_10030385 3300025961 Bacteria 3632
717 Ga0207712_10045095 3300025961 Bacteria 3052
718 Ga0207712_10060728 3300025961 Bacteria 2680
719 Ga0207712_10066740 3300025961 Unclassified 2572
720 Ga0207712_10144811 3300025961 Bacteria 1828
721 Ga0207712_10280437 3300025961 Unclassified 1360
722 Ga0207712_10713789 3300025961 Bacteria 876
723 Ga0207668_10204901 3300025972 Bacteria 1573
724 Ga0207668_10276264 3300025972 Bacteria 1375
725 Ga0207668_12014382 3300025972 Bacteria 520
726 Ga0207640_10044336 3300025981 Bacteria 2849
727 Ga0207640_10273930 3300025981 Bacteria 1322
728 Ga0207640_10400135 3300025981 Bacteria 1118
729 Ga0207640_10591306 3300025981 Bacteria 938
730 Ga0207640_10858117 3300025981 Bacteria 790
731 Ga0207658_10046164 3300025986 Unclassified 3180
732 Ga0207658_10047535 3300025986 Unclassified 3141
733 Ga0207658_10139432 3300025986 Bacteria 1960
734 Ga0207658_10166275 3300025986 Bacteria 1812
735 Ga0207658_10195815 3300025986 Bacteria 1683
736 Ga0207658_10923424 3300025986 Bacteria 795
737 Ga0207677_10010870 3300026023 Bacteria 5166
738 Ga0207677_10025173 3300026023 Bacteria 3708
739 Ga0207677_10410763 3300026023 Bacteria 1150
740 Ga0207677_10416708 3300026023 Bacteria 1143
741 Ga0207677_10505142 3300026023 Bacteria 1046
742 Ga0207677_10638641 3300026023 Bacteria 938
743 Ga0207677_11700038 3300026023 Unclassified 585
744 Ga0207703_10118278 3300026035 Unclassified 2271
745 Ga0207703_10190877 3300026035 Bacteria 1814
746 Ga0207703_10205809 3300026035 Bacteria 1751
747 Ga0207703_10412547 3300026035 Bacteria 1255
748 Ga0207703_10924571 3300026035 Bacteria 835
749 Ga0207639_10021442 3300026041 Bacteria 4641
750 Ga0207639_10149869 3300026041 Bacteria 1953
751 Ga0207639_10853686 3300026041 Bacteria 850
752 Ga0207639_11992699 3300026041 Unclassified 542
753 Ga0207678_10154694 3300026067 Bacteria 1958
754 Ga0207678_10631694 3300026067 Bacteria 940
755 Ga0207708_10111662 3300026075 Bacteria 2122
756 Ga0207708_10343179 3300026075 Bacteria 1223
757 Ga0207708_10380710 3300026075 Bacteria 1163
758 Ga0207641_10000380 3300026088 Bacteria 52801
759 Ga0207641_10030996 3300026088 Bacteria 4433
760 Ga0207641_10038209 3300026088 Unclassified 4012
761 Ga0207641_10153140 3300026088 Unclassified 2089
762 Ga0207641_10179946 3300026088 Unclassified 1936
763 Ga0207641_10283683 3300026088 Unclassified 1559
764 Ga0207641_10434559 3300026088 Bacteria 1266
765 Ga0207641_10441837 3300026088 Bacteria 1256
766 Ga0207641_10507230 3300026088 Bacteria 1172
767 Ga0207641_10568991 3300026088 Bacteria 1107
768 Ga0207641_10704931 3300026088 Bacteria 994
769 Ga0207641_11281054 3300026088 Bacteria 733
770 Ga0207641_11382699 3300026088 Bacteria 705
771 Ga0207648_10003538 3300026089 Bacteria 16338
772 Ga0207648_10003599 3300026089 Bacteria 16209
773 Ga0207648_10012445 3300026089 Bacteria 7966
774 Ga0207648_10126450 3300026089 Bacteria 2249
775 Ga0207648_10261908 3300026089 Unclassified 1543
776 Ga0207648_10360239 3300026089 Unclassified 1312
777 Ga0207648_10454315 3300026089 Bacteria 1167
778 Ga0207676_10001466 3300026095 Bacteria 17524
779 Ga0207676_10060215 3300026095 Unclassified 3002
780 Ga0207676_10068244 3300026095 Bacteria 2843
781 Ga0207676_10069450 3300026095 Bacteria 2821
782 Ga0207676_10190630 3300026095 Bacteria 1804
783 Ga0207676_10197411 3300026095 Bacteria 1775
784 Ga0207676_10496143 3300026095 Bacteria 1159
785 Ga0207676_10574438 3300026095 Bacteria 1080
786 Ga0207676_10733910 3300026095 Bacteria 959
787 Ga0207676_10942245 3300026095 Bacteria 849
788 Ga0207676_11058362 3300026095 Unclassified 801
789 Ga0207674_10003262 3300026116 Bacteria 19959
790 Ga0207674_10011079 3300026116 Bacteria 10136
791 Ga0207674_10249578 3300026116 Bacteria 1721
792 Ga0207674_11071057 3300026116 Bacteria 775
793 Ga0207674_11294737 3300026116 Bacteria 698
794 Ga0207675_100002458 3300026118 Bacteria 18348
795 Ga0207675_100018725 3300026118 Bacteria 6463
796 Ga0207675_100041774 3300026118 Unclassified 4281
797 Ga0207675_100058912 3300026118 Bacteria 3584
798 Ga0207675_100059596 3300026118 Bacteria 3562
799 Ga0207675_100175960 3300026118 Bacteria 2047
800 Ga0207675_101209818 3300026118 Bacteria 776
801 Ga0207683_10000691 3300026121 Bacteria 30953
802 Ga0207683_10095644 3300026121 Unclassified 2648
803 Ga0207683_11349968 3300026121 Bacteria 660
804 Ga0207698_10427270 3300026142 Unclassified 1273
805 Ga0207698_10791123 3300026142 Bacteria 950
806 Ga0207698_11086556 3300026142 Bacteria 812
807 Ga0207698_11393339 3300026142 Bacteria 716
808 Ga0209968_1011552 3300027526 Unclassified 1369
809 Ga0209974_10384764 3300027876 Unclassified 549
810 Ga0207428_10106615 3300027907 Unclassified 2160
811 Ga0207428_10415046 3300027907 Bacteria 984
812 Ga0207428_10656523 3300027907 Bacteria 752
813 Ga0268266_10011708 3300028379 Bacteria 7610
814 Ga0268265_10005161 3300028380 Bacteria 8945
815 Ga0268265_10309421 3300028380 Bacteria 1426
816 Ga0268265_11782480 3300028380 Unclassified 622
817 Ga0268265_11925425 3300028380 Bacteria 598
818 Ga0268264_10005023 3300028381 Bacteria 11200
819 Ga0268264_10067024 3300028381 Unclassified 3029
820 Ga0268264_10170717 3300028381 Bacteria 1967
821 Ga0268264_10232807 3300028381 Bacteria 1702
822 Ga0268264_10392022 3300028381 Unclassified 1332
823 Ga0268264_10968754 3300028381 Unclassified 856
824 Ga0307517_10358958 3300028786 Bacteria 788
825 Ga0307515_10000162 3300028794 Bacteria 163720
826 Ga0307515_10009312 3300028794 Bacteria 19000
827 Ga0307513_10134888 3300031456 Bacteria 2406
828 Ga0307513_10210849 3300031456 Bacteria 1774
829 Ga0307513_10258582 3300031456 Bacteria 1532
830 Ga0307513_10839378 3300031456 Bacteria 625
831 Ga0307509_10087781 3300031507 Bacteria 3194
832 Ga0307516_10501757 3300031730 Bacteria 868
833 Ga0307405_10000049 3300031731 Bacteria 66592
834 Ga0307407_10000024 3300031903 Bacteria 113716
835 Ga0307412_10708827 3300031911 Bacteria 865
836 Ga0307412_11091299 3300031911 Bacteria 710
837 Ga0307409_100036292 3300031995 Bacteria 3622
838 Ga0307416_100000037 3300032002 Bacteria 137513
839 Ga0307414_10001153 3300032004 Bacteria 13555
840 Ga0307414_10004809 3300032004 Bacteria 7371
841 Ga0307414_10006990 3300032004 Bacteria 6326
842 Ga0307414_10014942 3300032004 Bacteria 4674
843 Ga0307414_10091226 3300032004 Unclassified 2264
844 Ga0307414_10261129 3300032004 Bacteria 1445
845 Ga0307414_10364214 3300032004 Bacteria 1245
846 Ga0307414_10937782 3300032004 Bacteria 795
847 Ga0307414_11074882 3300032004 Bacteria 742
848 Ga0307414_11133521 3300032004 Bacteria 723
849 Ga0307414_11675027 3300032004 Bacteria 593
850 Ga0316585_10261770 3300032137 Unclassified 573
851 Ga0373936_0158230 3300035113 Bacteria 986
852 Ga0373943_0409636 3300035170 Bacteria 784
853 Ga0373927_0700862 3300035695 Unclassified 669
854 Ga0373947_1134028 3300035725 Bacteria 533
855 Ga0373937_0091931 3300036401 Bacteria 2812
856 Ga0373937_0541574 3300036401 Bacteria 1106
857 Ga0316584_0401050 3300036712 Bacteria 977
858 Ga0395905_0697672 3300037471 Bacteria 917
859 Ga0395905_0943594 3300037471 Unclassified 766
860 Ga0439436_0012382 3300041404 Bacteria 2590
861 Ga0439453_0020104 3300041408 Bacteria 1194
862 Ga0451787_042402 3300041441 Bacteria 748
863 Ga0451793_1161307 3300041452 Bacteria 759
864 Ga0451798_0509956 3300041458 Bacteria 840
865 Ga0451798_0812166 3300041458 Bacteria 651
866 Ga0451802_0969387 3300041460 Bacteria 606
867 Ga0451833_0659560 3300041491 Unclassified 852
868 Ga0451853_0376106 3300041512 Unclassified 723
869 Ga0451853_3668395 3300041512 Bacteria 1447
870 Ga0439441_001178 3300042001 Bacteria 3314
871 Ga0439441_057238 3300042001 Unclassified 814
872 Ga0439442_003138 3300042002 Unclassified 3268
873 Ga0439443_011622 3300042003 Unclassified 1293
874 Ga0439445_0043335 3300042004 Bacteria 1201
875 Ga0439449_0014815 3300042007 Bacteria 2930
876 Ga0439457_000827 3300042014 Bacteria 9289
877 Ga0439462_0052773 3300042015 Bacteria 1094
878 Ga0439446_0138484 3300042156 Bacteria 794
879 Ga0451577_0191859 3300042876 Unclassified 1843
880 Ga0466969_0000103 3300044656 Bacteria 44804
881 Ga0466972_0000012 3300044658 Bacteria 246338
882 Ga0466972_0000055 3300044658 Bacteria 111338
883 Ga0466966_0000097 3300044684 Bacteria 53836
884 Ga0466964_0114004 3300044706 Bacteria 1209
885 Ga0453684_0127023 3300044712 Unclassified 3067
886 Ga0453684_0321098 3300044712 Bacteria 1754
887 Ga0453684_0506006 3300044712 Bacteria 1337
888 Ga0466968_0181868 3300044735 Bacteria 978
889 Ga0466970_0000661 3300044765 Bacteria 16929
890 Ga0466957_0009079 3300044842 Bacteria 5667
891 Ga0466957_0014317 3300044842 Bacteria 4618
892 Ga0466960_0133182 3300044901 Bacteria 1314
893 Ga0466959_0000049 3300045049 Bacteria 83496
894 Ga0466959_0098950 3300045049 Unclassified 2089
895 Ga0495592_0071330 3300046454 Unclassified 2529
896 Ga0495580_0473783 3300046472 Bacteria 838
897 Ga0495582_0401646 3300046473 Unclassified 790
898 Ga0495582_0660730 3300046473 Unclassified 605
899 Ga0495607_0481222 3300046501 Bacteria 553
900 Ga0495606_0050331 3300046507 Bacteria 2726
901 Ga0495606_0166272 3300046507 Bacteria 1283
902 Ga0495610_0001236 3300046512 Bacteria 22946
903 Ga0495630_0064883 3300046517 Unclassified 2744
904 Ga0495630_0089950 3300046517 Bacteria 2319
905 Ga0495630_0119858 3300046517 Bacteria 1996
906 Ga0495630_0829498 3300046517 Bacteria 705
907 Ga0495644_0183496 3300046523 Bacteria 805
908 Ga0495666_0333421 3300046526 Bacteria 684
909 Ga0495652_0122549 3300046529 Bacteria 2071
910 Ga0495665_0268490 3300046531 Bacteria 876
911 Ga0495586_0226369 3300046535 Bacteria 1063
912 Ga0495586_0668487 3300046535 Bacteria 600
913 Ga0495598_0267966 3300046537 Bacteria 638
914 Ga0495609_0000025 3300046538 Bacteria 256898
915 Ga0495609_0068116 3300046538 Bacteria 1566
916 Ga0495621_0074559 3300046539 Bacteria 1255
917 Ga0495633_0151290 3300046558 Bacteria 1072
918 Ga0495668_0000489 3300046616 Bacteria 49613
919 Ga0495668_0005239 3300046616 Bacteria 8883
920 Ga0495634_0272909 3300046642 Bacteria 1029
921 Ga0495635_0487075 3300046663 Bacteria 813
922 Ga0495657_0396324 3300046675 Bacteria 813
923 Ga0495658_0015643 3300046683 Bacteria 3893
924 Ga0495604_0325939 3300047317 Bacteria 1026
925 Ga0495604_0335894 3300047317 Unclassified 1007
926 Ga0495674_0075977 3300047319 Unclassified 2890
927 Ga0495674_0144101 3300047319 Bacteria 2001
928 Ga0495674_0488483 3300047319 Bacteria 986
929 Ga0495672_0020249 3300047320 Unclassified 4365
930 Ga0495672_0084410 3300047320 Bacteria 1761
931 Ga0495675_0525942 3300047444 Unclassified 677
932 Ga0495684_0302795 3300047471 Bacteria 1148
933 Ga0495686_0000309 3300047472 Bacteria 82637
934 Ga0495686_0011789 3300047472 Bacteria 6151
935 Ga0495686_0106369 3300047472 Unclassified 1687
936 Ga0495602_0144639 3300048088 Bacteria 1878
937 Ga0496101_1046228 3300048904 Unclassified 642
938 Ga0496110_0111521 3300048913 Unclassified 2459
939 Ga0496110_0351734 3300048913 Unclassified 1342
940 Ga0496111_0542328 3300048914 Unclassified 854
941 Ga0496118_0264875 3300048921 Bacteria 967
942 Ga0496124_0086261 3300048927 Unclassified 2570
943 Ga0501290_024755 3300049513 Bacteria 837
944 Ga0501300_015794 3300049523 Bacteria 1102
945 Ga0501031_0074568 3300049568 Bacteria 2209
946 Ga0501032_0343630 3300049569 Unclassified 962
947 Ga0501034_0009004 3300049571 Bacteria 10484
948 Ga0501036_0135714 3300049572 Bacteria 2077
949 Ga0501036_0346584 3300049572 Bacteria 1240
950 Ga0501037_0014127 3300049573 Bacteria 5882
951 Ga0501037_0105476 3300049573 Bacteria 2031
952 Ga0501038_0097988 3300049574 Unclassified 2445
953 Ga0501038_0108978 3300049574 Unclassified 2295
954 Ga0501039_0118689 3300049575 Unclassified 2072
955 Ga0501039_0183059 3300049575 Bacteria 1647
956 Ga0501040_0119819 3300049576 Unclassified 1846
957 Ga0501043_0128031 3300049579 Bacteria 1990
958 Ga0501046_0650803 3300049580 Bacteria 745
959 Ga0501047_0004068 3300049581 Bacteria 13756
960 Ga0501047_0073419 3300049581 Bacteria 3294
961 Ga0501047_0484911 3300049581 Unclassified 1064
962 Ga0501249_054029 3300049679 Bacteria 924
963 Ga0501257_018663 3300049686 Bacteria 1619
964 Ga0501257_022946 3300049686 Bacteria 1478
965 Ga0501225_0002922 3300049705 Bacteria 5247
966 Ga0501225_0221027 3300049705 Bacteria 610
967 Ga0501225_0367309 3300049705 Bacteria 501
968 Ga0501083_0376495 3300049744 Bacteria 923
969 Ga0501241_029653 3300049758 Bacteria 1030
970 Ga0501035_0239732 3300049822 Bacteria 1543
971 Ga0501044_0007058 3300049823 Bacteria 12361
972 Ga0501044_0022983 3300049823 Bacteria 6636
973 Ga0501044_0033123 3300049823 Bacteria 5430
974 nmdc:mga03683_538042_c1 3300050489 Bacteria 568
975 nmdc:mga0k408_32475_c1 3300050493 Bacteria 2982
976 nmdc:mga0k408_42881_c1 3300050493 Unclassified 2606
977 nmdc:mga0k408_50920_c1 3300050493 Unclassified 2398
978 nmdc:mga07m45_789462_c1 3300050496 Unclassified 544
979 nmdc:mga05p37_20024_c2 3300050507 Bacteria 7172
980 nmdc:mga05p37_359497_c1 3300050507 Bacteria 1712
981 nmdc:mga09592_13499_c1 3300050508 Bacteria 6672
982 nmdc:mga09592_28065_c1 3300050508 Bacteria 4674
983 nmdc:mga0qj67_9692_c1 3300050509 Bacteria 7174
984 nmdc:mga06r32_402761_c1 3300050510 Bacteria 1350
985 nmdc:mga06r32_807494_c1 3300050510 Bacteria 898
986 nmdc:mga06r32_844003_c1 3300050510 Bacteria 875
987 nmdc:mga08y16_1501114_c1 3300050511 Unclassified 634
988 nmdc:mga08y16_1919537_c1 3300050511 Unclassified 543
989 nmdc:mga08y16_228835_c1 3300050511 Bacteria 1923
990 nmdc:mga08y16_251855_c1 3300050511 Bacteria 1825
991 nmdc:mga08y16_449092_c1 3300050511 Bacteria 1315
992 nmdc:mga08y16_55351_c1 3300050511 Bacteria 4145
993 nmdc:mga08y16_81001_c1 3300050511 Bacteria 3385
994 nmdc:mga0n895_283166_c1 3300050512 Bacteria 1681
995 Ga0495619_0280862 3300053085 Bacteria 1154
996 Ga0500578_0000934 3300053086 Bacteria 32814
997 Ga0500644_0006068 3300053088 Bacteria 3079
998 Ga0500644_0146434 3300053088 Unclassified 943
999 Ga0500562_000010 3300053108 Bacteria 183815
1000 Ga0500559_0043057 3300053136 Bacteria 1972
1001 Ga0500568_0170281 3300053139 Unclassified 802
1002 Ga0500616_0015278 3300053153 Bacteria 4394
1003 Ga0500616_0084695 3300053153 Bacteria 1585
1004 Ga0500636_0268542 3300053177 Bacteria 859
1005 Ga0500611_000002 3300053727 Bacteria 345991
1006 Ga0500645_019448 3300053730 Bacteria 2112
1007 2586209277 2585427687 Bacteria 5544917
1008 2738727299 2738541278 Bacteria 9755573
1009 2739590196 2739367651 Bacteria 6359826
1010 2739615988 2739367656 Bacteria 5152243
1011 2819588344 2818991444 Bacteria 6968812
1012 2842723021 2842722452 Bacteria 6263924
1013 2842913977 2842909656 Bacteria 6185908
1014 2849283718 2849281842 Bacteria 6065644
1015 2857628527 2857627736 Bacteria 5625397
1016 2884636423 2884634485 Bacteria 3928637
1017 2945999995 2945997725 Bacteria 6404843
1018 2954016594 2954016120 Bacteria 6446024
1019 2977245474 2977243572 Bacteria 4374394
1020 Ga0163162_10263899
1021 JGI25150J39212_1000001
1022 JGI25151J46595_10000001
1023 JGI25153J46596_10000001
1024 rootH1_10053600
1025 rootH2_10190875
1026 rootL2_10264365
1027 rootL2_10293189
1028 rootH1_10000181
1029 rootH1_10054153
1030 rootH1_10150505
1031 rootH1_10244305
1032 Ga0055536_1000049
1033 Ga0055530_10002378
1034 Ga0065714_10105041
1035 Ga0065714_10143233
1036 Ga0065714_10166575
1037 Ga0065714_10274671
1038 Ga0065714_10415037
1039 Ga0065704_10090452
1040 Ga0065704_10091501
1041 Ga0065704_10225333
1042 Ga0065704_10407427
1043 Ga0065712_10029553
1044 Ga0065712_10105332
1045 Ga0065712_10112518
1046 Ga0065712_10184667
1047 Ga0065712_10341352
1048 Ga0065712_10451977
1049 Ga0065712_10624182
1050 Ga0065715_10342428
1051 Ga0065715_10794894
1052 Ga0065707_10213588
1053 Ga0065707_11014821
1054 Ga0070658_10356901
1055 Ga0070658_10666312
1056 Ga0070658_11026603
1057 Ga0070658_11537467
1058 Ga0070676_10006273
1059 Ga0070676_10006346
1060 Ga0070676_10014248
1061 Ga0070676_10035984
1062 Ga0070676_10082262
1063 Ga0070676_10184920
1064 Ga0070683_100000884
1065 Ga0070683_100002198
1066 Ga0070683_100006866
1067 Ga0070683_100029414
1068 Ga0070683_100330631
1069 Ga0070683_100767271
1070 Ga0070683_101118224
1071 Ga0070690_100030587
1072 Ga0070690_100138734
1073 Ga0070690_100903427
1074 Ga0070670_100038715
1075 Ga0070670_100071381
1076 Ga0070670_100079675
1077 Ga0070670_100090886
1078 Ga0070670_100136497
1079 Ga0070670_100161718
1080 Ga0070670_100170053
1081 Ga0070670_100179924
1082 Ga0070670_100188955
1083 Ga0070670_100433475
1084 Ga0070670_100705587
1085 Ga0070670_100849121
1086 Ga0070670_101098515
1087 Ga0070670_101989193
1088 Ga0070677_10093803
1089 Ga0070677_10104953
1090 Ga0068869_100032681
1091 Ga0068869_100079604
1092 Ga0068869_100346436
1093 Ga0068869_100403661
1094 Ga0068869_100420282
1095 Ga0068869_101392285
1096 Ga0070666_10009022
1097 Ga0070666_10150195
1098 Ga0070666_10349275
1099 Ga0070666_10894214
1100 Ga0070680_100023470
1101 Ga0070682_100002796
1102 Ga0070682_100009802
1103 Ga0070682_100574770
1104 Ga0070682_100980691
1105 Ga0070682_101203970
1106 Ga0068868_100019618
1107 Ga0068868_100024597
1108 Ga0068868_100029146
1109 Ga0068868_100139554
1110 Ga0068868_100360934
1111 Ga0068868_100390339
1112 Ga0068868_100509856
1113 Ga0070660_100025895
1114 Ga0070660_100165681
1115 Ga0070689_100008890
1116 Ga0070689_100056139
1117 Ga0070689_100066838
1118 Ga0070689_100170158
1119 Ga0070689_100885230
1120 Ga0070689_100973196
1121 Ga0070689_101517759
1122 Ga0070691_10001334
1123 Ga0070687_100217812
1124 Ga0070687_100815374
1125 Ga0070661_100001199
1126 Ga0070661_100169617
1127 Ga0070661_100290147
1128 Ga0070661_101088717
1129 Ga0070661_101362213
1130 Ga0070668_100005828
1131 Ga0070668_100050217
1132 Ga0070668_100211590
1133 Ga0070668_101331949
1134 Ga0070669_100021823
1135 Ga0070669_100038346
1136 Ga0070669_100038810
1137 Ga0070669_100137279
1138 Ga0070669_100206513
1139 Ga0070675_100055610
1140 Ga0070675_100075014
1141 Ga0070675_100256189
1142 Ga0070675_100421802
1143 Ga0070675_100665980
1144 Ga0070675_100682108
1145 Ga0070675_101797255
1146 Ga0070671_100104453
1147 Ga0070671_100157818
1148 Ga0070671_100322607
1149 Ga0070671_100351174
1150 Ga0070671_100514063
1151 Ga0070671_100809958
1152 Ga0070671_100851802
1153 Ga0070674_100002262
1154 Ga0070674_100220221
1155 Ga0070674_101633353
1156 Ga0070673_100017076
1157 Ga0070673_100028166
1158 Ga0070673_100034436
1159 Ga0070673_100222754
1160 Ga0070673_100341093
1161 Ga0070673_100393675
1162 Ga0070673_100425301
1163 Ga0070688_100065171
1164 Ga0070688_100094197
1165 Ga0070688_100112375
1166 Ga0070688_100259140
1167 Ga0070688_100459320
1168 Ga0070688_100818293
1169 Ga0070688_100897212
1170 Ga0070659_100002681
1171 Ga0070659_100374152
1172 Ga0070667_100008921
1173 Ga0070667_100044780
1174 Ga0070667_100285969
1175 Ga0070667_100322357
1176 Ga0070667_100387567
1177 Ga0070667_100454645
1178 Ga0070667_100941170
1179 Ga0070667_101099550
1180 Ga0070667_101117632
1181 Ga0070700_100212574
1182 Ga0070700_100311240
1183 Ga0070708_101545923
1184 Ga0070663_100130815
1185 Ga0070663_100179024
1186 Ga0070663_100382812
1187 Ga0070663_100612015
1188 Ga0070678_100068363
1189 Ga0070678_100280384
1190 Ga0070678_100994860
1191 Ga0070678_101557452
1192 Ga0070662_100080932
1193 Ga0070681_10103173
1194 Ga0068867_100003798
1195 Ga0068867_100015472
1196 Ga0068867_100088556
1197 Ga0068867_100228530
1198 Ga0068867_100258565
1199 Ga0068867_100328520
1200 Ga0068867_100445586
1201 Ga0068867_100771679
1202 Ga0068867_101230353
1203 Ga0068867_101815760
1204 Ga0070685_10024684
1205 Ga0070685_10064012
1206 Ga0070685_10130977
1207 Ga0070685_10369176
1208 Ga0070685_10476729
1209 Ga0070685_11014295
1210 Ga0070698_100000645
1211 Ga0070698_100008979
1212 Ga0070698_100019854
1213 Ga0070698_100140783
1214 Ga0070698_100326179
1215 Ga0070699_101620087
1216 Ga0070679_100141159
1217 Ga0070684_100000298
1218 Ga0070684_100000731
1219 Ga0070684_100022231
1220 Ga0070684_100255794
1221 Ga0068853_100003450
1222 Ga0068853_100052550
1223 Ga0068853_100066002
1224 Ga0068853_100914221
1225 Ga0070672_100027429
1226 Ga0070672_100041352
1227 Ga0070672_100051699
1228 Ga0070672_100215575
1229 Ga0070672_100691284
1230 Ga0070672_101250206
1231 Ga0070672_101251864
1232 Ga0070672_101354764
1233 Ga0070672_101393976
1234 Ga0070693_100020989
1235 Ga0070693_100478637
1236 Ga0070665_100016621
1237 Ga0070665_100057795
1238 Ga0070665_101017656
1239 Ga0070665_101097011
1240 Ga0070665_101677084
1241 Ga0070704_100517298
1242 Ga0070704_100735393
1243 Ga0068855_100063789
1244 Ga0068855_100306408
1245 Ga0068855_100496220
1246 Ga0070664_100000884
1247 Ga0070664_100073067
1248 Ga0070664_100114267
1249 Ga0070664_100167746
1250 Ga0070664_100208954
1251 Ga0070664_100295760
1252 Ga0070664_100407187
1253 Ga0070664_100452610
1254 Ga0068857_100001112
1255 Ga0068857_100210581
1256 Ga0068857_100264695
1257 Ga0068857_100367708
1258 Ga0068857_100509685
1259 Ga0068857_101046206
1260 Ga0068854_100048477
1261 Ga0068854_100224693
1262 Ga0068854_100460605
1263 Ga0068854_102037084
1264 Ga0068856_100030139
1265 Ga0070702_100404723
1266 Ga0070702_101511161
1267 Ga0068852_100072020
1268 Ga0068852_100131631
1269 Ga0068852_100139480
1270 Ga0068852_100223628
1271 Ga0068852_100457373
1272 Ga0068852_100895315
1273 Ga0068852_101179371
1274 Ga0068859_100004404
1275 Ga0068859_100075284
1276 Ga0068859_100108016
1277 Ga0068859_100124092
1278 Ga0068859_100214701
1279 Ga0068859_100229380
1280 Ga0068859_100304305
1281 Ga0068859_100304908
1282 Ga0068859_100671669
1283 Ga0068859_100693113
1284 Ga0068859_101083943
1285 Ga0068859_101604169
1286 Ga0068864_100004501
1287 Ga0068864_100053139
1288 Ga0068864_100093526
1289 Ga0068864_100245416
1290 Ga0068864_100254652
1291 Ga0068864_100271715
1292 Ga0068864_100373124
1293 Ga0068864_100445220
1294 Ga0068864_100945805
1295 Ga0068866_10105036
1296 Ga0068866_10341620
1297 Ga0068866_10471334
1298 Ga0068861_100002289
1299 Ga0068861_100004874
1300 Ga0068861_100056095
1301 Ga0068861_100266584
1302 Ga0068861_100643567
1303 Ga0068861_101214280
1304 Ga0068851_10007629
1305 Ga0068851_10045339
1306 Ga0068851_10408476
1307 Ga0068870_10007133
1308 Ga0068870_10039824
1309 Ga0068870_10186277
1310 Ga0068863_100021002
1311 Ga0068863_100112697
1312 Ga0068863_100131005
1313 Ga0068863_100251085
1314 Ga0068863_100297431
1315 Ga0068863_100310402
1316 Ga0068863_100597451
1317 Ga0068863_100843924
1318 Ga0068863_100947352
1319 Ga0068863_100953563
1320 Ga0068863_101000882
1321 Ga0068863_101544605
1322 Ga0068858_100035184
1323 Ga0068858_100129440
1324 Ga0068858_100426769
1325 Ga0068858_100477133
1326 Ga0068858_100717233
1327 Ga0068858_102145998
1328 Ga0068860_100039308
1329 Ga0068860_100066104
1330 Ga0068860_100215946
1331 Ga0068860_100216549
1332 Ga0068860_100332966
1333 Ga0068860_100362646
1334 Ga0068860_100436720
1335 Ga0068860_100440244
1336 Ga0068860_100522898
1337 Ga0068860_102133210
1338 Ga0068860_102198580
1339 Ga0068862_100008657
1340 Ga0068862_100050350
1341 Ga0068862_100154765
1342 Ga0068862_100246618
1343 Ga0068862_100368944
1344 Ga0068862_100763185
1345 Ga0075366_10028830
1346 Ga0075366_10090286
1347 Ga0075366_10409239
1348 Ga0097621_100006252
1349 Ga0097621_100036651
1350 Ga0097621_100150295
1351 Ga0097621_100418028
1352 Ga0097621_100493333
1353 Ga0097621_100964397
1354 Ga0097621_101449434
1355 Ga0097621_101937953
1356 Ga0068871_100028294
1357 Ga0068871_100094846
1358 Ga0068871_100359833
1359 Ga0068871_100376721
1360 Ga0068871_100686995
1361 Ga0068871_100955658
1362 Ga0068871_101984683
1363 Ga0075428_100006620
1364 Ga0075428_100120899
1365 Ga0075431_100302401
1366 Ga0075431_100544290
1367 Ga0075431_100827605
1368 Ga0075434_100542930
1369 Ga0075429_100006687
1370 Ga0068865_100007780
1371 Ga0068865_100136220
1372 Ga0068865_100522607
1373 Ga0068865_100685092
1374 Ga0068865_101421373
1375 Ga0097620_100004404
1376 Ga0097620_100075283
1377 Ga0097620_100108014
1378 Ga0097620_100124090
1379 Ga0097620_100214718
1380 Ga0097620_100229387
1381 Ga0097620_100304303
1382 Ga0097620_100304931
1383 Ga0097620_100671662
1384 Ga0097620_100693110
1385 Ga0097620_101084175
1386 Ga0097620_101604142
1387 Ga0105251_10137987
1388 Ga0105240_10128066
1389 Ga0105240_10781773
1390 Ga0111539_10013360
1391 Ga0111539_10032439
1392 Ga0111539_10067124
1393 Ga0111539_10220240
1394 Ga0111539_10246021
1395 Ga0111539_11103185
1396 Ga0111539_11709038
1397 Ga0105245_10567915
1398 Ga0105245_11409426
1399 Ga0105247_10000726
1400 Ga0105247_10247903
1401 Ga0105247_10262322
1402 Ga0114129_10003569
1403 Ga0114129_10114463
1404 Ga0114129_10247648
1405 Ga0114129_12124285
1406 Ga0105243_11259514
1407 Ga0105243_12064240
1408 Ga0105241_10039119
1409 Ga0105241_10070874
1410 Ga0105241_10210813
1411 Ga0105241_10515675
1412 Ga0105241_10557781
1413 Ga0105241_10633758
1414 Ga0105242_10025664
1415 Ga0105242_10041753
1416 Ga0105242_10064334
1417 Ga0105242_10077674
1418 Ga0105242_10145021
1419 Ga0105242_10177261
1420 Ga0105242_10518059
1421 Ga0105242_10654933
1422 Ga0105242_10675525
1423 Ga0105242_10833908
1424 Ga0105242_11039062
1425 Ga0105242_11119214
1426 Ga0105248_10184560
1427 Ga0105248_11053959
1428 Ga0105237_10012365
1429 Ga0105237_10145977
1430 Ga0105237_11610442
1431 Ga0105238_11282734
1432 Ga0105249_10001240
1433 Ga0105249_10010036
1434 Ga0105249_10015498
1435 Ga0105249_10020990
1436 Ga0105249_10068305
1437 Ga0105249_10154060
1438 Ga0105249_10196662
1439 Ga0105249_10385708
1440 Ga0105249_10410106
1441 Ga0105249_10505328
1442 Ga0105239_10006184
1443 Ga0105239_10120110
1444 Ga0105239_10156948
1445 Ga0105239_10319849
1446 Ga0105239_10606324
1447 Ga0105239_11922873
1448 Ga0105246_10087749
1449 Ga0105246_10187786
1450 Ga0105246_10549492
1451 Ga0105246_10562040
1452 Ga0105246_10645339
1453 Ga0105246_10683687
1454 Ga0157373_10025044
1455 Ga0157373_10050175
1456 Ga0157373_10066048
1457 Ga0157373_10295262
1458 Ga0157373_10938817
1459 Ga0157371_10000119
1460 Ga0157371_10003679
1461 Ga0157371_10015182
1462 Ga0157371_10028476
1463 Ga0157371_10081579
1464 Ga0157371_10406661
1465 Ga0157371_10450674
1466 Ga0157370_10030052
1467 Ga0157370_10033654
1468 Ga0157370_10265726
1469 Ga0157370_10416454
1470 Ga0157370_10459668
1471 Ga0157370_10503203
1472 Ga0157370_10507602
1473 Ga0157370_10575848
1474 Ga0157370_10735814
1475 Ga0157370_10842792
1476 Ga0157369_10000015
1477 Ga0157369_10322555
1478 Ga0157369_10411950
1479 Ga0157369_10421462
1480 Ga0157374_10000955
1481 Ga0157374_10055794
1482 Ga0157374_10200871
1483 Ga0157374_10275185
1484 Ga0157374_10369768
1485 Ga0157374_10447887
1486 Ga0157374_11544754
1487 Ga0157374_11657892
1488 Ga0157378_10002905
1489 Ga0157378_10066840
1490 Ga0157378_10082393
1491 Ga0157378_10092687
1492 Ga0157378_10170532
1493 Ga0157378_10190987
1494 Ga0157378_10237149
1495 Ga0157378_10333369
1496 Ga0157378_10661608
1497 Ga0157378_10962941
1498 Ga0157378_11549208
1499 Ga0163162_10000705
1500 Ga0163162_10042164
1501 Ga0163162_10068699
1502 Ga0163162_10166333
1503 Ga0163162_10173453
1504 Ga0163162_10244214
1505 Ga0163162_10317383
1506 Ga0163162_10318254
1507 Ga0163162_10410055
1508 Ga0163162_10492466
1509 Ga0163162_10803852
1510 Ga0163162_10803864
1511 Ga0163162_10857042
1512 Ga0163162_10985075
1513 Ga0157372_10053750
1514 Ga0157372_10188694
1515 Ga0157372_10206085
1516 Ga0157372_10381973
1517 Ga0157372_10387543
1518 Ga0157372_10702646
1519 Ga0157375_10002578
1520 Ga0157375_10018939
1521 Ga0157375_10042379
1522 Ga0157375_10072939
1523 Ga0157375_10296600
1524 Ga0157375_10409309
1525 Ga0157375_10416386
1526 Ga0157375_10524470
1527 Ga0157375_10579078
1528 Ga0157375_10686151
1529 Ga0157375_10706200
1530 Ga0157375_10804328
1531 Ga0157375_11207623
1532 Ga0157375_11327413
1533 Ga0157375_11342922
1534 Ga0163163_10000075
1535 Ga0163163_10003651
1536 Ga0163163_10051116
1537 Ga0163163_10057069
1538 Ga0163163_10235166
1539 Ga0163163_12347744
1540 Ga0163163_12364570
1541 Ga0163163_12691298
1542 Ga0157380_10015138
1543 Ga0157380_10022281
1544 Ga0157380_10029842
1545 Ga0157380_10127062
1546 Ga0157380_10158898
1547 Ga0157380_10614001
1548 Ga0157380_11189433
1549 Ga0157380_11429565
1550 Ga0157380_12043816
1551 Ga0157380_12119135
1552 Ga0182008_10389072
1553 Ga0157377_10040530
1554 Ga0157377_10161590
1555 Ga0157377_10270941
1556 Ga0157377_10394916
1557 Ga0157379_10040212
1558 Ga0157379_10119098
1559 Ga0157379_10241637
1560 Ga0157379_10477251
1561 Ga0157379_10548316
1562 Ga0157379_10797736
1563 Ga0157379_11044122
1564 Ga0157376_10018590
1565 Ga0157376_10093092
1566 Ga0157376_10127726
1567 Ga0157376_10181832
1568 Ga0157376_10262818
1569 Ga0157376_10277377
1570 Ga0157376_10309012
1571 Ga0157376_10498432
1572 Ga0157376_11702982
1573 Ga0182006_1000091
1574 Ga0182006_1000957
1575 Ga0182006_1001651
1576 Ga0182007_10000010
1577 Ga0182007_10148461
1578 Ga0163161_10000046
1579 Ga0163161_10000890
1580 Ga0163161_10002168
1581 Ga0163161_10004792
1582 Ga0163161_10231168
1583 Ga0163161_10277361
1584 Ga0163161_10335287
1585 Ga0163161_10410025
1586 Ga0163161_11143908
1587 Ga0207425_1000002
1588 Ga0209646_1009276
1589 Ga0209129_1000002
1590 Ga0207666_1014067
1591 Ga0209676_1000001
1592 Ga0209025_1000004
1593 Ga0209758_1000006
1594 Ga0209050_1000258
1595 Ga0207697_10044155
1596 Ga0207697_10064655
1597 Ga0207697_10190333
1598 Ga0207656_10060635
1599 Ga0207656_10185330
1600 Ga0207656_10253863
1601 Ga0207682_10065085
1602 Ga0207682_10139110
1603 Ga0207642_10027412
1604 Ga0207642_10038175
1605 Ga0207642_10633404
1606 Ga0207710_10000852
1607 Ga0207688_10013484
1608 Ga0207680_10029382
1609 Ga0207680_10220506
1610 Ga0207680_10801572
1611 Ga0207680_11050456
1612 Ga0207647_10088228
1613 Ga0207685_10282761
1614 Ga0207645_10001934
1615 Ga0207645_10005381
1616 Ga0207645_10026908
1617 Ga0207645_10048324
1618 Ga0207645_10874100
1619 Ga0207643_10005138
1620 Ga0207643_10008586
1621 Ga0207643_10030001
1622 Ga0207705_10549346
1623 Ga0207705_10828653
1624 Ga0207654_10093825
1625 Ga0207654_10228348
1626 Ga0207707_10068501
1627 Ga0207695_10071967
1628 Ga0207695_10634553
1629 Ga0207671_10099919
1630 Ga0207671_10356189
1631 Ga0207660_10003834
1632 Ga0207662_10021709
1633 Ga0207662_10238866
1634 Ga0207662_10952016
1635 Ga0207657_10039267
1636 Ga0207657_10043943
1637 Ga0207649_10005426
1638 Ga0207649_10788019
1639 Ga0207652_10018838
1640 Ga0207646_10763564
1641 Ga0207681_10020255
1642 Ga0207681_10063936
1643 Ga0207681_10103637
1644 Ga0207681_10258980
1645 Ga0207681_10357531
1646 Ga0207650_10022251
1647 Ga0207650_10057288
1648 Ga0207650_10109524
1649 Ga0207650_10140545
1650 Ga0207650_10215846
1651 Ga0207650_10287669
1652 Ga0207650_10297257
1653 Ga0207650_10459995
1654 Ga0207650_10512948
1655 Ga0207659_10028420
1656 Ga0207659_10050201
1657 Ga0207659_10183573
1658 Ga0207659_11500238
1659 Ga0207687_10902367
1660 Ga0207644_10037282
1661 Ga0207644_10048838
1662 Ga0207644_10261815
1663 Ga0207644_10351113
1664 Ga0207644_10439415
1665 Ga0207644_10690339
1666 Ga0207690_10033205
1667 Ga0207690_10058128
1668 Ga0207706_10027723
1669 Ga0207706_10106909
1670 Ga0207706_10177720
1671 Ga0207706_10583464
1672 Ga0207686_10005406
1673 Ga0207686_10170855
1674 Ga0207686_10632322
1675 Ga0207670_10018985
1676 Ga0207670_10147113
1677 Ga0207670_10300209
1678 Ga0207670_10318353
1679 Ga0207670_10391754
1680 Ga0207670_10491663
1681 Ga0207670_11770861
1682 Ga0207669_10053289
1683 Ga0207669_11392892
1684 Ga0207669_11625856
1685 Ga0207704_10020737
1686 Ga0207704_10066559
1687 Ga0207704_10106051
1688 Ga0207704_10304916
1689 Ga0207704_10477007
1690 Ga0207704_11560944
1691 Ga0207691_10009095
1692 Ga0207691_10014205
1693 Ga0207691_10077842
1694 Ga0207691_10090652
1695 Ga0207691_10113912
1696 Ga0207691_10142374
1697 Ga0207691_10201402
1698 Ga0207691_10525217
1699 Ga0207691_10928239
1700 Ga0207691_10949161
1701 Ga0207691_11099161
1702 Ga0207689_10015791
1703 Ga0207689_10015930
1704 Ga0207689_10022578
1705 Ga0207689_10049068
1706 Ga0207689_10063806
1707 Ga0207689_10067860
1708 Ga0207689_10104803
1709 Ga0207689_10395491
1710 Ga0207661_10000738
1711 Ga0207661_10014684
1712 Ga0207661_10043248
1713 Ga0207661_10047130
1714 Ga0207661_10301127
1715 Ga0207661_10522603
1716 Ga0207679_10000902
1717 Ga0207679_10032681
1718 Ga0207679_10125874
1719 Ga0207679_10362698
1720 Ga0207679_10859078
1721 Ga0207679_11008555
1722 Ga0207667_10096088
1723 Ga0207667_10183389
1724 Ga0207651_10044105
1725 Ga0207651_10077993
1726 Ga0207651_10114790
1727 Ga0207651_10140712
1728 Ga0207651_10363019
1729 Ga0207651_10639825
1730 Ga0207651_10642254
1731 Ga0207651_10702776
1732 Ga0207651_10949936
1733 Ga0207651_10981146
1734 Ga0207712_10030385
1735 Ga0207712_10045095
1736 Ga0207712_10060728
1737 Ga0207712_10066740
1738 Ga0207712_10144811
1739 Ga0207712_10280437
1740 Ga0207712_10713789
1741 Ga0207668_10204901
1742 Ga0207668_10276264
1743 Ga0207668_12014382
1744 Ga0207640_10044336
1745 Ga0207640_10273930
1746 Ga0207640_10400135
1747 Ga0207640_10591306
1748 Ga0207640_10858117
1749 Ga0207658_10046164
1750 Ga0207658_10047535
1751 Ga0207658_10139432
1752 Ga0207658_10166275
1753 Ga0207658_10195815
1754 Ga0207658_10923424
1755 Ga0207677_10010870
1756 Ga0207677_10025173
1757 Ga0207677_10410763
1758 Ga0207677_10416708
1759 Ga0207677_10505142
1760 Ga0207677_10638641
1761 Ga0207677_11700038
1762 Ga0207703_10118278
1763 Ga0207703_10190877
1764 Ga0207703_10205809
1765 Ga0207703_10412547
1766 Ga0207703_10924571
1767 Ga0207639_10021442
1768 Ga0207639_10149869
1769 Ga0207639_10853686
1770 Ga0207639_11992699
1771 Ga0207678_10154694
1772 Ga0207678_10631694
1773 Ga0207708_10111662
1774 Ga0207708_10343179
1775 Ga0207708_10380710
1776 Ga0207641_10000380
1777 Ga0207641_10030996
1778 Ga0207641_10038209
1779 Ga0207641_10153140
1780 Ga0207641_10179946
1781 Ga0207641_10283683
1782 Ga0207641_10434559
1783 Ga0207641_10441837
1784 Ga0207641_10507230
1785 Ga0207641_10568991
1786 Ga0207641_10704931
1787 Ga0207641_11281054
1788 Ga0207641_11382699
1789 Ga0207648_10003538
1790 Ga0207648_10003599
1791 Ga0207648_10012445
1792 Ga0207648_10126450
1793 Ga0207648_10261908
1794 Ga0207648_10360239
1795 Ga0207648_10454315
1796 Ga0207676_10001466
1797 Ga0207676_10060215
1798 Ga0207676_10068244
1799 Ga0207676_10069450
1800 Ga0207676_10190630
1801 Ga0207676_10197411
1802 Ga0207676_10496143
1803 Ga0207676_10574438
1804 Ga0207676_10733910
1805 Ga0207676_10942245
1806 Ga0207676_11058362
1807 Ga0207674_10003262
1808 Ga0207674_10011079
1809 Ga0207674_10249578
1810 Ga0207674_11071057
1811 Ga0207674_11294737
1812 Ga0207675_100002458
1813 Ga0207675_100018725
1814 Ga0207675_100041774
1815 Ga0207675_100058912
1816 Ga0207675_100059596
1817 Ga0207675_100175960
1818 Ga0207675_101209818
1819 Ga0207683_10000691
1820 Ga0207683_10095644
1821 Ga0207683_11349968
1822 Ga0207698_10427270
1823 Ga0207698_10791123
1824 Ga0207698_11086556
1825 Ga0207698_11393339
1826 Ga0209968_1011552
1827 Ga0209974_10384764
1828 Ga0207428_10106615
1829 Ga0207428_10415046
1830 Ga0207428_10656523
1831 Ga0268266_10011708
1832 Ga0268265_10005161
1833 Ga0268265_10309421
1834 Ga0268265_11782480
1835 Ga0268265_11925425
1836 Ga0268264_10005023
1837 Ga0268264_10067024
1838 Ga0268264_10170717
1839 Ga0268264_10232807
1840 Ga0268264_10392022
1841 Ga0268264_10968754
1842 Ga0307517_10358958
1843 Ga0307515_10000162
1844 Ga0307515_10009312
1845 Ga0307513_10134888
1846 Ga0307513_10210849
1847 Ga0307513_10258582
1848 Ga0307513_10839378
1849 Ga0307509_10087781
1850 Ga0307516_10501757
1851 Ga0307405_10000049
1852 Ga0307407_10000024
1853 Ga0307412_10708827
1854 Ga0307412_11091299
1855 Ga0307409_100036292
1856 Ga0307416_100000037
1857 Ga0307414_10001153
1858 Ga0307414_10004809
1859 Ga0307414_10006990
1860 Ga0307414_10014942
1861 Ga0307414_10091226
1862 Ga0307414_10261129
1863 Ga0307414_10364214
1864 Ga0307414_10937782
1865 Ga0307414_11074882
1866 Ga0307414_11133521
1867 Ga0307414_11675027
1868 Ga0316585_10261770
1869 Ga0373936_0158230
1870 Ga0373943_0409636
1871 Ga0373927_0700862
1872 Ga0373947_1134028
1873 Ga0373937_0091931
1874 Ga0373937_0541574
1875 Ga0316584_0401050
1876 Ga0395905_0697672
1877 Ga0395905_0943594
1878 Ga0439436_0012382
1879 Ga0439453_0020104
1880 Ga0451787_042402
1881 Ga0451793_1161307
1882 Ga0451798_0509956
1883 Ga0451798_0812166
1884 Ga0451802_0969387
1885 Ga0451833_0659560
1886 Ga0451853_0376106
1887 Ga0451853_3668395
1888 Ga0439441_001178
1889 Ga0439441_057238
1890 Ga0439442_003138
1891 Ga0439443_011622
1892 Ga0439445_0043335
1893 Ga0439449_0014815
1894 Ga0439457_000827
1895 Ga0439462_0052773
1896 Ga0439446_0138484
1897 Ga0451577_0191859
1898 Ga0466969_0000103
1899 Ga0466972_0000012
1900 Ga0466972_0000055
1901 Ga0466966_0000097
1902 Ga0466964_0114004
1903 Ga0453684_0127023
1904 Ga0453684_0321098
1905 Ga0453684_0506006
1906 Ga0466968_0181868
1907 Ga0466970_0000661
1908 Ga0466957_0009079
1909 Ga0466957_0014317
1910 Ga0466960_0133182
1911 Ga0466959_0000049
1912 Ga0466959_0098950
1913 Ga0495592_0071330
1914 Ga0495580_0473783
1915 Ga0495582_0401646
1916 Ga0495582_0660730
1917 Ga0495607_0481222
1918 Ga0495606_0050331
1919 Ga0495606_0166272
1920 Ga0495610_0001236
1921 Ga0495630_0064883
1922 Ga0495630_0089950
1923 Ga0495630_0119858
1924 Ga0495630_0829498
1925 Ga0495644_0183496
1926 Ga0495666_0333421
1927 Ga0495652_0122549
1928 Ga0495665_0268490
1929 Ga0495586_0226369
1930 Ga0495586_0668487
1931 Ga0495598_0267966
1932 Ga0495609_0000025
1933 Ga0495609_0068116
1934 Ga0495621_0074559
1935 Ga0495633_0151290
1936 Ga0495668_0000489
1937 Ga0495668_0005239
1938 Ga0495634_0272909
1939 Ga0495635_0487075
1940 Ga0495657_0396324
1941 Ga0495658_0015643
1942 Ga0495604_0325939
1943 Ga0495604_0335894
1944 Ga0495674_0075977
1945 Ga0495674_0144101
1946 Ga0495674_0488483
1947 Ga0495672_0020249
1948 Ga0495672_0084410
1949 Ga0495675_0525942
1950 Ga0495684_0302795
1951 Ga0495686_0000309
1952 Ga0495686_0011789
1953 Ga0495686_0106369
1954 Ga0495602_0144639
1955 Ga0496101_1046228
1956 Ga0496110_0111521
1957 Ga0496110_0351734
1958 Ga0496111_0542328
1959 Ga0496118_0264875
1960 Ga0496124_0086261
1961 Ga0501290_024755
1962 Ga0501300_015794
1963 Ga0501031_0074568
1964 Ga0501032_0343630
1965 Ga0501034_0009004
1966 Ga0501036_0135714
1967 Ga0501036_0346584
1968 Ga0501037_0014127
1969 Ga0501037_0105476
1970 Ga0501038_0097988
1971 Ga0501038_0108978
1972 Ga0501039_0118689
1973 Ga0501039_0183059
1974 Ga0501040_0119819
1975 Ga0501043_0128031
1976 Ga0501046_0650803
1977 Ga0501047_0004068
1978 Ga0501047_0073419
1979 Ga0501047_0484911
1980 Ga0501249_054029
1981 Ga0501257_018663
1982 Ga0501257_022946
1983 Ga0501225_0002922
1984 Ga0501225_0221027
1985 Ga0501225_0367309
1986 Ga0501083_0376495
1987 Ga0501241_029653
1988 Ga0501035_0239732
1989 Ga0501044_0007058
1990 Ga0501044_0022983
1991 Ga0501044_0033123
1992 nmdc:mga03683_538042_c1
1993 nmdc:mga0k408_32475_c1
1994 nmdc:mga0k408_42881_c1
1995 nmdc:mga0k408_50920_c1
1996 nmdc:mga07m45_789462_c1
1997 nmdc:mga05p37_20024_c2
1998 nmdc:mga05p37_359497_c1
1999 nmdc:mga09592_13499_c1
2000 nmdc:mga09592_28065_c1
2001 nmdc:mga0qj67_9692_c1
2002 nmdc:mga06r32_402761_c1
2003 nmdc:mga06r32_807494_c1
2004 nmdc:mga06r32_844003_c1
2005 nmdc:mga08y16_1501114_c1
2006 nmdc:mga08y16_1919537_c1
2007 nmdc:mga08y16_228835_c1
2008 nmdc:mga08y16_251855_c1
2009 nmdc:mga08y16_449092_c1
2010 nmdc:mga08y16_55351_c1
2011 nmdc:mga08y16_81001_c1
2012 nmdc:mga0n895_283166_c1
2013 Ga0495619_0280862
2014 Ga0500578_0000934
2015 Ga0500644_0006068
2016 Ga0500644_0146434
2017 Ga0500562_000010
2018 Ga0500559_0043057
2019 Ga0500568_0170281
2020 Ga0500616_0015278
2021 Ga0500616_0084695
2022 Ga0500636_0268542
2023 Ga0500611_000002
2024 Ga0500645_019448
2025 2586209277
2026 2738727299
2027 2739590196
2028 2739615988
2029 2819588344
2030 2842723021
2031 2842913977
2032 2849283718
2033 2857628527
2034 2884636423
2035 2945999995
2036 2954016594
2037 2977245474

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

23

127

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nvi-assembly1.cif.gz_E-2 orthorhombic crystal form of molybdopterin synthase 0.8879 7 147
3rpf-assembly3.cif.gz_B protein-protein complex of subunit 1 and 2 of molybdopterin-converting factor from helicobacter pylori 26695 0.886 9 146
1nvj-assembly1.cif.gz_A deletion mutant (delta 141) of molybdopterin synthase 0.8766 7 132
2q5w-assembly1.cif.gz_E the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus 0.874 5 146
2q5w-assembly1.cif.gz_E the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus 0.868 5 146
ID Description Score Start End Superfamily
1fmaE00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8911 9 147 3.90.1170.40
3rpfA00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8685 9 143 3.90.1170.40
2qieK00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8653 7 144 3.90.1170.40
1nvjC00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8633 7 132 3.90.1170.40
af_Q86HF4_1_145_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.8606 9 146 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A1G1DT28-F1-model_v4 Molybdopterin converting factor 0.9981 33 147 GO:0006777
AF-A0A0A2MFR2-F1-model_v4 Molybdopterin converting factor 0.9952 3 147 GO:0006777
AF-A0A0D6TKZ7-F1-model_v4 Molybdopterin converting factor 0.9862 15 147 GO:0006777
AF-A7RSI1-F1-model_v4 MOCS2B 0.9861 53 135 GO:0005829
GO:0006777
AF-A0A0A2MFR2-F1-model_v4 Molybdopterin converting factor 0.9817 3 147 GO:0006777

Map