F488312
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1018 | 315 | 2037 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10263899|Ga0163162_102638992 |
| Length | 147 |
| Sequence | MDTTTKADGLMEKKPKNIFVQGKIDPVFIGESIQKHSTKTSIGGHSIFLGQVRADRINEKEMTAIEYKMHEIREAIFAKYPLTCMHVYHSLGRVAAGEICLFVFTSSKHRKAAIDACEETVEKIKNELPIWGKELFEDETYQWKVNQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 189 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 197 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 205 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 206 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 213 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 214 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 215 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 216 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 217 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 218 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 219 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 222 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 223 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 224 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 225 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 226 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 230 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 261 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 262 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 263 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 264 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 265 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 266 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 278 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 279 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 286 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 295 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 297 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 298 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 299 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 302 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 303 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 304 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 305 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 306 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 307 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 308 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 309 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 310 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 311 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 312 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 313 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 314 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 315 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 0 |
| Isolates | 1.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.95 |
| Nodule | 0 |
| Rhizoplane | 0.88 |
| Rhizosphere | 93.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_10263899 | 3300013306 | Unclassified | 1854 |
| 2 | JGI25150J39212_1000001 | 3300002774 | Bacteria | 1318726 |
| 3 | JGI25151J46595_10000001 | 3300003187 | Bacteria | 887211 |
| 4 | JGI25153J46596_10000001 | 3300003215 | Bacteria | 748985 |
| 5 | rootH1_10053600 | 3300003316 | Bacteria | 2284 |
| 6 | rootH2_10190875 | 3300003320 | Bacteria | 1321 |
| 7 | rootL2_10264365 | 3300003322 | Unclassified | 2201 |
| 8 | rootL2_10293189 | 3300003322 | Bacteria | 1714 |
| 9 | rootH1_10000181 | 3300003316 | Bacteria | 14072 |
| 10 | rootH1_10000181 | 3300003323 | Bacteria | 24625 |
| 11 | rootH1_10054153 | 3300003323 | Bacteria | 2722 |
| 12 | rootH1_10150505 | 3300003323 | Bacteria | 1842 |
| 13 | rootH1_10244305 | 3300003323 | Bacteria | 1983 |
| 14 | Ga0055536_1000049 | 3300003781 | Bacteria | 113328 |
| 15 | Ga0055530_10002378 | 3300003791 | Bacteria | 12196 |
| 16 | Ga0065714_10105041 | 3300005288 | Unclassified | 1573 |
| 17 | Ga0065714_10143233 | 3300005288 | Unclassified | 1156 |
| 18 | Ga0065714_10166575 | 3300005288 | Bacteria | 1025 |
| 19 | Ga0065714_10274671 | 3300005288 | Bacteria | 733 |
| 20 | Ga0065714_10415037 | 3300005288 | Bacteria | 568 |
| 21 | Ga0065704_10090452 | 3300005289 | Bacteria | 2786 |
| 22 | Ga0065704_10091501 | 3300005289 | Unclassified | 2713 |
| 23 | Ga0065704_10225333 | 3300005289 | Bacteria | 1060 |
| 24 | Ga0065704_10407427 | 3300005289 | Bacteria | 745 |
| 25 | Ga0065712_10029553 | 3300005290 | Unclassified | 1352 |
| 26 | Ga0065712_10105332 | 3300005290 | Bacteria | 1942 |
| 27 | Ga0065712_10112518 | 3300005290 | Unclassified | 1796 |
| 28 | Ga0065712_10184667 | 3300005290 | Bacteria | 1159 |
| 29 | Ga0065712_10341352 | 3300005290 | Bacteria | 800 |
| 30 | Ga0065712_10451977 | 3300005290 | Unclassified | 674 |
| 31 | Ga0065712_10624182 | 3300005290 | Unclassified | 557 |
| 32 | Ga0065715_10342428 | 3300005293 | Unclassified | 965 |
| 33 | Ga0065715_10794894 | 3300005293 | Bacteria | 612 |
| 34 | Ga0065707_10213588 | 3300005295 | Unclassified | 1255 |
| 35 | Ga0065707_11014821 | 3300005295 | Bacteria | 535 |
| 36 | Ga0070658_10356901 | 3300005327 | Unclassified | 1252 |
| 37 | Ga0070658_10666312 | 3300005327 | Bacteria | 903 |
| 38 | Ga0070658_11026603 | 3300005327 | Bacteria | 717 |
| 39 | Ga0070658_11537467 | 3300005327 | Unclassified | 577 |
| 40 | Ga0070676_10006273 | 3300005328 | Bacteria | 6350 |
| 41 | Ga0070676_10006346 | 3300005328 | Bacteria | 6317 |
| 42 | Ga0070676_10014248 | 3300005328 | Unclassified | 4369 |
| 43 | Ga0070676_10035984 | 3300005328 | Unclassified | 2850 |
| 44 | Ga0070676_10082262 | 3300005328 | Bacteria | 1956 |
| 45 | Ga0070676_10184920 | 3300005328 | Bacteria | 1357 |
| 46 | Ga0070683_100000884 | 3300005329 | Bacteria | 22238 |
| 47 | Ga0070683_100002198 | 3300005329 | Bacteria | 15442 |
| 48 | Ga0070683_100006866 | 3300005329 | Bacteria | 9564 |
| 49 | Ga0070683_100029414 | 3300005329 | Bacteria | 4973 |
| 50 | Ga0070683_100330631 | 3300005329 | Unclassified | 1451 |
| 51 | Ga0070683_100767271 | 3300005329 | Unclassified | 924 |
| 52 | Ga0070683_101118224 | 3300005329 | Unclassified | 757 |
| 53 | Ga0070690_100030587 | 3300005330 | Unclassified | 3347 |
| 54 | Ga0070690_100138734 | 3300005330 | Unclassified | 1649 |
| 55 | Ga0070690_100903427 | 3300005330 | Unclassified | 691 |
| 56 | Ga0070670_100038715 | 3300005331 | Bacteria | 4100 |
| 57 | Ga0070670_100071381 | 3300005331 | Unclassified | 2981 |
| 58 | Ga0070670_100079675 | 3300005331 | Unclassified | 2815 |
| 59 | Ga0070670_100090886 | 3300005331 | Bacteria | 2624 |
| 60 | Ga0070670_100136497 | 3300005331 | Bacteria | 2120 |
| 61 | Ga0070670_100161718 | 3300005331 | Bacteria | 1940 |
| 62 | Ga0070670_100170053 | 3300005331 | Bacteria | 1890 |
| 63 | Ga0070670_100179924 | 3300005331 | Bacteria | 1836 |
| 64 | Ga0070670_100188955 | 3300005331 | Bacteria | 1789 |
| 65 | Ga0070670_100433475 | 3300005331 | Bacteria | 1163 |
| 66 | Ga0070670_100705587 | 3300005331 | Bacteria | 907 |
| 67 | Ga0070670_100849121 | 3300005331 | Bacteria | 826 |
| 68 | Ga0070670_101098515 | 3300005331 | Unclassified | 725 |
| 69 | Ga0070670_101989193 | 3300005331 | Bacteria | 535 |
| 70 | Ga0070677_10093803 | 3300005333 | Bacteria | 1311 |
| 71 | Ga0070677_10104953 | 3300005333 | Unclassified | 1252 |
| 72 | Ga0068869_100032681 | 3300005334 | Unclassified | 3668 |
| 73 | Ga0068869_100079604 | 3300005334 | Unclassified | 2442 |
| 74 | Ga0068869_100346436 | 3300005334 | Unclassified | 1210 |
| 75 | Ga0068869_100403661 | 3300005334 | Bacteria | 1124 |
| 76 | Ga0068869_100420282 | 3300005334 | Bacteria | 1103 |
| 77 | Ga0068869_101392285 | 3300005334 | Unclassified | 620 |
| 78 | Ga0070666_10009022 | 3300005335 | Bacteria | 6212 |
| 79 | Ga0070666_10150195 | 3300005335 | Bacteria | 1625 |
| 80 | Ga0070666_10349275 | 3300005335 | Unclassified | 1058 |
| 81 | Ga0070666_10894214 | 3300005335 | Bacteria | 656 |
| 82 | Ga0070680_100023470 | 3300005336 | Bacteria | 4919 |
| 83 | Ga0070682_100002796 | 3300005337 | Bacteria | 9669 |
| 84 | Ga0070682_100009802 | 3300005337 | Bacteria | 5423 |
| 85 | Ga0070682_100574770 | 3300005337 | Bacteria | 886 |
| 86 | Ga0070682_100980691 | 3300005337 | Unclassified | 700 |
| 87 | Ga0070682_101203970 | 3300005337 | Unclassified | 639 |
| 88 | Ga0068868_100019618 | 3300005338 | Bacteria | 5067 |
| 89 | Ga0068868_100024597 | 3300005338 | Bacteria | 4572 |
| 90 | Ga0068868_100029146 | 3300005338 | Bacteria | 4227 |
| 91 | Ga0068868_100139554 | 3300005338 | Bacteria | 1989 |
| 92 | Ga0068868_100360934 | 3300005338 | Bacteria | 1246 |
| 93 | Ga0068868_100390339 | 3300005338 | Unclassified | 1199 |
| 94 | Ga0068868_100509856 | 3300005338 | Bacteria | 1055 |
| 95 | Ga0070660_100025895 | 3300005339 | Bacteria | 4363 |
| 96 | Ga0070660_100165681 | 3300005339 | Bacteria | 1783 |
| 97 | Ga0070689_100008890 | 3300005340 | Bacteria | 7101 |
| 98 | Ga0070689_100056139 | 3300005340 | Bacteria | 3053 |
| 99 | Ga0070689_100066838 | 3300005340 | Bacteria | 2801 |
| 100 | Ga0070689_100170158 | 3300005340 | Bacteria | 1765 |
| 101 | Ga0070689_100885230 | 3300005340 | Bacteria | 789 |
| 102 | Ga0070689_100973196 | 3300005340 | Bacteria | 754 |
| 103 | Ga0070689_101517759 | 3300005340 | Bacteria | 607 |
| 104 | Ga0070691_10001334 | 3300005341 | Bacteria | 10499 |
| 105 | Ga0070687_100217812 | 3300005343 | Bacteria | 1167 |
| 106 | Ga0070687_100815374 | 3300005343 | Bacteria | 662 |
| 107 | Ga0070661_100001199 | 3300005344 | Bacteria | 18295 |
| 108 | Ga0070661_100169617 | 3300005344 | Bacteria | 1657 |
| 109 | Ga0070661_100290147 | 3300005344 | Bacteria | 1271 |
| 110 | Ga0070661_101088717 | 3300005344 | Unclassified | 665 |
| 111 | Ga0070661_101362213 | 3300005344 | Bacteria | 596 |
| 112 | Ga0070668_100005828 | 3300005347 | Bacteria | 9138 |
| 113 | Ga0070668_100050217 | 3300005347 | Bacteria | 3211 |
| 114 | Ga0070668_100211590 | 3300005347 | Bacteria | 1595 |
| 115 | Ga0070668_101331949 | 3300005347 | Bacteria | 653 |
| 116 | Ga0070669_100021823 | 3300005353 | Bacteria | 4578 |
| 117 | Ga0070669_100038346 | 3300005353 | Unclassified | 3478 |
| 118 | Ga0070669_100038810 | 3300005353 | Bacteria | 3458 |
| 119 | Ga0070669_100137279 | 3300005353 | Bacteria | 1882 |
| 120 | Ga0070669_100206513 | 3300005353 | Bacteria | 1548 |
| 121 | Ga0070675_100055610 | 3300005354 | Bacteria | 3258 |
| 122 | Ga0070675_100075014 | 3300005354 | Bacteria | 2811 |
| 123 | Ga0070675_100256189 | 3300005354 | Bacteria | 1532 |
| 124 | Ga0070675_100421802 | 3300005354 | Bacteria | 1193 |
| 125 | Ga0070675_100665980 | 3300005354 | Unclassified | 946 |
| 126 | Ga0070675_100682108 | 3300005354 | Bacteria | 935 |
| 127 | Ga0070675_101797255 | 3300005354 | Unclassified | 565 |
| 128 | Ga0070671_100104453 | 3300005355 | Bacteria | 2377 |
| 129 | Ga0070671_100157818 | 3300005355 | Bacteria | 1917 |
| 130 | Ga0070671_100322607 | 3300005355 | Bacteria | 1316 |
| 131 | Ga0070671_100351174 | 3300005355 | Bacteria | 1259 |
| 132 | Ga0070671_100514063 | 3300005355 | Bacteria | 1031 |
| 133 | Ga0070671_100809958 | 3300005355 | Bacteria | 816 |
| 134 | Ga0070671_100851802 | 3300005355 | Unclassified | 795 |
| 135 | Ga0070674_100002262 | 3300005356 | Bacteria | 10628 |
| 136 | Ga0070674_100220221 | 3300005356 | Unclassified | 1476 |
| 137 | Ga0070674_101633353 | 3300005356 | Bacteria | 582 |
| 138 | Ga0070673_100017076 | 3300005364 | Bacteria | 5149 |
| 139 | Ga0070673_100028166 | 3300005364 | Bacteria | 4175 |
| 140 | Ga0070673_100034436 | 3300005364 | Bacteria | 3833 |
| 141 | Ga0070673_100222754 | 3300005364 | Unclassified | 1633 |
| 142 | Ga0070673_100341093 | 3300005364 | Bacteria | 1328 |
| 143 | Ga0070673_100393675 | 3300005364 | Bacteria | 1237 |
| 144 | Ga0070673_100425301 | 3300005364 | Bacteria | 1191 |
| 145 | Ga0070688_100065171 | 3300005365 | Bacteria | 2314 |
| 146 | Ga0070688_100094197 | 3300005365 | Unclassified | 1963 |
| 147 | Ga0070688_100112375 | 3300005365 | Bacteria | 1814 |
| 148 | Ga0070688_100259140 | 3300005365 | Bacteria | 1241 |
| 149 | Ga0070688_100459320 | 3300005365 | Bacteria | 953 |
| 150 | Ga0070688_100818293 | 3300005365 | Bacteria | 729 |
| 151 | Ga0070688_100897212 | 3300005365 | Bacteria | 699 |
| 152 | Ga0070659_100002681 | 3300005366 | Bacteria | 12650 |
| 153 | Ga0070659_100374152 | 3300005366 | Bacteria | 1199 |
| 154 | Ga0070667_100008921 | 3300005367 | Bacteria | 8299 |
| 155 | Ga0070667_100044780 | 3300005367 | Bacteria | 3718 |
| 156 | Ga0070667_100285969 | 3300005367 | Bacteria | 1482 |
| 157 | Ga0070667_100322357 | 3300005367 | Bacteria | 1394 |
| 158 | Ga0070667_100387567 | 3300005367 | Bacteria | 1270 |
| 159 | Ga0070667_100454645 | 3300005367 | Bacteria | 1170 |
| 160 | Ga0070667_100941170 | 3300005367 | Unclassified | 805 |
| 161 | Ga0070667_101099550 | 3300005367 | Bacteria | 743 |
| 162 | Ga0070667_101117632 | 3300005367 | Bacteria | 737 |
| 163 | Ga0070700_100212574 | 3300005441 | Bacteria | 1365 |
| 164 | Ga0070700_100311240 | 3300005441 | Bacteria | 1153 |
| 165 | Ga0070708_101545923 | 3300005445 | Unclassified | 618 |
| 166 | Ga0070663_100130815 | 3300005455 | Bacteria | 1906 |
| 167 | Ga0070663_100179024 | 3300005455 | Bacteria | 1643 |
| 168 | Ga0070663_100382812 | 3300005455 | Unclassified | 1146 |
| 169 | Ga0070663_100612015 | 3300005455 | Unclassified | 917 |
| 170 | Ga0070678_100068363 | 3300005456 | Unclassified | 2648 |
| 171 | Ga0070678_100280384 | 3300005456 | Bacteria | 1409 |
| 172 | Ga0070678_100994860 | 3300005456 | Unclassified | 770 |
| 173 | Ga0070678_101557452 | 3300005456 | Bacteria | 620 |
| 174 | Ga0070662_100080932 | 3300005457 | Bacteria | 2419 |
| 175 | Ga0070681_10103173 | 3300005458 | Bacteria | 2796 |
| 176 | Ga0068867_100003798 | 3300005459 | Bacteria | 10626 |
| 177 | Ga0068867_100015472 | 3300005459 | Bacteria | 5411 |
| 178 | Ga0068867_100088556 | 3300005459 | Bacteria | 2346 |
| 179 | Ga0068867_100228530 | 3300005459 | Unclassified | 1503 |
| 180 | Ga0068867_100258565 | 3300005459 | Bacteria | 1419 |
| 181 | Ga0068867_100328520 | 3300005459 | Bacteria | 1269 |
| 182 | Ga0068867_100445586 | 3300005459 | Bacteria | 1102 |
| 183 | Ga0068867_100771679 | 3300005459 | Bacteria | 855 |
| 184 | Ga0068867_101230353 | 3300005459 | Unclassified | 689 |
| 185 | Ga0068867_101815760 | 3300005459 | Bacteria | 573 |
| 186 | Ga0070685_10024684 | 3300005466 | Bacteria | 3303 |
| 187 | Ga0070685_10064012 | 3300005466 | Unclassified | 2161 |
| 188 | Ga0070685_10130977 | 3300005466 | Bacteria | 1568 |
| 189 | Ga0070685_10369176 | 3300005466 | Bacteria | 986 |
| 190 | Ga0070685_10476729 | 3300005466 | Bacteria | 879 |
| 191 | Ga0070685_11014295 | 3300005466 | Bacteria | 623 |
| 192 | Ga0070698_100000645 | 3300005471 | Bacteria | 37282 |
| 193 | Ga0070698_100008979 | 3300005471 | Bacteria | 10751 |
| 194 | Ga0070698_100019854 | 3300005471 | Bacteria | 7049 |
| 195 | Ga0070698_100140783 | 3300005471 | Bacteria | 2363 |
| 196 | Ga0070698_100326179 | 3300005471 | Unclassified | 1466 |
| 197 | Ga0070699_101620087 | 3300005518 | Bacteria | 593 |
| 198 | Ga0070679_100141159 | 3300005530 | Bacteria | 2388 |
| 199 | Ga0070684_100000298 | 3300005535 | Bacteria | 34479 |
| 200 | Ga0070684_100000731 | 3300005535 | Bacteria | 22754 |
| 201 | Ga0070684_100022231 | 3300005535 | Bacteria | 5286 |
| 202 | Ga0070684_100255794 | 3300005535 | Unclassified | 1601 |
| 203 | Ga0068853_100003450 | 3300005539 | Bacteria | 12095 |
| 204 | Ga0068853_100052550 | 3300005539 | Unclassified | 3509 |
| 205 | Ga0068853_100066002 | 3300005539 | Bacteria | 3142 |
| 206 | Ga0068853_100914221 | 3300005539 | Bacteria | 843 |
| 207 | Ga0070672_100027429 | 3300005543 | Bacteria | 4247 |
| 208 | Ga0070672_100041352 | 3300005543 | Unclassified | 3543 |
| 209 | Ga0070672_100051699 | 3300005543 | Bacteria | 3206 |
| 210 | Ga0070672_100215575 | 3300005543 | Bacteria | 1609 |
| 211 | Ga0070672_100691284 | 3300005543 | Bacteria | 893 |
| 212 | Ga0070672_101250206 | 3300005543 | Bacteria | 662 |
| 213 | Ga0070672_101251864 | 3300005543 | Unclassified | 662 |
| 214 | Ga0070672_101354764 | 3300005543 | Bacteria | 636 |
| 215 | Ga0070672_101393976 | 3300005543 | Unclassified | 627 |
| 216 | Ga0070693_100020989 | 3300005547 | Bacteria | 3453 |
| 217 | Ga0070693_100478637 | 3300005547 | Unclassified | 879 |
| 218 | Ga0070665_100016621 | 3300005548 | Bacteria | 7373 |
| 219 | Ga0070665_100057795 | 3300005548 | Unclassified | 3889 |
| 220 | Ga0070665_101017656 | 3300005548 | Bacteria | 841 |
| 221 | Ga0070665_101097011 | 3300005548 | Unclassified | 807 |
| 222 | Ga0070665_101677084 | 3300005548 | Bacteria | 643 |
| 223 | Ga0070704_100517298 | 3300005549 | Unclassified | 1038 |
| 224 | Ga0070704_100735393 | 3300005549 | Unclassified | 877 |
| 225 | Ga0068855_100063789 | 3300005563 | Bacteria | 4298 |
| 226 | Ga0068855_100306408 | 3300005563 | Bacteria | 1758 |
| 227 | Ga0068855_100496220 | 3300005563 | Bacteria | 1327 |
| 228 | Ga0070664_100000884 | 3300005564 | Bacteria | 23265 |
| 229 | Ga0070664_100073067 | 3300005564 | Unclassified | 2942 |
| 230 | Ga0070664_100114267 | 3300005564 | Unclassified | 2358 |
| 231 | Ga0070664_100167746 | 3300005564 | Bacteria | 1946 |
| 232 | Ga0070664_100208954 | 3300005564 | Unclassified | 1744 |
| 233 | Ga0070664_100295760 | 3300005564 | Bacteria | 1462 |
| 234 | Ga0070664_100407187 | 3300005564 | Bacteria | 1244 |
| 235 | Ga0070664_100452610 | 3300005564 | Unclassified | 1179 |
| 236 | Ga0068857_100001112 | 3300005577 | Bacteria | 20920 |
| 237 | Ga0068857_100210581 | 3300005577 | Bacteria | 1774 |
| 238 | Ga0068857_100264695 | 3300005577 | Bacteria | 1579 |
| 239 | Ga0068857_100367708 | 3300005577 | Unclassified | 1334 |
| 240 | Ga0068857_100509685 | 3300005577 | Bacteria | 1130 |
| 241 | Ga0068857_101046206 | 3300005577 | Bacteria | 787 |
| 242 | Ga0068854_100048477 | 3300005578 | Bacteria | 3031 |
| 243 | Ga0068854_100224693 | 3300005578 | Bacteria | 1487 |
| 244 | Ga0068854_100460605 | 3300005578 | Bacteria | 1064 |
| 245 | Ga0068854_102037084 | 3300005578 | Bacteria | 529 |
| 246 | Ga0068856_100030139 | 3300005614 | Bacteria | 5303 |
| 247 | Ga0070702_100404723 | 3300005615 | Unclassified | 977 |
| 248 | Ga0070702_101511161 | 3300005615 | Unclassified | 553 |
| 249 | Ga0068852_100072020 | 3300005616 | Bacteria | 3036 |
| 250 | Ga0068852_100131631 | 3300005616 | Bacteria | 2304 |
| 251 | Ga0068852_100139480 | 3300005616 | Bacteria | 2242 |
| 252 | Ga0068852_100223628 | 3300005616 | Bacteria | 1791 |
| 253 | Ga0068852_100457373 | 3300005616 | Unclassified | 1265 |
| 254 | Ga0068852_100895315 | 3300005616 | Unclassified | 904 |
| 255 | Ga0068852_101179371 | 3300005616 | Bacteria | 787 |
| 256 | Ga0068859_100004404 | 3300005617 | Bacteria | 14371 |
| 257 | Ga0068859_100075284 | 3300005617 | Bacteria | 3416 |
| 258 | Ga0068859_100108016 | 3300005617 | Bacteria | 2844 |
| 259 | Ga0068859_100124092 | 3300005617 | Unclassified | 2650 |
| 260 | Ga0068859_100214701 | 3300005617 | Bacteria | 2011 |
| 261 | Ga0068859_100229380 | 3300005617 | Unclassified | 1945 |
| 262 | Ga0068859_100304305 | 3300005617 | Bacteria | 1688 |
| 263 | Ga0068859_100304908 | 3300005617 | Bacteria | 1686 |
| 264 | Ga0068859_100671669 | 3300005617 | Unclassified | 1127 |
| 265 | Ga0068859_100693113 | 3300005617 | Bacteria | 1109 |
| 266 | Ga0068859_101083943 | 3300005617 | Bacteria | 881 |
| 267 | Ga0068859_101604169 | 3300005617 | Bacteria | 718 |
| 268 | Ga0068864_100004501 | 3300005618 | Bacteria | 11462 |
| 269 | Ga0068864_100053139 | 3300005618 | Bacteria | 3493 |
| 270 | Ga0068864_100093526 | 3300005618 | Unclassified | 2656 |
| 271 | Ga0068864_100245416 | 3300005618 | Unclassified | 1660 |
| 272 | Ga0068864_100254652 | 3300005618 | Bacteria | 1631 |
| 273 | Ga0068864_100271715 | 3300005618 | Bacteria | 1580 |
| 274 | Ga0068864_100373124 | 3300005618 | Bacteria | 1350 |
| 275 | Ga0068864_100445220 | 3300005618 | Bacteria | 1238 |
| 276 | Ga0068864_100945805 | 3300005618 | Bacteria | 852 |
| 277 | Ga0068866_10105036 | 3300005718 | Bacteria | 1565 |
| 278 | Ga0068866_10341620 | 3300005718 | Bacteria | 948 |
| 279 | Ga0068866_10471334 | 3300005718 | Bacteria | 825 |
| 280 | Ga0068861_100002289 | 3300005719 | Bacteria | 12425 |
| 281 | Ga0068861_100004874 | 3300005719 | Bacteria | 9030 |
| 282 | Ga0068861_100056095 | 3300005719 | Bacteria | 3006 |
| 283 | Ga0068861_100266584 | 3300005719 | Bacteria | 1469 |
| 284 | Ga0068861_100643567 | 3300005719 | Bacteria | 978 |
| 285 | Ga0068861_101214280 | 3300005719 | Bacteria | 730 |
| 286 | Ga0068851_10007629 | 3300005834 | Unclassified | 4975 |
| 287 | Ga0068851_10045339 | 3300005834 | Bacteria | 2222 |
| 288 | Ga0068851_10408476 | 3300005834 | Unclassified | 800 |
| 289 | Ga0068870_10007133 | 3300005840 | Bacteria | 4970 |
| 290 | Ga0068870_10039824 | 3300005840 | Bacteria | 2433 |
| 291 | Ga0068870_10186277 | 3300005840 | Unclassified | 1249 |
| 292 | Ga0068863_100021002 | 3300005841 | Bacteria | 6236 |
| 293 | Ga0068863_100112697 | 3300005841 | Unclassified | 2590 |
| 294 | Ga0068863_100131005 | 3300005841 | Unclassified | 2395 |
| 295 | Ga0068863_100251085 | 3300005841 | Unclassified | 1709 |
| 296 | Ga0068863_100297431 | 3300005841 | Unclassified | 1565 |
| 297 | Ga0068863_100310402 | 3300005841 | Unclassified | 1531 |
| 298 | Ga0068863_100597451 | 3300005841 | Bacteria | 1092 |
| 299 | Ga0068863_100843924 | 3300005841 | Bacteria | 915 |
| 300 | Ga0068863_100947352 | 3300005841 | Bacteria | 862 |
| 301 | Ga0068863_100953563 | 3300005841 | Bacteria | 859 |
| 302 | Ga0068863_101000882 | 3300005841 | Bacteria | 838 |
| 303 | Ga0068863_101544605 | 3300005841 | Bacteria | 673 |
| 304 | Ga0068858_100035184 | 3300005842 | Bacteria | 4645 |
| 305 | Ga0068858_100129440 | 3300005842 | Unclassified | 2366 |
| 306 | Ga0068858_100426769 | 3300005842 | Unclassified | 1275 |
| 307 | Ga0068858_100477133 | 3300005842 | Bacteria | 1203 |
| 308 | Ga0068858_100717233 | 3300005842 | Bacteria | 973 |
| 309 | Ga0068858_102145998 | 3300005842 | Unclassified | 552 |
| 310 | Ga0068860_100039308 | 3300005843 | Bacteria | 4525 |
| 311 | Ga0068860_100066104 | 3300005843 | Bacteria | 3434 |
| 312 | Ga0068860_100215946 | 3300005843 | Bacteria | 1861 |
| 313 | Ga0068860_100216549 | 3300005843 | Bacteria | 1859 |
| 314 | Ga0068860_100332966 | 3300005843 | Unclassified | 1491 |
| 315 | Ga0068860_100362646 | 3300005843 | Unclassified | 1428 |
| 316 | Ga0068860_100436720 | 3300005843 | Bacteria | 1300 |
| 317 | Ga0068860_100440244 | 3300005843 | Bacteria | 1294 |
| 318 | Ga0068860_100522898 | 3300005843 | Bacteria | 1186 |
| 319 | Ga0068860_102133210 | 3300005843 | Bacteria | 581 |
| 320 | Ga0068860_102198580 | 3300005843 | Unclassified | 573 |
| 321 | Ga0068862_100008657 | 3300005844 | Bacteria | 8417 |
| 322 | Ga0068862_100050350 | 3300005844 | Unclassified | 3560 |
| 323 | Ga0068862_100154765 | 3300005844 | Bacteria | 2043 |
| 324 | Ga0068862_100246618 | 3300005844 | Bacteria | 1626 |
| 325 | Ga0068862_100368944 | 3300005844 | Unclassified | 1336 |
| 326 | Ga0068862_100763185 | 3300005844 | Unclassified | 942 |
| 327 | Ga0075366_10028830 | 3300006195 | Bacteria | 3259 |
| 328 | Ga0075366_10090286 | 3300006195 | Bacteria | 1835 |
| 329 | Ga0075366_10409239 | 3300006195 | Bacteria | 835 |
| 330 | Ga0097621_100006252 | 3300006237 | Bacteria | 8451 |
| 331 | Ga0097621_100036651 | 3300006237 | Unclassified | 3924 |
| 332 | Ga0097621_100150295 | 3300006237 | Bacteria | 1997 |
| 333 | Ga0097621_100418028 | 3300006237 | Bacteria | 1203 |
| 334 | Ga0097621_100493333 | 3300006237 | Bacteria | 1108 |
| 335 | Ga0097621_100964397 | 3300006237 | Bacteria | 796 |
| 336 | Ga0097621_101449434 | 3300006237 | Bacteria | 651 |
| 337 | Ga0097621_101937953 | 3300006237 | Bacteria | 562 |
| 338 | Ga0068871_100028294 | 3300006358 | Bacteria | 4393 |
| 339 | Ga0068871_100094846 | 3300006358 | Bacteria | 2491 |
| 340 | Ga0068871_100359833 | 3300006358 | Bacteria | 1289 |
| 341 | Ga0068871_100376721 | 3300006358 | Bacteria | 1260 |
| 342 | Ga0068871_100686995 | 3300006358 | Unclassified | 937 |
| 343 | Ga0068871_100955658 | 3300006358 | Bacteria | 796 |
| 344 | Ga0068871_101984683 | 3300006358 | Bacteria | 554 |
| 345 | Ga0075428_100006620 | 3300006844 | Bacteria | 12891 |
| 346 | Ga0075428_100120899 | 3300006844 | Bacteria | 2852 |
| 347 | Ga0075431_100302401 | 3300006847 | Bacteria | 1616 |
| 348 | Ga0075431_100544290 | 3300006847 | Bacteria | 1149 |
| 349 | Ga0075431_100827605 | 3300006847 | Bacteria | 898 |
| 350 | Ga0075434_100542930 | 3300006871 | Bacteria | 1182 |
| 351 | Ga0075429_100006687 | 3300006880 | Bacteria | 9994 |
| 352 | Ga0068865_100007780 | 3300006881 | Bacteria | 6608 |
| 353 | Ga0068865_100136220 | 3300006881 | Bacteria | 1846 |
| 354 | Ga0068865_100522607 | 3300006881 | Unclassified | 993 |
| 355 | Ga0068865_100685092 | 3300006881 | Bacteria | 874 |
| 356 | Ga0068865_101421373 | 3300006881 | Bacteria | 620 |
| 357 | Ga0097620_100004404 | 3300006931 | Bacteria | 14371 |
| 358 | Ga0097620_100075283 | 3300006931 | Bacteria | 3416 |
| 359 | Ga0097620_100108014 | 3300006931 | Bacteria | 2844 |
| 360 | Ga0097620_100124090 | 3300006931 | Unclassified | 2650 |
| 361 | Ga0097620_100214718 | 3300006931 | Bacteria | 2011 |
| 362 | Ga0097620_100229387 | 3300006931 | Unclassified | 1945 |
| 363 | Ga0097620_100304303 | 3300006931 | Bacteria | 1688 |
| 364 | Ga0097620_100304931 | 3300006931 | Bacteria | 1686 |
| 365 | Ga0097620_100671662 | 3300006931 | Unclassified | 1127 |
| 366 | Ga0097620_100693110 | 3300006931 | Bacteria | 1109 |
| 367 | Ga0097620_101084175 | 3300006931 | Bacteria | 881 |
| 368 | Ga0097620_101604142 | 3300006931 | Bacteria | 718 |
| 369 | Ga0105251_10137987 | 3300009011 | Unclassified | 1104 |
| 370 | Ga0105240_10128066 | 3300009093 | Bacteria | 3048 |
| 371 | Ga0105240_10781773 | 3300009093 | Bacteria | 1035 |
| 372 | Ga0111539_10013360 | 3300009094 | Bacteria | 10262 |
| 373 | Ga0111539_10032439 | 3300009094 | Bacteria | 6342 |
| 374 | Ga0111539_10067124 | 3300009094 | Bacteria | 4236 |
| 375 | Ga0111539_10220240 | 3300009094 | Bacteria | 2210 |
| 376 | Ga0111539_10246021 | 3300009094 | Bacteria | 2082 |
| 377 | Ga0111539_11103185 | 3300009094 | Bacteria | 922 |
| 378 | Ga0111539_11709038 | 3300009094 | Unclassified | 730 |
| 379 | Ga0105245_10567915 | 3300009098 | Bacteria | 1158 |
| 380 | Ga0105245_11409426 | 3300009098 | Unclassified | 747 |
| 381 | Ga0105247_10000726 | 3300009101 | Bacteria | 25632 |
| 382 | Ga0105247_10247903 | 3300009101 | Unclassified | 1216 |
| 383 | Ga0105247_10262322 | 3300009101 | Bacteria | 1185 |
| 384 | Ga0114129_10003569 | 3300009147 | Bacteria | 21902 |
| 385 | Ga0114129_10114463 | 3300009147 | Bacteria | 3719 |
| 386 | Ga0114129_10247648 | 3300009147 | Unclassified | 2393 |
| 387 | Ga0114129_12124285 | 3300009147 | Bacteria | 677 |
| 388 | Ga0105243_11259514 | 3300009148 | Bacteria | 755 |
| 389 | Ga0105243_12064240 | 3300009148 | Bacteria | 605 |
| 390 | Ga0105241_10039119 | 3300009174 | Bacteria | 3577 |
| 391 | Ga0105241_10070874 | 3300009174 | Bacteria | 2705 |
| 392 | Ga0105241_10210813 | 3300009174 | Bacteria | 1628 |
| 393 | Ga0105241_10515675 | 3300009174 | Unclassified | 1068 |
| 394 | Ga0105241_10557781 | 3300009174 | Bacteria | 1029 |
| 395 | Ga0105241_10633758 | 3300009174 | Unclassified | 969 |
| 396 | Ga0105242_10025664 | 3300009176 | Unclassified | 4665 |
| 397 | Ga0105242_10041753 | 3300009176 | Bacteria | 3701 |
| 398 | Ga0105242_10064334 | 3300009176 | Unclassified | 3023 |
| 399 | Ga0105242_10077674 | 3300009176 | Bacteria | 2770 |
| 400 | Ga0105242_10145021 | 3300009176 | Bacteria | 2064 |
| 401 | Ga0105242_10177261 | 3300009176 | Unclassified | 1878 |
| 402 | Ga0105242_10518059 | 3300009176 | Bacteria | 1137 |
| 403 | Ga0105242_10654933 | 3300009176 | Unclassified | 1022 |
| 404 | Ga0105242_10675525 | 3300009176 | Bacteria | 1007 |
| 405 | Ga0105242_10833908 | 3300009176 | Bacteria | 916 |
| 406 | Ga0105242_11039062 | 3300009176 | Bacteria | 829 |
| 407 | Ga0105242_11119214 | 3300009176 | Bacteria | 802 |
| 408 | Ga0105248_10184560 | 3300009177 | Bacteria | 2351 |
| 409 | Ga0105248_11053959 | 3300009177 | Bacteria | 919 |
| 410 | Ga0105237_10012365 | 3300009545 | Bacteria | 8995 |
| 411 | Ga0105237_10145977 | 3300009545 | Bacteria | 2361 |
| 412 | Ga0105237_11610442 | 3300009545 | Bacteria | 656 |
| 413 | Ga0105238_11282734 | 3300009551 | Bacteria | 758 |
| 414 | Ga0105249_10001240 | 3300009553 | Bacteria | 22411 |
| 415 | Ga0105249_10010036 | 3300009553 | Bacteria | 8310 |
| 416 | Ga0105249_10015498 | 3300009553 | Bacteria | 6747 |
| 417 | Ga0105249_10020990 | 3300009553 | Bacteria | 5844 |
| 418 | Ga0105249_10068305 | 3300009553 | Bacteria | 3277 |
| 419 | Ga0105249_10154060 | 3300009553 | Bacteria | 2215 |
| 420 | Ga0105249_10196662 | 3300009553 | Unclassified | 1971 |
| 421 | Ga0105249_10385708 | 3300009553 | Bacteria | 1428 |
| 422 | Ga0105249_10410106 | 3300009553 | Bacteria | 1387 |
| 423 | Ga0105249_10505328 | 3300009553 | Bacteria | 1254 |
| 424 | Ga0105239_10006184 | 3300010375 | Bacteria | 13934 |
| 425 | Ga0105239_10120110 | 3300010375 | Unclassified | 2918 |
| 426 | Ga0105239_10156948 | 3300010375 | Bacteria | 2541 |
| 427 | Ga0105239_10319849 | 3300010375 | Unclassified | 1750 |
| 428 | Ga0105239_10606324 | 3300010375 | Bacteria | 1249 |
| 429 | Ga0105239_11922873 | 3300010375 | Bacteria | 686 |
| 430 | Ga0105246_10087749 | 3300011119 | Bacteria | 2233 |
| 431 | Ga0105246_10187786 | 3300011119 | Bacteria | 1597 |
| 432 | Ga0105246_10549492 | 3300011119 | Bacteria | 989 |
| 433 | Ga0105246_10562040 | 3300011119 | Bacteria | 979 |
| 434 | Ga0105246_10645339 | 3300011119 | Bacteria | 921 |
| 435 | Ga0105246_10683687 | 3300011119 | Bacteria | 897 |
| 436 | Ga0157373_10025044 | 3300013100 | Bacteria | 4320 |
| 437 | Ga0157373_10050175 | 3300013100 | Unclassified | 2972 |
| 438 | Ga0157373_10066048 | 3300013100 | Bacteria | 2560 |
| 439 | Ga0157373_10295262 | 3300013100 | Bacteria | 1150 |
| 440 | Ga0157373_10938817 | 3300013100 | Bacteria | 643 |
| 441 | Ga0157371_10000119 | 3300013102 | Bacteria | 120350 |
| 442 | Ga0157371_10003679 | 3300013102 | Bacteria | 13763 |
| 443 | Ga0157371_10015182 | 3300013102 | Bacteria | 5783 |
| 444 | Ga0157371_10028476 | 3300013102 | Bacteria | 4045 |
| 445 | Ga0157371_10081579 | 3300013102 | Unclassified | 2290 |
| 446 | Ga0157371_10406661 | 3300013102 | Bacteria | 996 |
| 447 | Ga0157371_10450674 | 3300013102 | Unclassified | 946 |
| 448 | Ga0157370_10030052 | 3300013104 | Bacteria | 5325 |
| 449 | Ga0157370_10033654 | 3300013104 | Bacteria | 4996 |
| 450 | Ga0157370_10265726 | 3300013104 | Bacteria | 1585 |
| 451 | Ga0157370_10416454 | 3300013104 | Bacteria | 1236 |
| 452 | Ga0157370_10459668 | 3300013104 | Unclassified | 1170 |
| 453 | Ga0157370_10503203 | 3300013104 | Bacteria | 1112 |
| 454 | Ga0157370_10507602 | 3300013104 | Bacteria | 1107 |
| 455 | Ga0157370_10575848 | 3300013104 | Bacteria | 1032 |
| 456 | Ga0157370_10735814 | 3300013104 | Bacteria | 899 |
| 457 | Ga0157370_10842792 | 3300013104 | Bacteria | 833 |
| 458 | Ga0157369_10000015 | 3300013105 | Bacteria | 262917 |
| 459 | Ga0157369_10322555 | 3300013105 | Bacteria | 1606 |
| 460 | Ga0157369_10411950 | 3300013105 | Bacteria | 1402 |
| 461 | Ga0157369_10421462 | 3300013105 | Bacteria | 1384 |
| 462 | Ga0157374_10000955 | 3300013296 | Bacteria | 25080 |
| 463 | Ga0157374_10055794 | 3300013296 | Bacteria | 3688 |
| 464 | Ga0157374_10200871 | 3300013296 | Bacteria | 1952 |
| 465 | Ga0157374_10275185 | 3300013296 | Bacteria | 1661 |
| 466 | Ga0157374_10369768 | 3300013296 | Bacteria | 1427 |
| 467 | Ga0157374_10447887 | 3300013296 | Bacteria | 1292 |
| 468 | Ga0157374_11544754 | 3300013296 | Unclassified | 687 |
| 469 | Ga0157374_11657892 | 3300013296 | Unclassified | 664 |
| 470 | Ga0157378_10002905 | 3300013297 | Bacteria | 15257 |
| 471 | Ga0157378_10066840 | 3300013297 | Bacteria | 3220 |
| 472 | Ga0157378_10082393 | 3300013297 | Bacteria | 2909 |
| 473 | Ga0157378_10092687 | 3300013297 | Unclassified | 2749 |
| 474 | Ga0157378_10170532 | 3300013297 | Bacteria | 2040 |
| 475 | Ga0157378_10190987 | 3300013297 | Bacteria | 1932 |
| 476 | Ga0157378_10237149 | 3300013297 | Bacteria | 1741 |
| 477 | Ga0157378_10333369 | 3300013297 | Bacteria | 1477 |
| 478 | Ga0157378_10661608 | 3300013297 | Bacteria | 1061 |
| 479 | Ga0157378_10962941 | 3300013297 | Bacteria | 886 |
| 480 | Ga0157378_11549208 | 3300013297 | Bacteria | 708 |
| 481 | Ga0163162_10000705 | 3300013306 | Bacteria | 30921 |
| 482 | Ga0163162_10042164 | 3300013306 | Bacteria | 4566 |
| 483 | Ga0163162_10068699 | 3300013306 | Unclassified | 3595 |
| 484 | Ga0163162_10166333 | 3300013306 | Bacteria | 2329 |
| 485 | Ga0163162_10173453 | 3300013306 | Bacteria | 2281 |
| 486 | Ga0163162_10244214 | 3300013306 | Unclassified | 1927 |
| 487 | Ga0163162_10317383 | 3300013306 | Unclassified | 1691 |
| 488 | Ga0163162_10318254 | 3300013306 | Bacteria | 1688 |
| 489 | Ga0163162_10410055 | 3300013306 | Bacteria | 1488 |
| 490 | Ga0163162_10492466 | 3300013306 | Bacteria | 1357 |
| 491 | Ga0163162_10803852 | 3300013306 | Bacteria | 1058 |
| 492 | Ga0163162_10803864 | 3300013306 | Bacteria | 1058 |
| 493 | Ga0163162_10857042 | 3300013306 | Bacteria | 1023 |
| 494 | Ga0163162_10985075 | 3300013306 | Unclassified | 953 |
| 495 | Ga0157372_10053750 | 3300013307 | Bacteria | 4491 |
| 496 | Ga0157372_10188694 | 3300013307 | Unclassified | 2387 |
| 497 | Ga0157372_10206085 | 3300013307 | Bacteria | 2279 |
| 498 | Ga0157372_10381973 | 3300013307 | Unclassified | 1641 |
| 499 | Ga0157372_10387543 | 3300013307 | Bacteria | 1628 |
| 500 | Ga0157372_10702646 | 3300013307 | Bacteria | 1177 |
| 501 | Ga0157375_10002578 | 3300013308 | Bacteria | 15745 |
| 502 | Ga0157375_10018939 | 3300013308 | Bacteria | 6250 |
| 503 | Ga0157375_10042379 | 3300013308 | Bacteria | 4406 |
| 504 | Ga0157375_10072939 | 3300013308 | Bacteria | 3451 |
| 505 | Ga0157375_10296600 | 3300013308 | Unclassified | 1780 |
| 506 | Ga0157375_10409309 | 3300013308 | Bacteria | 1523 |
| 507 | Ga0157375_10416386 | 3300013308 | Unclassified | 1510 |
| 508 | Ga0157375_10524470 | 3300013308 | Bacteria | 1347 |
| 509 | Ga0157375_10579078 | 3300013308 | Bacteria | 1283 |
| 510 | Ga0157375_10686151 | 3300013308 | Unclassified | 1178 |
| 511 | Ga0157375_10706200 | 3300013308 | Bacteria | 1162 |
| 512 | Ga0157375_10804328 | 3300013308 | Bacteria | 1089 |
| 513 | Ga0157375_11207623 | 3300013308 | Bacteria | 887 |
| 514 | Ga0157375_11327413 | 3300013308 | Bacteria | 846 |
| 515 | Ga0157375_11342922 | 3300013308 | Bacteria | 841 |
| 516 | Ga0163163_10000075 | 3300014325 | Bacteria | 109545 |
| 517 | Ga0163163_10003651 | 3300014325 | Bacteria | 13084 |
| 518 | Ga0163163_10051116 | 3300014325 | Unclassified | 4074 |
| 519 | Ga0163163_10057069 | 3300014325 | Unclassified | 3860 |
| 520 | Ga0163163_10235166 | 3300014325 | Unclassified | 1882 |
| 521 | Ga0163163_12347744 | 3300014325 | Unclassified | 592 |
| 522 | Ga0163163_12364570 | 3300014325 | Bacteria | 590 |
| 523 | Ga0163163_12691298 | 3300014325 | Bacteria | 554 |
| 524 | Ga0157380_10015138 | 3300014326 | Bacteria | 5661 |
| 525 | Ga0157380_10022281 | 3300014326 | Bacteria | 4766 |
| 526 | Ga0157380_10029842 | 3300014326 | Bacteria | 4170 |
| 527 | Ga0157380_10127062 | 3300014326 | Bacteria | 2169 |
| 528 | Ga0157380_10158898 | 3300014326 | Bacteria | 1962 |
| 529 | Ga0157380_10614001 | 3300014326 | Unclassified | 1078 |
| 530 | Ga0157380_11189433 | 3300014326 | Bacteria | 805 |
| 531 | Ga0157380_11429565 | 3300014326 | Bacteria | 743 |
| 532 | Ga0157380_12043816 | 3300014326 | Unclassified | 635 |
| 533 | Ga0157380_12119135 | 3300014326 | Bacteria | 625 |
| 534 | Ga0182008_10389072 | 3300014497 | Bacteria | 747 |
| 535 | Ga0157377_10040530 | 3300014745 | Bacteria | 2579 |
| 536 | Ga0157377_10161590 | 3300014745 | Unclassified | 1393 |
| 537 | Ga0157377_10270941 | 3300014745 | Bacteria | 1109 |
| 538 | Ga0157377_10394916 | 3300014745 | Bacteria | 940 |
| 539 | Ga0157379_10040212 | 3300014968 | Bacteria | 4172 |
| 540 | Ga0157379_10119098 | 3300014968 | Bacteria | 2375 |
| 541 | Ga0157379_10241637 | 3300014968 | Bacteria | 1638 |
| 542 | Ga0157379_10477251 | 3300014968 | Unclassified | 1154 |
| 543 | Ga0157379_10548316 | 3300014968 | Bacteria | 1076 |
| 544 | Ga0157379_10797736 | 3300014968 | Bacteria | 891 |
| 545 | Ga0157379_11044122 | 3300014968 | Unclassified | 781 |
| 546 | Ga0157376_10018590 | 3300014969 | Bacteria | 5333 |
| 547 | Ga0157376_10093092 | 3300014969 | Bacteria | 2615 |
| 548 | Ga0157376_10127726 | 3300014969 | Bacteria | 2264 |
| 549 | Ga0157376_10181832 | 3300014969 | Unclassified | 1923 |
| 550 | Ga0157376_10262818 | 3300014969 | Bacteria | 1618 |
| 551 | Ga0157376_10277377 | 3300014969 | Bacteria | 1577 |
| 552 | Ga0157376_10309012 | 3300014969 | Unclassified | 1499 |
| 553 | Ga0157376_10498432 | 3300014969 | Unclassified | 1196 |
| 554 | Ga0157376_11702982 | 3300014969 | Unclassified | 666 |
| 555 | Ga0182006_1000091 | 3300015261 | Bacteria | 109227 |
| 556 | Ga0182006_1000957 | 3300015261 | Bacteria | 19179 |
| 557 | Ga0182006_1001651 | 3300015261 | Bacteria | 13150 |
| 558 | Ga0182007_10000010 | 3300015262 | Bacteria | 286070 |
| 559 | Ga0182007_10148461 | 3300015262 | Bacteria | 796 |
| 560 | Ga0163161_10000046 | 3300017792 | Bacteria | 127211 |
| 561 | Ga0163161_10000890 | 3300017792 | Bacteria | 23195 |
| 562 | Ga0163161_10002168 | 3300017792 | Bacteria | 14151 |
| 563 | Ga0163161_10004792 | 3300017792 | Bacteria | 9423 |
| 564 | Ga0163161_10231168 | 3300017792 | Unclassified | 1435 |
| 565 | Ga0163161_10277361 | 3300017792 | Unclassified | 1314 |
| 566 | Ga0163161_10335287 | 3300017792 | Bacteria | 1199 |
| 567 | Ga0163161_10410025 | 3300017792 | Unclassified | 1088 |
| 568 | Ga0163161_11143908 | 3300017792 | Unclassified | 671 |
| 569 | Ga0207425_1000002 | 3300025245 | Bacteria | 1362590 |
| 570 | Ga0209646_1009276 | 3300025246 | Bacteria | 1563 |
| 571 | Ga0209129_1000002 | 3300025258 | Bacteria | 1359086 |
| 572 | Ga0207666_1014067 | 3300025271 | Unclassified | 1128 |
| 573 | Ga0209676_1000001 | 3300025292 | Bacteria | 1852142 |
| 574 | Ga0209025_1000004 | 3300025294 | Bacteria | 1361782 |
| 575 | Ga0209758_1000006 | 3300025297 | Bacteria | 1359562 |
| 576 | Ga0209050_1000258 | 3300025298 | Bacteria | 113741 |
| 577 | Ga0207697_10044155 | 3300025315 | Archaea | 1833 |
| 578 | Ga0207697_10064655 | 3300025315 | Unclassified | 1526 |
| 579 | Ga0207697_10190333 | 3300025315 | Bacteria | 901 |
| 580 | Ga0207656_10060635 | 3300025321 | Bacteria | 1659 |
| 581 | Ga0207656_10185330 | 3300025321 | Bacteria | 1000 |
| 582 | Ga0207656_10253863 | 3300025321 | Bacteria | 862 |
| 583 | Ga0207682_10065085 | 3300025893 | Bacteria | 1534 |
| 584 | Ga0207682_10139110 | 3300025893 | Bacteria | 1089 |
| 585 | Ga0207642_10027412 | 3300025899 | Unclassified | 2331 |
| 586 | Ga0207642_10038175 | 3300025899 | Bacteria | 2076 |
| 587 | Ga0207642_10633404 | 3300025899 | Bacteria | 669 |
| 588 | Ga0207710_10000852 | 3300025900 | Bacteria | 16442 |
| 589 | Ga0207688_10013484 | 3300025901 | Unclassified | 4442 |
| 590 | Ga0207680_10029382 | 3300025903 | Unclassified | 3087 |
| 591 | Ga0207680_10220506 | 3300025903 | Unclassified | 1300 |
| 592 | Ga0207680_10801572 | 3300025903 | Bacteria | 675 |
| 593 | Ga0207680_11050456 | 3300025903 | Bacteria | 583 |
| 594 | Ga0207647_10088228 | 3300025904 | Bacteria | 1852 |
| 595 | Ga0207685_10282761 | 3300025905 | Bacteria | 815 |
| 596 | Ga0207645_10001934 | 3300025907 | Bacteria | 16720 |
| 597 | Ga0207645_10005381 | 3300025907 | Bacteria | 9293 |
| 598 | Ga0207645_10026908 | 3300025907 | Bacteria | 3716 |
| 599 | Ga0207645_10048324 | 3300025907 | Bacteria | 2717 |
| 600 | Ga0207645_10874100 | 3300025907 | Bacteria | 611 |
| 601 | Ga0207643_10005138 | 3300025908 | Bacteria | 7002 |
| 602 | Ga0207643_10008586 | 3300025908 | Bacteria | 5480 |
| 603 | Ga0207643_10030001 | 3300025908 | Bacteria | 3025 |
| 604 | Ga0207705_10549346 | 3300025909 | Bacteria | 898 |
| 605 | Ga0207705_10828653 | 3300025909 | Bacteria | 718 |
| 606 | Ga0207654_10093825 | 3300025911 | Bacteria | 1836 |
| 607 | Ga0207654_10228348 | 3300025911 | Bacteria | 1238 |
| 608 | Ga0207707_10068501 | 3300025912 | Bacteria | 3092 |
| 609 | Ga0207695_10071967 | 3300025913 | Bacteria | 3530 |
| 610 | Ga0207695_10634553 | 3300025913 | Bacteria | 949 |
| 611 | Ga0207671_10099919 | 3300025914 | Bacteria | 2196 |
| 612 | Ga0207671_10356189 | 3300025914 | Bacteria | 1161 |
| 613 | Ga0207660_10003834 | 3300025917 | Bacteria | 9803 |
| 614 | Ga0207662_10021709 | 3300025918 | Unclassified | 3673 |
| 615 | Ga0207662_10238866 | 3300025918 | Bacteria | 1189 |
| 616 | Ga0207662_10952016 | 3300025918 | Bacteria | 609 |
| 617 | Ga0207657_10039267 | 3300025919 | Bacteria | 4209 |
| 618 | Ga0207657_10043943 | 3300025919 | Bacteria | 3932 |
| 619 | Ga0207649_10005426 | 3300025920 | Bacteria | 6902 |
| 620 | Ga0207649_10788019 | 3300025920 | Bacteria | 741 |
| 621 | Ga0207652_10018838 | 3300025921 | Bacteria | 5665 |
| 622 | Ga0207646_10763564 | 3300025922 | Bacteria | 862 |
| 623 | Ga0207681_10020255 | 3300025923 | Unclassified | 4212 |
| 624 | Ga0207681_10063936 | 3300025923 | Unclassified | 2539 |
| 625 | Ga0207681_10103637 | 3300025923 | Bacteria | 2056 |
| 626 | Ga0207681_10258980 | 3300025923 | Bacteria | 1361 |
| 627 | Ga0207681_10357531 | 3300025923 | Unclassified | 1170 |
| 628 | Ga0207650_10022251 | 3300025925 | Unclassified | 4485 |
| 629 | Ga0207650_10057288 | 3300025925 | Unclassified | 2898 |
| 630 | Ga0207650_10109524 | 3300025925 | Unclassified | 2136 |
| 631 | Ga0207650_10140545 | 3300025925 | Bacteria | 1898 |
| 632 | Ga0207650_10215846 | 3300025925 | Bacteria | 1542 |
| 633 | Ga0207650_10287669 | 3300025925 | Unclassified | 1339 |
| 634 | Ga0207650_10297257 | 3300025925 | Unclassified | 1318 |
| 635 | Ga0207650_10459995 | 3300025925 | Bacteria | 1060 |
| 636 | Ga0207650_10512948 | 3300025925 | Unclassified | 1003 |
| 637 | Ga0207659_10028420 | 3300025926 | Bacteria | 3801 |
| 638 | Ga0207659_10050201 | 3300025926 | Bacteria | 2963 |
| 639 | Ga0207659_10183573 | 3300025926 | Bacteria | 1659 |
| 640 | Ga0207659_11500238 | 3300025926 | Unclassified | 577 |
| 641 | Ga0207687_10902367 | 3300025927 | Bacteria | 756 |
| 642 | Ga0207644_10037282 | 3300025931 | Bacteria | 3420 |
| 643 | Ga0207644_10048838 | 3300025931 | Unclassified | 3028 |
| 644 | Ga0207644_10261815 | 3300025931 | Bacteria | 1383 |
| 645 | Ga0207644_10351113 | 3300025931 | Bacteria | 1198 |
| 646 | Ga0207644_10439415 | 3300025931 | Unclassified | 1071 |
| 647 | Ga0207644_10690339 | 3300025931 | Unclassified | 851 |
| 648 | Ga0207690_10033205 | 3300025932 | Bacteria | 3317 |
| 649 | Ga0207690_10058128 | 3300025932 | Bacteria | 2615 |
| 650 | Ga0207706_10027723 | 3300025933 | Bacteria | 5064 |
| 651 | Ga0207706_10106909 | 3300025933 | Unclassified | 2462 |
| 652 | Ga0207706_10177720 | 3300025933 | Unclassified | 1870 |
| 653 | Ga0207706_10583464 | 3300025933 | Bacteria | 961 |
| 654 | Ga0207686_10005406 | 3300025934 | Bacteria | 6849 |
| 655 | Ga0207686_10170855 | 3300025934 | Unclassified | 1533 |
| 656 | Ga0207686_10632322 | 3300025934 | Bacteria | 845 |
| 657 | Ga0207670_10018985 | 3300025936 | Bacteria | 4191 |
| 658 | Ga0207670_10147113 | 3300025936 | Bacteria | 1744 |
| 659 | Ga0207670_10300209 | 3300025936 | Bacteria | 1257 |
| 660 | Ga0207670_10318353 | 3300025936 | Bacteria | 1223 |
| 661 | Ga0207670_10391754 | 3300025936 | Bacteria | 1109 |
| 662 | Ga0207670_10491663 | 3300025936 | Unclassified | 995 |
| 663 | Ga0207670_11770861 | 3300025936 | Unclassified | 525 |
| 664 | Ga0207669_10053289 | 3300025937 | Bacteria | 2436 |
| 665 | Ga0207669_11392892 | 3300025937 | Bacteria | 597 |
| 666 | Ga0207669_11625856 | 3300025937 | Bacteria | 551 |
| 667 | Ga0207704_10020737 | 3300025938 | Unclassified | 3484 |
| 668 | Ga0207704_10066559 | 3300025938 | Unclassified | 2262 |
| 669 | Ga0207704_10106051 | 3300025938 | Bacteria | 1887 |
| 670 | Ga0207704_10304916 | 3300025938 | Bacteria | 1221 |
| 671 | Ga0207704_10477007 | 3300025938 | Bacteria | 1001 |
| 672 | Ga0207704_11560944 | 3300025938 | Bacteria | 567 |
| 673 | Ga0207691_10009095 | 3300025940 | Bacteria | 9534 |
| 674 | Ga0207691_10014205 | 3300025940 | Bacteria | 7596 |
| 675 | Ga0207691_10077842 | 3300025940 | Unclassified | 2986 |
| 676 | Ga0207691_10090652 | 3300025940 | Bacteria | 2740 |
| 677 | Ga0207691_10113912 | 3300025940 | Bacteria | 2403 |
| 678 | Ga0207691_10142374 | 3300025940 | Bacteria | 2112 |
| 679 | Ga0207691_10201402 | 3300025940 | Unclassified | 1732 |
| 680 | Ga0207691_10525217 | 3300025940 | Bacteria | 1004 |
| 681 | Ga0207691_10928239 | 3300025940 | Bacteria | 728 |
| 682 | Ga0207691_10949161 | 3300025940 | Bacteria | 719 |
| 683 | Ga0207691_11099161 | 3300025940 | Bacteria | 661 |
| 684 | Ga0207689_10015791 | 3300025942 | Bacteria | 6393 |
| 685 | Ga0207689_10015930 | 3300025942 | Bacteria | 6365 |
| 686 | Ga0207689_10022578 | 3300025942 | Bacteria | 5288 |
| 687 | Ga0207689_10049068 | 3300025942 | Unclassified | 3483 |
| 688 | Ga0207689_10063806 | 3300025942 | Unclassified | 3031 |
| 689 | Ga0207689_10067860 | 3300025942 | Unclassified | 2930 |
| 690 | Ga0207689_10104803 | 3300025942 | Unclassified | 2324 |
| 691 | Ga0207689_10395491 | 3300025942 | Bacteria | 1152 |
| 692 | Ga0207661_10000738 | 3300025944 | Bacteria | 21229 |
| 693 | Ga0207661_10014684 | 3300025944 | Bacteria | 5745 |
| 694 | Ga0207661_10043248 | 3300025944 | Bacteria | 3555 |
| 695 | Ga0207661_10047130 | 3300025944 | Bacteria | 3420 |
| 696 | Ga0207661_10301127 | 3300025944 | Bacteria | 1437 |
| 697 | Ga0207661_10522603 | 3300025944 | Bacteria | 1086 |
| 698 | Ga0207679_10000902 | 3300025945 | Bacteria | 18967 |
| 699 | Ga0207679_10032681 | 3300025945 | Bacteria | 3656 |
| 700 | Ga0207679_10125874 | 3300025945 | Bacteria | 2048 |
| 701 | Ga0207679_10362698 | 3300025945 | Bacteria | 1266 |
| 702 | Ga0207679_10859078 | 3300025945 | Bacteria | 829 |
| 703 | Ga0207679_11008555 | 3300025945 | Unclassified | 763 |
| 704 | Ga0207667_10096088 | 3300025949 | Bacteria | 3058 |
| 705 | Ga0207667_10183389 | 3300025949 | Bacteria | 2149 |
| 706 | Ga0207651_10044105 | 3300025960 | Bacteria | 2982 |
| 707 | Ga0207651_10077993 | 3300025960 | Bacteria | 2374 |
| 708 | Ga0207651_10114790 | 3300025960 | Unclassified | 2029 |
| 709 | Ga0207651_10140712 | 3300025960 | Bacteria | 1863 |
| 710 | Ga0207651_10363019 | 3300025960 | Unclassified | 1223 |
| 711 | Ga0207651_10639825 | 3300025960 | Bacteria | 933 |
| 712 | Ga0207651_10642254 | 3300025960 | Bacteria | 931 |
| 713 | Ga0207651_10702776 | 3300025960 | Unclassified | 891 |
| 714 | Ga0207651_10949936 | 3300025960 | Bacteria | 767 |
| 715 | Ga0207651_10981146 | 3300025960 | Unclassified | 754 |
| 716 | Ga0207712_10030385 | 3300025961 | Bacteria | 3632 |
| 717 | Ga0207712_10045095 | 3300025961 | Bacteria | 3052 |
| 718 | Ga0207712_10060728 | 3300025961 | Bacteria | 2680 |
| 719 | Ga0207712_10066740 | 3300025961 | Unclassified | 2572 |
| 720 | Ga0207712_10144811 | 3300025961 | Bacteria | 1828 |
| 721 | Ga0207712_10280437 | 3300025961 | Unclassified | 1360 |
| 722 | Ga0207712_10713789 | 3300025961 | Bacteria | 876 |
| 723 | Ga0207668_10204901 | 3300025972 | Bacteria | 1573 |
| 724 | Ga0207668_10276264 | 3300025972 | Bacteria | 1375 |
| 725 | Ga0207668_12014382 | 3300025972 | Bacteria | 520 |
| 726 | Ga0207640_10044336 | 3300025981 | Bacteria | 2849 |
| 727 | Ga0207640_10273930 | 3300025981 | Bacteria | 1322 |
| 728 | Ga0207640_10400135 | 3300025981 | Bacteria | 1118 |
| 729 | Ga0207640_10591306 | 3300025981 | Bacteria | 938 |
| 730 | Ga0207640_10858117 | 3300025981 | Bacteria | 790 |
| 731 | Ga0207658_10046164 | 3300025986 | Unclassified | 3180 |
| 732 | Ga0207658_10047535 | 3300025986 | Unclassified | 3141 |
| 733 | Ga0207658_10139432 | 3300025986 | Bacteria | 1960 |
| 734 | Ga0207658_10166275 | 3300025986 | Bacteria | 1812 |
| 735 | Ga0207658_10195815 | 3300025986 | Bacteria | 1683 |
| 736 | Ga0207658_10923424 | 3300025986 | Bacteria | 795 |
| 737 | Ga0207677_10010870 | 3300026023 | Bacteria | 5166 |
| 738 | Ga0207677_10025173 | 3300026023 | Bacteria | 3708 |
| 739 | Ga0207677_10410763 | 3300026023 | Bacteria | 1150 |
| 740 | Ga0207677_10416708 | 3300026023 | Bacteria | 1143 |
| 741 | Ga0207677_10505142 | 3300026023 | Bacteria | 1046 |
| 742 | Ga0207677_10638641 | 3300026023 | Bacteria | 938 |
| 743 | Ga0207677_11700038 | 3300026023 | Unclassified | 585 |
| 744 | Ga0207703_10118278 | 3300026035 | Unclassified | 2271 |
| 745 | Ga0207703_10190877 | 3300026035 | Bacteria | 1814 |
| 746 | Ga0207703_10205809 | 3300026035 | Bacteria | 1751 |
| 747 | Ga0207703_10412547 | 3300026035 | Bacteria | 1255 |
| 748 | Ga0207703_10924571 | 3300026035 | Bacteria | 835 |
| 749 | Ga0207639_10021442 | 3300026041 | Bacteria | 4641 |
| 750 | Ga0207639_10149869 | 3300026041 | Bacteria | 1953 |
| 751 | Ga0207639_10853686 | 3300026041 | Bacteria | 850 |
| 752 | Ga0207639_11992699 | 3300026041 | Unclassified | 542 |
| 753 | Ga0207678_10154694 | 3300026067 | Bacteria | 1958 |
| 754 | Ga0207678_10631694 | 3300026067 | Bacteria | 940 |
| 755 | Ga0207708_10111662 | 3300026075 | Bacteria | 2122 |
| 756 | Ga0207708_10343179 | 3300026075 | Bacteria | 1223 |
| 757 | Ga0207708_10380710 | 3300026075 | Bacteria | 1163 |
| 758 | Ga0207641_10000380 | 3300026088 | Bacteria | 52801 |
| 759 | Ga0207641_10030996 | 3300026088 | Bacteria | 4433 |
| 760 | Ga0207641_10038209 | 3300026088 | Unclassified | 4012 |
| 761 | Ga0207641_10153140 | 3300026088 | Unclassified | 2089 |
| 762 | Ga0207641_10179946 | 3300026088 | Unclassified | 1936 |
| 763 | Ga0207641_10283683 | 3300026088 | Unclassified | 1559 |
| 764 | Ga0207641_10434559 | 3300026088 | Bacteria | 1266 |
| 765 | Ga0207641_10441837 | 3300026088 | Bacteria | 1256 |
| 766 | Ga0207641_10507230 | 3300026088 | Bacteria | 1172 |
| 767 | Ga0207641_10568991 | 3300026088 | Bacteria | 1107 |
| 768 | Ga0207641_10704931 | 3300026088 | Bacteria | 994 |
| 769 | Ga0207641_11281054 | 3300026088 | Bacteria | 733 |
| 770 | Ga0207641_11382699 | 3300026088 | Bacteria | 705 |
| 771 | Ga0207648_10003538 | 3300026089 | Bacteria | 16338 |
| 772 | Ga0207648_10003599 | 3300026089 | Bacteria | 16209 |
| 773 | Ga0207648_10012445 | 3300026089 | Bacteria | 7966 |
| 774 | Ga0207648_10126450 | 3300026089 | Bacteria | 2249 |
| 775 | Ga0207648_10261908 | 3300026089 | Unclassified | 1543 |
| 776 | Ga0207648_10360239 | 3300026089 | Unclassified | 1312 |
| 777 | Ga0207648_10454315 | 3300026089 | Bacteria | 1167 |
| 778 | Ga0207676_10001466 | 3300026095 | Bacteria | 17524 |
| 779 | Ga0207676_10060215 | 3300026095 | Unclassified | 3002 |
| 780 | Ga0207676_10068244 | 3300026095 | Bacteria | 2843 |
| 781 | Ga0207676_10069450 | 3300026095 | Bacteria | 2821 |
| 782 | Ga0207676_10190630 | 3300026095 | Bacteria | 1804 |
| 783 | Ga0207676_10197411 | 3300026095 | Bacteria | 1775 |
| 784 | Ga0207676_10496143 | 3300026095 | Bacteria | 1159 |
| 785 | Ga0207676_10574438 | 3300026095 | Bacteria | 1080 |
| 786 | Ga0207676_10733910 | 3300026095 | Bacteria | 959 |
| 787 | Ga0207676_10942245 | 3300026095 | Bacteria | 849 |
| 788 | Ga0207676_11058362 | 3300026095 | Unclassified | 801 |
| 789 | Ga0207674_10003262 | 3300026116 | Bacteria | 19959 |
| 790 | Ga0207674_10011079 | 3300026116 | Bacteria | 10136 |
| 791 | Ga0207674_10249578 | 3300026116 | Bacteria | 1721 |
| 792 | Ga0207674_11071057 | 3300026116 | Bacteria | 775 |
| 793 | Ga0207674_11294737 | 3300026116 | Bacteria | 698 |
| 794 | Ga0207675_100002458 | 3300026118 | Bacteria | 18348 |
| 795 | Ga0207675_100018725 | 3300026118 | Bacteria | 6463 |
| 796 | Ga0207675_100041774 | 3300026118 | Unclassified | 4281 |
| 797 | Ga0207675_100058912 | 3300026118 | Bacteria | 3584 |
| 798 | Ga0207675_100059596 | 3300026118 | Bacteria | 3562 |
| 799 | Ga0207675_100175960 | 3300026118 | Bacteria | 2047 |
| 800 | Ga0207675_101209818 | 3300026118 | Bacteria | 776 |
| 801 | Ga0207683_10000691 | 3300026121 | Bacteria | 30953 |
| 802 | Ga0207683_10095644 | 3300026121 | Unclassified | 2648 |
| 803 | Ga0207683_11349968 | 3300026121 | Bacteria | 660 |
| 804 | Ga0207698_10427270 | 3300026142 | Unclassified | 1273 |
| 805 | Ga0207698_10791123 | 3300026142 | Bacteria | 950 |
| 806 | Ga0207698_11086556 | 3300026142 | Bacteria | 812 |
| 807 | Ga0207698_11393339 | 3300026142 | Bacteria | 716 |
| 808 | Ga0209968_1011552 | 3300027526 | Unclassified | 1369 |
| 809 | Ga0209974_10384764 | 3300027876 | Unclassified | 549 |
| 810 | Ga0207428_10106615 | 3300027907 | Unclassified | 2160 |
| 811 | Ga0207428_10415046 | 3300027907 | Bacteria | 984 |
| 812 | Ga0207428_10656523 | 3300027907 | Bacteria | 752 |
| 813 | Ga0268266_10011708 | 3300028379 | Bacteria | 7610 |
| 814 | Ga0268265_10005161 | 3300028380 | Bacteria | 8945 |
| 815 | Ga0268265_10309421 | 3300028380 | Bacteria | 1426 |
| 816 | Ga0268265_11782480 | 3300028380 | Unclassified | 622 |
| 817 | Ga0268265_11925425 | 3300028380 | Bacteria | 598 |
| 818 | Ga0268264_10005023 | 3300028381 | Bacteria | 11200 |
| 819 | Ga0268264_10067024 | 3300028381 | Unclassified | 3029 |
| 820 | Ga0268264_10170717 | 3300028381 | Bacteria | 1967 |
| 821 | Ga0268264_10232807 | 3300028381 | Bacteria | 1702 |
| 822 | Ga0268264_10392022 | 3300028381 | Unclassified | 1332 |
| 823 | Ga0268264_10968754 | 3300028381 | Unclassified | 856 |
| 824 | Ga0307517_10358958 | 3300028786 | Bacteria | 788 |
| 825 | Ga0307515_10000162 | 3300028794 | Bacteria | 163720 |
| 826 | Ga0307515_10009312 | 3300028794 | Bacteria | 19000 |
| 827 | Ga0307513_10134888 | 3300031456 | Bacteria | 2406 |
| 828 | Ga0307513_10210849 | 3300031456 | Bacteria | 1774 |
| 829 | Ga0307513_10258582 | 3300031456 | Bacteria | 1532 |
| 830 | Ga0307513_10839378 | 3300031456 | Bacteria | 625 |
| 831 | Ga0307509_10087781 | 3300031507 | Bacteria | 3194 |
| 832 | Ga0307516_10501757 | 3300031730 | Bacteria | 868 |
| 833 | Ga0307405_10000049 | 3300031731 | Bacteria | 66592 |
| 834 | Ga0307407_10000024 | 3300031903 | Bacteria | 113716 |
| 835 | Ga0307412_10708827 | 3300031911 | Bacteria | 865 |
| 836 | Ga0307412_11091299 | 3300031911 | Bacteria | 710 |
| 837 | Ga0307409_100036292 | 3300031995 | Bacteria | 3622 |
| 838 | Ga0307416_100000037 | 3300032002 | Bacteria | 137513 |
| 839 | Ga0307414_10001153 | 3300032004 | Bacteria | 13555 |
| 840 | Ga0307414_10004809 | 3300032004 | Bacteria | 7371 |
| 841 | Ga0307414_10006990 | 3300032004 | Bacteria | 6326 |
| 842 | Ga0307414_10014942 | 3300032004 | Bacteria | 4674 |
| 843 | Ga0307414_10091226 | 3300032004 | Unclassified | 2264 |
| 844 | Ga0307414_10261129 | 3300032004 | Bacteria | 1445 |
| 845 | Ga0307414_10364214 | 3300032004 | Bacteria | 1245 |
| 846 | Ga0307414_10937782 | 3300032004 | Bacteria | 795 |
| 847 | Ga0307414_11074882 | 3300032004 | Bacteria | 742 |
| 848 | Ga0307414_11133521 | 3300032004 | Bacteria | 723 |
| 849 | Ga0307414_11675027 | 3300032004 | Bacteria | 593 |
| 850 | Ga0316585_10261770 | 3300032137 | Unclassified | 573 |
| 851 | Ga0373936_0158230 | 3300035113 | Bacteria | 986 |
| 852 | Ga0373943_0409636 | 3300035170 | Bacteria | 784 |
| 853 | Ga0373927_0700862 | 3300035695 | Unclassified | 669 |
| 854 | Ga0373947_1134028 | 3300035725 | Bacteria | 533 |
| 855 | Ga0373937_0091931 | 3300036401 | Bacteria | 2812 |
| 856 | Ga0373937_0541574 | 3300036401 | Bacteria | 1106 |
| 857 | Ga0316584_0401050 | 3300036712 | Bacteria | 977 |
| 858 | Ga0395905_0697672 | 3300037471 | Bacteria | 917 |
| 859 | Ga0395905_0943594 | 3300037471 | Unclassified | 766 |
| 860 | Ga0439436_0012382 | 3300041404 | Bacteria | 2590 |
| 861 | Ga0439453_0020104 | 3300041408 | Bacteria | 1194 |
| 862 | Ga0451787_042402 | 3300041441 | Bacteria | 748 |
| 863 | Ga0451793_1161307 | 3300041452 | Bacteria | 759 |
| 864 | Ga0451798_0509956 | 3300041458 | Bacteria | 840 |
| 865 | Ga0451798_0812166 | 3300041458 | Bacteria | 651 |
| 866 | Ga0451802_0969387 | 3300041460 | Bacteria | 606 |
| 867 | Ga0451833_0659560 | 3300041491 | Unclassified | 852 |
| 868 | Ga0451853_0376106 | 3300041512 | Unclassified | 723 |
| 869 | Ga0451853_3668395 | 3300041512 | Bacteria | 1447 |
| 870 | Ga0439441_001178 | 3300042001 | Bacteria | 3314 |
| 871 | Ga0439441_057238 | 3300042001 | Unclassified | 814 |
| 872 | Ga0439442_003138 | 3300042002 | Unclassified | 3268 |
| 873 | Ga0439443_011622 | 3300042003 | Unclassified | 1293 |
| 874 | Ga0439445_0043335 | 3300042004 | Bacteria | 1201 |
| 875 | Ga0439449_0014815 | 3300042007 | Bacteria | 2930 |
| 876 | Ga0439457_000827 | 3300042014 | Bacteria | 9289 |
| 877 | Ga0439462_0052773 | 3300042015 | Bacteria | 1094 |
| 878 | Ga0439446_0138484 | 3300042156 | Bacteria | 794 |
| 879 | Ga0451577_0191859 | 3300042876 | Unclassified | 1843 |
| 880 | Ga0466969_0000103 | 3300044656 | Bacteria | 44804 |
| 881 | Ga0466972_0000012 | 3300044658 | Bacteria | 246338 |
| 882 | Ga0466972_0000055 | 3300044658 | Bacteria | 111338 |
| 883 | Ga0466966_0000097 | 3300044684 | Bacteria | 53836 |
| 884 | Ga0466964_0114004 | 3300044706 | Bacteria | 1209 |
| 885 | Ga0453684_0127023 | 3300044712 | Unclassified | 3067 |
| 886 | Ga0453684_0321098 | 3300044712 | Bacteria | 1754 |
| 887 | Ga0453684_0506006 | 3300044712 | Bacteria | 1337 |
| 888 | Ga0466968_0181868 | 3300044735 | Bacteria | 978 |
| 889 | Ga0466970_0000661 | 3300044765 | Bacteria | 16929 |
| 890 | Ga0466957_0009079 | 3300044842 | Bacteria | 5667 |
| 891 | Ga0466957_0014317 | 3300044842 | Bacteria | 4618 |
| 892 | Ga0466960_0133182 | 3300044901 | Bacteria | 1314 |
| 893 | Ga0466959_0000049 | 3300045049 | Bacteria | 83496 |
| 894 | Ga0466959_0098950 | 3300045049 | Unclassified | 2089 |
| 895 | Ga0495592_0071330 | 3300046454 | Unclassified | 2529 |
| 896 | Ga0495580_0473783 | 3300046472 | Bacteria | 838 |
| 897 | Ga0495582_0401646 | 3300046473 | Unclassified | 790 |
| 898 | Ga0495582_0660730 | 3300046473 | Unclassified | 605 |
| 899 | Ga0495607_0481222 | 3300046501 | Bacteria | 553 |
| 900 | Ga0495606_0050331 | 3300046507 | Bacteria | 2726 |
| 901 | Ga0495606_0166272 | 3300046507 | Bacteria | 1283 |
| 902 | Ga0495610_0001236 | 3300046512 | Bacteria | 22946 |
| 903 | Ga0495630_0064883 | 3300046517 | Unclassified | 2744 |
| 904 | Ga0495630_0089950 | 3300046517 | Bacteria | 2319 |
| 905 | Ga0495630_0119858 | 3300046517 | Bacteria | 1996 |
| 906 | Ga0495630_0829498 | 3300046517 | Bacteria | 705 |
| 907 | Ga0495644_0183496 | 3300046523 | Bacteria | 805 |
| 908 | Ga0495666_0333421 | 3300046526 | Bacteria | 684 |
| 909 | Ga0495652_0122549 | 3300046529 | Bacteria | 2071 |
| 910 | Ga0495665_0268490 | 3300046531 | Bacteria | 876 |
| 911 | Ga0495586_0226369 | 3300046535 | Bacteria | 1063 |
| 912 | Ga0495586_0668487 | 3300046535 | Bacteria | 600 |
| 913 | Ga0495598_0267966 | 3300046537 | Bacteria | 638 |
| 914 | Ga0495609_0000025 | 3300046538 | Bacteria | 256898 |
| 915 | Ga0495609_0068116 | 3300046538 | Bacteria | 1566 |
| 916 | Ga0495621_0074559 | 3300046539 | Bacteria | 1255 |
| 917 | Ga0495633_0151290 | 3300046558 | Bacteria | 1072 |
| 918 | Ga0495668_0000489 | 3300046616 | Bacteria | 49613 |
| 919 | Ga0495668_0005239 | 3300046616 | Bacteria | 8883 |
| 920 | Ga0495634_0272909 | 3300046642 | Bacteria | 1029 |
| 921 | Ga0495635_0487075 | 3300046663 | Bacteria | 813 |
| 922 | Ga0495657_0396324 | 3300046675 | Bacteria | 813 |
| 923 | Ga0495658_0015643 | 3300046683 | Bacteria | 3893 |
| 924 | Ga0495604_0325939 | 3300047317 | Bacteria | 1026 |
| 925 | Ga0495604_0335894 | 3300047317 | Unclassified | 1007 |
| 926 | Ga0495674_0075977 | 3300047319 | Unclassified | 2890 |
| 927 | Ga0495674_0144101 | 3300047319 | Bacteria | 2001 |
| 928 | Ga0495674_0488483 | 3300047319 | Bacteria | 986 |
| 929 | Ga0495672_0020249 | 3300047320 | Unclassified | 4365 |
| 930 | Ga0495672_0084410 | 3300047320 | Bacteria | 1761 |
| 931 | Ga0495675_0525942 | 3300047444 | Unclassified | 677 |
| 932 | Ga0495684_0302795 | 3300047471 | Bacteria | 1148 |
| 933 | Ga0495686_0000309 | 3300047472 | Bacteria | 82637 |
| 934 | Ga0495686_0011789 | 3300047472 | Bacteria | 6151 |
| 935 | Ga0495686_0106369 | 3300047472 | Unclassified | 1687 |
| 936 | Ga0495602_0144639 | 3300048088 | Bacteria | 1878 |
| 937 | Ga0496101_1046228 | 3300048904 | Unclassified | 642 |
| 938 | Ga0496110_0111521 | 3300048913 | Unclassified | 2459 |
| 939 | Ga0496110_0351734 | 3300048913 | Unclassified | 1342 |
| 940 | Ga0496111_0542328 | 3300048914 | Unclassified | 854 |
| 941 | Ga0496118_0264875 | 3300048921 | Bacteria | 967 |
| 942 | Ga0496124_0086261 | 3300048927 | Unclassified | 2570 |
| 943 | Ga0501290_024755 | 3300049513 | Bacteria | 837 |
| 944 | Ga0501300_015794 | 3300049523 | Bacteria | 1102 |
| 945 | Ga0501031_0074568 | 3300049568 | Bacteria | 2209 |
| 946 | Ga0501032_0343630 | 3300049569 | Unclassified | 962 |
| 947 | Ga0501034_0009004 | 3300049571 | Bacteria | 10484 |
| 948 | Ga0501036_0135714 | 3300049572 | Bacteria | 2077 |
| 949 | Ga0501036_0346584 | 3300049572 | Bacteria | 1240 |
| 950 | Ga0501037_0014127 | 3300049573 | Bacteria | 5882 |
| 951 | Ga0501037_0105476 | 3300049573 | Bacteria | 2031 |
| 952 | Ga0501038_0097988 | 3300049574 | Unclassified | 2445 |
| 953 | Ga0501038_0108978 | 3300049574 | Unclassified | 2295 |
| 954 | Ga0501039_0118689 | 3300049575 | Unclassified | 2072 |
| 955 | Ga0501039_0183059 | 3300049575 | Bacteria | 1647 |
| 956 | Ga0501040_0119819 | 3300049576 | Unclassified | 1846 |
| 957 | Ga0501043_0128031 | 3300049579 | Bacteria | 1990 |
| 958 | Ga0501046_0650803 | 3300049580 | Bacteria | 745 |
| 959 | Ga0501047_0004068 | 3300049581 | Bacteria | 13756 |
| 960 | Ga0501047_0073419 | 3300049581 | Bacteria | 3294 |
| 961 | Ga0501047_0484911 | 3300049581 | Unclassified | 1064 |
| 962 | Ga0501249_054029 | 3300049679 | Bacteria | 924 |
| 963 | Ga0501257_018663 | 3300049686 | Bacteria | 1619 |
| 964 | Ga0501257_022946 | 3300049686 | Bacteria | 1478 |
| 965 | Ga0501225_0002922 | 3300049705 | Bacteria | 5247 |
| 966 | Ga0501225_0221027 | 3300049705 | Bacteria | 610 |
| 967 | Ga0501225_0367309 | 3300049705 | Bacteria | 501 |
| 968 | Ga0501083_0376495 | 3300049744 | Bacteria | 923 |
| 969 | Ga0501241_029653 | 3300049758 | Bacteria | 1030 |
| 970 | Ga0501035_0239732 | 3300049822 | Bacteria | 1543 |
| 971 | Ga0501044_0007058 | 3300049823 | Bacteria | 12361 |
| 972 | Ga0501044_0022983 | 3300049823 | Bacteria | 6636 |
| 973 | Ga0501044_0033123 | 3300049823 | Bacteria | 5430 |
| 974 | nmdc:mga03683_538042_c1 | 3300050489 | Bacteria | 568 |
| 975 | nmdc:mga0k408_32475_c1 | 3300050493 | Bacteria | 2982 |
| 976 | nmdc:mga0k408_42881_c1 | 3300050493 | Unclassified | 2606 |
| 977 | nmdc:mga0k408_50920_c1 | 3300050493 | Unclassified | 2398 |
| 978 | nmdc:mga07m45_789462_c1 | 3300050496 | Unclassified | 544 |
| 979 | nmdc:mga05p37_20024_c2 | 3300050507 | Bacteria | 7172 |
| 980 | nmdc:mga05p37_359497_c1 | 3300050507 | Bacteria | 1712 |
| 981 | nmdc:mga09592_13499_c1 | 3300050508 | Bacteria | 6672 |
| 982 | nmdc:mga09592_28065_c1 | 3300050508 | Bacteria | 4674 |
| 983 | nmdc:mga0qj67_9692_c1 | 3300050509 | Bacteria | 7174 |
| 984 | nmdc:mga06r32_402761_c1 | 3300050510 | Bacteria | 1350 |
| 985 | nmdc:mga06r32_807494_c1 | 3300050510 | Bacteria | 898 |
| 986 | nmdc:mga06r32_844003_c1 | 3300050510 | Bacteria | 875 |
| 987 | nmdc:mga08y16_1501114_c1 | 3300050511 | Unclassified | 634 |
| 988 | nmdc:mga08y16_1919537_c1 | 3300050511 | Unclassified | 543 |
| 989 | nmdc:mga08y16_228835_c1 | 3300050511 | Bacteria | 1923 |
| 990 | nmdc:mga08y16_251855_c1 | 3300050511 | Bacteria | 1825 |
| 991 | nmdc:mga08y16_449092_c1 | 3300050511 | Bacteria | 1315 |
| 992 | nmdc:mga08y16_55351_c1 | 3300050511 | Bacteria | 4145 |
| 993 | nmdc:mga08y16_81001_c1 | 3300050511 | Bacteria | 3385 |
| 994 | nmdc:mga0n895_283166_c1 | 3300050512 | Bacteria | 1681 |
| 995 | Ga0495619_0280862 | 3300053085 | Bacteria | 1154 |
| 996 | Ga0500578_0000934 | 3300053086 | Bacteria | 32814 |
| 997 | Ga0500644_0006068 | 3300053088 | Bacteria | 3079 |
| 998 | Ga0500644_0146434 | 3300053088 | Unclassified | 943 |
| 999 | Ga0500562_000010 | 3300053108 | Bacteria | 183815 |
| 1000 | Ga0500559_0043057 | 3300053136 | Bacteria | 1972 |
| 1001 | Ga0500568_0170281 | 3300053139 | Unclassified | 802 |
| 1002 | Ga0500616_0015278 | 3300053153 | Bacteria | 4394 |
| 1003 | Ga0500616_0084695 | 3300053153 | Bacteria | 1585 |
| 1004 | Ga0500636_0268542 | 3300053177 | Bacteria | 859 |
| 1005 | Ga0500611_000002 | 3300053727 | Bacteria | 345991 |
| 1006 | Ga0500645_019448 | 3300053730 | Bacteria | 2112 |
| 1007 | 2586209277 | 2585427687 | Bacteria | 5544917 |
| 1008 | 2738727299 | 2738541278 | Bacteria | 9755573 |
| 1009 | 2739590196 | 2739367651 | Bacteria | 6359826 |
| 1010 | 2739615988 | 2739367656 | Bacteria | 5152243 |
| 1011 | 2819588344 | 2818991444 | Bacteria | 6968812 |
| 1012 | 2842723021 | 2842722452 | Bacteria | 6263924 |
| 1013 | 2842913977 | 2842909656 | Bacteria | 6185908 |
| 1014 | 2849283718 | 2849281842 | Bacteria | 6065644 |
| 1015 | 2857628527 | 2857627736 | Bacteria | 5625397 |
| 1016 | 2884636423 | 2884634485 | Bacteria | 3928637 |
| 1017 | 2945999995 | 2945997725 | Bacteria | 6404843 |
| 1018 | 2954016594 | 2954016120 | Bacteria | 6446024 |
| 1019 | 2977245474 | 2977243572 | Bacteria | 4374394 |
| 1020 | Ga0163162_10263899 | |||
| 1021 | JGI25150J39212_1000001 | |||
| 1022 | JGI25151J46595_10000001 | |||
| 1023 | JGI25153J46596_10000001 | |||
| 1024 | rootH1_10053600 | |||
| 1025 | rootH2_10190875 | |||
| 1026 | rootL2_10264365 | |||
| 1027 | rootL2_10293189 | |||
| 1028 | rootH1_10000181 | |||
| 1029 | rootH1_10054153 | |||
| 1030 | rootH1_10150505 | |||
| 1031 | rootH1_10244305 | |||
| 1032 | Ga0055536_1000049 | |||
| 1033 | Ga0055530_10002378 | |||
| 1034 | Ga0065714_10105041 | |||
| 1035 | Ga0065714_10143233 | |||
| 1036 | Ga0065714_10166575 | |||
| 1037 | Ga0065714_10274671 | |||
| 1038 | Ga0065714_10415037 | |||
| 1039 | Ga0065704_10090452 | |||
| 1040 | Ga0065704_10091501 | |||
| 1041 | Ga0065704_10225333 | |||
| 1042 | Ga0065704_10407427 | |||
| 1043 | Ga0065712_10029553 | |||
| 1044 | Ga0065712_10105332 | |||
| 1045 | Ga0065712_10112518 | |||
| 1046 | Ga0065712_10184667 | |||
| 1047 | Ga0065712_10341352 | |||
| 1048 | Ga0065712_10451977 | |||
| 1049 | Ga0065712_10624182 | |||
| 1050 | Ga0065715_10342428 | |||
| 1051 | Ga0065715_10794894 | |||
| 1052 | Ga0065707_10213588 | |||
| 1053 | Ga0065707_11014821 | |||
| 1054 | Ga0070658_10356901 | |||
| 1055 | Ga0070658_10666312 | |||
| 1056 | Ga0070658_11026603 | |||
| 1057 | Ga0070658_11537467 | |||
| 1058 | Ga0070676_10006273 | |||
| 1059 | Ga0070676_10006346 | |||
| 1060 | Ga0070676_10014248 | |||
| 1061 | Ga0070676_10035984 | |||
| 1062 | Ga0070676_10082262 | |||
| 1063 | Ga0070676_10184920 | |||
| 1064 | Ga0070683_100000884 | |||
| 1065 | Ga0070683_100002198 | |||
| 1066 | Ga0070683_100006866 | |||
| 1067 | Ga0070683_100029414 | |||
| 1068 | Ga0070683_100330631 | |||
| 1069 | Ga0070683_100767271 | |||
| 1070 | Ga0070683_101118224 | |||
| 1071 | Ga0070690_100030587 | |||
| 1072 | Ga0070690_100138734 | |||
| 1073 | Ga0070690_100903427 | |||
| 1074 | Ga0070670_100038715 | |||
| 1075 | Ga0070670_100071381 | |||
| 1076 | Ga0070670_100079675 | |||
| 1077 | Ga0070670_100090886 | |||
| 1078 | Ga0070670_100136497 | |||
| 1079 | Ga0070670_100161718 | |||
| 1080 | Ga0070670_100170053 | |||
| 1081 | Ga0070670_100179924 | |||
| 1082 | Ga0070670_100188955 | |||
| 1083 | Ga0070670_100433475 | |||
| 1084 | Ga0070670_100705587 | |||
| 1085 | Ga0070670_100849121 | |||
| 1086 | Ga0070670_101098515 | |||
| 1087 | Ga0070670_101989193 | |||
| 1088 | Ga0070677_10093803 | |||
| 1089 | Ga0070677_10104953 | |||
| 1090 | Ga0068869_100032681 | |||
| 1091 | Ga0068869_100079604 | |||
| 1092 | Ga0068869_100346436 | |||
| 1093 | Ga0068869_100403661 | |||
| 1094 | Ga0068869_100420282 | |||
| 1095 | Ga0068869_101392285 | |||
| 1096 | Ga0070666_10009022 | |||
| 1097 | Ga0070666_10150195 | |||
| 1098 | Ga0070666_10349275 | |||
| 1099 | Ga0070666_10894214 | |||
| 1100 | Ga0070680_100023470 | |||
| 1101 | Ga0070682_100002796 | |||
| 1102 | Ga0070682_100009802 | |||
| 1103 | Ga0070682_100574770 | |||
| 1104 | Ga0070682_100980691 | |||
| 1105 | Ga0070682_101203970 | |||
| 1106 | Ga0068868_100019618 | |||
| 1107 | Ga0068868_100024597 | |||
| 1108 | Ga0068868_100029146 | |||
| 1109 | Ga0068868_100139554 | |||
| 1110 | Ga0068868_100360934 | |||
| 1111 | Ga0068868_100390339 | |||
| 1112 | Ga0068868_100509856 | |||
| 1113 | Ga0070660_100025895 | |||
| 1114 | Ga0070660_100165681 | |||
| 1115 | Ga0070689_100008890 | |||
| 1116 | Ga0070689_100056139 | |||
| 1117 | Ga0070689_100066838 | |||
| 1118 | Ga0070689_100170158 | |||
| 1119 | Ga0070689_100885230 | |||
| 1120 | Ga0070689_100973196 | |||
| 1121 | Ga0070689_101517759 | |||
| 1122 | Ga0070691_10001334 | |||
| 1123 | Ga0070687_100217812 | |||
| 1124 | Ga0070687_100815374 | |||
| 1125 | Ga0070661_100001199 | |||
| 1126 | Ga0070661_100169617 | |||
| 1127 | Ga0070661_100290147 | |||
| 1128 | Ga0070661_101088717 | |||
| 1129 | Ga0070661_101362213 | |||
| 1130 | Ga0070668_100005828 | |||
| 1131 | Ga0070668_100050217 | |||
| 1132 | Ga0070668_100211590 | |||
| 1133 | Ga0070668_101331949 | |||
| 1134 | Ga0070669_100021823 | |||
| 1135 | Ga0070669_100038346 | |||
| 1136 | Ga0070669_100038810 | |||
| 1137 | Ga0070669_100137279 | |||
| 1138 | Ga0070669_100206513 | |||
| 1139 | Ga0070675_100055610 | |||
| 1140 | Ga0070675_100075014 | |||
| 1141 | Ga0070675_100256189 | |||
| 1142 | Ga0070675_100421802 | |||
| 1143 | Ga0070675_100665980 | |||
| 1144 | Ga0070675_100682108 | |||
| 1145 | Ga0070675_101797255 | |||
| 1146 | Ga0070671_100104453 | |||
| 1147 | Ga0070671_100157818 | |||
| 1148 | Ga0070671_100322607 | |||
| 1149 | Ga0070671_100351174 | |||
| 1150 | Ga0070671_100514063 | |||
| 1151 | Ga0070671_100809958 | |||
| 1152 | Ga0070671_100851802 | |||
| 1153 | Ga0070674_100002262 | |||
| 1154 | Ga0070674_100220221 | |||
| 1155 | Ga0070674_101633353 | |||
| 1156 | Ga0070673_100017076 | |||
| 1157 | Ga0070673_100028166 | |||
| 1158 | Ga0070673_100034436 | |||
| 1159 | Ga0070673_100222754 | |||
| 1160 | Ga0070673_100341093 | |||
| 1161 | Ga0070673_100393675 | |||
| 1162 | Ga0070673_100425301 | |||
| 1163 | Ga0070688_100065171 | |||
| 1164 | Ga0070688_100094197 | |||
| 1165 | Ga0070688_100112375 | |||
| 1166 | Ga0070688_100259140 | |||
| 1167 | Ga0070688_100459320 | |||
| 1168 | Ga0070688_100818293 | |||
| 1169 | Ga0070688_100897212 | |||
| 1170 | Ga0070659_100002681 | |||
| 1171 | Ga0070659_100374152 | |||
| 1172 | Ga0070667_100008921 | |||
| 1173 | Ga0070667_100044780 | |||
| 1174 | Ga0070667_100285969 | |||
| 1175 | Ga0070667_100322357 | |||
| 1176 | Ga0070667_100387567 | |||
| 1177 | Ga0070667_100454645 | |||
| 1178 | Ga0070667_100941170 | |||
| 1179 | Ga0070667_101099550 | |||
| 1180 | Ga0070667_101117632 | |||
| 1181 | Ga0070700_100212574 | |||
| 1182 | Ga0070700_100311240 | |||
| 1183 | Ga0070708_101545923 | |||
| 1184 | Ga0070663_100130815 | |||
| 1185 | Ga0070663_100179024 | |||
| 1186 | Ga0070663_100382812 | |||
| 1187 | Ga0070663_100612015 | |||
| 1188 | Ga0070678_100068363 | |||
| 1189 | Ga0070678_100280384 | |||
| 1190 | Ga0070678_100994860 | |||
| 1191 | Ga0070678_101557452 | |||
| 1192 | Ga0070662_100080932 | |||
| 1193 | Ga0070681_10103173 | |||
| 1194 | Ga0068867_100003798 | |||
| 1195 | Ga0068867_100015472 | |||
| 1196 | Ga0068867_100088556 | |||
| 1197 | Ga0068867_100228530 | |||
| 1198 | Ga0068867_100258565 | |||
| 1199 | Ga0068867_100328520 | |||
| 1200 | Ga0068867_100445586 | |||
| 1201 | Ga0068867_100771679 | |||
| 1202 | Ga0068867_101230353 | |||
| 1203 | Ga0068867_101815760 | |||
| 1204 | Ga0070685_10024684 | |||
| 1205 | Ga0070685_10064012 | |||
| 1206 | Ga0070685_10130977 | |||
| 1207 | Ga0070685_10369176 | |||
| 1208 | Ga0070685_10476729 | |||
| 1209 | Ga0070685_11014295 | |||
| 1210 | Ga0070698_100000645 | |||
| 1211 | Ga0070698_100008979 | |||
| 1212 | Ga0070698_100019854 | |||
| 1213 | Ga0070698_100140783 | |||
| 1214 | Ga0070698_100326179 | |||
| 1215 | Ga0070699_101620087 | |||
| 1216 | Ga0070679_100141159 | |||
| 1217 | Ga0070684_100000298 | |||
| 1218 | Ga0070684_100000731 | |||
| 1219 | Ga0070684_100022231 | |||
| 1220 | Ga0070684_100255794 | |||
| 1221 | Ga0068853_100003450 | |||
| 1222 | Ga0068853_100052550 | |||
| 1223 | Ga0068853_100066002 | |||
| 1224 | Ga0068853_100914221 | |||
| 1225 | Ga0070672_100027429 | |||
| 1226 | Ga0070672_100041352 | |||
| 1227 | Ga0070672_100051699 | |||
| 1228 | Ga0070672_100215575 | |||
| 1229 | Ga0070672_100691284 | |||
| 1230 | Ga0070672_101250206 | |||
| 1231 | Ga0070672_101251864 | |||
| 1232 | Ga0070672_101354764 | |||
| 1233 | Ga0070672_101393976 | |||
| 1234 | Ga0070693_100020989 | |||
| 1235 | Ga0070693_100478637 | |||
| 1236 | Ga0070665_100016621 | |||
| 1237 | Ga0070665_100057795 | |||
| 1238 | Ga0070665_101017656 | |||
| 1239 | Ga0070665_101097011 | |||
| 1240 | Ga0070665_101677084 | |||
| 1241 | Ga0070704_100517298 | |||
| 1242 | Ga0070704_100735393 | |||
| 1243 | Ga0068855_100063789 | |||
| 1244 | Ga0068855_100306408 | |||
| 1245 | Ga0068855_100496220 | |||
| 1246 | Ga0070664_100000884 | |||
| 1247 | Ga0070664_100073067 | |||
| 1248 | Ga0070664_100114267 | |||
| 1249 | Ga0070664_100167746 | |||
| 1250 | Ga0070664_100208954 | |||
| 1251 | Ga0070664_100295760 | |||
| 1252 | Ga0070664_100407187 | |||
| 1253 | Ga0070664_100452610 | |||
| 1254 | Ga0068857_100001112 | |||
| 1255 | Ga0068857_100210581 | |||
| 1256 | Ga0068857_100264695 | |||
| 1257 | Ga0068857_100367708 | |||
| 1258 | Ga0068857_100509685 | |||
| 1259 | Ga0068857_101046206 | |||
| 1260 | Ga0068854_100048477 | |||
| 1261 | Ga0068854_100224693 | |||
| 1262 | Ga0068854_100460605 | |||
| 1263 | Ga0068854_102037084 | |||
| 1264 | Ga0068856_100030139 | |||
| 1265 | Ga0070702_100404723 | |||
| 1266 | Ga0070702_101511161 | |||
| 1267 | Ga0068852_100072020 | |||
| 1268 | Ga0068852_100131631 | |||
| 1269 | Ga0068852_100139480 | |||
| 1270 | Ga0068852_100223628 | |||
| 1271 | Ga0068852_100457373 | |||
| 1272 | Ga0068852_100895315 | |||
| 1273 | Ga0068852_101179371 | |||
| 1274 | Ga0068859_100004404 | |||
| 1275 | Ga0068859_100075284 | |||
| 1276 | Ga0068859_100108016 | |||
| 1277 | Ga0068859_100124092 | |||
| 1278 | Ga0068859_100214701 | |||
| 1279 | Ga0068859_100229380 | |||
| 1280 | Ga0068859_100304305 | |||
| 1281 | Ga0068859_100304908 | |||
| 1282 | Ga0068859_100671669 | |||
| 1283 | Ga0068859_100693113 | |||
| 1284 | Ga0068859_101083943 | |||
| 1285 | Ga0068859_101604169 | |||
| 1286 | Ga0068864_100004501 | |||
| 1287 | Ga0068864_100053139 | |||
| 1288 | Ga0068864_100093526 | |||
| 1289 | Ga0068864_100245416 | |||
| 1290 | Ga0068864_100254652 | |||
| 1291 | Ga0068864_100271715 | |||
| 1292 | Ga0068864_100373124 | |||
| 1293 | Ga0068864_100445220 | |||
| 1294 | Ga0068864_100945805 | |||
| 1295 | Ga0068866_10105036 | |||
| 1296 | Ga0068866_10341620 | |||
| 1297 | Ga0068866_10471334 | |||
| 1298 | Ga0068861_100002289 | |||
| 1299 | Ga0068861_100004874 | |||
| 1300 | Ga0068861_100056095 | |||
| 1301 | Ga0068861_100266584 | |||
| 1302 | Ga0068861_100643567 | |||
| 1303 | Ga0068861_101214280 | |||
| 1304 | Ga0068851_10007629 | |||
| 1305 | Ga0068851_10045339 | |||
| 1306 | Ga0068851_10408476 | |||
| 1307 | Ga0068870_10007133 | |||
| 1308 | Ga0068870_10039824 | |||
| 1309 | Ga0068870_10186277 | |||
| 1310 | Ga0068863_100021002 | |||
| 1311 | Ga0068863_100112697 | |||
| 1312 | Ga0068863_100131005 | |||
| 1313 | Ga0068863_100251085 | |||
| 1314 | Ga0068863_100297431 | |||
| 1315 | Ga0068863_100310402 | |||
| 1316 | Ga0068863_100597451 | |||
| 1317 | Ga0068863_100843924 | |||
| 1318 | Ga0068863_100947352 | |||
| 1319 | Ga0068863_100953563 | |||
| 1320 | Ga0068863_101000882 | |||
| 1321 | Ga0068863_101544605 | |||
| 1322 | Ga0068858_100035184 | |||
| 1323 | Ga0068858_100129440 | |||
| 1324 | Ga0068858_100426769 | |||
| 1325 | Ga0068858_100477133 | |||
| 1326 | Ga0068858_100717233 | |||
| 1327 | Ga0068858_102145998 | |||
| 1328 | Ga0068860_100039308 | |||
| 1329 | Ga0068860_100066104 | |||
| 1330 | Ga0068860_100215946 | |||
| 1331 | Ga0068860_100216549 | |||
| 1332 | Ga0068860_100332966 | |||
| 1333 | Ga0068860_100362646 | |||
| 1334 | Ga0068860_100436720 | |||
| 1335 | Ga0068860_100440244 | |||
| 1336 | Ga0068860_100522898 | |||
| 1337 | Ga0068860_102133210 | |||
| 1338 | Ga0068860_102198580 | |||
| 1339 | Ga0068862_100008657 | |||
| 1340 | Ga0068862_100050350 | |||
| 1341 | Ga0068862_100154765 | |||
| 1342 | Ga0068862_100246618 | |||
| 1343 | Ga0068862_100368944 | |||
| 1344 | Ga0068862_100763185 | |||
| 1345 | Ga0075366_10028830 | |||
| 1346 | Ga0075366_10090286 | |||
| 1347 | Ga0075366_10409239 | |||
| 1348 | Ga0097621_100006252 | |||
| 1349 | Ga0097621_100036651 | |||
| 1350 | Ga0097621_100150295 | |||
| 1351 | Ga0097621_100418028 | |||
| 1352 | Ga0097621_100493333 | |||
| 1353 | Ga0097621_100964397 | |||
| 1354 | Ga0097621_101449434 | |||
| 1355 | Ga0097621_101937953 | |||
| 1356 | Ga0068871_100028294 | |||
| 1357 | Ga0068871_100094846 | |||
| 1358 | Ga0068871_100359833 | |||
| 1359 | Ga0068871_100376721 | |||
| 1360 | Ga0068871_100686995 | |||
| 1361 | Ga0068871_100955658 | |||
| 1362 | Ga0068871_101984683 | |||
| 1363 | Ga0075428_100006620 | |||
| 1364 | Ga0075428_100120899 | |||
| 1365 | Ga0075431_100302401 | |||
| 1366 | Ga0075431_100544290 | |||
| 1367 | Ga0075431_100827605 | |||
| 1368 | Ga0075434_100542930 | |||
| 1369 | Ga0075429_100006687 | |||
| 1370 | Ga0068865_100007780 | |||
| 1371 | Ga0068865_100136220 | |||
| 1372 | Ga0068865_100522607 | |||
| 1373 | Ga0068865_100685092 | |||
| 1374 | Ga0068865_101421373 | |||
| 1375 | Ga0097620_100004404 | |||
| 1376 | Ga0097620_100075283 | |||
| 1377 | Ga0097620_100108014 | |||
| 1378 | Ga0097620_100124090 | |||
| 1379 | Ga0097620_100214718 | |||
| 1380 | Ga0097620_100229387 | |||
| 1381 | Ga0097620_100304303 | |||
| 1382 | Ga0097620_100304931 | |||
| 1383 | Ga0097620_100671662 | |||
| 1384 | Ga0097620_100693110 | |||
| 1385 | Ga0097620_101084175 | |||
| 1386 | Ga0097620_101604142 | |||
| 1387 | Ga0105251_10137987 | |||
| 1388 | Ga0105240_10128066 | |||
| 1389 | Ga0105240_10781773 | |||
| 1390 | Ga0111539_10013360 | |||
| 1391 | Ga0111539_10032439 | |||
| 1392 | Ga0111539_10067124 | |||
| 1393 | Ga0111539_10220240 | |||
| 1394 | Ga0111539_10246021 | |||
| 1395 | Ga0111539_11103185 | |||
| 1396 | Ga0111539_11709038 | |||
| 1397 | Ga0105245_10567915 | |||
| 1398 | Ga0105245_11409426 | |||
| 1399 | Ga0105247_10000726 | |||
| 1400 | Ga0105247_10247903 | |||
| 1401 | Ga0105247_10262322 | |||
| 1402 | Ga0114129_10003569 | |||
| 1403 | Ga0114129_10114463 | |||
| 1404 | Ga0114129_10247648 | |||
| 1405 | Ga0114129_12124285 | |||
| 1406 | Ga0105243_11259514 | |||
| 1407 | Ga0105243_12064240 | |||
| 1408 | Ga0105241_10039119 | |||
| 1409 | Ga0105241_10070874 | |||
| 1410 | Ga0105241_10210813 | |||
| 1411 | Ga0105241_10515675 | |||
| 1412 | Ga0105241_10557781 | |||
| 1413 | Ga0105241_10633758 | |||
| 1414 | Ga0105242_10025664 | |||
| 1415 | Ga0105242_10041753 | |||
| 1416 | Ga0105242_10064334 | |||
| 1417 | Ga0105242_10077674 | |||
| 1418 | Ga0105242_10145021 | |||
| 1419 | Ga0105242_10177261 | |||
| 1420 | Ga0105242_10518059 | |||
| 1421 | Ga0105242_10654933 | |||
| 1422 | Ga0105242_10675525 | |||
| 1423 | Ga0105242_10833908 | |||
| 1424 | Ga0105242_11039062 | |||
| 1425 | Ga0105242_11119214 | |||
| 1426 | Ga0105248_10184560 | |||
| 1427 | Ga0105248_11053959 | |||
| 1428 | Ga0105237_10012365 | |||
| 1429 | Ga0105237_10145977 | |||
| 1430 | Ga0105237_11610442 | |||
| 1431 | Ga0105238_11282734 | |||
| 1432 | Ga0105249_10001240 | |||
| 1433 | Ga0105249_10010036 | |||
| 1434 | Ga0105249_10015498 | |||
| 1435 | Ga0105249_10020990 | |||
| 1436 | Ga0105249_10068305 | |||
| 1437 | Ga0105249_10154060 | |||
| 1438 | Ga0105249_10196662 | |||
| 1439 | Ga0105249_10385708 | |||
| 1440 | Ga0105249_10410106 | |||
| 1441 | Ga0105249_10505328 | |||
| 1442 | Ga0105239_10006184 | |||
| 1443 | Ga0105239_10120110 | |||
| 1444 | Ga0105239_10156948 | |||
| 1445 | Ga0105239_10319849 | |||
| 1446 | Ga0105239_10606324 | |||
| 1447 | Ga0105239_11922873 | |||
| 1448 | Ga0105246_10087749 | |||
| 1449 | Ga0105246_10187786 | |||
| 1450 | Ga0105246_10549492 | |||
| 1451 | Ga0105246_10562040 | |||
| 1452 | Ga0105246_10645339 | |||
| 1453 | Ga0105246_10683687 | |||
| 1454 | Ga0157373_10025044 | |||
| 1455 | Ga0157373_10050175 | |||
| 1456 | Ga0157373_10066048 | |||
| 1457 | Ga0157373_10295262 | |||
| 1458 | Ga0157373_10938817 | |||
| 1459 | Ga0157371_10000119 | |||
| 1460 | Ga0157371_10003679 | |||
| 1461 | Ga0157371_10015182 | |||
| 1462 | Ga0157371_10028476 | |||
| 1463 | Ga0157371_10081579 | |||
| 1464 | Ga0157371_10406661 | |||
| 1465 | Ga0157371_10450674 | |||
| 1466 | Ga0157370_10030052 | |||
| 1467 | Ga0157370_10033654 | |||
| 1468 | Ga0157370_10265726 | |||
| 1469 | Ga0157370_10416454 | |||
| 1470 | Ga0157370_10459668 | |||
| 1471 | Ga0157370_10503203 | |||
| 1472 | Ga0157370_10507602 | |||
| 1473 | Ga0157370_10575848 | |||
| 1474 | Ga0157370_10735814 | |||
| 1475 | Ga0157370_10842792 | |||
| 1476 | Ga0157369_10000015 | |||
| 1477 | Ga0157369_10322555 | |||
| 1478 | Ga0157369_10411950 | |||
| 1479 | Ga0157369_10421462 | |||
| 1480 | Ga0157374_10000955 | |||
| 1481 | Ga0157374_10055794 | |||
| 1482 | Ga0157374_10200871 | |||
| 1483 | Ga0157374_10275185 | |||
| 1484 | Ga0157374_10369768 | |||
| 1485 | Ga0157374_10447887 | |||
| 1486 | Ga0157374_11544754 | |||
| 1487 | Ga0157374_11657892 | |||
| 1488 | Ga0157378_10002905 | |||
| 1489 | Ga0157378_10066840 | |||
| 1490 | Ga0157378_10082393 | |||
| 1491 | Ga0157378_10092687 | |||
| 1492 | Ga0157378_10170532 | |||
| 1493 | Ga0157378_10190987 | |||
| 1494 | Ga0157378_10237149 | |||
| 1495 | Ga0157378_10333369 | |||
| 1496 | Ga0157378_10661608 | |||
| 1497 | Ga0157378_10962941 | |||
| 1498 | Ga0157378_11549208 | |||
| 1499 | Ga0163162_10000705 | |||
| 1500 | Ga0163162_10042164 | |||
| 1501 | Ga0163162_10068699 | |||
| 1502 | Ga0163162_10166333 | |||
| 1503 | Ga0163162_10173453 | |||
| 1504 | Ga0163162_10244214 | |||
| 1505 | Ga0163162_10317383 | |||
| 1506 | Ga0163162_10318254 | |||
| 1507 | Ga0163162_10410055 | |||
| 1508 | Ga0163162_10492466 | |||
| 1509 | Ga0163162_10803852 | |||
| 1510 | Ga0163162_10803864 | |||
| 1511 | Ga0163162_10857042 | |||
| 1512 | Ga0163162_10985075 | |||
| 1513 | Ga0157372_10053750 | |||
| 1514 | Ga0157372_10188694 | |||
| 1515 | Ga0157372_10206085 | |||
| 1516 | Ga0157372_10381973 | |||
| 1517 | Ga0157372_10387543 | |||
| 1518 | Ga0157372_10702646 | |||
| 1519 | Ga0157375_10002578 | |||
| 1520 | Ga0157375_10018939 | |||
| 1521 | Ga0157375_10042379 | |||
| 1522 | Ga0157375_10072939 | |||
| 1523 | Ga0157375_10296600 | |||
| 1524 | Ga0157375_10409309 | |||
| 1525 | Ga0157375_10416386 | |||
| 1526 | Ga0157375_10524470 | |||
| 1527 | Ga0157375_10579078 | |||
| 1528 | Ga0157375_10686151 | |||
| 1529 | Ga0157375_10706200 | |||
| 1530 | Ga0157375_10804328 | |||
| 1531 | Ga0157375_11207623 | |||
| 1532 | Ga0157375_11327413 | |||
| 1533 | Ga0157375_11342922 | |||
| 1534 | Ga0163163_10000075 | |||
| 1535 | Ga0163163_10003651 | |||
| 1536 | Ga0163163_10051116 | |||
| 1537 | Ga0163163_10057069 | |||
| 1538 | Ga0163163_10235166 | |||
| 1539 | Ga0163163_12347744 | |||
| 1540 | Ga0163163_12364570 | |||
| 1541 | Ga0163163_12691298 | |||
| 1542 | Ga0157380_10015138 | |||
| 1543 | Ga0157380_10022281 | |||
| 1544 | Ga0157380_10029842 | |||
| 1545 | Ga0157380_10127062 | |||
| 1546 | Ga0157380_10158898 | |||
| 1547 | Ga0157380_10614001 | |||
| 1548 | Ga0157380_11189433 | |||
| 1549 | Ga0157380_11429565 | |||
| 1550 | Ga0157380_12043816 | |||
| 1551 | Ga0157380_12119135 | |||
| 1552 | Ga0182008_10389072 | |||
| 1553 | Ga0157377_10040530 | |||
| 1554 | Ga0157377_10161590 | |||
| 1555 | Ga0157377_10270941 | |||
| 1556 | Ga0157377_10394916 | |||
| 1557 | Ga0157379_10040212 | |||
| 1558 | Ga0157379_10119098 | |||
| 1559 | Ga0157379_10241637 | |||
| 1560 | Ga0157379_10477251 | |||
| 1561 | Ga0157379_10548316 | |||
| 1562 | Ga0157379_10797736 | |||
| 1563 | Ga0157379_11044122 | |||
| 1564 | Ga0157376_10018590 | |||
| 1565 | Ga0157376_10093092 | |||
| 1566 | Ga0157376_10127726 | |||
| 1567 | Ga0157376_10181832 | |||
| 1568 | Ga0157376_10262818 | |||
| 1569 | Ga0157376_10277377 | |||
| 1570 | Ga0157376_10309012 | |||
| 1571 | Ga0157376_10498432 | |||
| 1572 | Ga0157376_11702982 | |||
| 1573 | Ga0182006_1000091 | |||
| 1574 | Ga0182006_1000957 | |||
| 1575 | Ga0182006_1001651 | |||
| 1576 | Ga0182007_10000010 | |||
| 1577 | Ga0182007_10148461 | |||
| 1578 | Ga0163161_10000046 | |||
| 1579 | Ga0163161_10000890 | |||
| 1580 | Ga0163161_10002168 | |||
| 1581 | Ga0163161_10004792 | |||
| 1582 | Ga0163161_10231168 | |||
| 1583 | Ga0163161_10277361 | |||
| 1584 | Ga0163161_10335287 | |||
| 1585 | Ga0163161_10410025 | |||
| 1586 | Ga0163161_11143908 | |||
| 1587 | Ga0207425_1000002 | |||
| 1588 | Ga0209646_1009276 | |||
| 1589 | Ga0209129_1000002 | |||
| 1590 | Ga0207666_1014067 | |||
| 1591 | Ga0209676_1000001 | |||
| 1592 | Ga0209025_1000004 | |||
| 1593 | Ga0209758_1000006 | |||
| 1594 | Ga0209050_1000258 | |||
| 1595 | Ga0207697_10044155 | |||
| 1596 | Ga0207697_10064655 | |||
| 1597 | Ga0207697_10190333 | |||
| 1598 | Ga0207656_10060635 | |||
| 1599 | Ga0207656_10185330 | |||
| 1600 | Ga0207656_10253863 | |||
| 1601 | Ga0207682_10065085 | |||
| 1602 | Ga0207682_10139110 | |||
| 1603 | Ga0207642_10027412 | |||
| 1604 | Ga0207642_10038175 | |||
| 1605 | Ga0207642_10633404 | |||
| 1606 | Ga0207710_10000852 | |||
| 1607 | Ga0207688_10013484 | |||
| 1608 | Ga0207680_10029382 | |||
| 1609 | Ga0207680_10220506 | |||
| 1610 | Ga0207680_10801572 | |||
| 1611 | Ga0207680_11050456 | |||
| 1612 | Ga0207647_10088228 | |||
| 1613 | Ga0207685_10282761 | |||
| 1614 | Ga0207645_10001934 | |||
| 1615 | Ga0207645_10005381 | |||
| 1616 | Ga0207645_10026908 | |||
| 1617 | Ga0207645_10048324 | |||
| 1618 | Ga0207645_10874100 | |||
| 1619 | Ga0207643_10005138 | |||
| 1620 | Ga0207643_10008586 | |||
| 1621 | Ga0207643_10030001 | |||
| 1622 | Ga0207705_10549346 | |||
| 1623 | Ga0207705_10828653 | |||
| 1624 | Ga0207654_10093825 | |||
| 1625 | Ga0207654_10228348 | |||
| 1626 | Ga0207707_10068501 | |||
| 1627 | Ga0207695_10071967 | |||
| 1628 | Ga0207695_10634553 | |||
| 1629 | Ga0207671_10099919 | |||
| 1630 | Ga0207671_10356189 | |||
| 1631 | Ga0207660_10003834 | |||
| 1632 | Ga0207662_10021709 | |||
| 1633 | Ga0207662_10238866 | |||
| 1634 | Ga0207662_10952016 | |||
| 1635 | Ga0207657_10039267 | |||
| 1636 | Ga0207657_10043943 | |||
| 1637 | Ga0207649_10005426 | |||
| 1638 | Ga0207649_10788019 | |||
| 1639 | Ga0207652_10018838 | |||
| 1640 | Ga0207646_10763564 | |||
| 1641 | Ga0207681_10020255 | |||
| 1642 | Ga0207681_10063936 | |||
| 1643 | Ga0207681_10103637 | |||
| 1644 | Ga0207681_10258980 | |||
| 1645 | Ga0207681_10357531 | |||
| 1646 | Ga0207650_10022251 | |||
| 1647 | Ga0207650_10057288 | |||
| 1648 | Ga0207650_10109524 | |||
| 1649 | Ga0207650_10140545 | |||
| 1650 | Ga0207650_10215846 | |||
| 1651 | Ga0207650_10287669 | |||
| 1652 | Ga0207650_10297257 | |||
| 1653 | Ga0207650_10459995 | |||
| 1654 | Ga0207650_10512948 | |||
| 1655 | Ga0207659_10028420 | |||
| 1656 | Ga0207659_10050201 | |||
| 1657 | Ga0207659_10183573 | |||
| 1658 | Ga0207659_11500238 | |||
| 1659 | Ga0207687_10902367 | |||
| 1660 | Ga0207644_10037282 | |||
| 1661 | Ga0207644_10048838 | |||
| 1662 | Ga0207644_10261815 | |||
| 1663 | Ga0207644_10351113 | |||
| 1664 | Ga0207644_10439415 | |||
| 1665 | Ga0207644_10690339 | |||
| 1666 | Ga0207690_10033205 | |||
| 1667 | Ga0207690_10058128 | |||
| 1668 | Ga0207706_10027723 | |||
| 1669 | Ga0207706_10106909 | |||
| 1670 | Ga0207706_10177720 | |||
| 1671 | Ga0207706_10583464 | |||
| 1672 | Ga0207686_10005406 | |||
| 1673 | Ga0207686_10170855 | |||
| 1674 | Ga0207686_10632322 | |||
| 1675 | Ga0207670_10018985 | |||
| 1676 | Ga0207670_10147113 | |||
| 1677 | Ga0207670_10300209 | |||
| 1678 | Ga0207670_10318353 | |||
| 1679 | Ga0207670_10391754 | |||
| 1680 | Ga0207670_10491663 | |||
| 1681 | Ga0207670_11770861 | |||
| 1682 | Ga0207669_10053289 | |||
| 1683 | Ga0207669_11392892 | |||
| 1684 | Ga0207669_11625856 | |||
| 1685 | Ga0207704_10020737 | |||
| 1686 | Ga0207704_10066559 | |||
| 1687 | Ga0207704_10106051 | |||
| 1688 | Ga0207704_10304916 | |||
| 1689 | Ga0207704_10477007 | |||
| 1690 | Ga0207704_11560944 | |||
| 1691 | Ga0207691_10009095 | |||
| 1692 | Ga0207691_10014205 | |||
| 1693 | Ga0207691_10077842 | |||
| 1694 | Ga0207691_10090652 | |||
| 1695 | Ga0207691_10113912 | |||
| 1696 | Ga0207691_10142374 | |||
| 1697 | Ga0207691_10201402 | |||
| 1698 | Ga0207691_10525217 | |||
| 1699 | Ga0207691_10928239 | |||
| 1700 | Ga0207691_10949161 | |||
| 1701 | Ga0207691_11099161 | |||
| 1702 | Ga0207689_10015791 | |||
| 1703 | Ga0207689_10015930 | |||
| 1704 | Ga0207689_10022578 | |||
| 1705 | Ga0207689_10049068 | |||
| 1706 | Ga0207689_10063806 | |||
| 1707 | Ga0207689_10067860 | |||
| 1708 | Ga0207689_10104803 | |||
| 1709 | Ga0207689_10395491 | |||
| 1710 | Ga0207661_10000738 | |||
| 1711 | Ga0207661_10014684 | |||
| 1712 | Ga0207661_10043248 | |||
| 1713 | Ga0207661_10047130 | |||
| 1714 | Ga0207661_10301127 | |||
| 1715 | Ga0207661_10522603 | |||
| 1716 | Ga0207679_10000902 | |||
| 1717 | Ga0207679_10032681 | |||
| 1718 | Ga0207679_10125874 | |||
| 1719 | Ga0207679_10362698 | |||
| 1720 | Ga0207679_10859078 | |||
| 1721 | Ga0207679_11008555 | |||
| 1722 | Ga0207667_10096088 | |||
| 1723 | Ga0207667_10183389 | |||
| 1724 | Ga0207651_10044105 | |||
| 1725 | Ga0207651_10077993 | |||
| 1726 | Ga0207651_10114790 | |||
| 1727 | Ga0207651_10140712 | |||
| 1728 | Ga0207651_10363019 | |||
| 1729 | Ga0207651_10639825 | |||
| 1730 | Ga0207651_10642254 | |||
| 1731 | Ga0207651_10702776 | |||
| 1732 | Ga0207651_10949936 | |||
| 1733 | Ga0207651_10981146 | |||
| 1734 | Ga0207712_10030385 | |||
| 1735 | Ga0207712_10045095 | |||
| 1736 | Ga0207712_10060728 | |||
| 1737 | Ga0207712_10066740 | |||
| 1738 | Ga0207712_10144811 | |||
| 1739 | Ga0207712_10280437 | |||
| 1740 | Ga0207712_10713789 | |||
| 1741 | Ga0207668_10204901 | |||
| 1742 | Ga0207668_10276264 | |||
| 1743 | Ga0207668_12014382 | |||
| 1744 | Ga0207640_10044336 | |||
| 1745 | Ga0207640_10273930 | |||
| 1746 | Ga0207640_10400135 | |||
| 1747 | Ga0207640_10591306 | |||
| 1748 | Ga0207640_10858117 | |||
| 1749 | Ga0207658_10046164 | |||
| 1750 | Ga0207658_10047535 | |||
| 1751 | Ga0207658_10139432 | |||
| 1752 | Ga0207658_10166275 | |||
| 1753 | Ga0207658_10195815 | |||
| 1754 | Ga0207658_10923424 | |||
| 1755 | Ga0207677_10010870 | |||
| 1756 | Ga0207677_10025173 | |||
| 1757 | Ga0207677_10410763 | |||
| 1758 | Ga0207677_10416708 | |||
| 1759 | Ga0207677_10505142 | |||
| 1760 | Ga0207677_10638641 | |||
| 1761 | Ga0207677_11700038 | |||
| 1762 | Ga0207703_10118278 | |||
| 1763 | Ga0207703_10190877 | |||
| 1764 | Ga0207703_10205809 | |||
| 1765 | Ga0207703_10412547 | |||
| 1766 | Ga0207703_10924571 | |||
| 1767 | Ga0207639_10021442 | |||
| 1768 | Ga0207639_10149869 | |||
| 1769 | Ga0207639_10853686 | |||
| 1770 | Ga0207639_11992699 | |||
| 1771 | Ga0207678_10154694 | |||
| 1772 | Ga0207678_10631694 | |||
| 1773 | Ga0207708_10111662 | |||
| 1774 | Ga0207708_10343179 | |||
| 1775 | Ga0207708_10380710 | |||
| 1776 | Ga0207641_10000380 | |||
| 1777 | Ga0207641_10030996 | |||
| 1778 | Ga0207641_10038209 | |||
| 1779 | Ga0207641_10153140 | |||
| 1780 | Ga0207641_10179946 | |||
| 1781 | Ga0207641_10283683 | |||
| 1782 | Ga0207641_10434559 | |||
| 1783 | Ga0207641_10441837 | |||
| 1784 | Ga0207641_10507230 | |||
| 1785 | Ga0207641_10568991 | |||
| 1786 | Ga0207641_10704931 | |||
| 1787 | Ga0207641_11281054 | |||
| 1788 | Ga0207641_11382699 | |||
| 1789 | Ga0207648_10003538 | |||
| 1790 | Ga0207648_10003599 | |||
| 1791 | Ga0207648_10012445 | |||
| 1792 | Ga0207648_10126450 | |||
| 1793 | Ga0207648_10261908 | |||
| 1794 | Ga0207648_10360239 | |||
| 1795 | Ga0207648_10454315 | |||
| 1796 | Ga0207676_10001466 | |||
| 1797 | Ga0207676_10060215 | |||
| 1798 | Ga0207676_10068244 | |||
| 1799 | Ga0207676_10069450 | |||
| 1800 | Ga0207676_10190630 | |||
| 1801 | Ga0207676_10197411 | |||
| 1802 | Ga0207676_10496143 | |||
| 1803 | Ga0207676_10574438 | |||
| 1804 | Ga0207676_10733910 | |||
| 1805 | Ga0207676_10942245 | |||
| 1806 | Ga0207676_11058362 | |||
| 1807 | Ga0207674_10003262 | |||
| 1808 | Ga0207674_10011079 | |||
| 1809 | Ga0207674_10249578 | |||
| 1810 | Ga0207674_11071057 | |||
| 1811 | Ga0207674_11294737 | |||
| 1812 | Ga0207675_100002458 | |||
| 1813 | Ga0207675_100018725 | |||
| 1814 | Ga0207675_100041774 | |||
| 1815 | Ga0207675_100058912 | |||
| 1816 | Ga0207675_100059596 | |||
| 1817 | Ga0207675_100175960 | |||
| 1818 | Ga0207675_101209818 | |||
| 1819 | Ga0207683_10000691 | |||
| 1820 | Ga0207683_10095644 | |||
| 1821 | Ga0207683_11349968 | |||
| 1822 | Ga0207698_10427270 | |||
| 1823 | Ga0207698_10791123 | |||
| 1824 | Ga0207698_11086556 | |||
| 1825 | Ga0207698_11393339 | |||
| 1826 | Ga0209968_1011552 | |||
| 1827 | Ga0209974_10384764 | |||
| 1828 | Ga0207428_10106615 | |||
| 1829 | Ga0207428_10415046 | |||
| 1830 | Ga0207428_10656523 | |||
| 1831 | Ga0268266_10011708 | |||
| 1832 | Ga0268265_10005161 | |||
| 1833 | Ga0268265_10309421 | |||
| 1834 | Ga0268265_11782480 | |||
| 1835 | Ga0268265_11925425 | |||
| 1836 | Ga0268264_10005023 | |||
| 1837 | Ga0268264_10067024 | |||
| 1838 | Ga0268264_10170717 | |||
| 1839 | Ga0268264_10232807 | |||
| 1840 | Ga0268264_10392022 | |||
| 1841 | Ga0268264_10968754 | |||
| 1842 | Ga0307517_10358958 | |||
| 1843 | Ga0307515_10000162 | |||
| 1844 | Ga0307515_10009312 | |||
| 1845 | Ga0307513_10134888 | |||
| 1846 | Ga0307513_10210849 | |||
| 1847 | Ga0307513_10258582 | |||
| 1848 | Ga0307513_10839378 | |||
| 1849 | Ga0307509_10087781 | |||
| 1850 | Ga0307516_10501757 | |||
| 1851 | Ga0307405_10000049 | |||
| 1852 | Ga0307407_10000024 | |||
| 1853 | Ga0307412_10708827 | |||
| 1854 | Ga0307412_11091299 | |||
| 1855 | Ga0307409_100036292 | |||
| 1856 | Ga0307416_100000037 | |||
| 1857 | Ga0307414_10001153 | |||
| 1858 | Ga0307414_10004809 | |||
| 1859 | Ga0307414_10006990 | |||
| 1860 | Ga0307414_10014942 | |||
| 1861 | Ga0307414_10091226 | |||
| 1862 | Ga0307414_10261129 | |||
| 1863 | Ga0307414_10364214 | |||
| 1864 | Ga0307414_10937782 | |||
| 1865 | Ga0307414_11074882 | |||
| 1866 | Ga0307414_11133521 | |||
| 1867 | Ga0307414_11675027 | |||
| 1868 | Ga0316585_10261770 | |||
| 1869 | Ga0373936_0158230 | |||
| 1870 | Ga0373943_0409636 | |||
| 1871 | Ga0373927_0700862 | |||
| 1872 | Ga0373947_1134028 | |||
| 1873 | Ga0373937_0091931 | |||
| 1874 | Ga0373937_0541574 | |||
| 1875 | Ga0316584_0401050 | |||
| 1876 | Ga0395905_0697672 | |||
| 1877 | Ga0395905_0943594 | |||
| 1878 | Ga0439436_0012382 | |||
| 1879 | Ga0439453_0020104 | |||
| 1880 | Ga0451787_042402 | |||
| 1881 | Ga0451793_1161307 | |||
| 1882 | Ga0451798_0509956 | |||
| 1883 | Ga0451798_0812166 | |||
| 1884 | Ga0451802_0969387 | |||
| 1885 | Ga0451833_0659560 | |||
| 1886 | Ga0451853_0376106 | |||
| 1887 | Ga0451853_3668395 | |||
| 1888 | Ga0439441_001178 | |||
| 1889 | Ga0439441_057238 | |||
| 1890 | Ga0439442_003138 | |||
| 1891 | Ga0439443_011622 | |||
| 1892 | Ga0439445_0043335 | |||
| 1893 | Ga0439449_0014815 | |||
| 1894 | Ga0439457_000827 | |||
| 1895 | Ga0439462_0052773 | |||
| 1896 | Ga0439446_0138484 | |||
| 1897 | Ga0451577_0191859 | |||
| 1898 | Ga0466969_0000103 | |||
| 1899 | Ga0466972_0000012 | |||
| 1900 | Ga0466972_0000055 | |||
| 1901 | Ga0466966_0000097 | |||
| 1902 | Ga0466964_0114004 | |||
| 1903 | Ga0453684_0127023 | |||
| 1904 | Ga0453684_0321098 | |||
| 1905 | Ga0453684_0506006 | |||
| 1906 | Ga0466968_0181868 | |||
| 1907 | Ga0466970_0000661 | |||
| 1908 | Ga0466957_0009079 | |||
| 1909 | Ga0466957_0014317 | |||
| 1910 | Ga0466960_0133182 | |||
| 1911 | Ga0466959_0000049 | |||
| 1912 | Ga0466959_0098950 | |||
| 1913 | Ga0495592_0071330 | |||
| 1914 | Ga0495580_0473783 | |||
| 1915 | Ga0495582_0401646 | |||
| 1916 | Ga0495582_0660730 | |||
| 1917 | Ga0495607_0481222 | |||
| 1918 | Ga0495606_0050331 | |||
| 1919 | Ga0495606_0166272 | |||
| 1920 | Ga0495610_0001236 | |||
| 1921 | Ga0495630_0064883 | |||
| 1922 | Ga0495630_0089950 | |||
| 1923 | Ga0495630_0119858 | |||
| 1924 | Ga0495630_0829498 | |||
| 1925 | Ga0495644_0183496 | |||
| 1926 | Ga0495666_0333421 | |||
| 1927 | Ga0495652_0122549 | |||
| 1928 | Ga0495665_0268490 | |||
| 1929 | Ga0495586_0226369 | |||
| 1930 | Ga0495586_0668487 | |||
| 1931 | Ga0495598_0267966 | |||
| 1932 | Ga0495609_0000025 | |||
| 1933 | Ga0495609_0068116 | |||
| 1934 | Ga0495621_0074559 | |||
| 1935 | Ga0495633_0151290 | |||
| 1936 | Ga0495668_0000489 | |||
| 1937 | Ga0495668_0005239 | |||
| 1938 | Ga0495634_0272909 | |||
| 1939 | Ga0495635_0487075 | |||
| 1940 | Ga0495657_0396324 | |||
| 1941 | Ga0495658_0015643 | |||
| 1942 | Ga0495604_0325939 | |||
| 1943 | Ga0495604_0335894 | |||
| 1944 | Ga0495674_0075977 | |||
| 1945 | Ga0495674_0144101 | |||
| 1946 | Ga0495674_0488483 | |||
| 1947 | Ga0495672_0020249 | |||
| 1948 | Ga0495672_0084410 | |||
| 1949 | Ga0495675_0525942 | |||
| 1950 | Ga0495684_0302795 | |||
| 1951 | Ga0495686_0000309 | |||
| 1952 | Ga0495686_0011789 | |||
| 1953 | Ga0495686_0106369 | |||
| 1954 | Ga0495602_0144639 | |||
| 1955 | Ga0496101_1046228 | |||
| 1956 | Ga0496110_0111521 | |||
| 1957 | Ga0496110_0351734 | |||
| 1958 | Ga0496111_0542328 | |||
| 1959 | Ga0496118_0264875 | |||
| 1960 | Ga0496124_0086261 | |||
| 1961 | Ga0501290_024755 | |||
| 1962 | Ga0501300_015794 | |||
| 1963 | Ga0501031_0074568 | |||
| 1964 | Ga0501032_0343630 | |||
| 1965 | Ga0501034_0009004 | |||
| 1966 | Ga0501036_0135714 | |||
| 1967 | Ga0501036_0346584 | |||
| 1968 | Ga0501037_0014127 | |||
| 1969 | Ga0501037_0105476 | |||
| 1970 | Ga0501038_0097988 | |||
| 1971 | Ga0501038_0108978 | |||
| 1972 | Ga0501039_0118689 | |||
| 1973 | Ga0501039_0183059 | |||
| 1974 | Ga0501040_0119819 | |||
| 1975 | Ga0501043_0128031 | |||
| 1976 | Ga0501046_0650803 | |||
| 1977 | Ga0501047_0004068 | |||
| 1978 | Ga0501047_0073419 | |||
| 1979 | Ga0501047_0484911 | |||
| 1980 | Ga0501249_054029 | |||
| 1981 | Ga0501257_018663 | |||
| 1982 | Ga0501257_022946 | |||
| 1983 | Ga0501225_0002922 | |||
| 1984 | Ga0501225_0221027 | |||
| 1985 | Ga0501225_0367309 | |||
| 1986 | Ga0501083_0376495 | |||
| 1987 | Ga0501241_029653 | |||
| 1988 | Ga0501035_0239732 | |||
| 1989 | Ga0501044_0007058 | |||
| 1990 | Ga0501044_0022983 | |||
| 1991 | Ga0501044_0033123 | |||
| 1992 | nmdc:mga03683_538042_c1 | |||
| 1993 | nmdc:mga0k408_32475_c1 | |||
| 1994 | nmdc:mga0k408_42881_c1 | |||
| 1995 | nmdc:mga0k408_50920_c1 | |||
| 1996 | nmdc:mga07m45_789462_c1 | |||
| 1997 | nmdc:mga05p37_20024_c2 | |||
| 1998 | nmdc:mga05p37_359497_c1 | |||
| 1999 | nmdc:mga09592_13499_c1 | |||
| 2000 | nmdc:mga09592_28065_c1 | |||
| 2001 | nmdc:mga0qj67_9692_c1 | |||
| 2002 | nmdc:mga06r32_402761_c1 | |||
| 2003 | nmdc:mga06r32_807494_c1 | |||
| 2004 | nmdc:mga06r32_844003_c1 | |||
| 2005 | nmdc:mga08y16_1501114_c1 | |||
| 2006 | nmdc:mga08y16_1919537_c1 | |||
| 2007 | nmdc:mga08y16_228835_c1 | |||
| 2008 | nmdc:mga08y16_251855_c1 | |||
| 2009 | nmdc:mga08y16_449092_c1 | |||
| 2010 | nmdc:mga08y16_55351_c1 | |||
| 2011 | nmdc:mga08y16_81001_c1 | |||
| 2012 | nmdc:mga0n895_283166_c1 | |||
| 2013 | Ga0495619_0280862 | |||
| 2014 | Ga0500578_0000934 | |||
| 2015 | Ga0500644_0006068 | |||
| 2016 | Ga0500644_0146434 | |||
| 2017 | Ga0500562_000010 | |||
| 2018 | Ga0500559_0043057 | |||
| 2019 | Ga0500568_0170281 | |||
| 2020 | Ga0500616_0015278 | |||
| 2021 | Ga0500616_0084695 | |||
| 2022 | Ga0500636_0268542 | |||
| 2023 | Ga0500611_000002 | |||
| 2024 | Ga0500645_019448 | |||
| 2025 | 2586209277 | |||
| 2026 | 2738727299 | |||
| 2027 | 2739590196 | |||
| 2028 | 2739615988 | |||
| 2029 | 2819588344 | |||
| 2030 | 2842723021 | |||
| 2031 | 2842913977 | |||
| 2032 | 2849283718 | |||
| 2033 | 2857628527 | |||
| 2034 | 2884636423 | |||
| 2035 | 2945999995 | |||
| 2036 | 2954016594 | |||
| 2037 | 2977245474 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nvi-assembly1.cif.gz_E-2 | orthorhombic crystal form of molybdopterin synthase | 0.8879 | 7 | 147 |
| 3rpf-assembly3.cif.gz_B | protein-protein complex of subunit 1 and 2 of molybdopterin-converting factor from helicobacter pylori 26695 | 0.886 | 9 | 146 |
| 1nvj-assembly1.cif.gz_A | deletion mutant (delta 141) of molybdopterin synthase | 0.8766 | 7 | 132 |
| 2q5w-assembly1.cif.gz_E | the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus | 0.874 | 5 | 146 |
| 2q5w-assembly1.cif.gz_E | the x-ray crystal structure of molybdopterin synthase from staphylococcus aureus | 0.868 | 5 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1fmaE00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.8911 | 9 | 147 | 3.90.1170.40 |
| 3rpfA00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.8685 | 9 | 143 | 3.90.1170.40 |
| 2qieK00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.8653 | 7 | 144 | 3.90.1170.40 |
| 1nvjC00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.8633 | 7 | 132 | 3.90.1170.40 |
| af_Q86HF4_1_145_3.90.1170.40 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.8606 | 9 | 146 | 3.90.1170.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G1DT28-F1-model_v4 | Molybdopterin converting factor | 0.9981 | 33 | 147 |
GO:0006777
|
| AF-A0A0A2MFR2-F1-model_v4 | Molybdopterin converting factor | 0.9952 | 3 | 147 |
GO:0006777
|
| AF-A0A0D6TKZ7-F1-model_v4 | Molybdopterin converting factor | 0.9862 | 15 | 147 |
GO:0006777
|
| AF-A7RSI1-F1-model_v4 | MOCS2B | 0.9861 | 53 | 135 |
GO:0005829
GO:0006777 |
| AF-A0A0A2MFR2-F1-model_v4 | Molybdopterin converting factor | 0.9817 | 3 | 147 |
GO:0006777
|