F488313

General Info

Members Datasets Scaffolds Average Seq Length
1018 519 995 132

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_11222599|Ga0157379_112225991
Length 149
Sequence MYSVNVRDHFMIAHSFRGEVFGPAQRLHGATYVVDLELRRAELDADGVVVDIALATEVLRGVLGELNLRNLDDDPSFKGKNTTTEFMARVIFDRIADRIAKGELGPHSSGLSALRVRLNESHVAWAAYEGALPARAGGTTAAAFSFRET

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
4 2643221711 Terrabacter sp. Root85 Isolate Unclassified
5 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
6 2738543013 Variovorax sp. BT01 Isolate Unclassified
7 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
8 2842733646 Variovorax sp. R-72446 Isolate Unclassified
9 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
10 2858868258 Micromonospora sp. MH33 Isolate Unclassified
11 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
12 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
13 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
14 2902582711 Micromonospora sp. AP08 Isolate Unclassified
15 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
16 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
19 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
138 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
139 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
140 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
147 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
148 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
149 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
150 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
222 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
228 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
229 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
230 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
233 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
234 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
235 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
236 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
237 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
238 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
241 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
242 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
243 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
244 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
245 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
246 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
247 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
248 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
249 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
250 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
251 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
252 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
255 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
256 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
257 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
258 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
259 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
260 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
261 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
262 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
263 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
264 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
265 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
266 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
267 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
269 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
270 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
271 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
272 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
275 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
276 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
277 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
278 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
279 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
283 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
284 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
285 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
286 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
287 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
288 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
289 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
290 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
291 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
292 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
293 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
294 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
295 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
296 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
297 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
298 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
299 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
300 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
301 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
302 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
303 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
304 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
305 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
306 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
307 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
308 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
309 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
310 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
311 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
312 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
313 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
314 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
315 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
316 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
317 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
318 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
319 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
320 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
321 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
322 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
323 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
324 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
325 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
326 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
327 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
328 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
329 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
330 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
331 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
332 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
333 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
334 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
335 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
336 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
337 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
338 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
339 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
340 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
341 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
342 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
343 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
344 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
345 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
346 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
350 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
351 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
352 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
353 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
354 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
355 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
356 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
357 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
358 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
359 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
360 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
361 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
362 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
363 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
364 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
365 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
366 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
367 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
368 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
369 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
370 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
371 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
372 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
373 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
374 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
375 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
376 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
377 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
378 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
379 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
380 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
381 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
382 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
383 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
384 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
385 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
386 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
387 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
388 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
389 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
390 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
391 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
392 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
393 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
394 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
395 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
396 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
397 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
398 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
399 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
400 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
401 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
402 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
403 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
404 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
405 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
406 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
407 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
408 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
409 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
410 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
411 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
412 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
413 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
414 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
415 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
416 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
417 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
418 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
419 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
420 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
421 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
422 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
423 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
424 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
425 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
426 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
427 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
428 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
429 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
430 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
431 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
432 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
433 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
434 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
435 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
436 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
437 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
438 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
439 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
440 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
441 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
442 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
443 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
444 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
445 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
446 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
447 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
448 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
449 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
451 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
452 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
453 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
465 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
466 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
467 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
468 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
469 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
470 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
471 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
472 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
473 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
474 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
475 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
476 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
477 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
478 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
480 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
481 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
482 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
483 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
484 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
485 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
486 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
487 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
488 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
489 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
490 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
491 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
492 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
493 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
494 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
495 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
496 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
497 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
498 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
499 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
500 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
501 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
502 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
503 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
504 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
505 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
506 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
507 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
508 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
509 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
510 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
511 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
512 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
513 649633069 Micromonospora sp. L5 Isolate Unclassified
514 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
515 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
516 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
517 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
518 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
519 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.35
Metatranscriptomes 0.39
Isolates 2.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.99
Nodule 0
Rhizoplane 8.55
Rhizosphere 79.47
Stem 0
Stem Tuber 0.1
Unclassified 5.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10172920 3300002067 Bacteria 625
2 JGI24748J21848_1008115 3300002074 Bacteria 1233
3 JGI24744J21845_10008927 3300002077 Bacteria 2060
4 JGI24742J22300_10001686 3300002244 Bacteria 3522
5 JGI25159J45721_1018451 3300002987 Bacteria 1406
6 rootH2_10034964 3300003320 Bacteria 2548
7 rootL2_10026840 3300003322 Bacteria 1234
8 Ga0055536_1021586 3300003781 Bacteria 1948
9 Ga0055534_1001074 3300003784 Bacteria 11753
10 Ga0065165_1023608 3300005262 Bacteria 2081
11 Ga0065714_10304250 3300005288 Bacteria 690
12 Ga0065715_10265259 3300005293 Bacteria 1109
13 Ga0070658_10090488 3300005327 Bacteria 2521
14 Ga0070676_10070662 3300005328 Bacteria 2095
15 Ga0070676_10112415 3300005328 Bacteria 1698
16 Ga0070690_100371934 3300005330 Bacteria 1043
17 Ga0070670_100449115 3300005331 Bacteria 1142
18 Ga0070670_101161066 3300005331 Bacteria 705
19 Ga0070670_101206962 3300005331 Bacteria 691
20 Ga0070666_10140479 3300005335 Bacteria 1682
21 Ga0070666_10186907 3300005335 Bacteria 1455
22 Ga0070680_100413145 3300005336 Bacteria 1151
23 Ga0070682_101082412 3300005337 Bacteria 670
24 Ga0070682_101673269 3300005337 Bacteria 552
25 Ga0068868_100016515 3300005338 Bacteria 5484
26 Ga0068868_101073879 3300005338 Bacteria 740
27 Ga0068868_101465723 3300005338 Bacteria 638
28 Ga0070660_100207859 3300005339 Bacteria 1589
29 Ga0070660_100805747 3300005339 Bacteria 790
30 Ga0070689_100025236 3300005340 Bacteria 4463
31 Ga0070691_10225640 3300005341 Bacteria 995
32 Ga0070692_10154673 3300005345 Bacteria 1309
33 Ga0070668_100018680 3300005347 Bacteria 5205
34 Ga0070668_100332893 3300005347 Bacteria 1281
35 Ga0070669_100064693 3300005353 Bacteria 2694
36 Ga0070669_100244349 3300005353 Bacteria 1427
37 Ga0070675_100173253 3300005354 Bacteria 1862
38 Ga0070675_100356422 3300005354 Bacteria 1298
39 Ga0070675_100793664 3300005354 Bacteria 865
40 Ga0070671_100766453 3300005355 Bacteria 839
41 Ga0070674_100008012 3300005356 Bacteria 6262
42 Ga0070674_100021660 3300005356 Bacteria 4132
43 Ga0070674_100341654 3300005356 Bacteria 1206
44 Ga0070674_101411477 3300005356 Bacteria 624
45 Ga0070673_100042639 3300005364 Bacteria 3500
46 Ga0070673_100575249 3300005364 Bacteria 1025
47 Ga0070673_101812787 3300005364 Bacteria 578
48 Ga0070659_100152307 3300005366 Bacteria 1887
49 Ga0070659_100407126 3300005366 Bacteria 1149
50 Ga0070659_100413861 3300005366 Bacteria 1139
51 Ga0070667_100027114 3300005367 Bacteria 4767
52 Ga0070667_100036634 3300005367 Bacteria 4113
53 Ga0070709_10199704 3300005434 Bacteria 1415
54 Ga0070714_100105406 3300005435 Bacteria 2489
55 Ga0070713_100079692 3300005436 Bacteria 2790
56 Ga0070710_10039279 3300005437 Bacteria 2604
57 Ga0070701_10017100 3300005438 Bacteria 3385
58 Ga0070711_100014147 3300005439 Bacteria 5022
59 Ga0070705_100048274 3300005440 Bacteria 2465
60 Ga0070705_100071395 3300005440 Bacteria 2100
61 Ga0070700_100053452 3300005441 Bacteria 2521
62 Ga0070700_100176358 3300005441 Bacteria 1484
63 Ga0070700_100807657 3300005441 Bacteria 756
64 Ga0070694_100173161 3300005444 Bacteria 1591
65 Ga0070708_102150063 3300005445 Bacteria 516
66 Ga0070663_100558960 3300005455 Bacteria 957
67 Ga0070678_100001294 3300005456 Bacteria 13272
68 Ga0070678_100078800 3300005456 Bacteria 2490
69 Ga0070678_100086545 3300005456 Bacteria 2391
70 Ga0070678_100784048 3300005456 Bacteria 864
71 Ga0070662_100257279 3300005457 Bacteria 1405
72 Ga0070662_101398133 3300005457 Bacteria 603
73 Ga0070681_10144431 3300005458 Bacteria 2309
74 Ga0070681_10442928 3300005458 Bacteria 1211
75 Ga0068867_100008440 3300005459 Bacteria 7265
76 Ga0068867_100293167 3300005459 Bacteria 1338
77 Ga0070685_10439347 3300005466 Bacteria 912
78 Ga0070706_100090329 3300005467 Unclassified 2840
79 Ga0070707_100062969 3300005468 Bacteria 3559
80 Ga0070707_100528875 3300005468 Bacteria 1141
81 Ga0070699_100180201 3300005518 Bacteria 1875
82 Ga0070699_101159005 3300005518 Bacteria 709
83 Ga0070679_100269820 3300005530 Bacteria 1656
84 Ga0070679_100955777 3300005530 Bacteria 800
85 Ga0070684_100369695 3300005535 Bacteria 1320
86 Ga0068853_100036947 3300005539 Bacteria 4155
87 Ga0068853_100107809 3300005539 Bacteria 2470
88 Ga0068853_100315093 3300005539 Bacteria 1449
89 Ga0070672_100151280 3300005543 Bacteria 1920
90 Ga0070672_100548114 3300005543 Bacteria 1004
91 Ga0070686_100093953 3300005544 Bacteria 2012
92 Ga0070695_100045120 3300005545 Bacteria 2808
93 Ga0070696_100066279 3300005546 Bacteria 2532
94 Ga0070696_100172963 3300005546 Bacteria 1598
95 Ga0070693_100031922 3300005547 Bacteria 2891
96 Ga0070693_101161568 3300005547 Bacteria 591
97 Ga0070693_101171658 3300005547 Bacteria 589
98 Ga0070665_100042922 3300005548 Bacteria 4546
99 Ga0070665_100051263 3300005548 Bacteria 4139
100 Ga0070665_100383285 3300005548 Bacteria 1413
101 Ga0070665_100534506 3300005548 Bacteria 1184
102 Ga0070665_100910509 3300005548 Bacteria 892
103 Ga0070665_101304798 3300005548 Bacteria 736
104 Ga0070665_101662619 3300005548 Bacteria 646
105 Ga0070704_100024045 3300005549 Bacteria 3991
106 Ga0068855_100114588 3300005563 Bacteria 3090
107 Ga0068855_100855039 3300005563 Bacteria 964
108 Ga0070664_101332470 3300005564 Bacteria 678
109 Ga0068854_100023417 3300005578 Bacteria 4218
110 Ga0068854_100045135 3300005578 Bacteria 3132
111 Ga0070702_100024373 3300005615 Bacteria 3227
112 Ga0070702_100199986 3300005615 Bacteria 1322
113 Ga0068852_100549006 3300005616 Bacteria 1156
114 Ga0068859_100037263 3300005617 Bacteria 4881
115 Ga0068859_100111455 3300005617 Bacteria 2799
116 Ga0068859_100293493 3300005617 Bacteria 1719
117 Ga0068859_101260357 3300005617 Bacteria 814
118 Ga0068864_101975244 3300005618 Bacteria 589
119 Ga0068866_10001530 3300005718 Bacteria 9830
120 Ga0068861_100038370 3300005719 Bacteria 3566
121 Ga0068861_101379145 3300005719 Bacteria 688
122 Ga0068851_10337315 3300005834 Bacteria 874
123 Ga0068863_100146957 3300005841 Bacteria 2255
124 Ga0068863_100373813 3300005841 Bacteria 1391
125 Ga0068863_101056975 3300005841 Bacteria 816
126 Ga0068858_100267655 3300005842 Bacteria 1625
127 Ga0068860_100011938 3300005843 Bacteria 8562
128 Ga0068862_100047952 3300005844 Bacteria 3646
129 Ga0068862_100610275 3300005844 Bacteria 1048
130 Ga0068862_101376999 3300005844 Bacteria 708
131 Ga0081538_10046032 3300005981 Bacteria 2697
132 Ga0081538_10091673 3300005981 Bacteria 1568
133 Ga0081540_1007386 3300005983 Bacteria 7838
134 Ga0081540_1016146 3300005983 Bacteria 4688
135 Ga0081540_1167435 3300005983 Bacteria 843
136 Ga0081539_10000299 3300005985 Bacteria 111908
137 Ga0081539_10006277 3300005985 Bacteria 11490
138 Ga0070717_10010702 3300006028 Bacteria 6939
139 Ga0070717_10066969 3300006028 Bacteria 2987
140 Ga0070717_10120662 3300006028 Bacteria 2246
141 Ga0075365_10071999 3300006038 Bacteria 2328
142 Ga0075365_10211734 3300006038 Bacteria 1359
143 Ga0075365_10220873 3300006038 Bacteria 1329
144 Ga0075365_10271109 3300006038 Bacteria 1194
145 Ga0075368_10143308 3300006042 Bacteria 996
146 Ga0075368_10150401 3300006042 Bacteria 972
147 Ga0075363_100023402 3300006048 Bacteria 3130
148 Ga0075363_100592895 3300006048 Bacteria 663
149 Ga0075363_100696964 3300006048 Bacteria 613
150 Ga0075364_10029290 3300006051 Bacteria 3530
151 Ga0075364_10458701 3300006051 Bacteria 871
152 Ga0070715_10052427 3300006163 Bacteria 1759
153 Ga0070716_100068576 3300006173 Bacteria 2075
154 Ga0070716_101393205 3300006173 Bacteria 570
155 Ga0070712_100008934 3300006175 Bacteria 6311
156 Ga0070712_100345257 3300006175 Bacteria 1217
157 Ga0075362_10060502 3300006177 Bacteria 1712
158 Ga0075362_10720379 3300006177 Bacteria 521
159 Ga0075367_10390720 3300006178 Bacteria 879
160 Ga0075366_10208717 3300006195 Bacteria 1188
161 Ga0075366_10268627 3300006195 Bacteria 1042
162 Ga0075370_10368658 3300006353 Bacteria 859
163 Ga0075370_10947642 3300006353 Bacteria 527
164 Ga0068871_100398100 3300006358 Bacteria 1226
165 Ga0075428_100018822 3300006844 Bacteria 7635
166 Ga0075428_100354231 3300006844 Bacteria 1575
167 Ga0075430_100072971 3300006846 Bacteria 2878
168 Ga0075431_100042432 3300006847 Bacteria 4692
169 Ga0075431_101084318 3300006847 Bacteria 766
170 Ga0075433_10182552 3300006852 Bacteria 1867
171 Ga0075433_11767433 3300006852 Bacteria 532
172 Ga0075434_100367206 3300006871 Bacteria 1460
173 Ga0068865_100125572 3300006881 Bacteria 1915
174 Ga0068865_100129560 3300006881 Bacteria 1888
175 Ga0097620_100037262 3300006931 Bacteria 4881
176 Ga0097620_100111448 3300006931 Bacteria 2799
177 Ga0097620_100293499 3300006931 Bacteria 1719
178 Ga0097620_101260336 3300006931 Bacteria 814
179 Ga0075435_100014526 3300007076 Bacteria 5889
180 Ga0105251_10017909 3300009011 Bacteria 3783
181 Ga0105244_10197529 3300009036 Bacteria 949
182 Ga0105250_10092247 3300009092 Bacteria 1233
183 Ga0105240_10074931 3300009093 Bacteria 4175
184 Ga0105240_11384836 3300009093 Bacteria 740
185 Ga0105240_12236665 3300009093 Bacteria 567
186 Ga0105240_12472115 3300009093 Bacteria 537
187 Ga0105245_10009348 3300009098 Bacteria 8551
188 Ga0105245_10368583 3300009098 Bacteria 1427
189 Ga0105245_11653112 3300009098 Bacteria 692
190 Ga0105247_10006155 3300009101 Bacteria 7453
191 Ga0105247_10010073 3300009101 Bacteria 5726
192 Ga0105247_11080438 3300009101 Bacteria 632
193 Ga0105247_11651280 3300009101 Bacteria 528
194 Ga0114129_10017668 3300009147 Bacteria 10155
195 Ga0114129_10678086 3300009147 Bacteria 1327
196 Ga0114129_10942226 3300009147 Bacteria 1091
197 Ga0105243_10051593 3300009148 Bacteria 3254
198 Ga0105243_10897620 3300009148 Bacteria 881
199 Ga0105241_11225501 3300009174 Bacteria 712
200 Ga0105242_10042876 3300009176 Bacteria 3657
201 Ga0105248_10038947 3300009177 Bacteria 5322
202 Ga0105248_10143185 3300009177 Bacteria 2697
203 Ga0105248_10859441 3300009177 Bacteria 1024
204 Ga0105248_11240489 3300009177 Bacteria 843
205 Ga0105237_10318849 3300009545 Bacteria 1558
206 Ga0105237_11013762 3300009545 Bacteria 837
207 Ga0105237_11314535 3300009545 Bacteria 729
208 Ga0105238_10024517 3300009551 Bacteria 6148
209 Ga0105238_10300619 3300009551 Bacteria 1588
210 Ga0105249_11822231 3300009553 Bacteria 681
211 Ga0105239_10142382 3300010375 Bacteria 2673
212 Ga0105239_10171478 3300010375 Bacteria 2426
213 Ga0105239_10420894 3300010375 Bacteria 1513
214 Ga0105239_12761492 3300010375 Bacteria 573
215 Ga0105246_10114745 3300011119 Bacteria 1985
216 Ga0105246_11917460 3300011119 Bacteria 569
217 Ga0157371_10190717 3300013102 Bacteria 1467
218 Ga0157370_11678116 3300013104 Bacteria 570
219 Ga0157369_10310155 3300013105 Bacteria 1641
220 Ga0157369_10331275 3300013105 Bacteria 1582
221 Ga0171462_1004 3300013250 Bacteria 678877
222 Ga0157374_10208145 3300013296 Bacteria 1917
223 Ga0157374_10493822 3300013296 Bacteria 1228
224 Ga0157378_10021612 3300013297 Bacteria 5659
225 Ga0163162_10084317 3300013306 Bacteria 3253
226 Ga0163162_10142108 3300013306 Bacteria 2514
227 Ga0163162_10332349 3300013306 Bacteria 1652
228 Ga0163162_10654578 3300013306 Bacteria 1174
229 Ga0157372_10102729 3300013307 Bacteria 3265
230 Ga0157372_11219675 3300013307 Bacteria 869
231 Ga0157375_10210678 3300013308 Bacteria 2101
232 Ga0157375_10224591 3300013308 Bacteria 2037
233 Ga0157375_10614737 3300013308 Bacteria 1245
234 Ga0157375_10731172 3300013308 Bacteria 1142
235 Ga0157375_11403674 3300013308 Bacteria 823
236 Ga0157380_10049476 3300014326 Bacteria 3316
237 Ga0182008_10001482 3300014497 Bacteria 15678
238 Ga0182008_10749493 3300014497 Bacteria 562
239 Ga0157377_10073172 3300014745 Bacteria 1985
240 Ga0157377_10333652 3300014745 Bacteria 1012
241 Ga0157379_10143086 3300014968 Bacteria 2156
242 Ga0157379_10207813 3300014968 Bacteria 1772
243 Ga0157379_10300546 3300014968 Bacteria 1463
244 Ga0157379_11222599 3300014968 Bacteria 723
245 Ga0157376_10894255 3300014969 Bacteria 906
246 Ga0157376_10984409 3300014969 Bacteria 865
247 Ga0157376_11044620 3300014969 Bacteria 841
248 Ga0157376_12384402 3300014969 Bacteria 569
249 Ga0182007_10000321 3300015262 Bacteria 30433
250 Ga0182005_1037556 3300015265 Bacteria 1317
251 Ga0183362_10003 3300015683 Bacteria 977584
252 Ga0163161_10073709 3300017792 Bacteria 2502
253 Ga0163161_10098765 3300017792 Bacteria 2170
254 Ga0163161_10743269 3300017792 Bacteria 820
255 Ga0163161_11172797 3300017792 Bacteria 663
256 Ga0163161_11448280 3300017792 Bacteria 601
257 Ga0213876_10028695 3300021384 Bacteria 2934
258 Ga0224712_10046356 3300022467 Bacteria 1668
259 Ga0209130_1006006 3300025284 Bacteria 4044
260 Ga0209675_1005102 3300025291 Bacteria 5600
261 Ga0209676_1006325 3300025292 Bacteria 5875
262 Ga0209564_1045945 3300025295 Bacteria 1118
263 Ga0209758_1008881 3300025297 Bacteria 6384
264 Ga0209050_1064932 3300025298 Bacteria 843
265 Ga0207426_1068224 3300025302 Bacteria 1000
266 Ga0209051_1021425 3300025303 Bacteria 2753
267 Ga0209257_1021959 3300025304 Bacteria 2295
268 Ga0207696_1185139 3300025711 Bacteria 550
269 Ga0207713_1032370 3300025735 Bacteria 2297
270 Ga0207682_10112758 3300025893 Bacteria 1198
271 Ga0207692_10000532 3300025898 Bacteria 13531
272 Ga0207692_10014167 3300025898 Bacteria 3479
273 Ga0207642_10005216 3300025899 Bacteria 4233
274 Ga0207642_10365176 3300025899 Bacteria 855
275 Ga0207710_10005704 3300025900 Bacteria 5346
276 Ga0207710_10013402 3300025900 Bacteria 3451
277 Ga0207710_10203756 3300025900 Bacteria 978
278 Ga0207688_10105007 3300025901 Bacteria 1635
279 Ga0207688_10479698 3300025901 Bacteria 777
280 Ga0207680_10273418 3300025903 Bacteria 1172
281 Ga0207645_10133496 3300025907 Bacteria 1616
282 Ga0207645_10591921 3300025907 Bacteria 753
283 Ga0207643_10051860 3300025908 Bacteria 2329
284 Ga0207684_11190203 3300025910 Bacteria 631
285 Ga0207654_10100282 3300025911 Bacteria 1783
286 Ga0207707_10091702 3300025912 Bacteria 2655
287 Ga0207707_10257787 3300025912 Bacteria 1514
288 Ga0207695_10369810 3300025913 Bacteria 1320
289 Ga0207671_10319052 3300025914 Bacteria 1229
290 Ga0207671_10724174 3300025914 Bacteria 791
291 Ga0207693_10022554 3300025915 Bacteria 5002
292 Ga0207693_10155484 3300025915 Bacteria 1798
293 Ga0207693_10240116 3300025915 Bacteria 1422
294 Ga0207663_10020680 3300025916 Bacteria 3731
295 Ga0207660_10098925 3300025917 Bacteria 2176
296 Ga0207660_10207307 3300025917 Bacteria 1534
297 Ga0207660_10416852 3300025917 Bacteria 1083
298 Ga0207662_10192237 3300025918 Bacteria 1317
299 Ga0207657_10241729 3300025919 Bacteria 1441
300 Ga0207657_10325893 3300025919 Bacteria 1214
301 Ga0207657_10376376 3300025919 Bacteria 1118
302 Ga0207657_10769224 3300025919 Bacteria 745
303 Ga0207652_10331988 3300025921 Bacteria 1373
304 Ga0207652_10571534 3300025921 Bacteria 1015
305 Ga0207652_10748062 3300025921 Bacteria 870
306 Ga0207652_11355563 3300025921 Bacteria 614
307 Ga0207646_10168149 3300025922 Unclassified 1980
308 Ga0207681_10060858 3300025923 Bacteria 2593
309 Ga0207681_10263604 3300025923 Bacteria 1350
310 Ga0207694_10065630 3300025924 Bacteria 2830
311 Ga0207650_10644367 3300025925 Bacteria 893
312 Ga0207650_11388262 3300025925 Bacteria 598
313 Ga0207659_10188988 3300025926 Bacteria 1638
314 Ga0207659_10203087 3300025926 Bacteria 1584
315 Ga0207659_10562722 3300025926 Bacteria 970
316 Ga0207659_10669363 3300025926 Bacteria 888
317 Ga0207687_10008069 3300025927 Bacteria 6890
318 Ga0207687_10030326 3300025927 Bacteria 3646
319 Ga0207700_10462442 3300025928 Bacteria 1119
320 Ga0207700_10766761 3300025928 Bacteria 862
321 Ga0207664_10068766 3300025929 Bacteria 2846
322 Ga0207644_10844881 3300025931 Bacteria 766
323 Ga0207644_11043055 3300025931 Bacteria 687
324 Ga0207690_10172027 3300025932 Bacteria 1624
325 Ga0207690_10367526 3300025932 Bacteria 1141
326 Ga0207690_10386997 3300025932 Bacteria 1113
327 Ga0207690_10419978 3300025932 Bacteria 1070
328 Ga0207690_11013745 3300025932 Bacteria 691
329 Ga0207706_10046195 3300025933 Bacteria 3856
330 Ga0207709_10012850 3300025935 Bacteria 4617
331 Ga0207709_11615274 3300025935 Bacteria 538
332 Ga0207670_10644665 3300025936 Bacteria 873
333 Ga0207669_10010595 3300025937 Bacteria 4442
334 Ga0207669_10086942 3300025937 Bacteria 2023
335 Ga0207669_10286496 3300025937 Bacteria 1245
336 Ga0207669_11089017 3300025937 Bacteria 674
337 Ga0207704_10001963 3300025938 Bacteria 9223
338 Ga0207704_10159079 3300025938 Bacteria 1605
339 Ga0207704_10688319 3300025938 Bacteria 845
340 Ga0207665_10013758 3300025939 Bacteria 5321
341 Ga0207691_10012135 3300025940 Bacteria 8261
342 Ga0207691_10683048 3300025940 Bacteria 866
343 Ga0207711_10089795 3300025941 Bacteria 2700
344 Ga0207711_10823973 3300025941 Bacteria 864
345 Ga0207711_10903854 3300025941 Bacteria 821
346 Ga0207711_11417763 3300025941 Bacteria 637
347 Ga0207689_10104805 3300025942 Bacteria 2324
348 Ga0207661_10237536 3300025944 Bacteria 1616
349 Ga0207661_10446308 3300025944 Bacteria 1178
350 Ga0207679_11720307 3300025945 Bacteria 574
351 Ga0207667_10353033 3300025949 Bacteria 1499
352 Ga0207667_11067545 3300025949 Bacteria 792
353 Ga0207667_11301264 3300025949 Bacteria 703
354 Ga0207651_10001558 3300025960 Bacteria 10485
355 Ga0207651_10778370 3300025960 Bacteria 847
356 Ga0207712_10413268 3300025961 Bacteria 1137
357 Ga0207712_10424765 3300025961 Bacteria 1122
358 Ga0207668_10012098 3300025972 Bacteria 5271
359 Ga0207640_10073446 3300025981 Bacteria 2311
360 Ga0207640_10210114 3300025981 Bacteria 1482
361 Ga0207658_10004918 3300025986 Bacteria 9215
362 Ga0207658_10029493 3300025986 Bacteria 3875
363 Ga0207677_10011807 3300026023 Bacteria 4996
364 Ga0207677_10065995 3300026023 Bacteria 2528
365 Ga0207677_10297832 3300026023 Bacteria 1331
366 Ga0207703_10096913 3300026035 Bacteria 2491
367 Ga0207703_10185395 3300026035 Bacteria 1839
368 Ga0207639_10015661 3300026041 Bacteria 5350
369 Ga0207639_10027103 3300026041 Bacteria 4170
370 Ga0207678_10114498 3300026067 Bacteria 2301
371 Ga0207678_10505399 3300026067 Bacteria 1054
372 Ga0207678_10799330 3300026067 Bacteria 833
373 Ga0207708_10051067 3300026075 Bacteria 3148
374 Ga0207708_10323234 3300026075 Bacteria 1260
375 Ga0207702_10691622 3300026078 Bacteria 1005
376 Ga0207641_10163572 3300026088 Bacteria 2025
377 Ga0207641_11333372 3300026088 Bacteria 718
378 Ga0207648_10066671 3300026089 Bacteria 3139
379 Ga0207648_10323752 3300026089 Bacteria 1386
380 Ga0207648_10371651 3300026089 Bacteria 1291
381 Ga0207648_11661497 3300026089 Bacteria 600
382 Ga0207676_10277669 3300026095 Bacteria 1520
383 Ga0207676_10335749 3300026095 Bacteria 1392
384 Ga0207676_10390358 3300026095 Bacteria 1298
385 Ga0207676_11210054 3300026095 Bacteria 749
386 Ga0207676_11249253 3300026095 Bacteria 737
387 Ga0207675_100058616 3300026118 Bacteria 3593
388 Ga0207675_100138746 3300026118 Bacteria 2309
389 Ga0207675_100740156 3300026118 Bacteria 994
390 Ga0207683_10062809 3300026121 Bacteria 3271
391 Ga0207683_10081042 3300026121 Bacteria 2880
392 Ga0207683_10115571 3300026121 Bacteria 2405
393 Ga0207683_10232151 3300026121 Bacteria 1683
394 Ga0207683_10323035 3300026121 Bacteria 1414
395 Ga0207683_10617951 3300026121 Bacteria 1003
396 Ga0207683_10665235 3300026121 Bacteria 965
397 Ga0207683_11113099 3300026121 Bacteria 733
398 Ga0207698_10209663 3300026142 Bacteria 1752
399 Ga0207698_10993240 3300026142 Bacteria 850
400 Ga0207698_11084800 3300026142 Bacteria 813
401 Ga0207698_11321224 3300026142 Bacteria 736
402 Ga0209813_10161325 3300027866 Bacteria 809
403 Ga0209974_10224326 3300027876 Bacteria 700
404 Ga0207428_10111254 3300027907 Bacteria 2107
405 Ga0268266_10016681 3300028379 Bacteria 6276
406 Ga0268266_10204779 3300028379 Bacteria 1807
407 Ga0268266_10208375 3300028379 Bacteria 1792
408 Ga0268266_10222587 3300028379 Bacteria 1735
409 Ga0268266_10435207 3300028379 Bacteria 1245
410 Ga0268266_10480135 3300028379 Bacteria 1185
411 Ga0268266_11108744 3300028379 Bacteria 766
412 Ga0268265_10316918 3300028380 Bacteria 1410
413 Ga0268264_10030902 3300028381 Bacteria 4391
414 Ga0265337_1031514 3300028556 Bacteria 1574
415 Ga0265318_10325930 3300028577 Bacteria 560
416 Ga0265336_10061960 3300028666 Bacteria 1122
417 Ga0307517_10130253 3300028786 Bacteria 1815
418 Ga0307515_10000487 3300028794 Bacteria 94783
419 Ga0307515_10056940 3300028794 Bacteria 5667
420 Ga0307511_10000159 3300030521 Bacteria 65231
421 Ga0307511_10001103 3300030521 Bacteria 28774
422 Ga0307512_10053040 3300030522 Bacteria 3228
423 Ga0316177_1113942 3300030731 Bacteria 718
424 Ga0265320_10000429 3300031240 Bacteria 33137
425 Ga0265331_10197765 3300031250 Bacteria 906
426 Ga0265327_10003277 3300031251 Bacteria 15681
427 Ga0265316_10037489 3300031344 Bacteria 3912
428 Ga0307513_10025548 3300031456 Bacteria 6837
429 Ga0307513_10032587 3300031456 Bacteria 5873
430 Ga0307513_10033683 3300031456 Bacteria 5756
431 Ga0307513_10098869 3300031456 Bacteria 2947
432 Ga0307513_10308731 3300031456 Bacteria 1345
433 Ga0307513_10441643 3300031456 Bacteria 1027
434 Ga0307513_10445830 3300031456 Bacteria 1020
435 Ga0307513_10448606 3300031456 Bacteria 1015
436 Ga0307509_10036922 3300031507 Bacteria 5344
437 Ga0307408_100214815 3300031548 Bacteria 1566
438 Ga0307408_100269808 3300031548 Bacteria 1412
439 Ga0307408_100556305 3300031548 Bacteria 1013
440 Ga0307408_101932668 3300031548 Bacteria 566
441 Ga0307514_10108568 3300031649 Bacteria 1972
442 Ga0316575_10002608 3300031665 Bacteria 6073
443 Ga0316579_10003332 3300031691 Bacteria 6242
444 Ga0316579_10422801 3300031691 Bacteria 644
445 Ga0265314_10022219 3300031711 Bacteria 4862
446 Ga0316576_10002073 3300031727 Bacteria 11256
447 Ga0316576_10204172 3300031727 Bacteria 1488
448 Ga0316578_10000393 3300031728 Bacteria 14094
449 Ga0316578_10158789 3300031728 Bacteria 1362
450 Ga0307516_10001460 3300031730 Bacteria 32683
451 Ga0307516_10041378 3300031730 Bacteria 4580
452 Ga0307405_10456388 3300031731 Bacteria 1014
453 Ga0316577_10029468 3300031733 Bacteria 3063
454 Ga0307413_10096982 3300031824 Bacteria 1937
455 Ga0307413_10481726 3300031824 Bacteria 992
456 Ga0307413_11207694 3300031824 Bacteria 658
457 Ga0307413_11921610 3300031824 Bacteria 532
458 Ga0307518_10009673 3300031838 Bacteria 6883
459 Ga0307410_10035590 3300031852 Bacteria 3235
460 Ga0307410_10282119 3300031852 Bacteria 1304
461 Ga0307406_10046095 3300031901 Bacteria 2741
462 Ga0307406_10145830 3300031901 Bacteria 1682
463 Ga0307406_11158689 3300031901 Bacteria 670
464 Ga0307407_10022944 3300031903 Bacteria 3248
465 Ga0307407_11451107 3300031903 Bacteria 542
466 Ga0307412_10551037 3300031911 Bacteria 968
467 Ga0307412_10822742 3300031911 Bacteria 808
468 Ga0307409_100069879 3300031995 Bacteria 2785
469 Ga0307409_100221069 3300031995 Bacteria 1710
470 Ga0307409_100277771 3300031995 Bacteria 1546
471 Ga0307409_101283505 3300031995 Bacteria 757
472 Ga0307416_100365830 3300032002 Bacteria 1466
473 Ga0307416_101094106 3300032002 Bacteria 901
474 Ga0307416_102273067 3300032002 Bacteria 643
475 Ga0307414_10224023 3300032004 Bacteria 1546
476 Ga0307411_10000850 3300032005 Bacteria 11472
477 Ga0307411_10289605 3300032005 Bacteria 1308
478 Ga0307411_11303703 3300032005 Bacteria 662
479 Ga0307415_100395947 3300032126 Bacteria 1177
480 Ga0316583_10010654 3300032133 Bacteria 3315
481 Ga0316583_10061685 3300032133 Bacteria 1313
482 Ga0316585_10154369 3300032137 Bacteria 758
483 Ga0316580_10010722 3300032139 Bacteria 2774
484 Ga0316580_10081089 3300032139 Bacteria 992
485 Ga0307507_10015626 3300033179 Bacteria 8907
486 Ga0307507_10047289 3300033179 Bacteria 4205
487 Ga0307510_10076915 3300033180 Bacteria 3277
488 Ga0316596_1020082 3300033541 Bacteria 1698
489 Ga0373948_0022376 3300034817 Bacteria 1218
490 Ga0373928_0031819 3300035084 Bacteria 1173
491 Ga0373929_0096214 3300035085 Bacteria 741
492 Ga0373940_0013567 3300035088 Bacteria 1975
493 Ga0373932_0025237 3300035112 Bacteria 1607
494 Ga0373932_0034054 3300035112 Bacteria 1433
495 Ga0373943_0801310 3300035170 Bacteria 561
496 Ga0373955_1000875 3300035172 Bacteria 515
497 Ga0316574_0007588 3300035398 Bacteria 5957
498 Ga0316574_0182618 3300035398 Bacteria 1349
499 Ga0316574_0325191 3300035398 Bacteria 976
500 Ga0316574_0639565 3300035398 Bacteria 655
501 Ga0373931_0047293 3300035691 Bacteria 2277
502 Ga0316582_0001290 3300036647 Bacteria 10842
503 Ga0316582_0119321 3300036647 Bacteria 1763
504 Ga0316584_0005768 3300036712 Bacteria 8344
505 Ga0316584_0006427 3300036712 Bacteria 7957
506 Ga0316584_0028260 3300036712 Bacteria 4133
507 Ga0316584_0056631 3300036712 Bacteria 2934
508 Ga0373925_0341859 3300037068 Bacteria 1214
509 Ga0373925_0916629 3300037068 Bacteria 722
510 Ga0395900_0685437 3300037418 Bacteria 959
511 Ga0395898_1280448 3300037466 Bacteria 663
512 Ga0395905_0001958 3300037471 Bacteria 23568
513 Ga0436364_0814508 3300037853 Bacteria 6441
514 Ga0395901_0038670 3300038443 Bacteria 4935
515 Ga0395901_0104465 3300038443 Bacteria 2973
516 Ga0395901_0155976 3300038443 Bacteria 2398
517 Ga0395901_0398040 3300038443 Bacteria 1415
518 Ga0436365_0301162 3300039437 Bacteria 3663
519 Ga0436363_1309788 3300039450 Bacteria 672
520 Ga0436363_1589930 3300039450 Bacteria 683
521 Ga0439436_0010782 3300041404 Bacteria 2784
522 Ga0439436_0018666 3300041404 Bacteria 2073
523 Ga0439436_0076691 3300041404 Bacteria 931
524 Ga0439438_073999 3300041405 Bacteria 841
525 Ga0439439_0003849 3300041406 Bacteria 3337
526 Ga0439439_0123106 3300041406 Bacteria 724
527 Ga0439447_012773 3300041407 Bacteria 2402
528 Ga0439447_032115 3300041407 Bacteria 1314
529 Ga0439461_0007746 3300041410 Bacteria 1912
530 Ga0439461_0020941 3300041410 Bacteria 1299
531 Ga0439466_0070440 3300041411 Bacteria 1114
532 Ga0439466_0101741 3300041411 Bacteria 895
533 Ga0439465_0012312 3300041413 Bacteria 2677
534 Ga0451800_0803309 3300041459 Unclassified 899
535 Ga0451802_1269109 3300041460 Bacteria 1025
536 Ga0451833_0080370 3300041491 Bacteria 845
537 Ga0451837_1419958 3300041494 Bacteria 1653
538 Ga0451845_0914589 3300041501 Bacteria 793
539 Ga0451847_0013531 3300041503 Bacteria 675
540 Ga0451849_0339851 3300041505 Bacteria 3606
541 Ga0451843_0253762 3300041509 Bacteria 760
542 Ga0451843_1206146 3300041509 Bacteria 584
543 Ga0451843_1772571 3300041509 Bacteria 599
544 Ga0451853_0371860 3300041512 Bacteria 25651
545 Ga0451853_2463512 3300041512 Bacteria 1325
546 Ga0439431_0002697 3300041997 Bacteria 3901
547 Ga0439431_0025503 3300041997 Bacteria 1444
548 Ga0439433_0006460 3300041999 Bacteria 2522
549 Ga0439433_0025770 3300041999 Bacteria 1329
550 Ga0439433_0056272 3300041999 Bacteria 933
551 Ga0439433_0075693 3300041999 Bacteria 814
552 Ga0439442_020830 3300042002 Bacteria 1359
553 Ga0439442_038499 3300042002 Bacteria 1002
554 Ga0439445_0003652 3300042004 Bacteria 3454
555 Ga0439432_001430 3300042006 Bacteria 8979
556 Ga0439432_047206 3300042006 Bacteria 1351
557 Ga0439449_0000791 3300042007 Bacteria 12215
558 Ga0439449_0002046 3300042007 Bacteria 7942
559 Ga0439449_0012758 3300042007 Bacteria 3160
560 Ga0439452_003109 3300042010 Bacteria 5886
561 Ga0439452_038430 3300042010 Bacteria 1136
562 Ga0439457_018913 3300042014 Bacteria 1530
563 Ga0439457_025777 3300042014 Bacteria 1300
564 Ga0439457_026139 3300042014 Bacteria 1292
565 Ga0439462_0007236 3300042015 Bacteria 2776
566 Ga0439462_0012747 3300042015 Bacteria 2150
567 Ga0439462_0119658 3300042015 Bacteria 732
568 Ga0450897_018121 3300042128 Bacteria 737
569 Ga0450894_001632 3300042131 Bacteria 3168
570 Ga0450894_009610 3300042131 Bacteria 1255
571 Ga0450898_023986 3300042134 Bacteria 1088
572 Ga0450889_020336 3300042144 Bacteria 735
573 Ga0450906_030582 3300042145 Bacteria 952
574 Ga0450907_043258 3300042146 Bacteria 771
575 Ga0439446_0011919 3300042156 Bacteria 2368
576 Ga0439446_0247102 3300042156 Bacteria 614
577 Ga0439446_0345635 3300042156 Bacteria 529
578 Ga0450908_022151 3300042184 Bacteria 1114
579 Ga0450909_001800 3300042185 Bacteria 3017
580 Ga0439434_0012172 3300042435 Bacteria 2545
581 Ga0439434_0012407 3300042435 Bacteria 2521
582 Ga0439434_0092605 3300042435 Bacteria 968
583 Ga0439459_0151166 3300042438 Bacteria 607
584 Ga0439460_0151314 3300042461 Bacteria 774
585 Ga0450893_0016581 3300042532 Bacteria 1248
586 Ga0466969_0020496 3300044656 Bacteria 3423
587 Ga0466969_0045057 3300044656 Bacteria 2190
588 Ga0466972_0007057 3300044658 Bacteria 5637
589 Ga0466972_0013289 3300044658 Bacteria 4133
590 Ga0466972_0139847 3300044658 Bacteria 1139
591 Ga0466972_0621125 3300044658 Bacteria 511
592 Ga0466965_0446689 3300044683 Bacteria 719
593 Ga0466966_0012619 3300044684 Bacteria 5600
594 Ga0466966_0290131 3300044684 Bacteria 983
595 Ga0466961_0019506 3300044693 Bacteria 4361
596 Ga0466961_0026723 3300044693 Bacteria 3711
597 Ga0466961_0171730 3300044693 Bacteria 1348
598 Ga0466963_0023612 3300044694 Bacteria 3908
599 Ga0466963_0046778 3300044694 Bacteria 2854
600 Ga0466964_0045742 3300044706 Bacteria 1782
601 Ga0466964_0046761 3300044706 Bacteria 1765
602 Ga0466971_0013985 3300044719 Bacteria 3527
603 Ga0466971_0235231 3300044719 Bacteria 870
604 Ga0466968_0003477 3300044735 Bacteria 5823
605 Ga0466968_0013252 3300044735 Bacteria 3240
606 Ga0466968_0054924 3300044735 Bacteria 1708
607 Ga0466968_0170000 3300044735 Bacteria 1010
608 Ga0466970_0045561 3300044765 Bacteria 2336
609 Ga0466970_0109183 3300044765 Bacteria 1510
610 Ga0466970_0115115 3300044765 Bacteria 1470
611 Ga0466970_0165459 3300044765 Bacteria 1224
612 Ga0466970_0776843 3300044765 Bacteria 560
613 Ga0466957_0204418 3300044842 Bacteria 1298
614 Ga0466957_1301351 3300044842 Bacteria 527
615 Ga0466960_0011715 3300044901 Bacteria 3680
616 Ga0466960_0015043 3300044901 Bacteria 3329
617 Ga0466960_0061209 3300044901 Bacteria 1847
618 Ga0466960_0127334 3300044901 Bacteria 1340
619 Ga0466960_0538870 3300044901 Bacteria 687
620 Ga0466960_0562661 3300044901 Bacteria 673
621 Ga0466960_0602736 3300044901 Bacteria 652
622 Ga0466959_0027067 3300045049 Bacteria 4253
623 Ga0466959_0146439 3300045049 Bacteria 1666
624 Ga0466959_0361069 3300045049 Bacteria 990
625 Ga0451576_0861574 3300045051 Bacteria 951
626 Ga0466958_0001930 3300045836 Bacteria 10160
627 Ga0466958_0258283 3300045836 Bacteria 1115
628 Ga0466967_0042891 3300045976 Bacteria 3913
629 Ga0466967_0195376 3300045976 Bacteria 1914
630 Ga0466967_0219775 3300045976 Bacteria 1805
631 Ga0466967_0234972 3300045976 Bacteria 1746
632 Ga0466967_0331305 3300045976 Bacteria 1470
633 Ga0466967_0492976 3300045976 Bacteria 1201
634 Ga0466967_0499147 3300045976 Bacteria 1194
635 Ga0466967_0877783 3300045976 Bacteria 892
636 Ga0466967_2036727 3300045976 Bacteria 571
637 Ga0495617_007078 3300046452 Bacteria 3912
638 Ga0495627_031049 3300046453 Bacteria 1690
639 Ga0495592_0046118 3300046454 Bacteria 3249
640 Ga0495592_0236177 3300046454 Bacteria 1215
641 Ga0495603_0011194 3300046455 Bacteria 5437
642 Ga0495603_0020447 3300046455 Bacteria 4011
643 Ga0495603_0064159 3300046455 Bacteria 2166
644 Ga0495590_0101900 3300046457 Bacteria 1020
645 Ga0495629_0000826 3300046459 Bacteria 25106
646 Ga0495629_0089285 3300046459 Bacteria 2150
647 Ga0495629_0129549 3300046459 Bacteria 1757
648 Ga0495629_0183071 3300046459 Bacteria 1452
649 Ga0495638_0134535 3300046460 Bacteria 1449
650 Ga0495651_0039768 3300046462 Bacteria 3659
651 Ga0495651_0067319 3300046462 Bacteria 2732
652 Ga0495651_0551112 3300046462 Bacteria 732
653 Ga0495653_0532159 3300046463 Bacteria 729
654 Ga0495653_0811526 3300046463 Bacteria 562
655 Ga0495650_0004071 3300046471 Bacteria 10225
656 Ga0495650_0122923 3300046471 Bacteria 954
657 Ga0495580_0274634 3300046472 Bacteria 1150
658 Ga0495582_0080172 3300046473 Bacteria 1812
659 Ga0495605_0003700 3300046474 Bacteria 9072
660 Ga0495639_0001006 3300046475 Bacteria 12734
661 Ga0495639_0003852 3300046475 Bacteria 6445
662 Ga0495662_0005228 3300046476 Bacteria 6506
663 Ga0495664_0556275 3300046477 Bacteria 683
664 Ga0495584_0133047 3300046491 Bacteria 1262
665 Ga0495594_0000177 3300046499 Bacteria 30788
666 Ga0495594_0139607 3300046499 Bacteria 1374
667 Ga0495583_0059830 3300046506 Bacteria 1705
668 Ga0495606_0016399 3300046507 Bacteria 5650
669 Ga0495608_0090288 3300046511 Bacteria 1982
670 Ga0495608_0222705 3300046511 Bacteria 1183
671 Ga0495610_0060642 3300046512 Bacteria 1800
672 Ga0495616_0018753 3300046513 Bacteria 3790
673 Ga0495618_0050137 3300046514 Bacteria 2636
674 Ga0495620_0050344 3300046515 Bacteria 1777
675 Ga0495628_0066026 3300046516 Bacteria 2828
676 Ga0495628_0321781 3300046516 Bacteria 1141
677 Ga0495628_0740758 3300046516 Bacteria 691
678 Ga0495630_0684128 3300046517 Bacteria 785
679 Ga0495631_0005737 3300046518 Bacteria 6475
680 Ga0495632_0170772 3300046519 Bacteria 999
681 Ga0495643_0005063 3300046522 Bacteria 9017
682 Ga0495643_0095385 3300046522 Bacteria 1530
683 Ga0495648_0013270 3300046524 Bacteria 6102
684 Ga0495663_0009814 3300046525 Bacteria 2658
685 Ga0495666_0010356 3300046526 Bacteria 4647
686 Ga0495642_0010168 3300046528 Bacteria 3604
687 Ga0495642_0532180 3300046528 Bacteria 521
688 Ga0495652_0012460 3300046529 Bacteria 7666
689 Ga0495654_0078989 3300046530 Bacteria 1546
690 Ga0495665_0593313 3300046531 Bacteria 554
691 Ga0495640_0009264 3300046533 Bacteria 7675
692 Ga0495640_0145921 3300046533 Bacteria 1522
693 Ga0495586_0089819 3300046535 Bacteria 1696
694 Ga0495586_0470595 3300046535 Bacteria 725
695 Ga0495587_0419179 3300046536 Bacteria 743
696 Ga0495621_0322780 3300046539 Bacteria 643
697 Ga0495645_0160416 3300046543 Bacteria 1555
698 Ga0495645_0287484 3300046543 Bacteria 1079
699 Ga0495645_0358971 3300046543 Bacteria 937
700 Ga0495622_0047154 3300046557 Bacteria 2002
701 Ga0495622_0065903 3300046557 Bacteria 1674
702 Ga0495622_0101223 3300046557 Bacteria 1320
703 Ga0495633_0042904 3300046558 Bacteria 2146
704 Ga0495633_0573919 3300046558 Bacteria 507
705 Ga0495656_0000073 3300046615 Bacteria 44754
706 Ga0495668_0012473 3300046616 Bacteria 5038
707 Ga0495634_0044708 3300046642 Bacteria 2996
708 Ga0495611_0046736 3300046648 Bacteria 1941
709 Ga0495625_0038753 3300046660 Bacteria 3486
710 Ga0495625_0183547 3300046660 Bacteria 1389
711 Ga0495635_0021267 3300046663 Bacteria 4522
712 Ga0495635_0335406 3300046663 Bacteria 1010
713 Ga0495659_0370794 3300046664 Bacteria 614
714 Ga0495661_0029347 3300046665 Bacteria 3511
715 Ga0495588_0002150 3300046674 Bacteria 8432
716 Ga0495588_0089506 3300046674 Bacteria 1612
717 Ga0495588_0096693 3300046674 Bacteria 1549
718 Ga0495588_0242631 3300046674 Bacteria 950
719 Ga0495588_0543978 3300046674 Bacteria 608
720 Ga0495657_0099059 3300046675 Bacteria 1859
721 Ga0495599_0271547 3300046678 Bacteria 1029
722 Ga0495599_0275980 3300046678 Bacteria 1019
723 Ga0495599_0554923 3300046678 Bacteria 672
724 Ga0495623_0047241 3300046679 Bacteria 2732
725 Ga0495658_0060684 3300046683 Bacteria 2169
726 Ga0495658_0438519 3300046683 Bacteria 834
727 Ga0495669_0383665 3300046684 Bacteria 680
728 Ga0495613_0021244 3300046689 Bacteria 4841
729 Ga0495613_0170537 3300046689 Bacteria 1544
730 Ga0495613_0570427 3300046689 Bacteria 755
731 Ga0495624_0021994 3300046690 Bacteria 4222
732 Ga0495624_0065203 3300046690 Bacteria 2275
733 Ga0495624_0699164 3300046690 Bacteria 602
734 Ga0495670_0129399 3300046691 Bacteria 1315
735 Ga0495649_0031727 3300046694 Bacteria 2912
736 Ga0495589_0212769 3300046794 Bacteria 910
737 Ga0495600_0125983 3300046809 Bacteria 1666
738 Ga0495600_0166548 3300046809 Bacteria 1423
739 Ga0495660_0208771 3300046810 Bacteria 927
740 Ga0495581_0094891 3300047315 Bacteria 1732
741 Ga0495581_0235632 3300047315 Bacteria 1070
742 Ga0495604_0151764 3300047317 Bacteria 1645
743 Ga0495604_0225515 3300047317 Bacteria 1288
744 Ga0495604_0625339 3300047317 Bacteria 688
745 Ga0495636_0009829 3300047318 Bacteria 3767
746 Ga0495636_0063959 3300047318 Bacteria 1560
747 Ga0495636_0367052 3300047318 Bacteria 681
748 Ga0495674_0066221 3300047319 Bacteria 3135
749 Ga0495674_0108554 3300047319 Bacteria 2354
750 Ga0495676_0008000 3300047321 Bacteria 9694
751 Ga0495676_0066306 3300047321 Bacteria 2798
752 Ga0495676_0105305 3300047321 Bacteria 2080
753 Ga0495680_0091481 3300047322 Bacteria 2280
754 Ga0495687_001616 3300047443 Bacteria 20319
755 Ga0495687_055125 3300047443 Bacteria 1663
756 Ga0495687_084167 3300047443 Bacteria 1236
757 Ga0495675_0006543 3300047444 Bacteria 7134
758 Ga0495675_0668309 3300047444 Bacteria 584
759 Ga0495677_0046213 3300047445 Bacteria 1598
760 Ga0495677_0351579 3300047445 Bacteria 582
761 Ga0495685_001871 3300047447 Bacteria 6504
762 Ga0495685_005147 3300047447 Bacteria 4258
763 Ga0495681_0064080 3300047470 Bacteria 1685
764 Ga0495681_0198968 3300047470 Bacteria 814
765 Ga0495684_0130016 3300047471 Bacteria 1892
766 Ga0495686_0111878 3300047472 Bacteria 1636
767 Ga0495686_0498386 3300047472 Bacteria 642
768 Ga0495686_0509102 3300047472 Bacteria 633
769 Ga0495686_0568431 3300047472 Bacteria 590
770 Ga0495593_0090469 3300047673 Bacteria 1576
771 Ga0495593_0096633 3300047673 Bacteria 1517
772 Ga0495602_0446839 3300048088 Bacteria 913
773 Ga0495614_0033238 3300048089 Bacteria 2219
774 Ga0495626_0111202 3300048091 Bacteria 1186
775 Ga0495626_0115705 3300048091 Bacteria 1157
776 Ga0496100_0003006 3300048903 Bacteria 8695
777 Ga0496100_0009927 3300048903 Bacteria 5369
778 Ga0496100_0262922 3300048903 Bacteria 1280
779 Ga0496101_0003437 3300048904 Bacteria 9883
780 Ga0496101_0003632 3300048904 Bacteria 9631
781 Ga0496101_0005647 3300048904 Bacteria 7980
782 Ga0496101_0296101 3300048904 Bacteria 1267
783 Ga0496101_0342137 3300048904 Bacteria 1175
784 Ga0496101_0378587 3300048904 Bacteria 1113
785 Ga0496101_0441698 3300048904 Bacteria 1026
786 Ga0496101_1078930 3300048904 Bacteria 631
787 Ga0496102_0000044 3300048905 Bacteria 187834
788 Ga0496102_0005443 3300048905 Bacteria 10797
789 Ga0496102_0014277 3300048905 Bacteria 6902
790 Ga0496102_0074466 3300048905 Bacteria 3121
791 Ga0496102_0347129 3300048905 Bacteria 1397
792 Ga0496102_1100422 3300048905 Bacteria 714
793 Ga0496103_0000123 3300048906 Bacteria 83794
794 Ga0496103_0002209 3300048906 Bacteria 12338
795 Ga0496103_0029536 3300048906 Bacteria 3332
796 Ga0496103_0085105 3300048906 Bacteria 1992
797 Ga0496103_0108051 3300048906 Bacteria 1765
798 Ga0496104_0001352 3300048907 Bacteria 21226
799 Ga0496104_0013914 3300048907 Bacteria 7259
800 Ga0496104_0037452 3300048907 Bacteria 4536
801 Ga0496104_0040299 3300048907 Bacteria 4378
802 Ga0496104_0069434 3300048907 Bacteria 3349
803 Ga0496104_0647129 3300048907 Bacteria 966
804 Ga0496104_1466524 3300048907 Bacteria 585
805 Ga0496105_0001642 3300048908 Bacteria 15921
806 Ga0496105_0062883 3300048908 Bacteria 3062
807 Ga0496105_0111863 3300048908 Bacteria 2253
808 Ga0496105_0148916 3300048908 Bacteria 1924
809 Ga0496105_0242187 3300048908 Bacteria 1463
810 Ga0496105_1003590 3300048908 Bacteria 624
811 Ga0496105_1196171 3300048908 Bacteria 560
812 Ga0496106_0003811 3300048909 Bacteria 11238
813 Ga0496106_0131730 3300048909 Bacteria 1961
814 Ga0496106_0167838 3300048909 Bacteria 1738
815 Ga0496106_0187073 3300048909 Bacteria 1645
816 Ga0496107_0005200 3300048910 Bacteria 8888
817 Ga0496107_0017687 3300048910 Bacteria 5016
818 Ga0496107_0300023 3300048910 Bacteria 1196
819 Ga0496107_0477407 3300048910 Bacteria 925
820 Ga0496108_0001073 3300048911 Bacteria 21338
821 Ga0496108_0010591 3300048911 Bacteria 7484
822 Ga0496108_0221656 3300048911 Bacteria 1643
823 Ga0496108_1160860 3300048911 Bacteria 654
824 Ga0496109_0001427 3300048912 Bacteria 19839
825 Ga0496109_0031889 3300048912 Bacteria 4734
826 Ga0496109_0032893 3300048912 Bacteria 4665
827 Ga0496109_0158597 3300048912 Bacteria 2119
828 Ga0496109_0291856 3300048912 Bacteria 1537
829 Ga0496109_0308043 3300048912 Bacteria 1494
830 Ga0496109_0945495 3300048912 Bacteria 800
831 Ga0496110_0019879 3300048913 Bacteria 5660
832 Ga0496110_0091020 3300048913 Bacteria 2728
833 Ga0496110_0114355 3300048913 Bacteria 2428
834 Ga0496110_0114747 3300048913 Bacteria 2424
835 Ga0496110_0118502 3300048913 Bacteria 2384
836 Ga0496110_0212754 3300048913 Bacteria 1758
837 Ga0496110_0632040 3300048913 Bacteria 970
838 Ga0496110_1347307 3300048913 Bacteria 623
839 Ga0496111_0002651 3300048914 Bacteria 10848
840 Ga0496111_0088090 3300048914 Bacteria 2273
841 Ga0496111_0102392 3300048914 Bacteria 2105
842 Ga0496112_0105661 3300048915 Bacteria 2785
843 Ga0496112_0144537 3300048915 Bacteria 2347
844 Ga0496112_0903852 3300048915 Bacteria 805
845 Ga0496113_0172971 3300048916 Bacteria 1711
846 Ga0496113_0271922 3300048916 Bacteria 1354
847 Ga0496113_1190826 3300048916 Bacteria 595
848 Ga0496114_0003033 3300048917 Bacteria 12879
849 Ga0496114_0014718 3300048917 Bacteria 6286
850 Ga0496114_0025803 3300048917 Bacteria 4806
851 Ga0496114_0028600 3300048917 Bacteria 4575
852 Ga0496114_0085365 3300048917 Bacteria 2674
853 Ga0496114_0093689 3300048917 Bacteria 2554
854 Ga0496114_0159218 3300048917 Bacteria 1962
855 Ga0496114_0160327 3300048917 Bacteria 1955
856 Ga0496114_1177035 3300048917 Bacteria 652
857 Ga0496114_1519473 3300048917 Bacteria 557
858 Ga0496115_0018895 3300048918 Bacteria 5300
859 Ga0496115_0217946 3300048918 Bacteria 1575
860 Ga0496117_0345407 3300048920 Bacteria 770
861 Ga0496118_0106977 3300048921 Bacteria 1869
862 Ga0496119_0015393 3300048922 Bacteria 5893
863 Ga0496121_0008995 3300048924 Bacteria 11580
864 Ga0496121_0711222 3300048924 Bacteria 603
865 Ga0496122_0260143 3300048925 Bacteria 964
866 Ga0496125_0519795 3300048928 Bacteria 666
867 Ga0496126_0000026 3300048929 Bacteria 422310
868 Ga0495678_040874 3300049459 Bacteria 1860
869 Ga0501320_019591 3300049536 Bacteria 773
870 Ga0501325_056979 3300049541 Bacteria 509
871 Ga0501031_0023018 3300049568 Bacteria 4063
872 Ga0501031_0073073 3300049568 Bacteria 2233
873 Ga0501031_0343690 3300049568 Bacteria 966
874 Ga0501032_0173014 3300049569 Bacteria 1415
875 Ga0501032_0320542 3300049569 Bacteria 1000
876 Ga0501033_0189168 3300049570 Bacteria 1474
877 Ga0501033_0192909 3300049570 Bacteria 1457
878 Ga0501034_0023509 3300049571 Bacteria 6280
879 Ga0501034_0481555 3300049571 Bacteria 1156
880 Ga0501034_0742682 3300049571 Bacteria 877
881 Ga0501034_1332925 3300049571 Bacteria 594
882 Ga0501036_0166222 3300049572 Bacteria 1860
883 Ga0501036_0632376 3300049572 Bacteria 887
884 Ga0501037_0014653 3300049573 Bacteria 5769
885 Ga0501037_0640389 3300049573 Bacteria 711
886 Ga0501038_0528442 3300049574 Bacteria 899
887 Ga0501039_0037309 3300049575 Bacteria 3750
888 Ga0501039_0068441 3300049575 Bacteria 2757
889 Ga0501039_0335445 3300049575 Bacteria 1188
890 Ga0501040_0063758 3300049576 Bacteria 2536
891 Ga0501040_0273327 3300049576 Bacteria 1207
892 Ga0501040_0725630 3300049576 Bacteria 719
893 Ga0501041_0027304 3300049577 Bacteria 3440
894 Ga0501041_0048489 3300049577 Bacteria 2587
895 Ga0501041_0249025 3300049577 Bacteria 1117
896 Ga0501042_0048239 3300049578 Bacteria 3037
897 Ga0501042_0064138 3300049578 Bacteria 2625
898 Ga0501042_0406136 3300049578 Bacteria 987
899 Ga0501042_0548212 3300049578 Bacteria 840
900 Ga0501043_0053889 3300049579 Bacteria 3158
901 Ga0501043_0291779 3300049579 Bacteria 1248
902 Ga0501043_0675573 3300049579 Bacteria 756
903 Ga0501046_0045749 3300049580 Bacteria 3475
904 Ga0501046_0459756 3300049580 Bacteria 915
905 Ga0501046_1274242 3300049580 Bacteria 503
906 Ga0501047_0039795 3300049581 Bacteria 4547
907 Ga0501048_0025305 3300049582 Bacteria 4325
908 Ga0501048_0132673 3300049582 Bacteria 1760
909 Ga0501067_0222949 3300049583 Bacteria 1050
910 Ga0501068_0218630 3300049584 Bacteria 1211
911 Ga0501069_0324543 3300049585 Bacteria 905
912 Ga0501070_0003499 3300049586 Bacteria 13603
913 Ga0501070_1334663 3300049586 Bacteria 547
914 Ga0501071_0080329 3300049587 Bacteria 2384
915 Ga0501071_0246643 3300049587 Bacteria 1347
916 Ga0501071_0440933 3300049587 Bacteria 996
917 Ga0501072_0016033 3300049588 Bacteria 5746
918 Ga0501072_0019727 3300049588 Bacteria 5215
919 Ga0501072_0617195 3300049588 Bacteria 854
920 Ga0501074_0137136 3300049590 Bacteria 1750
921 Ga0501074_0450420 3300049590 Bacteria 913
922 Ga0501074_1290099 3300049590 Bacteria 512
923 Ga0501075_0121026 3300049591 Bacteria 1992
924 Ga0501075_0156975 3300049591 Bacteria 1735
925 Ga0501076_0037194 3300049592 Bacteria 3816
926 Ga0501076_0121735 3300049592 Bacteria 2113
927 Ga0501076_0433121 3300049592 Bacteria 1082
928 Ga0501076_0553768 3300049592 Bacteria 948
929 Ga0501077_0039288 3300049593 Bacteria 3014
930 Ga0501077_0147522 3300049593 Bacteria 1492
931 Ga0501077_0694437 3300049593 Bacteria 654
932 Ga0501079_0068644 3300049741 Bacteria 2736
933 Ga0501080_0328331 3300049742 Bacteria 1384
934 Ga0501081_0038825 3300049743 Bacteria 3256
935 Ga0501081_0164928 3300049743 Bacteria 1598
936 Ga0501081_1278983 3300049743 Bacteria 556
937 Ga0501083_0201281 3300049744 Bacteria 1299
938 Ga0501083_0708608 3300049744 Bacteria 655
939 Ga0501035_0035383 3300049822 Bacteria 4532
940 Ga0501044_0000854 3300049823 Bacteria 36617
941 Ga0501044_0426551 3300049823 Bacteria 1235
942 Ga0501045_0077963 3300049824 Bacteria 2442
943 Ga0501045_0118141 3300049824 Bacteria 1968
944 Ga0501045_0298601 3300049824 Bacteria 1199
945 Ga0501045_0345218 3300049824 Bacteria 1108
946 nmdc:mga03683_304756_c1 3300050489 Bacteria 748
947 nmdc:mga03683_508175_c1 3300050489 Bacteria 584
948 nmdc:mga03n38_27148_c1 3300050490 Bacteria 2372
949 nmdc:mga03n38_6707_c1 3300050490 Bacteria 4023
950 nmdc:mga03n38_911639_c1 3300050490 Bacteria 517
951 nmdc:mga0yw44_43246_c1 3300050492 Bacteria 2689
952 nmdc:mga0yw44_521209_c1 3300050492 Bacteria 807
953 nmdc:mga0yw44_84242_c1 3300050492 Bacteria 1998
954 nmdc:mga0k408_250805_c1 3300050493 Bacteria 1057
955 nmdc:mga0k408_26286_c1 3300050493 Bacteria 3299
956 nmdc:mga0k408_743818_c1 3300050493 Bacteria 573
957 nmdc:mga06z11_308684_c1 3300050494 Bacteria 942
958 nmdc:mga06z11_338566_c1 3300050494 Bacteria 899
959 nmdc:mga04h51_114965_c1 3300050495 Bacteria 996
960 nmdc:mga07m45_542831_c1 3300050496 Bacteria 672
961 nmdc:mga07m45_64778_c1 3300050496 Bacteria 2074
962 nmdc:mga05p37_1106233_c1 3300050507 Bacteria 829
963 nmdc:mga05p37_391874_c1 3300050507 Bacteria 1624
964 nmdc:mga05p37_63568_c1 3300050507 Bacteria 4542
965 nmdc:mga0qj67_104126_c1 3300050509 Bacteria 2289
966 nmdc:mga06r32_116320_c1 3300050510 Bacteria 2634
967 nmdc:mga0n895_18784_c1 3300050512 Bacteria 5880
968 nmdc:mga0rr50_14251_c1 3300050513 Bacteria 5207
969 nmdc:mga0a205_98967_c2 3300050515 Bacteria 1883
970 nmdc:mga0sz30_353798_c1 3300050516 Bacteria 656
971 Ga0495619_0162262 3300053085 Bacteria 1544
972 Ga0500643_215482 3300053087 Bacteria 515
973 Ga0500644_0018445 3300053088 Bacteria 2044
974 Ga0500646_0053454 3300053090 Bacteria 1171
975 Ga0500650_0174622 3300053098 Bacteria 986
976 Ga0500554_030720 3300053102 Bacteria 1581
977 Ga0500562_001750 3300053108 Bacteria 5417
978 Ga0500568_0180783 3300053139 Bacteria 775
979 Ga0500573_0143528 3300053140 Bacteria 1313
980 Ga0500586_004324 3300053145 Bacteria 3464
981 Ga0500590_031916 3300053148 Bacteria 2731
982 Ga0500600_0069878 3300053149 Bacteria 1929
983 Ga0500619_000013 3300053154 Bacteria 56987
984 Ga0501084_0017861 3300054114 Bacteria 5905
985 Ga0501084_0119084 3300054114 Bacteria 2219
986 Ga0590071_002328 3300059421 Bacteria 4799
987 Ga0501082_0079810 3300060353 Bacteria 2824
988 Ga0501082_0575828 3300060353 Bacteria 985
989 Ga0466962_0026001 3300061719 Bacteria 2810
990 Ga0466962_0182206 3300061719 Bacteria 1024
991 Ga0466962_0204940 3300061719 Bacteria 964
992 Ga0530510_0035937 3300061734 Bacteria 3571
993 Ga0530510_0370493 3300061734 Bacteria 1077
994 Ga0530510_0474942 3300061734 Bacteria 947
995 Ga0530510_1295287 3300061734 Bacteria 559

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030522 Ga0307512_10053040 Ga0307512_100530403 107
2 3300031456 Ga0307513_10098869 Ga0307513_100988692 107
3 3300031649 Ga0307514_10108568 Ga0307514_101085682 107
4 3300041494 Ga0451837_1419958 Ga0451837_1419958_837_1235 107
5 3300046660 Ga0495625_0038753 Ga0495625_0038753_2258_2656 107
6 3300053149 Ga0500600_0069878 Ga0500600_0069878_1334_1732 107
7 3300049541 Ga0501325_056979 Ga0501325_056979_123_494 112
8 3300028379 Ga0268266_11108744 Ga0268266_111087442 116
9 3300053140 Ga0500573_0143528 Ga0500573_0143528_554_952 117
10 3300014969 Ga0157376_10894255 Ga0157376_108942552 118
11 3300047472 Ga0495686_0498386 Ga0495686_0498386_30_392 118
12 3300049586 Ga0501070_0003499 Ga0501070_0003499_13229_13591 118
13 3300053102 Ga0500554_030720 Ga0500554_030720_111_491 118
14 3300044842 Ga0466957_1301351 Ga0466957_1301351_50_448 119
15 3300048913 Ga0496110_0632040 Ga0496110_0632040_17_382 119
16 iso_pu_bacteria 2728369276 2729905317 119
17 3300005617 Ga0068859_100111455 Ga0068859_1001114554 120
18 3300005719 Ga0068861_101379145 Ga0068861_1013791452 120
19 3300006931 Ga0097620_100111448 Ga0097620_1001114484 120
20 3300009101 Ga0105247_10006155 Ga0105247_100061559 120
21 3300009147 Ga0114129_10678086 Ga0114129_106780861 120
22 3300009148 Ga0105243_10051593 Ga0105243_100515934 120
23 3300013296 Ga0157374_10208145 Ga0157374_102081452 120
24 3300025898 Ga0207692_10000532 Ga0207692_100005329 120
25 3300025900 Ga0207710_10005704 Ga0207710_100057042 120
26 3300025944 Ga0207661_10237536 Ga0207661_102375362 120
27 3300026121 Ga0207683_10665235 Ga0207683_106652352 120
28 3300026142 Ga0207698_11084800 Ga0207698_110848002 120
29 3300030731 Ga0316177_1113942 Ga0316177_11139422 120
30 3300032005 Ga0307411_10000850 Ga0307411_100008502 120
31 3300035398 Ga0316574_0325191 Ga0316574_0325191_274_654 120
32 3300036712 Ga0316584_0028260 Ga0316584_0028260_2114_2488 120
33 3300037068 Ga0373925_0916629 Ga0373925_0916629_65_433 120
34 3300041459 Ga0451800_0803309 Ga0451800_0803309_255_623 120
35 3300044658 Ga0466972_0013289 Ga0466972_0013289_1846_2226 120
36 3300044658 Ga0466972_0621125 Ga0466972_0621125_16_384 120
37 3300044683 Ga0466965_0446689 Ga0466965_0446689_280_660 120
38 3300044735 Ga0466968_0013252 Ga0466968_0013252_1898_2278 120
39 3300044765 Ga0466970_0109183 Ga0466970_0109183_1090_1458 120
40 3300044901 Ga0466960_0538870 Ga0466960_0538870_307_675 120
41 3300044901 Ga0466960_0602736 Ga0466960_0602736_98_466 120
42 3300045976 Ga0466967_0492976 Ga0466967_0492976_747_1115 120
43 3300046459 Ga0495629_0129549 Ga0495629_0129549_14_382 120
44 3300046794 Ga0495589_0212769 Ga0495589_0212769_37_405 120
45 3300048091 Ga0495626_0111202 Ga0495626_0111202_808_1176 120
46 3300048905 Ga0496102_0000044 Ga0496102_0000044_17919_18317 120
47 3300048906 Ga0496103_0000123 Ga0496103_0000123_66242_66640 120
48 3300048920 Ga0496117_0345407 Ga0496117_0345407_141_539 120
49 3300048921 Ga0496118_0106977 Ga0496118_0106977_1398_1796 120
50 3300048922 Ga0496119_0015393 Ga0496119_0015393_4391_4789 120
51 3300049572 Ga0501036_0166222 Ga0501036_0166222_856_1254 120
52 3300049576 Ga0501040_0725630 Ga0501040_0725630_340_708 120
53 3300049587 Ga0501071_0440933 Ga0501071_0440933_313_693 120
54 3300049590 Ga0501074_0450420 Ga0501074_0450420_288_686 120
55 3300049591 Ga0501075_0121026 Ga0501075_0121026_125_505 120
56 3300049592 Ga0501076_0433121 Ga0501076_0433121_30_410 120
57 3300049593 Ga0501077_0694437 Ga0501077_0694437_216_596 120
58 3300049824 Ga0501045_0298601 Ga0501045_0298601_543_923 120
59 3300050507 nmdc:mga05p37_391874_c1 nmdc:mga05p37_391874_c1_1212_1598 120
60 3300061734 Ga0530510_0370493 Ga0530510_0370493_45_425 120
61 3300005983 Ga0081540_1007386 Ga0081540_10073864 121
62 3300005983 Ga0081540_1016146 Ga0081540_10161462 121
63 3300009036 Ga0105244_10197529 Ga0105244_101975292 121
64 3300009147 Ga0114129_10942226 Ga0114129_109422262 121
65 3300009177 Ga0105248_10038947 Ga0105248_100389476 121
66 3300035112 Ga0373932_0025237 Ga0373932_0025237_921_1292 121
67 3300035172 Ga0373955_1000875 Ga0373955_1000875_22_393 121
68 3300035398 Ga0316574_0007588 Ga0316574_0007588_2685_3056 121
69 3300036647 Ga0316582_0001290 Ga0316582_0001290_3168_3539 121
70 3300036712 Ga0316584_0006427 Ga0316584_0006427_5011_5382 121
71 3300042461 Ga0439460_0151314 Ga0439460_0151314_299_670 121
72 3300044735 Ga0466968_0003477 Ga0466968_0003477_3045_3416 121
73 3300045051 Ga0451576_0861574 Ga0451576_0861574_86_457 121
74 3300046511 Ga0495608_0090288 Ga0495608_0090288_645_1016 121
75 3300046684 Ga0495669_0383665 Ga0495669_0383665_294_665 121
76 3300049572 Ga0501036_0632376 Ga0501036_0632376_458_856 121
77 3300050489 nmdc:mga03683_508175_c1 nmdc:mga03683_508175_c1_63_434 121
78 3300050507 nmdc:mga05p37_1106233_c1 nmdc:mga05p37_1106233_c1_332_703 121
79 3300005467 Ga0070706_100090329 Ga0070706_1000903292 122
80 3300005468 Ga0070707_100062969 Ga0070707_1000629692 122
81 3300014969 Ga0157376_10984409 Ga0157376_109844092 122
82 3300025922 Ga0207646_10168149 Ga0207646_101681493 122
83 3300025931 Ga0207644_11043055 Ga0207644_110430552 122
84 3300049536 Ga0501320_019591 Ga0501320_019591_321_722 122
85 3300013307 Ga0157372_11219675 Ga0157372_112196752 123
86 3300026142 Ga0207698_11321224 Ga0207698_113212242 123
87 3300041410 Ga0439461_0020941 Ga0439461_0020941_341_718 123
88 3300045976 Ga0466967_0331305 Ga0466967_0331305_531_908 123
89 3300045976 Ga0466967_0877783 Ga0466967_0877783_254_640 123
90 3300049568 Ga0501031_0023018 Ga0501031_0023018_426_803 123
91 3300049571 Ga0501034_1332925 Ga0501034_1332925_21_398 123
92 3300049575 Ga0501039_0068441 Ga0501039_0068441_2158_2535 123
93 3300049577 Ga0501041_0027304 Ga0501041_0027304_470_847 123
94 3300049578 Ga0501042_0048239 Ga0501042_0048239_1734_2111 123
95 3300049582 Ga0501048_0132673 Ga0501048_0132673_988_1365 123
96 3300049587 Ga0501071_0080329 Ga0501071_0080329_1705_2082 123
97 3300049588 Ga0501072_0019727 Ga0501072_0019727_2498_2875 123
98 3300049588 Ga0501072_0617195 Ga0501072_0617195_86_463 123
99 3300049590 Ga0501074_0137136 Ga0501074_0137136_1363_1740 123
100 3300049592 Ga0501076_0121735 Ga0501076_0121735_991_1368 123
101 3300049743 Ga0501081_0038825 Ga0501081_0038825_2753_3130 123
102 3300049743 Ga0501081_1278983 Ga0501081_1278983_16_393 123
103 3300049824 Ga0501045_0118141 Ga0501045_0118141_413_790 123
104 3300054114 Ga0501084_0017861 Ga0501084_0017861_3320_3697 123
105 3300005841 Ga0068863_100146957 Ga0068863_1001469573 124
106 3300006038 Ga0075365_10071999 Ga0075365_100719992 124
107 3300006038 Ga0075365_10211734 Ga0075365_102117341 124
108 3300006038 Ga0075365_10220873 Ga0075365_102208732 124
109 3300006042 Ga0075368_10150401 Ga0075368_101504012 124
110 3300006048 Ga0075363_100592895 Ga0075363_1005928952 124
111 3300006051 Ga0075364_10029290 Ga0075364_100292901 124
112 3300006051 Ga0075364_10458701 Ga0075364_104587012 124
113 3300006178 Ga0075367_10390720 Ga0075367_103907202 124
114 3300006353 Ga0075370_10947642 Ga0075370_109476422 124
115 3300026088 Ga0207641_11333372 Ga0207641_113333722 124
116 3300031995 Ga0307409_100069879 Ga0307409_1000698793 124
117 3300050490 nmdc:mga03n38_6707_c1 nmdc:mga03n38_6707_c1_799_1179 124
118 3300050492 nmdc:mga0yw44_43246_c1 nmdc:mga0yw44_43246_c1_1654_2034 124
119 3300050492 nmdc:mga0yw44_521209_c1 nmdc:mga0yw44_521209_c1_133_513 124
120 3300050494 nmdc:mga06z11_308684_c1 nmdc:mga06z11_308684_c1_341_721 124
121 3300050496 nmdc:mga07m45_64778_c1 nmdc:mga07m45_64778_c1_296_676 124
122 3300002077 JGI24744J21845_10008927 JGI24744J21845_100089272 125
123 iso_pu_bacteria 2558860280 2559426176 126
124 iso_pu_bacteria 2616644814 2616693470 126
125 iso_pu_bacteria 2643221711 2644607862 126
126 iso_pu_bacteria 2738543013 2739247849 126
127 iso_pu_bacteria 2791355406 2793980085 126
128 iso_pu_bacteria 2842733646 2842734119 126
129 iso_pu_bacteria 2856858025 2856863314 126
130 iso_pu_bacteria 2858868258 2858874511 126
131 iso_pu_bacteria 2885192300 2885195364 126
132 iso_pu_bacteria 2899370129 2899372111 126
133 iso_pu_bacteria 2902582711 2902582960 126
134 iso_pu_bacteria 2919704043 2919704965 126
135 iso_pu_bacteria 2997600082 2997601797 126
136 iso_pu_bacteria 649633069 649814921 126
137 iso_pu_bacteria 8008574985 8008575993 126
138 iso_pu_bacteria 8047893842 8047900101 126
139 iso_pu_bacteria 8048356638 8048358826 126
140 iso_pu_bacteria 8048369669 8048377048 126
141 iso_pu_bacteria 8048379754 8048386103 126
142 iso_pu_bacteria 8056829672 8056834290 126
143 3300006038 Ga0075365_10271109 Ga0075365_102711092 127
144 3300026142 Ga0207698_10993240 Ga0207698_109932402 127
145 3300037853 Ga0436364_0814508 Ga0436364_0814508_1091_1492 127
146 3300044694 Ga0466963_0046778 Ga0466963_0046778_180_578 127
147 3300044706 Ga0466964_0045742 Ga0466964_0045742_619_1017 127
148 3300044719 Ga0466971_0013985 Ga0466971_0013985_206_604 127
149 3300044842 Ga0466957_0204418 Ga0466957_0204418_414_812 127
150 3300044901 Ga0466960_0011715 Ga0466960_0011715_2172_2570 127
151 3300045049 Ga0466959_0361069 Ga0466959_0361069_284_682 127
152 3300045976 Ga0466967_0234972 Ga0466967_0234972_1170_1568 127
153 3300048929 Ga0496126_0000026 Ga0496126_0000026_116303_116701 127
154 3300050492 nmdc:mga0yw44_84242_c1 nmdc:mga0yw44_84242_c1_34_423 127
155 3300061719 Ga0466962_0026001 Ga0466962_0026001_1438_1836 127
156 3300005366 Ga0070659_100152307 Ga0070659_1001523072 128
157 3300013250 Ga0171462_1004 Ga0171462_1004652 128
158 3300017792 Ga0163161_10098765 Ga0163161_100987654 128
159 3300025921 Ga0207652_11355563 Ga0207652_113555632 128
160 3300025932 Ga0207690_10419978 Ga0207690_104199781 128
161 3300031728 Ga0316578_10158789 Ga0316578_101587891 128
162 3300031824 Ga0307413_10481726 Ga0307413_104817262 128
163 3300031901 Ga0307406_10145830 Ga0307406_101458302 128
164 3300032139 Ga0316580_10010722 Ga0316580_100107221 128
165 3300035398 Ga0316574_0182618 Ga0316574_0182618_179_577 128
166 3300036647 Ga0316582_0119321 Ga0316582_0119321_221_619 128
167 3300037466 Ga0395898_1280448 Ga0395898_1280448_141_536 128
168 3300038443 Ga0395901_0155976 Ga0395901_0155976_517_912 128
169 3300041503 Ga0451847_0013531 Ga0451847_0013531_85_480 128
170 3300046543 Ga0495645_0287484 Ga0495645_0287484_388_837 128
171 3300048917 Ga0496114_0159218 Ga0496114_0159218_349_774 128
172 iso_pu_bacteria 2501939600 2501941712 128
173 3300002987 JGI25159J45721_1018451 JGI25159J45721_10184511 129
174 3300003781 Ga0055536_1021586 Ga0055536_10215862 129
175 3300003784 Ga0055534_1001074 Ga0055534_10010745 129
176 3300005262 Ga0065165_1023608 Ga0065165_10236083 129
177 3300013105 Ga0157369_10310155 Ga0157369_103101552 129
178 3300025284 Ga0209130_1006006 Ga0209130_10060062 129
179 3300025291 Ga0209675_1005102 Ga0209675_10051023 129
180 3300025292 Ga0209676_1006325 Ga0209676_10063252 129
181 3300025295 Ga0209564_1045945 Ga0209564_10459452 129
182 3300025298 Ga0209050_1064932 Ga0209050_10649322 129
183 3300025303 Ga0209051_1021425 Ga0209051_10214254 129
184 3300025304 Ga0209257_1021959 Ga0209257_10219592 129
185 3300049576 Ga0501040_0063758 Ga0501040_0063758_1164_1571 129
186 3300049580 Ga0501046_1274242 Ga0501046_1274242_80_475 129
187 3300049586 Ga0501070_1334663 Ga0501070_1334663_34_441 129
188 3300002067 JGI24735J21928_10172920 JGI24735J21928_101729202 130
189 3300002074 JGI24748J21848_1008115 JGI24748J21848_10081152 130
190 3300002244 JGI24742J22300_10001686 JGI24742J22300_100016863 130
191 3300003320 rootH2_10034964 rootH2_100349643 130
192 3300003322 rootL2_10026840 rootL2_100268402 130
193 3300005288 Ga0065714_10304250 Ga0065714_103042501 130
194 3300005293 Ga0065715_10265259 Ga0065715_102652592 130
195 3300005327 Ga0070658_10090488 Ga0070658_100904883 130
196 3300005328 Ga0070676_10070662 Ga0070676_100706622 130
197 3300005328 Ga0070676_10112415 Ga0070676_101124152 130
198 3300005330 Ga0070690_100371934 Ga0070690_1003719342 130
199 3300005331 Ga0070670_100449115 Ga0070670_1004491152 130
200 3300005331 Ga0070670_101161066 Ga0070670_1011610662 130
201 3300005331 Ga0070670_101206962 Ga0070670_1012069621 130
202 3300005335 Ga0070666_10140479 Ga0070666_101404792 130
203 3300005335 Ga0070666_10186907 Ga0070666_101869072 130
204 3300005336 Ga0070680_100413145 Ga0070680_1004131452 130
205 3300005337 Ga0070682_101082412 Ga0070682_1010824122 130
206 3300005337 Ga0070682_101673269 Ga0070682_1016732691 130
207 3300005338 Ga0068868_100016515 Ga0068868_1000165153 130
208 3300005338 Ga0068868_101073879 Ga0068868_1010738792 130
209 3300005338 Ga0068868_101465723 Ga0068868_1014657231 130
210 3300005339 Ga0070660_100207859 Ga0070660_1002078592 130
211 3300005339 Ga0070660_100805747 Ga0070660_1008057471 130
212 3300005340 Ga0070689_100025236 Ga0070689_1000252362 130
213 3300005341 Ga0070691_10225640 Ga0070691_102256402 130
214 3300005345 Ga0070692_10154673 Ga0070692_101546732 130
215 3300005347 Ga0070668_100018680 Ga0070668_1000186804 130
216 3300005347 Ga0070668_100332893 Ga0070668_1003328932 130
217 3300005353 Ga0070669_100064693 Ga0070669_1000646932 130
218 3300005353 Ga0070669_100244349 Ga0070669_1002443492 130
219 3300005354 Ga0070675_100173253 Ga0070675_1001732532 130
220 3300005354 Ga0070675_100356422 Ga0070675_1003564222 130
221 3300005354 Ga0070675_100793664 Ga0070675_1007936642 130
222 3300005355 Ga0070671_100766453 Ga0070671_1007664532 130
223 3300005356 Ga0070674_100008012 Ga0070674_1000080125 130
224 3300005356 Ga0070674_100021660 Ga0070674_1000216602 130
225 3300005356 Ga0070674_100341654 Ga0070674_1003416541 130
226 3300005356 Ga0070674_101411477 Ga0070674_1014114771 130
227 3300005364 Ga0070673_100042639 Ga0070673_1000426393 130
228 3300005364 Ga0070673_100575249 Ga0070673_1005752492 130
229 3300005364 Ga0070673_101812787 Ga0070673_1018127871 130
230 3300005366 Ga0070659_100407126 Ga0070659_1004071262 130
231 3300005366 Ga0070659_100413861 Ga0070659_1004138612 130
232 3300005367 Ga0070667_100027114 Ga0070667_1000271146 130
233 3300005367 Ga0070667_100036634 Ga0070667_1000366343 130
234 3300005434 Ga0070709_10199704 Ga0070709_101997042 130
235 3300005435 Ga0070714_100105406 Ga0070714_1001054064 130
236 3300005436 Ga0070713_100079692 Ga0070713_1000796923 130
237 3300005437 Ga0070710_10039279 Ga0070710_100392793 130
238 3300005438 Ga0070701_10017100 Ga0070701_100171001 130
239 3300005439 Ga0070711_100014147 Ga0070711_1000141472 130
240 3300005440 Ga0070705_100048274 Ga0070705_1000482742 130
241 3300005440 Ga0070705_100071395 Ga0070705_1000713952 130
242 3300005441 Ga0070700_100053452 Ga0070700_1000534522 130
243 3300005441 Ga0070700_100176358 Ga0070700_1001763581 130
244 3300005441 Ga0070700_100807657 Ga0070700_1008076572 130
245 3300005444 Ga0070694_100173161 Ga0070694_1001731611 130
246 3300005445 Ga0070708_102150063 Ga0070708_1021500631 130
247 3300005455 Ga0070663_100558960 Ga0070663_1005589602 130
248 3300005456 Ga0070678_100001294 Ga0070678_1000012948 130
249 3300005456 Ga0070678_100078800 Ga0070678_1000788004 130
250 3300005456 Ga0070678_100086545 Ga0070678_1000865454 130
251 3300005456 Ga0070678_100784048 Ga0070678_1007840482 130
252 3300005457 Ga0070662_100257279 Ga0070662_1002572792 130
253 3300005457 Ga0070662_101398133 Ga0070662_1013981331 130
254 3300005458 Ga0070681_10144431 Ga0070681_101444313 130
255 3300005458 Ga0070681_10442928 Ga0070681_104429282 130
256 3300005459 Ga0068867_100008440 Ga0068867_1000084405 130
257 3300005459 Ga0068867_100293167 Ga0068867_1002931672 130
258 3300005466 Ga0070685_10439347 Ga0070685_104393472 130
259 3300005468 Ga0070707_100528875 Ga0070707_1005288752 130
260 3300005518 Ga0070699_100180201 Ga0070699_1001802012 130
261 3300005518 Ga0070699_101159005 Ga0070699_1011590052 130
262 3300005530 Ga0070679_100269820 Ga0070679_1002698202 130
263 3300005530 Ga0070679_100955777 Ga0070679_1009557772 130
264 3300005535 Ga0070684_100369695 Ga0070684_1003696952 130
265 3300005539 Ga0068853_100036947 Ga0068853_1000369473 130
266 3300005539 Ga0068853_100107809 Ga0068853_1001078092 130
267 3300005539 Ga0068853_100315093 Ga0068853_1003150932 130
268 3300005543 Ga0070672_100151280 Ga0070672_1001512802 130
269 3300005543 Ga0070672_100548114 Ga0070672_1005481142 130
270 3300005544 Ga0070686_100093953 Ga0070686_1000939532 130
271 3300005545 Ga0070695_100045120 Ga0070695_1000451202 130
272 3300005546 Ga0070696_100066279 Ga0070696_1000662793 130
273 3300005546 Ga0070696_100172963 Ga0070696_1001729631 130
274 3300005547 Ga0070693_100031922 Ga0070693_1000319223 130
275 3300005547 Ga0070693_101161568 Ga0070693_1011615681 130
276 3300005547 Ga0070693_101171658 Ga0070693_1011716582 130
277 3300005548 Ga0070665_100042922 Ga0070665_1000429222 130
278 3300005548 Ga0070665_100051263 Ga0070665_1000512636 130
279 3300005548 Ga0070665_100383285 Ga0070665_1003832852 130
280 3300005548 Ga0070665_100534506 Ga0070665_1005345062 130
281 3300005548 Ga0070665_100910509 Ga0070665_1009105092 130
282 3300005548 Ga0070665_101304798 Ga0070665_1013047982 130
283 3300005548 Ga0070665_101662619 Ga0070665_1016626191 130
284 3300005549 Ga0070704_100024045 Ga0070704_1000240455 130
285 3300005563 Ga0068855_100114588 Ga0068855_1001145884 130
286 3300005563 Ga0068855_100855039 Ga0068855_1008550392 130
287 3300005564 Ga0070664_101332470 Ga0070664_1013324701 130
288 3300005578 Ga0068854_100023417 Ga0068854_1000234172 130
289 3300005578 Ga0068854_100045135 Ga0068854_1000451353 130
290 3300005615 Ga0070702_100024373 Ga0070702_1000243732 130
291 3300005615 Ga0070702_100199986 Ga0070702_1001999861 130
292 3300005616 Ga0068852_100549006 Ga0068852_1005490062 130
293 3300005617 Ga0068859_100037263 Ga0068859_1000372633 130
294 3300005617 Ga0068859_100293493 Ga0068859_1002934931 130
295 3300005617 Ga0068859_101260357 Ga0068859_1012603572 130
296 3300005618 Ga0068864_101975244 Ga0068864_1019752441 130
297 3300005718 Ga0068866_10001530 Ga0068866_100015305 130
298 3300005719 Ga0068861_100038370 Ga0068861_1000383704 130
299 3300005834 Ga0068851_10337315 Ga0068851_103373151 130
300 3300005841 Ga0068863_100373813 Ga0068863_1003738132 130
301 3300005841 Ga0068863_101056975 Ga0068863_1010569752 130
302 3300005842 Ga0068858_100267655 Ga0068858_1002676552 130
303 3300005843 Ga0068860_100011938 Ga0068860_1000119385 130
304 3300005844 Ga0068862_100047952 Ga0068862_1000479522 130
305 3300005844 Ga0068862_100610275 Ga0068862_1006102751 130
306 3300005844 Ga0068862_101376999 Ga0068862_1013769992 130
307 3300005981 Ga0081538_10046032 Ga0081538_100460322 130
308 3300005981 Ga0081538_10091673 Ga0081538_100916732 130
309 3300005983 Ga0081540_1167435 Ga0081540_11674352 130
310 3300005985 Ga0081539_10000299 Ga0081539_100002995 130
311 3300005985 Ga0081539_10006277 Ga0081539_1000627711 130
312 3300006028 Ga0070717_10010702 Ga0070717_100107023 130
313 3300006028 Ga0070717_10066969 Ga0070717_100669695 130
314 3300006028 Ga0070717_10120662 Ga0070717_101206623 130
315 3300006042 Ga0075368_10143308 Ga0075368_101433082 130
316 3300006048 Ga0075363_100023402 Ga0075363_1000234023 130
317 3300006048 Ga0075363_100696964 Ga0075363_1006969641 130
318 3300006163 Ga0070715_10052427 Ga0070715_100524272 130
319 3300006173 Ga0070716_100068576 Ga0070716_1000685763 130
320 3300006173 Ga0070716_101393205 Ga0070716_1013932052 130
321 3300006175 Ga0070712_100008934 Ga0070712_1000089346 130
322 3300006175 Ga0070712_100345257 Ga0070712_1003452572 130
323 3300006177 Ga0075362_10060502 Ga0075362_100605022 130
324 3300006177 Ga0075362_10720379 Ga0075362_107203792 130
325 3300006195 Ga0075366_10208717 Ga0075366_102087172 130
326 3300006195 Ga0075366_10268627 Ga0075366_102686272 130
327 3300006353 Ga0075370_10368658 Ga0075370_103686582 130
328 3300006358 Ga0068871_100398100 Ga0068871_1003981002 130
329 3300006844 Ga0075428_100018822 Ga0075428_1000188229 130
330 3300006844 Ga0075428_100354231 Ga0075428_1003542311 130
331 3300006846 Ga0075430_100072971 Ga0075430_1000729714 130
332 3300006847 Ga0075431_100042432 Ga0075431_1000424328 130
333 3300006847 Ga0075431_101084318 Ga0075431_1010843182 130
334 3300006852 Ga0075433_10182552 Ga0075433_101825522 130
335 3300006852 Ga0075433_11767433 Ga0075433_117674331 130
336 3300006871 Ga0075434_100367206 Ga0075434_1003672062 130
337 3300006881 Ga0068865_100125572 Ga0068865_1001255723 130
338 3300006881 Ga0068865_100129560 Ga0068865_1001295602 130
339 3300006931 Ga0097620_100037262 Ga0097620_1000372623 130
340 3300006931 Ga0097620_100293499 Ga0097620_1002934992 130
341 3300006931 Ga0097620_101260336 Ga0097620_1012603362 130
342 3300007076 Ga0075435_100014526 Ga0075435_1000145266 130
343 3300009011 Ga0105251_10017909 Ga0105251_100179092 130
344 3300009092 Ga0105250_10092247 Ga0105250_100922472 130
345 3300009093 Ga0105240_10074931 Ga0105240_100749313 130
346 3300009093 Ga0105240_11384836 Ga0105240_113848362 130
347 3300009093 Ga0105240_12236665 Ga0105240_122366652 130
348 3300009093 Ga0105240_12472115 Ga0105240_124721151 130
349 3300009098 Ga0105245_10009348 Ga0105245_100093483 130
350 3300009098 Ga0105245_10368583 Ga0105245_103685832 130
351 3300009098 Ga0105245_11653112 Ga0105245_116531121 130
352 3300009101 Ga0105247_10010073 Ga0105247_100100734 130
353 3300009101 Ga0105247_11080438 Ga0105247_110804382 130
354 3300009101 Ga0105247_11651280 Ga0105247_116512801 130
355 3300009147 Ga0114129_10017668 Ga0114129_1001766810 130
356 3300009148 Ga0105243_10897620 Ga0105243_108976202 130
357 3300009174 Ga0105241_11225501 Ga0105241_112255012 130
358 3300009176 Ga0105242_10042876 Ga0105242_100428763 130
359 3300009177 Ga0105248_10143185 Ga0105248_101431853 130
360 3300009177 Ga0105248_10859441 Ga0105248_108594412 130
361 3300009177 Ga0105248_11240489 Ga0105248_112404892 130
362 3300009545 Ga0105237_10318849 Ga0105237_103188492 130
363 3300009545 Ga0105237_11013762 Ga0105237_110137622 130
364 3300009545 Ga0105237_11314535 Ga0105237_113145351 130
365 3300009551 Ga0105238_10024517 Ga0105238_100245176 130
366 3300009551 Ga0105238_10300619 Ga0105238_103006192 130
367 3300009553 Ga0105249_11822231 Ga0105249_118222311 130
368 3300010375 Ga0105239_10142382 Ga0105239_101423822 130
369 3300010375 Ga0105239_10171478 Ga0105239_101714782 130
370 3300010375 Ga0105239_10420894 Ga0105239_104208942 130
371 3300010375 Ga0105239_12761492 Ga0105239_127614921 130
372 3300011119 Ga0105246_10114745 Ga0105246_101147452 130
373 3300011119 Ga0105246_11917460 Ga0105246_119174601 130
374 3300013102 Ga0157371_10190717 Ga0157371_101907172 130
375 3300013104 Ga0157370_11678116 Ga0157370_116781162 130
376 3300013105 Ga0157369_10331275 Ga0157369_103312752 130
377 3300013296 Ga0157374_10493822 Ga0157374_104938222 130
378 3300013297 Ga0157378_10021612 Ga0157378_100216126 130
379 3300013306 Ga0163162_10084317 Ga0163162_100843172 130
380 3300013306 Ga0163162_10142108 Ga0163162_101421082 130
381 3300013306 Ga0163162_10332349 Ga0163162_103323492 130
382 3300013306 Ga0163162_10654578 Ga0163162_106545782 130
383 3300013307 Ga0157372_10102729 Ga0157372_101027292 130
384 3300013308 Ga0157375_10210678 Ga0157375_102106782 130
385 3300013308 Ga0157375_10224591 Ga0157375_102245912 130
386 3300013308 Ga0157375_10614737 Ga0157375_106147372 130
387 3300013308 Ga0157375_10731172 Ga0157375_107311722 130
388 3300013308 Ga0157375_11403674 Ga0157375_114036742 130
389 3300014326 Ga0157380_10049476 Ga0157380_100494763 130
390 3300014497 Ga0182008_10001482 Ga0182008_1000148210 130
391 3300014497 Ga0182008_10749493 Ga0182008_107494931 130
392 3300014745 Ga0157377_10073172 Ga0157377_100731723 130
393 3300014745 Ga0157377_10333652 Ga0157377_103336522 130
394 3300014968 Ga0157379_10143086 Ga0157379_101430862 130
395 3300014968 Ga0157379_10207813 Ga0157379_102078132 130
396 3300014968 Ga0157379_10300546 Ga0157379_103005462 130
397 3300014968 Ga0157379_11222599 Ga0157379_112225991 130
398 3300014969 Ga0157376_11044620 Ga0157376_110446202 130
399 3300014969 Ga0157376_12384402 Ga0157376_123844021 130
400 3300015262 Ga0182007_10000321 Ga0182007_100003219 130
401 3300015265 Ga0182005_1037556 Ga0182005_10375562 130
402 3300015683 Ga0183362_10003 Ga0183362_10003350 130
403 3300017792 Ga0163161_10073709 Ga0163161_100737093 130
404 3300017792 Ga0163161_10743269 Ga0163161_107432692 130
405 3300017792 Ga0163161_11172797 Ga0163161_111727972 130
406 3300017792 Ga0163161_11448280 Ga0163161_114482802 130
407 3300021384 Ga0213876_10028695 Ga0213876_100286952 130
408 3300022467 Ga0224712_10046356 Ga0224712_100463562 130
409 3300025297 Ga0209758_1008881 Ga0209758_10088818 130
410 3300025302 Ga0207426_1068224 Ga0207426_10682242 130
411 3300025711 Ga0207696_1185139 Ga0207696_11851391 130
412 3300025735 Ga0207713_1032370 Ga0207713_10323702 130
413 3300025893 Ga0207682_10112758 Ga0207682_101127583 130
414 3300025898 Ga0207692_10014167 Ga0207692_100141672 130
415 3300025899 Ga0207642_10005216 Ga0207642_100052165 130
416 3300025899 Ga0207642_10365176 Ga0207642_103651762 130
417 3300025900 Ga0207710_10013402 Ga0207710_100134024 130
418 3300025900 Ga0207710_10203756 Ga0207710_102037562 130
419 3300025901 Ga0207688_10105007 Ga0207688_101050072 130
420 3300025901 Ga0207688_10479698 Ga0207688_104796981 130
421 3300025903 Ga0207680_10273418 Ga0207680_102734182 130
422 3300025907 Ga0207645_10133496 Ga0207645_101334962 130
423 3300025907 Ga0207645_10591921 Ga0207645_105919212 130
424 3300025908 Ga0207643_10051860 Ga0207643_100518602 130
425 3300025910 Ga0207684_11190203 Ga0207684_111902032 130
426 3300025911 Ga0207654_10100282 Ga0207654_101002821 130
427 3300025912 Ga0207707_10091702 Ga0207707_100917023 130
428 3300025912 Ga0207707_10257787 Ga0207707_102577872 130
429 3300025913 Ga0207695_10369810 Ga0207695_103698102 130
430 3300025914 Ga0207671_10319052 Ga0207671_103190522 130
431 3300025914 Ga0207671_10724174 Ga0207671_107241741 130
432 3300025915 Ga0207693_10022554 Ga0207693_100225545 130
433 3300025915 Ga0207693_10155484 Ga0207693_101554842 130
434 3300025915 Ga0207693_10240116 Ga0207693_102401162 130
435 3300025916 Ga0207663_10020680 Ga0207663_100206803 130
436 3300025917 Ga0207660_10098925 Ga0207660_100989252 130
437 3300025917 Ga0207660_10207307 Ga0207660_102073072 130
438 3300025917 Ga0207660_10416852 Ga0207660_104168522 130
439 3300025918 Ga0207662_10192237 Ga0207662_101922372 130
440 3300025919 Ga0207657_10241729 Ga0207657_102417292 130
441 3300025919 Ga0207657_10325893 Ga0207657_103258932 130
442 3300025919 Ga0207657_10376376 Ga0207657_103763762 130
443 3300025919 Ga0207657_10769224 Ga0207657_107692242 130
444 3300025921 Ga0207652_10331988 Ga0207652_103319882 130
445 3300025921 Ga0207652_10571534 Ga0207652_105715342 130
446 3300025921 Ga0207652_10748062 Ga0207652_107480622 130
447 3300025923 Ga0207681_10060858 Ga0207681_100608582 130
448 3300025923 Ga0207681_10263604 Ga0207681_102636042 130
449 3300025924 Ga0207694_10065630 Ga0207694_100656303 130
450 3300025925 Ga0207650_10644367 Ga0207650_106443671 130
451 3300025925 Ga0207650_11388262 Ga0207650_113882622 130
452 3300025926 Ga0207659_10188988 Ga0207659_101889883 130
453 3300025926 Ga0207659_10203087 Ga0207659_102030872 130
454 3300025926 Ga0207659_10562722 Ga0207659_105627222 130
455 3300025926 Ga0207659_10669363 Ga0207659_106693632 130
456 3300025927 Ga0207687_10008069 Ga0207687_100080693 130
457 3300025927 Ga0207687_10030326 Ga0207687_100303263 130
458 3300025928 Ga0207700_10462442 Ga0207700_104624422 130
459 3300025928 Ga0207700_10766761 Ga0207700_107667612 130
460 3300025929 Ga0207664_10068766 Ga0207664_100687662 130
461 3300025931 Ga0207644_10844881 Ga0207644_108448812 130
462 3300025932 Ga0207690_10172027 Ga0207690_101720272 130
463 3300025932 Ga0207690_10367526 Ga0207690_103675262 130
464 3300025932 Ga0207690_10386997 Ga0207690_103869972 130
465 3300025932 Ga0207690_11013745 Ga0207690_110137452 130
466 3300025933 Ga0207706_10046195 Ga0207706_100461953 130
467 3300025935 Ga0207709_10012850 Ga0207709_100128505 130
468 3300025935 Ga0207709_11615274 Ga0207709_116152741 130
469 3300025936 Ga0207670_10644665 Ga0207670_106446652 130
470 3300025937 Ga0207669_10010595 Ga0207669_100105952 130
471 3300025937 Ga0207669_10086942 Ga0207669_100869422 130
472 3300025937 Ga0207669_10286496 Ga0207669_102864962 130
473 3300025937 Ga0207669_11089017 Ga0207669_110890172 130
474 3300025938 Ga0207704_10001963 Ga0207704_100019636 130
475 3300025938 Ga0207704_10159079 Ga0207704_101590792 130
476 3300025938 Ga0207704_10688319 Ga0207704_106883192 130
477 3300025939 Ga0207665_10013758 Ga0207665_100137583 130
478 3300025940 Ga0207691_10012135 Ga0207691_100121354 130
479 3300025940 Ga0207691_10683048 Ga0207691_106830482 130
480 3300025941 Ga0207711_10089795 Ga0207711_100897952 130
481 3300025941 Ga0207711_10823973 Ga0207711_108239732 130
482 3300025941 Ga0207711_10903854 Ga0207711_109038542 130
483 3300025941 Ga0207711_11417763 Ga0207711_114177632 130
484 3300025942 Ga0207689_10104805 Ga0207689_101048052 130
485 3300025944 Ga0207661_10446308 Ga0207661_104463082 130
486 3300025945 Ga0207679_11720307 Ga0207679_117203072 130
487 3300025949 Ga0207667_10353033 Ga0207667_103530332 130
488 3300025949 Ga0207667_11067545 Ga0207667_110675452 130
489 3300025949 Ga0207667_11301264 Ga0207667_113012642 130
490 3300025960 Ga0207651_10001558 Ga0207651_100015587 130
491 3300025960 Ga0207651_10778370 Ga0207651_107783701 130
492 3300025961 Ga0207712_10413268 Ga0207712_104132682 130
493 3300025961 Ga0207712_10424765 Ga0207712_104247651 130
494 3300025972 Ga0207668_10012098 Ga0207668_100120986 130
495 3300025981 Ga0207640_10073446 Ga0207640_100734462 130
496 3300025981 Ga0207640_10210114 Ga0207640_102101142 130
497 3300025986 Ga0207658_10004918 Ga0207658_100049189 130
498 3300025986 Ga0207658_10029493 Ga0207658_100294932 130
499 3300026023 Ga0207677_10011807 Ga0207677_100118073 130
500 3300026023 Ga0207677_10065995 Ga0207677_100659952 130
501 3300026023 Ga0207677_10297832 Ga0207677_102978322 130
502 3300026035 Ga0207703_10096913 Ga0207703_100969133 130
503 3300026035 Ga0207703_10185395 Ga0207703_101853952 130
504 3300026041 Ga0207639_10015661 Ga0207639_100156612 130
505 3300026041 Ga0207639_10027103 Ga0207639_100271035 130
506 3300026067 Ga0207678_10114498 Ga0207678_101144982 130
507 3300026067 Ga0207678_10505399 Ga0207678_105053992 130
508 3300026067 Ga0207678_10799330 Ga0207678_107993302 130
509 3300026075 Ga0207708_10051067 Ga0207708_100510672 130
510 3300026075 Ga0207708_10323234 Ga0207708_103232342 130
511 3300026078 Ga0207702_10691622 Ga0207702_106916222 130
512 3300026088 Ga0207641_10163572 Ga0207641_101635722 130
513 3300026089 Ga0207648_10066671 Ga0207648_100666712 130
514 3300026089 Ga0207648_10323752 Ga0207648_103237521 130
515 3300026089 Ga0207648_10371651 Ga0207648_103716512 130
516 3300026089 Ga0207648_11661497 Ga0207648_116614972 130
517 3300026095 Ga0207676_10277669 Ga0207676_102776692 130
518 3300026095 Ga0207676_10335749 Ga0207676_103357492 130
519 3300026095 Ga0207676_10390358 Ga0207676_103903582 130
520 3300026095 Ga0207676_11210054 Ga0207676_112100542 130
521 3300026095 Ga0207676_11249253 Ga0207676_112492532 130
522 3300026118 Ga0207675_100058616 Ga0207675_1000586162 130
523 3300026118 Ga0207675_100138746 Ga0207675_1001387462 130
524 3300026118 Ga0207675_100740156 Ga0207675_1007401562 130
525 3300026121 Ga0207683_10062809 Ga0207683_100628092 130
526 3300026121 Ga0207683_10081042 Ga0207683_100810422 130
527 3300026121 Ga0207683_10115571 Ga0207683_101155712 130
528 3300026121 Ga0207683_10232151 Ga0207683_102321513 130
529 3300026121 Ga0207683_10323035 Ga0207683_103230352 130
530 3300026121 Ga0207683_10617951 Ga0207683_106179512 130
531 3300026121 Ga0207683_11113099 Ga0207683_111130992 130
532 3300026142 Ga0207698_10209663 Ga0207698_102096632 130
533 3300027866 Ga0209813_10161325 Ga0209813_101613251 130
534 3300027876 Ga0209974_10224326 Ga0209974_102243262 130
535 3300027907 Ga0207428_10111254 Ga0207428_101112542 130
536 3300028379 Ga0268266_10016681 Ga0268266_100166813 130
537 3300028379 Ga0268266_10204779 Ga0268266_102047792 130
538 3300028379 Ga0268266_10208375 Ga0268266_102083752 130
539 3300028379 Ga0268266_10222587 Ga0268266_102225872 130
540 3300028379 Ga0268266_10435207 Ga0268266_104352072 130
541 3300028379 Ga0268266_10480135 Ga0268266_104801352 130
542 3300028380 Ga0268265_10316918 Ga0268265_103169182 130
543 3300028381 Ga0268264_10030902 Ga0268264_100309022 130
544 3300028556 Ga0265337_1031514 Ga0265337_10315142 130
545 3300028577 Ga0265318_10325930 Ga0265318_103259302 130
546 3300028666 Ga0265336_10061960 Ga0265336_100619602 130
547 3300028786 Ga0307517_10130253 Ga0307517_101302532 130
548 3300028794 Ga0307515_10000487 Ga0307515_1000048736 130
549 3300028794 Ga0307515_10056940 Ga0307515_100569404 130
550 3300030521 Ga0307511_10000159 Ga0307511_1000015953 130
551 3300030521 Ga0307511_10001103 Ga0307511_1000110310 130
552 3300031240 Ga0265320_10000429 Ga0265320_100004292 130
553 3300031250 Ga0265331_10197765 Ga0265331_101977652 130
554 3300031251 Ga0265327_10003277 Ga0265327_1000327712 130
555 3300031344 Ga0265316_10037489 Ga0265316_100374892 130
556 3300031456 Ga0307513_10025548 Ga0307513_100255484 130
557 3300031456 Ga0307513_10032587 Ga0307513_100325875 130
558 3300031456 Ga0307513_10033683 Ga0307513_100336837 130
559 3300031456 Ga0307513_10308731 Ga0307513_103087312 130
560 3300031456 Ga0307513_10441643 Ga0307513_104416432 130
561 3300031456 Ga0307513_10445830 Ga0307513_104458302 130
562 3300031456 Ga0307513_10448606 Ga0307513_104486062 130
563 3300031507 Ga0307509_10036922 Ga0307509_100369222 130
564 3300031548 Ga0307408_100214815 Ga0307408_1002148152 130
565 3300031548 Ga0307408_100269808 Ga0307408_1002698082 130
566 3300031548 Ga0307408_100556305 Ga0307408_1005563051 130
567 3300031548 Ga0307408_101932668 Ga0307408_1019326682 130
568 3300031665 Ga0316575_10002608 Ga0316575_100026082 130
569 3300031691 Ga0316579_10003332 Ga0316579_100033325 130
570 3300031691 Ga0316579_10422801 Ga0316579_104228011 130
571 3300031711 Ga0265314_10022219 Ga0265314_100222194 130
572 3300031727 Ga0316576_10002073 Ga0316576_100020738 130
573 3300031727 Ga0316576_10204172 Ga0316576_102041722 130
574 3300031728 Ga0316578_10000393 Ga0316578_100003939 130
575 3300031730 Ga0307516_10001460 Ga0307516_100014609 130
576 3300031730 Ga0307516_10041378 Ga0307516_100413783 130
577 3300031731 Ga0307405_10456388 Ga0307405_104563882 130
578 3300031733 Ga0316577_10029468 Ga0316577_100294685 130
579 3300031824 Ga0307413_10096982 Ga0307413_100969822 130
580 3300031824 Ga0307413_11207694 Ga0307413_112076941 130
581 3300031824 Ga0307413_11921610 Ga0307413_119216101 130
582 3300031838 Ga0307518_10009673 Ga0307518_100096739 130
583 3300031852 Ga0307410_10035590 Ga0307410_100355902 130
584 3300031852 Ga0307410_10282119 Ga0307410_102821191 130
585 3300031901 Ga0307406_10046095 Ga0307406_100460952 130
586 3300031901 Ga0307406_11158689 Ga0307406_111586891 130
587 3300031903 Ga0307407_10022944 Ga0307407_100229442 130
588 3300031903 Ga0307407_11451107 Ga0307407_114511071 130
589 3300031911 Ga0307412_10551037 Ga0307412_105510372 130
590 3300031911 Ga0307412_10822742 Ga0307412_108227422 130
591 3300031995 Ga0307409_100221069 Ga0307409_1002210692 130
592 3300031995 Ga0307409_100277771 Ga0307409_1002777712 130
593 3300031995 Ga0307409_101283505 Ga0307409_1012835052 130
594 3300032002 Ga0307416_100365830 Ga0307416_1003658302 130
595 3300032002 Ga0307416_101094106 Ga0307416_1010941062 130
596 3300032002 Ga0307416_102273067 Ga0307416_1022730672 130
597 3300032004 Ga0307414_10224023 Ga0307414_102240232 130
598 3300032005 Ga0307411_10289605 Ga0307411_102896052 130
599 3300032005 Ga0307411_11303703 Ga0307411_113037032 130
600 3300032126 Ga0307415_100395947 Ga0307415_1003959472 130
601 3300032133 Ga0316583_10010654 Ga0316583_100106544 130
602 3300032133 Ga0316583_10061685 Ga0316583_100616851 130
603 3300032137 Ga0316585_10154369 Ga0316585_101543691 130
604 3300032139 Ga0316580_10081089 Ga0316580_100810891 130
605 3300033179 Ga0307507_10015626 Ga0307507_100156267 130
606 3300033179 Ga0307507_10047289 Ga0307507_100472895 130
607 3300033180 Ga0307510_10076915 Ga0307510_100769152 130
608 3300033541 Ga0316596_1020082 Ga0316596_10200822 130
609 3300034817 Ga0373948_0022376 Ga0373948_0022376_25_423 130
610 3300035084 Ga0373928_0031819 Ga0373928_0031819_607_1005 130
611 3300035085 Ga0373929_0096214 Ga0373929_0096214_272_676 130
612 3300035088 Ga0373940_0013567 Ga0373940_0013567_193_591 130
613 3300035112 Ga0373932_0034054 Ga0373932_0034054_220_618 130
614 3300035170 Ga0373943_0801310 Ga0373943_0801310_93_491 130
615 3300035398 Ga0316574_0639565 Ga0316574_0639565_212_616 130
616 3300035691 Ga0373931_0047293 Ga0373931_0047293_832_1236 130
617 3300036712 Ga0316584_0005768 Ga0316584_0005768_4503_4913 130
618 3300036712 Ga0316584_0056631 Ga0316584_0056631_142_546 130
619 3300037068 Ga0373925_0341859 Ga0373925_0341859_603_1001 130
620 3300037418 Ga0395900_0685437 Ga0395900_0685437_108_500 130
621 3300037471 Ga0395905_0001958 Ga0395905_0001958_5824_6240 130
622 3300038443 Ga0395901_0038670 Ga0395901_0038670_693_1085 130
623 3300038443 Ga0395901_0104465 Ga0395901_0104465_1088_1486 130
624 3300038443 Ga0395901_0398040 Ga0395901_0398040_633_1055 130
625 3300039437 Ga0436365_0301162 Ga0436365_0301162_1725_2123 130
626 3300039450 Ga0436363_1309788 Ga0436363_1309788_24_437 130
627 3300039450 Ga0436363_1589930 Ga0436363_1589930_24_422 130
628 3300041404 Ga0439436_0010782 Ga0439436_0010782_1955_2353 130
629 3300041404 Ga0439436_0018666 Ga0439436_0018666_1624_2022 130
630 3300041404 Ga0439436_0076691 Ga0439436_0076691_171_587 130
631 3300041405 Ga0439438_073999 Ga0439438_073999_413_811 130
632 3300041406 Ga0439439_0003849 Ga0439439_0003849_1414_1812 130
633 3300041406 Ga0439439_0123106 Ga0439439_0123106_311_709 130
634 3300041407 Ga0439447_012773 Ga0439447_012773_1317_1715 130
635 3300041407 Ga0439447_032115 Ga0439447_032115_244_642 130
636 3300041410 Ga0439461_0007746 Ga0439461_0007746_1375_1779 130
637 3300041411 Ga0439466_0070440 Ga0439466_0070440_71_469 130
638 3300041411 Ga0439466_0101741 Ga0439466_0101741_97_495 130
639 3300041413 Ga0439465_0012312 Ga0439465_0012312_2176_2574 130
640 3300041460 Ga0451802_1269109 Ga0451802_1269109_561_977 130
641 3300041491 Ga0451833_0080370 Ga0451833_0080370_275_679 130
642 3300041501 Ga0451845_0914589 Ga0451845_0914589_64_462 130
643 3300041505 Ga0451849_0339851 Ga0451849_0339851_2694_3125 130
644 3300041509 Ga0451843_0253762 Ga0451843_0253762_291_722 130
645 3300041509 Ga0451843_1206146 Ga0451843_1206146_79_477 130
646 3300041509 Ga0451843_1772571 Ga0451843_1772571_43_447 130
647 3300041512 Ga0451853_0371860 Ga0451853_0371860_10820_11251 130
648 3300041512 Ga0451853_2463512 Ga0451853_2463512_487_885 130
649 3300041997 Ga0439431_0002697 Ga0439431_0002697_1515_1913 130
650 3300041997 Ga0439431_0025503 Ga0439431_0025503_114_530 130
651 3300041999 Ga0439433_0006460 Ga0439433_0006460_1921_2319 130
652 3300041999 Ga0439433_0025770 Ga0439433_0025770_209_619 130
653 3300041999 Ga0439433_0056272 Ga0439433_0056272_112_522 130
654 3300041999 Ga0439433_0075693 Ga0439433_0075693_255_653 130
655 3300042002 Ga0439442_020830 Ga0439442_020830_420_818 130
656 3300042002 Ga0439442_038499 Ga0439442_038499_396_794 130
657 3300042004 Ga0439445_0003652 Ga0439445_0003652_650_1048 130
658 3300042006 Ga0439432_001430 Ga0439432_001430_6615_7013 130
659 3300042006 Ga0439432_047206 Ga0439432_047206_306_704 130
660 3300042007 Ga0439449_0000791 Ga0439449_0000791_5551_5949 130
661 3300042007 Ga0439449_0002046 Ga0439449_0002046_4962_5360 130
662 3300042007 Ga0439449_0012758 Ga0439449_0012758_1364_1762 130
663 3300042010 Ga0439452_003109 Ga0439452_003109_1717_2115 130
664 3300042010 Ga0439452_038430 Ga0439452_038430_40_438 130
665 3300042014 Ga0439457_018913 Ga0439457_018913_943_1341 130
666 3300042014 Ga0439457_025777 Ga0439457_025777_290_688 130
667 3300042014 Ga0439457_026139 Ga0439457_026139_856_1272 130
668 3300042015 Ga0439462_0007236 Ga0439462_0007236_1528_1926 130
669 3300042015 Ga0439462_0012747 Ga0439462_0012747_771_1169 130
670 3300042015 Ga0439462_0119658 Ga0439462_0119658_231_641 130
671 3300042128 Ga0450897_018121 Ga0450897_018121_32_430 130
672 3300042131 Ga0450894_001632 Ga0450894_001632_2178_2576 130
673 3300042131 Ga0450894_009610 Ga0450894_009610_25_429 130
674 3300042134 Ga0450898_023986 Ga0450898_023986_160_558 130
675 3300042144 Ga0450889_020336 Ga0450889_020336_165_563 130
676 3300042145 Ga0450906_030582 Ga0450906_030582_55_453 130
677 3300042146 Ga0450907_043258 Ga0450907_043258_248_646 130
678 3300042156 Ga0439446_0011919 Ga0439446_0011919_1220_1618 130
679 3300042156 Ga0439446_0247102 Ga0439446_0247102_201_599 130
680 3300042156 Ga0439446_0345635 Ga0439446_0345635_36_446 130
681 3300042184 Ga0450908_022151 Ga0450908_022151_192_590 130
682 3300042185 Ga0450909_001800 Ga0450909_001800_650_1048 130
683 3300042435 Ga0439434_0012172 Ga0439434_0012172_183_581 130
684 3300042435 Ga0439434_0012407 Ga0439434_0012407_770_1168 130
685 3300042435 Ga0439434_0092605 Ga0439434_0092605_527_931 130
686 3300042438 Ga0439459_0151166 Ga0439459_0151166_115_513 130
687 3300042532 Ga0450893_0016581 Ga0450893_0016581_76_474 130
688 3300044656 Ga0466969_0020496 Ga0466969_0020496_487_885 130
689 3300044656 Ga0466969_0045057 Ga0466969_0045057_233_637 130
690 3300044658 Ga0466972_0007057 Ga0466972_0007057_5048_5446 130
691 3300044658 Ga0466972_0139847 Ga0466972_0139847_326_724 130
692 3300044684 Ga0466966_0012619 Ga0466966_0012619_1635_2033 130
693 3300044684 Ga0466966_0290131 Ga0466966_0290131_381_785 130
694 3300044693 Ga0466961_0019506 Ga0466961_0019506_2243_2641 130
695 3300044693 Ga0466961_0026723 Ga0466961_0026723_679_1083 130
696 3300044693 Ga0466961_0171730 Ga0466961_0171730_678_1082 130
697 3300044694 Ga0466963_0023612 Ga0466963_0023612_120_518 130
698 3300044706 Ga0466964_0046761 Ga0466964_0046761_1140_1538 130
699 3300044719 Ga0466971_0235231 Ga0466971_0235231_133_537 130
700 3300044735 Ga0466968_0054924 Ga0466968_0054924_41_439 130
701 3300044735 Ga0466968_0170000 Ga0466968_0170000_407_805 130
702 3300044765 Ga0466970_0045561 Ga0466970_0045561_1672_2076 130
703 3300044765 Ga0466970_0115115 Ga0466970_0115115_295_699 130
704 3300044765 Ga0466970_0165459 Ga0466970_0165459_55_453 130
705 3300044765 Ga0466970_0776843 Ga0466970_0776843_30_428 130
706 3300044901 Ga0466960_0015043 Ga0466960_0015043_1338_1736 130
707 3300044901 Ga0466960_0061209 Ga0466960_0061209_279_677 130
708 3300044901 Ga0466960_0127334 Ga0466960_0127334_514_912 130
709 3300044901 Ga0466960_0562661 Ga0466960_0562661_172_570 130
710 3300045049 Ga0466959_0027067 Ga0466959_0027067_823_1221 130
711 3300045049 Ga0466959_0146439 Ga0466959_0146439_298_696 130
712 3300045836 Ga0466958_0001930 Ga0466958_0001930_3217_3615 130
713 3300045836 Ga0466958_0258283 Ga0466958_0258283_259_657 130
714 3300045976 Ga0466967_0042891 Ga0466967_0042891_2180_2578 130
715 3300045976 Ga0466967_0195376 Ga0466967_0195376_168_566 130
716 3300045976 Ga0466967_0219775 Ga0466967_0219775_953_1351 130
717 3300045976 Ga0466967_0499147 Ga0466967_0499147_571_981 130
718 3300045976 Ga0466967_2036727 Ga0466967_2036727_43_441 130
719 3300046452 Ga0495617_007078 Ga0495617_007078_89_511 130
720 3300046453 Ga0495627_031049 Ga0495627_031049_1084_1506 130
721 3300046454 Ga0495592_0046118 Ga0495592_0046118_2065_2463 130
722 3300046454 Ga0495592_0236177 Ga0495592_0236177_744_1154 130
723 3300046455 Ga0495603_0011194 Ga0495603_0011194_1453_1851 130
724 3300046455 Ga0495603_0020447 Ga0495603_0020447_719_1141 130
725 3300046455 Ga0495603_0064159 Ga0495603_0064159_539_937 130
726 3300046457 Ga0495590_0101900 Ga0495590_0101900_281_703 130
727 3300046459 Ga0495629_0000826 Ga0495629_0000826_12074_12472 130
728 3300046459 Ga0495629_0089285 Ga0495629_0089285_751_1149 130
729 3300046459 Ga0495629_0183071 Ga0495629_0183071_610_1008 130
730 3300046460 Ga0495638_0134535 Ga0495638_0134535_793_1215 130
731 3300046462 Ga0495651_0039768 Ga0495651_0039768_739_1137 130
732 3300046462 Ga0495651_0067319 Ga0495651_0067319_410_823 130
733 3300046462 Ga0495651_0551112 Ga0495651_0551112_42_464 130
734 3300046463 Ga0495653_0532159 Ga0495653_0532159_191_604 130
735 3300046463 Ga0495653_0811526 Ga0495653_0811526_61_483 130
736 3300046471 Ga0495650_0004071 Ga0495650_0004071_5569_5985 130
737 3300046471 Ga0495650_0122923 Ga0495650_0122923_480_890 130
738 3300046472 Ga0495580_0274634 Ga0495580_0274634_714_1112 130
739 3300046473 Ga0495582_0080172 Ga0495582_0080172_1047_1445 130
740 3300046474 Ga0495605_0003700 Ga0495605_0003700_2539_2961 130
741 3300046475 Ga0495639_0001006 Ga0495639_0001006_8858_9271 130
742 3300046475 Ga0495639_0003852 Ga0495639_0003852_598_996 130
743 3300046476 Ga0495662_0005228 Ga0495662_0005228_2749_3147 130
744 3300046477 Ga0495664_0556275 Ga0495664_0556275_73_495 130
745 3300046491 Ga0495584_0133047 Ga0495584_0133047_364_786 130
746 3300046499 Ga0495594_0000177 Ga0495594_0000177_11274_11672 130
747 3300046499 Ga0495594_0139607 Ga0495594_0139607_681_1079 130
748 3300046506 Ga0495583_0059830 Ga0495583_0059830_779_1201 130
749 3300046507 Ga0495606_0016399 Ga0495606_0016399_1939_2361 130
750 3300046511 Ga0495608_0222705 Ga0495608_0222705_733_1131 130
751 3300046512 Ga0495610_0060642 Ga0495610_0060642_26_448 130
752 3300046513 Ga0495616_0018753 Ga0495616_0018753_2732_3154 130
753 3300046514 Ga0495618_0050137 Ga0495618_0050137_1963_2385 130
754 3300046515 Ga0495620_0050344 Ga0495620_0050344_365_787 130
755 3300046516 Ga0495628_0066026 Ga0495628_0066026_184_582 130
756 3300046516 Ga0495628_0321781 Ga0495628_0321781_595_993 130
757 3300046516 Ga0495628_0740758 Ga0495628_0740758_148_561 130
758 3300046517 Ga0495630_0684128 Ga0495630_0684128_87_485 130
759 3300046518 Ga0495631_0005737 Ga0495631_0005737_4112_4534 130
760 3300046519 Ga0495632_0170772 Ga0495632_0170772_10_432 130
761 3300046522 Ga0495643_0005063 Ga0495643_0005063_6807_7205 130
762 3300046522 Ga0495643_0095385 Ga0495643_0095385_510_920 130
763 3300046524 Ga0495648_0013270 Ga0495648_0013270_4686_5108 130
764 3300046525 Ga0495663_0009814 Ga0495663_0009814_441_854 130
765 3300046526 Ga0495666_0010356 Ga0495666_0010356_3507_3929 130
766 3300046528 Ga0495642_0010168 Ga0495642_0010168_1403_1816 130
767 3300046528 Ga0495642_0532180 Ga0495642_0532180_41_439 130
768 3300046529 Ga0495652_0012460 Ga0495652_0012460_5408_5806 130
769 3300046530 Ga0495654_0078989 Ga0495654_0078989_382_804 130
770 3300046531 Ga0495665_0593313 Ga0495665_0593313_108_530 130
771 3300046533 Ga0495640_0009264 Ga0495640_0009264_6994_7416 130
772 3300046533 Ga0495640_0145921 Ga0495640_0145921_970_1368 130
773 3300046535 Ga0495586_0089819 Ga0495586_0089819_1017_1415 130
774 3300046535 Ga0495586_0470595 Ga0495586_0470595_84_482 130
775 3300046536 Ga0495587_0419179 Ga0495587_0419179_288_701 130
776 3300046539 Ga0495621_0322780 Ga0495621_0322780_219_632 130
777 3300046543 Ga0495645_0160416 Ga0495645_0160416_94_492 130
778 3300046543 Ga0495645_0358971 Ga0495645_0358971_506_904 130
779 3300046557 Ga0495622_0047154 Ga0495622_0047154_1455_1877 130
780 3300046557 Ga0495622_0065903 Ga0495622_0065903_931_1329 130
781 3300046557 Ga0495622_0101223 Ga0495622_0101223_408_806 130
782 3300046558 Ga0495633_0042904 Ga0495633_0042904_1062_1484 130
783 3300046558 Ga0495633_0573919 Ga0495633_0573919_81_479 130
784 3300046615 Ga0495656_0000073 Ga0495656_0000073_26518_26931 130
785 3300046616 Ga0495668_0012473 Ga0495668_0012473_2907_3329 130
786 3300046642 Ga0495634_0044708 Ga0495634_0044708_103_501 130
787 3300046648 Ga0495611_0046736 Ga0495611_0046736_978_1400 130
788 3300046660 Ga0495625_0183547 Ga0495625_0183547_669_1091 130
789 3300046663 Ga0495635_0021267 Ga0495635_0021267_4025_4423 130
790 3300046663 Ga0495635_0335406 Ga0495635_0335406_32_430 130
791 3300046664 Ga0495659_0370794 Ga0495659_0370794_142_540 130
792 3300046665 Ga0495661_0029347 Ga0495661_0029347_1023_1445 130
793 3300046674 Ga0495588_0002150 Ga0495588_0002150_496_894 130
794 3300046674 Ga0495588_0089506 Ga0495588_0089506_395_793 130
795 3300046674 Ga0495588_0096693 Ga0495588_0096693_73_471 130
796 3300046674 Ga0495588_0242631 Ga0495588_0242631_378_776 130
797 3300046674 Ga0495588_0543978 Ga0495588_0543978_169_567 130
798 3300046675 Ga0495657_0099059 Ga0495657_0099059_1167_1565 130
799 3300046678 Ga0495599_0271547 Ga0495599_0271547_288_686 130
800 3300046678 Ga0495599_0275980 Ga0495599_0275980_99_497 130
801 3300046678 Ga0495599_0554923 Ga0495599_0554923_141_563 130
802 3300046679 Ga0495623_0047241 Ga0495623_0047241_1408_1806 130
803 3300046683 Ga0495658_0060684 Ga0495658_0060684_417_815 130
804 3300046683 Ga0495658_0438519 Ga0495658_0438519_273_686 130
805 3300046689 Ga0495613_0021244 Ga0495613_0021244_1737_2135 130
806 3300046689 Ga0495613_0170537 Ga0495613_0170537_30_452 130
807 3300046689 Ga0495613_0570427 Ga0495613_0570427_54_452 130
808 3300046690 Ga0495624_0021994 Ga0495624_0021994_435_833 130
809 3300046690 Ga0495624_0065203 Ga0495624_0065203_1031_1429 130
810 3300046690 Ga0495624_0699164 Ga0495624_0699164_179_592 130
811 3300046691 Ga0495670_0129399 Ga0495670_0129399_149_547 130
812 3300046694 Ga0495649_0031727 Ga0495649_0031727_975_1373 130
813 3300046809 Ga0495600_0125983 Ga0495600_0125983_662_1060 130
814 3300046809 Ga0495600_0166548 Ga0495600_0166548_536_958 130
815 3300046810 Ga0495660_0208771 Ga0495660_0208771_79_501 130
816 3300047315 Ga0495581_0094891 Ga0495581_0094891_1247_1645 130
817 3300047315 Ga0495581_0235632 Ga0495581_0235632_388_786 130
818 3300047317 Ga0495604_0151764 Ga0495604_0151764_180_578 130
819 3300047317 Ga0495604_0225515 Ga0495604_0225515_413_811 130
820 3300047317 Ga0495604_0625339 Ga0495604_0625339_215_637 130
821 3300047318 Ga0495636_0009829 Ga0495636_0009829_63_461 130
822 3300047318 Ga0495636_0063959 Ga0495636_0063959_1115_1513 130
823 3300047318 Ga0495636_0367052 Ga0495636_0367052_267_665 130
824 3300047319 Ga0495674_0066221 Ga0495674_0066221_1991_2413 130
825 3300047319 Ga0495674_0108554 Ga0495674_0108554_69_467 130
826 3300047321 Ga0495676_0008000 Ga0495676_0008000_4677_5075 130
827 3300047321 Ga0495676_0066306 Ga0495676_0066306_1264_1686 130
828 3300047321 Ga0495676_0105305 Ga0495676_0105305_951_1349 130
829 3300047322 Ga0495680_0091481 Ga0495680_0091481_1162_1560 130
830 3300047443 Ga0495687_001616 Ga0495687_001616_8727_9125 130
831 3300047443 Ga0495687_055125 Ga0495687_055125_215_637 130
832 3300047443 Ga0495687_084167 Ga0495687_084167_341_739 130
833 3300047444 Ga0495675_0006543 Ga0495675_0006543_2127_2525 130
834 3300047444 Ga0495675_0668309 Ga0495675_0668309_38_436 130
835 3300047445 Ga0495677_0046213 Ga0495677_0046213_1040_1438 130
836 3300047445 Ga0495677_0351579 Ga0495677_0351579_127_549 130
837 3300047447 Ga0495685_001871 Ga0495685_001871_1136_1534 130
838 3300047447 Ga0495685_005147 Ga0495685_005147_2484_2906 130
839 3300047470 Ga0495681_0064080 Ga0495681_0064080_74_472 130
840 3300047470 Ga0495681_0198968 Ga0495681_0198968_239_652 130
841 3300047471 Ga0495684_0130016 Ga0495684_0130016_817_1215 130
842 3300047472 Ga0495686_0111878 Ga0495686_0111878_297_719 130
843 3300047472 Ga0495686_0509102 Ga0495686_0509102_188_586 130
844 3300047472 Ga0495686_0568431 Ga0495686_0568431_164_577 130
845 3300047673 Ga0495593_0090469 Ga0495593_0090469_134_532 130
846 3300047673 Ga0495593_0096633 Ga0495593_0096633_624_1046 130
847 3300048088 Ga0495602_0446839 Ga0495602_0446839_120_518 130
848 3300048089 Ga0495614_0033238 Ga0495614_0033238_100_498 130
849 3300048091 Ga0495626_0115705 Ga0495626_0115705_484_882 130
850 3300048903 Ga0496100_0003006 Ga0496100_0003006_3626_4024 130
851 3300048903 Ga0496100_0009927 Ga0496100_0009927_4843_5256 130
852 3300048903 Ga0496100_0262922 Ga0496100_0262922_542_940 130
853 3300048904 Ga0496101_0003437 Ga0496101_0003437_328_741 130
854 3300048904 Ga0496101_0003632 Ga0496101_0003632_2931_3329 130
855 3300048904 Ga0496101_0005647 Ga0496101_0005647_3370_3768 130
856 3300048904 Ga0496101_0296101 Ga0496101_0296101_511_909 130
857 3300048904 Ga0496101_0342137 Ga0496101_0342137_14_412 130
858 3300048904 Ga0496101_0378587 Ga0496101_0378587_514_912 130
859 3300048904 Ga0496101_0441698 Ga0496101_0441698_497_895 130
860 3300048904 Ga0496101_1078930 Ga0496101_1078930_59_457 130
861 3300048905 Ga0496102_0005443 Ga0496102_0005443_8602_9000 130
862 3300048905 Ga0496102_0014277 Ga0496102_0014277_84_482 130
863 3300048905 Ga0496102_0074466 Ga0496102_0074466_2046_2444 130
864 3300048905 Ga0496102_0347129 Ga0496102_0347129_178_576 130
865 3300048905 Ga0496102_1100422 Ga0496102_1100422_289_687 130
866 3300048906 Ga0496103_0002209 Ga0496103_0002209_11827_12225 130
867 3300048906 Ga0496103_0029536 Ga0496103_0029536_649_1062 130
868 3300048906 Ga0496103_0085105 Ga0496103_0085105_990_1388 130
869 3300048906 Ga0496103_0108051 Ga0496103_0108051_275_673 130
870 3300048907 Ga0496104_0001352 Ga0496104_0001352_14148_14546 130
871 3300048907 Ga0496104_0013914 Ga0496104_0013914_4988_5401 130
872 3300048907 Ga0496104_0037452 Ga0496104_0037452_2308_2706 130
873 3300048907 Ga0496104_0040299 Ga0496104_0040299_779_1177 130
874 3300048907 Ga0496104_0069434 Ga0496104_0069434_2093_2491 130
875 3300048907 Ga0496104_0647129 Ga0496104_0647129_483_881 130
876 3300048907 Ga0496104_1466524 Ga0496104_1466524_151_549 130
877 3300048908 Ga0496105_0001642 Ga0496105_0001642_14481_14894 130
878 3300048908 Ga0496105_0062883 Ga0496105_0062883_2264_2662 130
879 3300048908 Ga0496105_0111863 Ga0496105_0111863_376_774 130
880 3300048908 Ga0496105_0148916 Ga0496105_0148916_1398_1796 130
881 3300048908 Ga0496105_0242187 Ga0496105_0242187_36_434 130
882 3300048908 Ga0496105_1003590 Ga0496105_1003590_13_411 130
883 3300048908 Ga0496105_1196171 Ga0496105_1196171_38_436 130
884 3300048909 Ga0496106_0003811 Ga0496106_0003811_409_822 130
885 3300048909 Ga0496106_0131730 Ga0496106_0131730_930_1328 130
886 3300048909 Ga0496106_0167838 Ga0496106_0167838_1235_1633 130
887 3300048909 Ga0496106_0187073 Ga0496106_0187073_972_1370 130
888 3300048910 Ga0496107_0005200 Ga0496107_0005200_4289_4687 130
889 3300048910 Ga0496107_0017687 Ga0496107_0017687_157_570 130
890 3300048910 Ga0496107_0300023 Ga0496107_0300023_568_966 130
891 3300048910 Ga0496107_0477407 Ga0496107_0477407_431_829 130
892 3300048911 Ga0496108_0001073 Ga0496108_0001073_11193_11591 130
893 3300048911 Ga0496108_0010591 Ga0496108_0010591_6624_7037 130
894 3300048911 Ga0496108_0221656 Ga0496108_0221656_572_985 130
895 3300048911 Ga0496108_1160860 Ga0496108_1160860_182_580 130
896 3300048912 Ga0496109_0001427 Ga0496109_0001427_7479_7877 130
897 3300048912 Ga0496109_0031889 Ga0496109_0031889_1056_1454 130
898 3300048912 Ga0496109_0032893 Ga0496109_0032893_2177_2590 130
899 3300048912 Ga0496109_0158597 Ga0496109_0158597_21_434 130
900 3300048912 Ga0496109_0291856 Ga0496109_0291856_453_851 130
901 3300048912 Ga0496109_0308043 Ga0496109_0308043_412_810 130
902 3300048912 Ga0496109_0945495 Ga0496109_0945495_33_431 130
903 3300048913 Ga0496110_0019879 Ga0496110_0019879_2566_2979 130
904 3300048913 Ga0496110_0091020 Ga0496110_0091020_653_1066 130
905 3300048913 Ga0496110_0114355 Ga0496110_0114355_1535_1933 130
906 3300048913 Ga0496110_0114747 Ga0496110_0114747_703_1116 130
907 3300048913 Ga0496110_0118502 Ga0496110_0118502_835_1233 130
908 3300048913 Ga0496110_0212754 Ga0496110_0212754_40_438 130
909 3300048913 Ga0496110_1347307 Ga0496110_1347307_155_553 130
910 3300048914 Ga0496111_0002651 Ga0496111_0002651_4799_5212 130
911 3300048914 Ga0496111_0088090 Ga0496111_0088090_439_837 130
912 3300048914 Ga0496111_0102392 Ga0496111_0102392_589_1002 130
913 3300048915 Ga0496112_0105661 Ga0496112_0105661_1037_1435 130
914 3300048915 Ga0496112_0144537 Ga0496112_0144537_1273_1671 130
915 3300048915 Ga0496112_0903852 Ga0496112_0903852_238_636 130
916 3300048916 Ga0496113_0172971 Ga0496113_0172971_957_1355 130
917 3300048916 Ga0496113_0271922 Ga0496113_0271922_490_903 130
918 3300048916 Ga0496113_1190826 Ga0496113_1190826_12_425 130
919 3300048917 Ga0496114_0003033 Ga0496114_0003033_5111_5509 130
920 3300048917 Ga0496114_0014718 Ga0496114_0014718_1588_1986 130
921 3300048917 Ga0496114_0025803 Ga0496114_0025803_89_502 130
922 3300048917 Ga0496114_0028600 Ga0496114_0028600_634_1032 130
923 3300048917 Ga0496114_0085365 Ga0496114_0085365_2079_2477 130
924 3300048917 Ga0496114_0093689 Ga0496114_0093689_1842_2264 130
925 3300048917 Ga0496114_0160327 Ga0496114_0160327_977_1399 130
926 3300048917 Ga0496114_1177035 Ga0496114_1177035_219_617 130
927 3300048917 Ga0496114_1519473 Ga0496114_1519473_84_482 130
928 3300048918 Ga0496115_0018895 Ga0496115_0018895_4733_5131 130
929 3300048918 Ga0496115_0217946 Ga0496115_0217946_838_1236 130
930 3300048924 Ga0496121_0008995 Ga0496121_0008995_7432_7830 130
931 3300048924 Ga0496121_0711222 Ga0496121_0711222_122_523 130
932 3300048925 Ga0496122_0260143 Ga0496122_0260143_208_615 130
933 3300048928 Ga0496125_0519795 Ga0496125_0519795_21_419 130
934 3300049459 Ga0495678_040874 Ga0495678_040874_1187_1585 130
935 3300049568 Ga0501031_0073073 Ga0501031_0073073_630_1040 130
936 3300049568 Ga0501031_0343690 Ga0501031_0343690_154_564 130
937 3300049569 Ga0501032_0173014 Ga0501032_0173014_937_1335 130
938 3300049569 Ga0501032_0320542 Ga0501032_0320542_117_515 130
939 3300049570 Ga0501033_0189168 Ga0501033_0189168_262_672 130
940 3300049570 Ga0501033_0192909 Ga0501033_0192909_920_1318 130
941 3300049571 Ga0501034_0023509 Ga0501034_0023509_973_1371 130
942 3300049571 Ga0501034_0481555 Ga0501034_0481555_672_1070 130
943 3300049571 Ga0501034_0742682 Ga0501034_0742682_133_537 130
944 3300049573 Ga0501037_0014653 Ga0501037_0014653_1149_1547 130
945 3300049573 Ga0501037_0640389 Ga0501037_0640389_221_619 130
946 3300049574 Ga0501038_0528442 Ga0501038_0528442_280_690 130
947 3300049575 Ga0501039_0037309 Ga0501039_0037309_2333_2743 130
948 3300049575 Ga0501039_0335445 Ga0501039_0335445_755_1153 130
949 3300049576 Ga0501040_0273327 Ga0501040_0273327_87_485 130
950 3300049577 Ga0501041_0048489 Ga0501041_0048489_1561_1971 130
951 3300049577 Ga0501041_0249025 Ga0501041_0249025_623_1027 130
952 3300049578 Ga0501042_0064138 Ga0501042_0064138_1931_2341 130
953 3300049578 Ga0501042_0406136 Ga0501042_0406136_42_452 130
954 3300049578 Ga0501042_0548212 Ga0501042_0548212_378_776 130
955 3300049579 Ga0501043_0053889 Ga0501043_0053889_1061_1459 130
956 3300049579 Ga0501043_0291779 Ga0501043_0291779_650_1048 130
957 3300049579 Ga0501043_0675573 Ga0501043_0675573_159_569 130
958 3300049580 Ga0501046_0045749 Ga0501046_0045749_1590_1988 130
959 3300049580 Ga0501046_0459756 Ga0501046_0459756_269_679 130
960 3300049581 Ga0501047_0039795 Ga0501047_0039795_775_1173 130
961 3300049582 Ga0501048_0025305 Ga0501048_0025305_56_454 130
962 3300049583 Ga0501067_0222949 Ga0501067_0222949_453_857 130
963 3300049584 Ga0501068_0218630 Ga0501068_0218630_432_842 130
964 3300049585 Ga0501069_0324543 Ga0501069_0324543_439_849 130
965 3300049587 Ga0501071_0246643 Ga0501071_0246643_639_1049 130
966 3300049588 Ga0501072_0016033 Ga0501072_0016033_4361_4771 130
967 3300049590 Ga0501074_1290099 Ga0501074_1290099_88_492 130
968 3300049591 Ga0501075_0156975 Ga0501075_0156975_285_695 130
969 3300049592 Ga0501076_0037194 Ga0501076_0037194_1433_1843 130
970 3300049592 Ga0501076_0553768 Ga0501076_0553768_269_676 130
971 3300049593 Ga0501077_0039288 Ga0501077_0039288_912_1322 130
972 3300049593 Ga0501077_0147522 Ga0501077_0147522_144_548 130
973 3300049741 Ga0501079_0068644 Ga0501079_0068644_988_1398 130
974 3300049742 Ga0501080_0328331 Ga0501080_0328331_559_969 130
975 3300049743 Ga0501081_0164928 Ga0501081_0164928_911_1321 130
976 3300049744 Ga0501083_0201281 Ga0501083_0201281_207_617 130
977 3300049744 Ga0501083_0708608 Ga0501083_0708608_63_461 130
978 3300049822 Ga0501035_0035383 Ga0501035_0035383_3102_3500 130
979 3300049823 Ga0501044_0000854 Ga0501044_0000854_19027_19425 130
980 3300049823 Ga0501044_0426551 Ga0501044_0426551_51_449 130
981 3300049824 Ga0501045_0077963 Ga0501045_0077963_210_620 130
982 3300049824 Ga0501045_0345218 Ga0501045_0345218_311_709 130
983 3300050489 nmdc:mga03683_304756_c1 nmdc:mga03683_304756_c1_139_537 130
984 3300050490 nmdc:mga03n38_27148_c1 nmdc:mga03n38_27148_c1_39_437 130
985 3300050490 nmdc:mga03n38_911639_c1 nmdc:mga03n38_911639_c1_66_479 130
986 3300050493 nmdc:mga0k408_250805_c1 nmdc:mga0k408_250805_c1_217_615 130
987 3300050493 nmdc:mga0k408_26286_c1 nmdc:mga0k408_26286_c1_386_784 130
988 3300050493 nmdc:mga0k408_743818_c1 nmdc:mga0k408_743818_c1_137_535 130
989 3300050494 nmdc:mga06z11_338566_c1 nmdc:mga06z11_338566_c1_131_529 130
990 3300050495 nmdc:mga04h51_114965_c1 nmdc:mga04h51_114965_c1_561_959 130
991 3300050496 nmdc:mga07m45_542831_c1 nmdc:mga07m45_542831_c1_55_465 130
992 3300050507 nmdc:mga05p37_63568_c1 nmdc:mga05p37_63568_c1_2718_3116 130
993 3300050509 nmdc:mga0qj67_104126_c1 nmdc:mga0qj67_104126_c1_155_553 130
994 3300050510 nmdc:mga06r32_116320_c1 nmdc:mga06r32_116320_c1_1681_2079 130
995 3300050512 nmdc:mga0n895_18784_c1 nmdc:mga0n895_18784_c1_149_547 130
996 3300050513 nmdc:mga0rr50_14251_c1 nmdc:mga0rr50_14251_c1_3122_3520 130
997 3300050515 nmdc:mga0a205_98967_c2 nmdc:mga0a205_98967_c2_912_1316 130
998 3300050516 nmdc:mga0sz30_353798_c1 nmdc:mga0sz30_353798_c1_111_509 130
999 3300053085 Ga0495619_0162262 Ga0495619_0162262_766_1164 130
1000 3300053087 Ga0500643_215482 Ga0500643_215482_96_500 130
1001 3300053088 Ga0500644_0018445 Ga0500644_0018445_1344_1748 130
1002 3300053090 Ga0500646_0053454 Ga0500646_0053454_689_1108 130
1003 3300053098 Ga0500650_0174622 Ga0500650_0174622_524_922 130
1004 3300053108 Ga0500562_001750 Ga0500562_001750_3741_4145 130
1005 3300053139 Ga0500568_0180783 Ga0500568_0180783_249_653 130
1006 3300053145 Ga0500586_004324 Ga0500586_004324_255_659 130
1007 3300053148 Ga0500590_031916 Ga0500590_031916_863_1273 130
1008 3300053154 Ga0500619_000013 Ga0500619_000013_40715_41128 130
1009 3300054114 Ga0501084_0119084 Ga0501084_0119084_1677_2087 130
1010 3300059421 Ga0590071_002328 Ga0590071_002328_2615_3028 130
1011 3300060353 Ga0501082_0079810 Ga0501082_0079810_585_995 130
1012 3300060353 Ga0501082_0575828 Ga0501082_0575828_37_447 130
1013 3300061719 Ga0466962_0182206 Ga0466962_0182206_240_644 130
1014 3300061719 Ga0466962_0204940 Ga0466962_0204940_436_834 130
1015 3300061734 Ga0530510_0035937 Ga0530510_0035937_1085_1495 130
1016 3300061734 Ga0530510_0474942 Ga0530510_0474942_524_934 130
1017 3300061734 Ga0530510_1295287 Ga0530510_1295287_43_453 130
1018 iso_pu_bacteria 2866612099 2866613216 130

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

3

131

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9837 2 130
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9688 2 130
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8756 2 128
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8524 2 128
2dtt-assembly2.cif.gz_E crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8448 2 128
ID Description Score Start End Superfamily
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9745 2 130 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9597 2 130 3.30.479.10
af_Q3TQ88_34_148_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8385 111 130 2.60.40.10
af_Q58668_4_160_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8193 9 130 3.30.479.10
1y13C00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8055 2 130 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A841CCW2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9946 35 130 GO:0016829
GO:0046872
AF-A0A2R8AFA4-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9882 1 130 GO:0046872
GO:0070497
AF-A0A1V2QES6-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9861 1 129 GO:0046872
GO:0070497
AF-A0A1Q9SV15-F1-model_v4 deleted 0.9855 1 130
AF-L0DYM8-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9853 1 130 GO:0046872
GO:0070497

Feature Viewer

pLDDT pTM Quality
96.66 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map