F488313
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1018 | 519 | 995 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300014968|Ga0157379_11222599|Ga0157379_112225991 |
| Length | 149 |
| Sequence | MYSVNVRDHFMIAHSFRGEVFGPAQRLHGATYVVDLELRRAELDADGVVVDIALATEVLRGVLGELNLRNLDDDPSFKGKNTTTEFMARVIFDRIADRIAKGELGPHSSGLSALRVRLNESHVAWAAYEGALPARAGGTTAAAFSFRET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 3 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 4 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 5 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 6 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 7 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 8 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 9 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 10 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 11 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 12 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 13 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 14 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 15 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 16 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 17 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 18 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 19 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 20 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 21 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 22 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 89 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 90 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 91 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 92 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 93 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 106 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 151 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 229 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 231 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 232 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 233 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 234 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 235 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 238 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 241 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 242 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 243 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 244 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 245 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 247 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 248 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 249 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 250 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 251 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 252 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 253 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 254 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 255 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 256 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 258 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 259 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 260 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 261 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 262 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 263 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 264 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 265 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 266 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 267 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 270 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 271 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 276 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 277 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 278 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 279 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 281 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 282 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 283 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 284 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 285 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 286 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 287 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 288 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 289 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 290 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 291 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 292 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 293 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 294 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 295 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 296 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 297 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 298 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 299 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 300 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 301 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 302 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 303 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 304 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 305 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 306 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 307 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 308 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 309 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 310 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 311 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 312 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 313 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 314 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 315 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 316 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 317 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 318 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 319 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 320 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 321 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 322 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 323 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 324 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 325 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 326 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 327 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 328 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 329 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 330 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 331 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 332 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 333 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 334 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 335 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 336 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 337 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 338 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 339 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 340 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 341 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 424 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 426 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 427 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 428 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 429 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 430 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 431 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 432 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 434 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 435 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 436 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 437 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 438 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 439 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 440 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 441 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 442 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 443 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 444 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 445 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 446 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 452 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 482 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 483 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 484 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 485 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 486 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 487 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 488 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 489 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 490 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 491 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 492 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 493 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 494 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 495 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 497 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 499 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 500 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 501 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 502 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 503 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 504 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 505 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 506 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 507 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 508 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 510 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 511 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 512 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 513 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 514 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 515 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 516 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 517 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 518 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 519 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.35 |
| Metatranscriptomes | 0.39 |
| Isolates | 2.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.99 |
| Nodule | 0 |
| Rhizoplane | 8.55 |
| Rhizosphere | 79.47 |
| Stem | 0 |
| Stem Tuber | 0.1 |
| Unclassified | 5.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10172920 | 3300002067 | Bacteria | 625 |
| 2 | JGI24748J21848_1008115 | 3300002074 | Bacteria | 1233 |
| 3 | JGI24744J21845_10008927 | 3300002077 | Bacteria | 2060 |
| 4 | JGI24742J22300_10001686 | 3300002244 | Bacteria | 3522 |
| 5 | JGI25159J45721_1018451 | 3300002987 | Bacteria | 1406 |
| 6 | rootH2_10034964 | 3300003320 | Bacteria | 2548 |
| 7 | rootL2_10026840 | 3300003322 | Bacteria | 1234 |
| 8 | Ga0055536_1021586 | 3300003781 | Bacteria | 1948 |
| 9 | Ga0055534_1001074 | 3300003784 | Bacteria | 11753 |
| 10 | Ga0065165_1023608 | 3300005262 | Bacteria | 2081 |
| 11 | Ga0065714_10304250 | 3300005288 | Bacteria | 690 |
| 12 | Ga0065715_10265259 | 3300005293 | Bacteria | 1109 |
| 13 | Ga0070658_10090488 | 3300005327 | Bacteria | 2521 |
| 14 | Ga0070676_10070662 | 3300005328 | Bacteria | 2095 |
| 15 | Ga0070676_10112415 | 3300005328 | Bacteria | 1698 |
| 16 | Ga0070690_100371934 | 3300005330 | Bacteria | 1043 |
| 17 | Ga0070670_100449115 | 3300005331 | Bacteria | 1142 |
| 18 | Ga0070670_101161066 | 3300005331 | Bacteria | 705 |
| 19 | Ga0070670_101206962 | 3300005331 | Bacteria | 691 |
| 20 | Ga0070666_10140479 | 3300005335 | Bacteria | 1682 |
| 21 | Ga0070666_10186907 | 3300005335 | Bacteria | 1455 |
| 22 | Ga0070680_100413145 | 3300005336 | Bacteria | 1151 |
| 23 | Ga0070682_101082412 | 3300005337 | Bacteria | 670 |
| 24 | Ga0070682_101673269 | 3300005337 | Bacteria | 552 |
| 25 | Ga0068868_100016515 | 3300005338 | Bacteria | 5484 |
| 26 | Ga0068868_101073879 | 3300005338 | Bacteria | 740 |
| 27 | Ga0068868_101465723 | 3300005338 | Bacteria | 638 |
| 28 | Ga0070660_100207859 | 3300005339 | Bacteria | 1589 |
| 29 | Ga0070660_100805747 | 3300005339 | Bacteria | 790 |
| 30 | Ga0070689_100025236 | 3300005340 | Bacteria | 4463 |
| 31 | Ga0070691_10225640 | 3300005341 | Bacteria | 995 |
| 32 | Ga0070692_10154673 | 3300005345 | Bacteria | 1309 |
| 33 | Ga0070668_100018680 | 3300005347 | Bacteria | 5205 |
| 34 | Ga0070668_100332893 | 3300005347 | Bacteria | 1281 |
| 35 | Ga0070669_100064693 | 3300005353 | Bacteria | 2694 |
| 36 | Ga0070669_100244349 | 3300005353 | Bacteria | 1427 |
| 37 | Ga0070675_100173253 | 3300005354 | Bacteria | 1862 |
| 38 | Ga0070675_100356422 | 3300005354 | Bacteria | 1298 |
| 39 | Ga0070675_100793664 | 3300005354 | Bacteria | 865 |
| 40 | Ga0070671_100766453 | 3300005355 | Bacteria | 839 |
| 41 | Ga0070674_100008012 | 3300005356 | Bacteria | 6262 |
| 42 | Ga0070674_100021660 | 3300005356 | Bacteria | 4132 |
| 43 | Ga0070674_100341654 | 3300005356 | Bacteria | 1206 |
| 44 | Ga0070674_101411477 | 3300005356 | Bacteria | 624 |
| 45 | Ga0070673_100042639 | 3300005364 | Bacteria | 3500 |
| 46 | Ga0070673_100575249 | 3300005364 | Bacteria | 1025 |
| 47 | Ga0070673_101812787 | 3300005364 | Bacteria | 578 |
| 48 | Ga0070659_100152307 | 3300005366 | Bacteria | 1887 |
| 49 | Ga0070659_100407126 | 3300005366 | Bacteria | 1149 |
| 50 | Ga0070659_100413861 | 3300005366 | Bacteria | 1139 |
| 51 | Ga0070667_100027114 | 3300005367 | Bacteria | 4767 |
| 52 | Ga0070667_100036634 | 3300005367 | Bacteria | 4113 |
| 53 | Ga0070709_10199704 | 3300005434 | Bacteria | 1415 |
| 54 | Ga0070714_100105406 | 3300005435 | Bacteria | 2489 |
| 55 | Ga0070713_100079692 | 3300005436 | Bacteria | 2790 |
| 56 | Ga0070710_10039279 | 3300005437 | Bacteria | 2604 |
| 57 | Ga0070701_10017100 | 3300005438 | Bacteria | 3385 |
| 58 | Ga0070711_100014147 | 3300005439 | Bacteria | 5022 |
| 59 | Ga0070705_100048274 | 3300005440 | Bacteria | 2465 |
| 60 | Ga0070705_100071395 | 3300005440 | Bacteria | 2100 |
| 61 | Ga0070700_100053452 | 3300005441 | Bacteria | 2521 |
| 62 | Ga0070700_100176358 | 3300005441 | Bacteria | 1484 |
| 63 | Ga0070700_100807657 | 3300005441 | Bacteria | 756 |
| 64 | Ga0070694_100173161 | 3300005444 | Bacteria | 1591 |
| 65 | Ga0070708_102150063 | 3300005445 | Bacteria | 516 |
| 66 | Ga0070663_100558960 | 3300005455 | Bacteria | 957 |
| 67 | Ga0070678_100001294 | 3300005456 | Bacteria | 13272 |
| 68 | Ga0070678_100078800 | 3300005456 | Bacteria | 2490 |
| 69 | Ga0070678_100086545 | 3300005456 | Bacteria | 2391 |
| 70 | Ga0070678_100784048 | 3300005456 | Bacteria | 864 |
| 71 | Ga0070662_100257279 | 3300005457 | Bacteria | 1405 |
| 72 | Ga0070662_101398133 | 3300005457 | Bacteria | 603 |
| 73 | Ga0070681_10144431 | 3300005458 | Bacteria | 2309 |
| 74 | Ga0070681_10442928 | 3300005458 | Bacteria | 1211 |
| 75 | Ga0068867_100008440 | 3300005459 | Bacteria | 7265 |
| 76 | Ga0068867_100293167 | 3300005459 | Bacteria | 1338 |
| 77 | Ga0070685_10439347 | 3300005466 | Bacteria | 912 |
| 78 | Ga0070706_100090329 | 3300005467 | Unclassified | 2840 |
| 79 | Ga0070707_100062969 | 3300005468 | Bacteria | 3559 |
| 80 | Ga0070707_100528875 | 3300005468 | Bacteria | 1141 |
| 81 | Ga0070699_100180201 | 3300005518 | Bacteria | 1875 |
| 82 | Ga0070699_101159005 | 3300005518 | Bacteria | 709 |
| 83 | Ga0070679_100269820 | 3300005530 | Bacteria | 1656 |
| 84 | Ga0070679_100955777 | 3300005530 | Bacteria | 800 |
| 85 | Ga0070684_100369695 | 3300005535 | Bacteria | 1320 |
| 86 | Ga0068853_100036947 | 3300005539 | Bacteria | 4155 |
| 87 | Ga0068853_100107809 | 3300005539 | Bacteria | 2470 |
| 88 | Ga0068853_100315093 | 3300005539 | Bacteria | 1449 |
| 89 | Ga0070672_100151280 | 3300005543 | Bacteria | 1920 |
| 90 | Ga0070672_100548114 | 3300005543 | Bacteria | 1004 |
| 91 | Ga0070686_100093953 | 3300005544 | Bacteria | 2012 |
| 92 | Ga0070695_100045120 | 3300005545 | Bacteria | 2808 |
| 93 | Ga0070696_100066279 | 3300005546 | Bacteria | 2532 |
| 94 | Ga0070696_100172963 | 3300005546 | Bacteria | 1598 |
| 95 | Ga0070693_100031922 | 3300005547 | Bacteria | 2891 |
| 96 | Ga0070693_101161568 | 3300005547 | Bacteria | 591 |
| 97 | Ga0070693_101171658 | 3300005547 | Bacteria | 589 |
| 98 | Ga0070665_100042922 | 3300005548 | Bacteria | 4546 |
| 99 | Ga0070665_100051263 | 3300005548 | Bacteria | 4139 |
| 100 | Ga0070665_100383285 | 3300005548 | Bacteria | 1413 |
| 101 | Ga0070665_100534506 | 3300005548 | Bacteria | 1184 |
| 102 | Ga0070665_100910509 | 3300005548 | Bacteria | 892 |
| 103 | Ga0070665_101304798 | 3300005548 | Bacteria | 736 |
| 104 | Ga0070665_101662619 | 3300005548 | Bacteria | 646 |
| 105 | Ga0070704_100024045 | 3300005549 | Bacteria | 3991 |
| 106 | Ga0068855_100114588 | 3300005563 | Bacteria | 3090 |
| 107 | Ga0068855_100855039 | 3300005563 | Bacteria | 964 |
| 108 | Ga0070664_101332470 | 3300005564 | Bacteria | 678 |
| 109 | Ga0068854_100023417 | 3300005578 | Bacteria | 4218 |
| 110 | Ga0068854_100045135 | 3300005578 | Bacteria | 3132 |
| 111 | Ga0070702_100024373 | 3300005615 | Bacteria | 3227 |
| 112 | Ga0070702_100199986 | 3300005615 | Bacteria | 1322 |
| 113 | Ga0068852_100549006 | 3300005616 | Bacteria | 1156 |
| 114 | Ga0068859_100037263 | 3300005617 | Bacteria | 4881 |
| 115 | Ga0068859_100111455 | 3300005617 | Bacteria | 2799 |
| 116 | Ga0068859_100293493 | 3300005617 | Bacteria | 1719 |
| 117 | Ga0068859_101260357 | 3300005617 | Bacteria | 814 |
| 118 | Ga0068864_101975244 | 3300005618 | Bacteria | 589 |
| 119 | Ga0068866_10001530 | 3300005718 | Bacteria | 9830 |
| 120 | Ga0068861_100038370 | 3300005719 | Bacteria | 3566 |
| 121 | Ga0068861_101379145 | 3300005719 | Bacteria | 688 |
| 122 | Ga0068851_10337315 | 3300005834 | Bacteria | 874 |
| 123 | Ga0068863_100146957 | 3300005841 | Bacteria | 2255 |
| 124 | Ga0068863_100373813 | 3300005841 | Bacteria | 1391 |
| 125 | Ga0068863_101056975 | 3300005841 | Bacteria | 816 |
| 126 | Ga0068858_100267655 | 3300005842 | Bacteria | 1625 |
| 127 | Ga0068860_100011938 | 3300005843 | Bacteria | 8562 |
| 128 | Ga0068862_100047952 | 3300005844 | Bacteria | 3646 |
| 129 | Ga0068862_100610275 | 3300005844 | Bacteria | 1048 |
| 130 | Ga0068862_101376999 | 3300005844 | Bacteria | 708 |
| 131 | Ga0081538_10046032 | 3300005981 | Bacteria | 2697 |
| 132 | Ga0081538_10091673 | 3300005981 | Bacteria | 1568 |
| 133 | Ga0081540_1007386 | 3300005983 | Bacteria | 7838 |
| 134 | Ga0081540_1016146 | 3300005983 | Bacteria | 4688 |
| 135 | Ga0081540_1167435 | 3300005983 | Bacteria | 843 |
| 136 | Ga0081539_10000299 | 3300005985 | Bacteria | 111908 |
| 137 | Ga0081539_10006277 | 3300005985 | Bacteria | 11490 |
| 138 | Ga0070717_10010702 | 3300006028 | Bacteria | 6939 |
| 139 | Ga0070717_10066969 | 3300006028 | Bacteria | 2987 |
| 140 | Ga0070717_10120662 | 3300006028 | Bacteria | 2246 |
| 141 | Ga0075365_10071999 | 3300006038 | Bacteria | 2328 |
| 142 | Ga0075365_10211734 | 3300006038 | Bacteria | 1359 |
| 143 | Ga0075365_10220873 | 3300006038 | Bacteria | 1329 |
| 144 | Ga0075365_10271109 | 3300006038 | Bacteria | 1194 |
| 145 | Ga0075368_10143308 | 3300006042 | Bacteria | 996 |
| 146 | Ga0075368_10150401 | 3300006042 | Bacteria | 972 |
| 147 | Ga0075363_100023402 | 3300006048 | Bacteria | 3130 |
| 148 | Ga0075363_100592895 | 3300006048 | Bacteria | 663 |
| 149 | Ga0075363_100696964 | 3300006048 | Bacteria | 613 |
| 150 | Ga0075364_10029290 | 3300006051 | Bacteria | 3530 |
| 151 | Ga0075364_10458701 | 3300006051 | Bacteria | 871 |
| 152 | Ga0070715_10052427 | 3300006163 | Bacteria | 1759 |
| 153 | Ga0070716_100068576 | 3300006173 | Bacteria | 2075 |
| 154 | Ga0070716_101393205 | 3300006173 | Bacteria | 570 |
| 155 | Ga0070712_100008934 | 3300006175 | Bacteria | 6311 |
| 156 | Ga0070712_100345257 | 3300006175 | Bacteria | 1217 |
| 157 | Ga0075362_10060502 | 3300006177 | Bacteria | 1712 |
| 158 | Ga0075362_10720379 | 3300006177 | Bacteria | 521 |
| 159 | Ga0075367_10390720 | 3300006178 | Bacteria | 879 |
| 160 | Ga0075366_10208717 | 3300006195 | Bacteria | 1188 |
| 161 | Ga0075366_10268627 | 3300006195 | Bacteria | 1042 |
| 162 | Ga0075370_10368658 | 3300006353 | Bacteria | 859 |
| 163 | Ga0075370_10947642 | 3300006353 | Bacteria | 527 |
| 164 | Ga0068871_100398100 | 3300006358 | Bacteria | 1226 |
| 165 | Ga0075428_100018822 | 3300006844 | Bacteria | 7635 |
| 166 | Ga0075428_100354231 | 3300006844 | Bacteria | 1575 |
| 167 | Ga0075430_100072971 | 3300006846 | Bacteria | 2878 |
| 168 | Ga0075431_100042432 | 3300006847 | Bacteria | 4692 |
| 169 | Ga0075431_101084318 | 3300006847 | Bacteria | 766 |
| 170 | Ga0075433_10182552 | 3300006852 | Bacteria | 1867 |
| 171 | Ga0075433_11767433 | 3300006852 | Bacteria | 532 |
| 172 | Ga0075434_100367206 | 3300006871 | Bacteria | 1460 |
| 173 | Ga0068865_100125572 | 3300006881 | Bacteria | 1915 |
| 174 | Ga0068865_100129560 | 3300006881 | Bacteria | 1888 |
| 175 | Ga0097620_100037262 | 3300006931 | Bacteria | 4881 |
| 176 | Ga0097620_100111448 | 3300006931 | Bacteria | 2799 |
| 177 | Ga0097620_100293499 | 3300006931 | Bacteria | 1719 |
| 178 | Ga0097620_101260336 | 3300006931 | Bacteria | 814 |
| 179 | Ga0075435_100014526 | 3300007076 | Bacteria | 5889 |
| 180 | Ga0105251_10017909 | 3300009011 | Bacteria | 3783 |
| 181 | Ga0105244_10197529 | 3300009036 | Bacteria | 949 |
| 182 | Ga0105250_10092247 | 3300009092 | Bacteria | 1233 |
| 183 | Ga0105240_10074931 | 3300009093 | Bacteria | 4175 |
| 184 | Ga0105240_11384836 | 3300009093 | Bacteria | 740 |
| 185 | Ga0105240_12236665 | 3300009093 | Bacteria | 567 |
| 186 | Ga0105240_12472115 | 3300009093 | Bacteria | 537 |
| 187 | Ga0105245_10009348 | 3300009098 | Bacteria | 8551 |
| 188 | Ga0105245_10368583 | 3300009098 | Bacteria | 1427 |
| 189 | Ga0105245_11653112 | 3300009098 | Bacteria | 692 |
| 190 | Ga0105247_10006155 | 3300009101 | Bacteria | 7453 |
| 191 | Ga0105247_10010073 | 3300009101 | Bacteria | 5726 |
| 192 | Ga0105247_11080438 | 3300009101 | Bacteria | 632 |
| 193 | Ga0105247_11651280 | 3300009101 | Bacteria | 528 |
| 194 | Ga0114129_10017668 | 3300009147 | Bacteria | 10155 |
| 195 | Ga0114129_10678086 | 3300009147 | Bacteria | 1327 |
| 196 | Ga0114129_10942226 | 3300009147 | Bacteria | 1091 |
| 197 | Ga0105243_10051593 | 3300009148 | Bacteria | 3254 |
| 198 | Ga0105243_10897620 | 3300009148 | Bacteria | 881 |
| 199 | Ga0105241_11225501 | 3300009174 | Bacteria | 712 |
| 200 | Ga0105242_10042876 | 3300009176 | Bacteria | 3657 |
| 201 | Ga0105248_10038947 | 3300009177 | Bacteria | 5322 |
| 202 | Ga0105248_10143185 | 3300009177 | Bacteria | 2697 |
| 203 | Ga0105248_10859441 | 3300009177 | Bacteria | 1024 |
| 204 | Ga0105248_11240489 | 3300009177 | Bacteria | 843 |
| 205 | Ga0105237_10318849 | 3300009545 | Bacteria | 1558 |
| 206 | Ga0105237_11013762 | 3300009545 | Bacteria | 837 |
| 207 | Ga0105237_11314535 | 3300009545 | Bacteria | 729 |
| 208 | Ga0105238_10024517 | 3300009551 | Bacteria | 6148 |
| 209 | Ga0105238_10300619 | 3300009551 | Bacteria | 1588 |
| 210 | Ga0105249_11822231 | 3300009553 | Bacteria | 681 |
| 211 | Ga0105239_10142382 | 3300010375 | Bacteria | 2673 |
| 212 | Ga0105239_10171478 | 3300010375 | Bacteria | 2426 |
| 213 | Ga0105239_10420894 | 3300010375 | Bacteria | 1513 |
| 214 | Ga0105239_12761492 | 3300010375 | Bacteria | 573 |
| 215 | Ga0105246_10114745 | 3300011119 | Bacteria | 1985 |
| 216 | Ga0105246_11917460 | 3300011119 | Bacteria | 569 |
| 217 | Ga0157371_10190717 | 3300013102 | Bacteria | 1467 |
| 218 | Ga0157370_11678116 | 3300013104 | Bacteria | 570 |
| 219 | Ga0157369_10310155 | 3300013105 | Bacteria | 1641 |
| 220 | Ga0157369_10331275 | 3300013105 | Bacteria | 1582 |
| 221 | Ga0171462_1004 | 3300013250 | Bacteria | 678877 |
| 222 | Ga0157374_10208145 | 3300013296 | Bacteria | 1917 |
| 223 | Ga0157374_10493822 | 3300013296 | Bacteria | 1228 |
| 224 | Ga0157378_10021612 | 3300013297 | Bacteria | 5659 |
| 225 | Ga0163162_10084317 | 3300013306 | Bacteria | 3253 |
| 226 | Ga0163162_10142108 | 3300013306 | Bacteria | 2514 |
| 227 | Ga0163162_10332349 | 3300013306 | Bacteria | 1652 |
| 228 | Ga0163162_10654578 | 3300013306 | Bacteria | 1174 |
| 229 | Ga0157372_10102729 | 3300013307 | Bacteria | 3265 |
| 230 | Ga0157372_11219675 | 3300013307 | Bacteria | 869 |
| 231 | Ga0157375_10210678 | 3300013308 | Bacteria | 2101 |
| 232 | Ga0157375_10224591 | 3300013308 | Bacteria | 2037 |
| 233 | Ga0157375_10614737 | 3300013308 | Bacteria | 1245 |
| 234 | Ga0157375_10731172 | 3300013308 | Bacteria | 1142 |
| 235 | Ga0157375_11403674 | 3300013308 | Bacteria | 823 |
| 236 | Ga0157380_10049476 | 3300014326 | Bacteria | 3316 |
| 237 | Ga0182008_10001482 | 3300014497 | Bacteria | 15678 |
| 238 | Ga0182008_10749493 | 3300014497 | Bacteria | 562 |
| 239 | Ga0157377_10073172 | 3300014745 | Bacteria | 1985 |
| 240 | Ga0157377_10333652 | 3300014745 | Bacteria | 1012 |
| 241 | Ga0157379_10143086 | 3300014968 | Bacteria | 2156 |
| 242 | Ga0157379_10207813 | 3300014968 | Bacteria | 1772 |
| 243 | Ga0157379_10300546 | 3300014968 | Bacteria | 1463 |
| 244 | Ga0157379_11222599 | 3300014968 | Bacteria | 723 |
| 245 | Ga0157376_10894255 | 3300014969 | Bacteria | 906 |
| 246 | Ga0157376_10984409 | 3300014969 | Bacteria | 865 |
| 247 | Ga0157376_11044620 | 3300014969 | Bacteria | 841 |
| 248 | Ga0157376_12384402 | 3300014969 | Bacteria | 569 |
| 249 | Ga0182007_10000321 | 3300015262 | Bacteria | 30433 |
| 250 | Ga0182005_1037556 | 3300015265 | Bacteria | 1317 |
| 251 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 252 | Ga0163161_10073709 | 3300017792 | Bacteria | 2502 |
| 253 | Ga0163161_10098765 | 3300017792 | Bacteria | 2170 |
| 254 | Ga0163161_10743269 | 3300017792 | Bacteria | 820 |
| 255 | Ga0163161_11172797 | 3300017792 | Bacteria | 663 |
| 256 | Ga0163161_11448280 | 3300017792 | Bacteria | 601 |
| 257 | Ga0213876_10028695 | 3300021384 | Bacteria | 2934 |
| 258 | Ga0224712_10046356 | 3300022467 | Bacteria | 1668 |
| 259 | Ga0209130_1006006 | 3300025284 | Bacteria | 4044 |
| 260 | Ga0209675_1005102 | 3300025291 | Bacteria | 5600 |
| 261 | Ga0209676_1006325 | 3300025292 | Bacteria | 5875 |
| 262 | Ga0209564_1045945 | 3300025295 | Bacteria | 1118 |
| 263 | Ga0209758_1008881 | 3300025297 | Bacteria | 6384 |
| 264 | Ga0209050_1064932 | 3300025298 | Bacteria | 843 |
| 265 | Ga0207426_1068224 | 3300025302 | Bacteria | 1000 |
| 266 | Ga0209051_1021425 | 3300025303 | Bacteria | 2753 |
| 267 | Ga0209257_1021959 | 3300025304 | Bacteria | 2295 |
| 268 | Ga0207696_1185139 | 3300025711 | Bacteria | 550 |
| 269 | Ga0207713_1032370 | 3300025735 | Bacteria | 2297 |
| 270 | Ga0207682_10112758 | 3300025893 | Bacteria | 1198 |
| 271 | Ga0207692_10000532 | 3300025898 | Bacteria | 13531 |
| 272 | Ga0207692_10014167 | 3300025898 | Bacteria | 3479 |
| 273 | Ga0207642_10005216 | 3300025899 | Bacteria | 4233 |
| 274 | Ga0207642_10365176 | 3300025899 | Bacteria | 855 |
| 275 | Ga0207710_10005704 | 3300025900 | Bacteria | 5346 |
| 276 | Ga0207710_10013402 | 3300025900 | Bacteria | 3451 |
| 277 | Ga0207710_10203756 | 3300025900 | Bacteria | 978 |
| 278 | Ga0207688_10105007 | 3300025901 | Bacteria | 1635 |
| 279 | Ga0207688_10479698 | 3300025901 | Bacteria | 777 |
| 280 | Ga0207680_10273418 | 3300025903 | Bacteria | 1172 |
| 281 | Ga0207645_10133496 | 3300025907 | Bacteria | 1616 |
| 282 | Ga0207645_10591921 | 3300025907 | Bacteria | 753 |
| 283 | Ga0207643_10051860 | 3300025908 | Bacteria | 2329 |
| 284 | Ga0207684_11190203 | 3300025910 | Bacteria | 631 |
| 285 | Ga0207654_10100282 | 3300025911 | Bacteria | 1783 |
| 286 | Ga0207707_10091702 | 3300025912 | Bacteria | 2655 |
| 287 | Ga0207707_10257787 | 3300025912 | Bacteria | 1514 |
| 288 | Ga0207695_10369810 | 3300025913 | Bacteria | 1320 |
| 289 | Ga0207671_10319052 | 3300025914 | Bacteria | 1229 |
| 290 | Ga0207671_10724174 | 3300025914 | Bacteria | 791 |
| 291 | Ga0207693_10022554 | 3300025915 | Bacteria | 5002 |
| 292 | Ga0207693_10155484 | 3300025915 | Bacteria | 1798 |
| 293 | Ga0207693_10240116 | 3300025915 | Bacteria | 1422 |
| 294 | Ga0207663_10020680 | 3300025916 | Bacteria | 3731 |
| 295 | Ga0207660_10098925 | 3300025917 | Bacteria | 2176 |
| 296 | Ga0207660_10207307 | 3300025917 | Bacteria | 1534 |
| 297 | Ga0207660_10416852 | 3300025917 | Bacteria | 1083 |
| 298 | Ga0207662_10192237 | 3300025918 | Bacteria | 1317 |
| 299 | Ga0207657_10241729 | 3300025919 | Bacteria | 1441 |
| 300 | Ga0207657_10325893 | 3300025919 | Bacteria | 1214 |
| 301 | Ga0207657_10376376 | 3300025919 | Bacteria | 1118 |
| 302 | Ga0207657_10769224 | 3300025919 | Bacteria | 745 |
| 303 | Ga0207652_10331988 | 3300025921 | Bacteria | 1373 |
| 304 | Ga0207652_10571534 | 3300025921 | Bacteria | 1015 |
| 305 | Ga0207652_10748062 | 3300025921 | Bacteria | 870 |
| 306 | Ga0207652_11355563 | 3300025921 | Bacteria | 614 |
| 307 | Ga0207646_10168149 | 3300025922 | Unclassified | 1980 |
| 308 | Ga0207681_10060858 | 3300025923 | Bacteria | 2593 |
| 309 | Ga0207681_10263604 | 3300025923 | Bacteria | 1350 |
| 310 | Ga0207694_10065630 | 3300025924 | Bacteria | 2830 |
| 311 | Ga0207650_10644367 | 3300025925 | Bacteria | 893 |
| 312 | Ga0207650_11388262 | 3300025925 | Bacteria | 598 |
| 313 | Ga0207659_10188988 | 3300025926 | Bacteria | 1638 |
| 314 | Ga0207659_10203087 | 3300025926 | Bacteria | 1584 |
| 315 | Ga0207659_10562722 | 3300025926 | Bacteria | 970 |
| 316 | Ga0207659_10669363 | 3300025926 | Bacteria | 888 |
| 317 | Ga0207687_10008069 | 3300025927 | Bacteria | 6890 |
| 318 | Ga0207687_10030326 | 3300025927 | Bacteria | 3646 |
| 319 | Ga0207700_10462442 | 3300025928 | Bacteria | 1119 |
| 320 | Ga0207700_10766761 | 3300025928 | Bacteria | 862 |
| 321 | Ga0207664_10068766 | 3300025929 | Bacteria | 2846 |
| 322 | Ga0207644_10844881 | 3300025931 | Bacteria | 766 |
| 323 | Ga0207644_11043055 | 3300025931 | Bacteria | 687 |
| 324 | Ga0207690_10172027 | 3300025932 | Bacteria | 1624 |
| 325 | Ga0207690_10367526 | 3300025932 | Bacteria | 1141 |
| 326 | Ga0207690_10386997 | 3300025932 | Bacteria | 1113 |
| 327 | Ga0207690_10419978 | 3300025932 | Bacteria | 1070 |
| 328 | Ga0207690_11013745 | 3300025932 | Bacteria | 691 |
| 329 | Ga0207706_10046195 | 3300025933 | Bacteria | 3856 |
| 330 | Ga0207709_10012850 | 3300025935 | Bacteria | 4617 |
| 331 | Ga0207709_11615274 | 3300025935 | Bacteria | 538 |
| 332 | Ga0207670_10644665 | 3300025936 | Bacteria | 873 |
| 333 | Ga0207669_10010595 | 3300025937 | Bacteria | 4442 |
| 334 | Ga0207669_10086942 | 3300025937 | Bacteria | 2023 |
| 335 | Ga0207669_10286496 | 3300025937 | Bacteria | 1245 |
| 336 | Ga0207669_11089017 | 3300025937 | Bacteria | 674 |
| 337 | Ga0207704_10001963 | 3300025938 | Bacteria | 9223 |
| 338 | Ga0207704_10159079 | 3300025938 | Bacteria | 1605 |
| 339 | Ga0207704_10688319 | 3300025938 | Bacteria | 845 |
| 340 | Ga0207665_10013758 | 3300025939 | Bacteria | 5321 |
| 341 | Ga0207691_10012135 | 3300025940 | Bacteria | 8261 |
| 342 | Ga0207691_10683048 | 3300025940 | Bacteria | 866 |
| 343 | Ga0207711_10089795 | 3300025941 | Bacteria | 2700 |
| 344 | Ga0207711_10823973 | 3300025941 | Bacteria | 864 |
| 345 | Ga0207711_10903854 | 3300025941 | Bacteria | 821 |
| 346 | Ga0207711_11417763 | 3300025941 | Bacteria | 637 |
| 347 | Ga0207689_10104805 | 3300025942 | Bacteria | 2324 |
| 348 | Ga0207661_10237536 | 3300025944 | Bacteria | 1616 |
| 349 | Ga0207661_10446308 | 3300025944 | Bacteria | 1178 |
| 350 | Ga0207679_11720307 | 3300025945 | Bacteria | 574 |
| 351 | Ga0207667_10353033 | 3300025949 | Bacteria | 1499 |
| 352 | Ga0207667_11067545 | 3300025949 | Bacteria | 792 |
| 353 | Ga0207667_11301264 | 3300025949 | Bacteria | 703 |
| 354 | Ga0207651_10001558 | 3300025960 | Bacteria | 10485 |
| 355 | Ga0207651_10778370 | 3300025960 | Bacteria | 847 |
| 356 | Ga0207712_10413268 | 3300025961 | Bacteria | 1137 |
| 357 | Ga0207712_10424765 | 3300025961 | Bacteria | 1122 |
| 358 | Ga0207668_10012098 | 3300025972 | Bacteria | 5271 |
| 359 | Ga0207640_10073446 | 3300025981 | Bacteria | 2311 |
| 360 | Ga0207640_10210114 | 3300025981 | Bacteria | 1482 |
| 361 | Ga0207658_10004918 | 3300025986 | Bacteria | 9215 |
| 362 | Ga0207658_10029493 | 3300025986 | Bacteria | 3875 |
| 363 | Ga0207677_10011807 | 3300026023 | Bacteria | 4996 |
| 364 | Ga0207677_10065995 | 3300026023 | Bacteria | 2528 |
| 365 | Ga0207677_10297832 | 3300026023 | Bacteria | 1331 |
| 366 | Ga0207703_10096913 | 3300026035 | Bacteria | 2491 |
| 367 | Ga0207703_10185395 | 3300026035 | Bacteria | 1839 |
| 368 | Ga0207639_10015661 | 3300026041 | Bacteria | 5350 |
| 369 | Ga0207639_10027103 | 3300026041 | Bacteria | 4170 |
| 370 | Ga0207678_10114498 | 3300026067 | Bacteria | 2301 |
| 371 | Ga0207678_10505399 | 3300026067 | Bacteria | 1054 |
| 372 | Ga0207678_10799330 | 3300026067 | Bacteria | 833 |
| 373 | Ga0207708_10051067 | 3300026075 | Bacteria | 3148 |
| 374 | Ga0207708_10323234 | 3300026075 | Bacteria | 1260 |
| 375 | Ga0207702_10691622 | 3300026078 | Bacteria | 1005 |
| 376 | Ga0207641_10163572 | 3300026088 | Bacteria | 2025 |
| 377 | Ga0207641_11333372 | 3300026088 | Bacteria | 718 |
| 378 | Ga0207648_10066671 | 3300026089 | Bacteria | 3139 |
| 379 | Ga0207648_10323752 | 3300026089 | Bacteria | 1386 |
| 380 | Ga0207648_10371651 | 3300026089 | Bacteria | 1291 |
| 381 | Ga0207648_11661497 | 3300026089 | Bacteria | 600 |
| 382 | Ga0207676_10277669 | 3300026095 | Bacteria | 1520 |
| 383 | Ga0207676_10335749 | 3300026095 | Bacteria | 1392 |
| 384 | Ga0207676_10390358 | 3300026095 | Bacteria | 1298 |
| 385 | Ga0207676_11210054 | 3300026095 | Bacteria | 749 |
| 386 | Ga0207676_11249253 | 3300026095 | Bacteria | 737 |
| 387 | Ga0207675_100058616 | 3300026118 | Bacteria | 3593 |
| 388 | Ga0207675_100138746 | 3300026118 | Bacteria | 2309 |
| 389 | Ga0207675_100740156 | 3300026118 | Bacteria | 994 |
| 390 | Ga0207683_10062809 | 3300026121 | Bacteria | 3271 |
| 391 | Ga0207683_10081042 | 3300026121 | Bacteria | 2880 |
| 392 | Ga0207683_10115571 | 3300026121 | Bacteria | 2405 |
| 393 | Ga0207683_10232151 | 3300026121 | Bacteria | 1683 |
| 394 | Ga0207683_10323035 | 3300026121 | Bacteria | 1414 |
| 395 | Ga0207683_10617951 | 3300026121 | Bacteria | 1003 |
| 396 | Ga0207683_10665235 | 3300026121 | Bacteria | 965 |
| 397 | Ga0207683_11113099 | 3300026121 | Bacteria | 733 |
| 398 | Ga0207698_10209663 | 3300026142 | Bacteria | 1752 |
| 399 | Ga0207698_10993240 | 3300026142 | Bacteria | 850 |
| 400 | Ga0207698_11084800 | 3300026142 | Bacteria | 813 |
| 401 | Ga0207698_11321224 | 3300026142 | Bacteria | 736 |
| 402 | Ga0209813_10161325 | 3300027866 | Bacteria | 809 |
| 403 | Ga0209974_10224326 | 3300027876 | Bacteria | 700 |
| 404 | Ga0207428_10111254 | 3300027907 | Bacteria | 2107 |
| 405 | Ga0268266_10016681 | 3300028379 | Bacteria | 6276 |
| 406 | Ga0268266_10204779 | 3300028379 | Bacteria | 1807 |
| 407 | Ga0268266_10208375 | 3300028379 | Bacteria | 1792 |
| 408 | Ga0268266_10222587 | 3300028379 | Bacteria | 1735 |
| 409 | Ga0268266_10435207 | 3300028379 | Bacteria | 1245 |
| 410 | Ga0268266_10480135 | 3300028379 | Bacteria | 1185 |
| 411 | Ga0268266_11108744 | 3300028379 | Bacteria | 766 |
| 412 | Ga0268265_10316918 | 3300028380 | Bacteria | 1410 |
| 413 | Ga0268264_10030902 | 3300028381 | Bacteria | 4391 |
| 414 | Ga0265337_1031514 | 3300028556 | Bacteria | 1574 |
| 415 | Ga0265318_10325930 | 3300028577 | Bacteria | 560 |
| 416 | Ga0265336_10061960 | 3300028666 | Bacteria | 1122 |
| 417 | Ga0307517_10130253 | 3300028786 | Bacteria | 1815 |
| 418 | Ga0307515_10000487 | 3300028794 | Bacteria | 94783 |
| 419 | Ga0307515_10056940 | 3300028794 | Bacteria | 5667 |
| 420 | Ga0307511_10000159 | 3300030521 | Bacteria | 65231 |
| 421 | Ga0307511_10001103 | 3300030521 | Bacteria | 28774 |
| 422 | Ga0307512_10053040 | 3300030522 | Bacteria | 3228 |
| 423 | Ga0316177_1113942 | 3300030731 | Bacteria | 718 |
| 424 | Ga0265320_10000429 | 3300031240 | Bacteria | 33137 |
| 425 | Ga0265331_10197765 | 3300031250 | Bacteria | 906 |
| 426 | Ga0265327_10003277 | 3300031251 | Bacteria | 15681 |
| 427 | Ga0265316_10037489 | 3300031344 | Bacteria | 3912 |
| 428 | Ga0307513_10025548 | 3300031456 | Bacteria | 6837 |
| 429 | Ga0307513_10032587 | 3300031456 | Bacteria | 5873 |
| 430 | Ga0307513_10033683 | 3300031456 | Bacteria | 5756 |
| 431 | Ga0307513_10098869 | 3300031456 | Bacteria | 2947 |
| 432 | Ga0307513_10308731 | 3300031456 | Bacteria | 1345 |
| 433 | Ga0307513_10441643 | 3300031456 | Bacteria | 1027 |
| 434 | Ga0307513_10445830 | 3300031456 | Bacteria | 1020 |
| 435 | Ga0307513_10448606 | 3300031456 | Bacteria | 1015 |
| 436 | Ga0307509_10036922 | 3300031507 | Bacteria | 5344 |
| 437 | Ga0307408_100214815 | 3300031548 | Bacteria | 1566 |
| 438 | Ga0307408_100269808 | 3300031548 | Bacteria | 1412 |
| 439 | Ga0307408_100556305 | 3300031548 | Bacteria | 1013 |
| 440 | Ga0307408_101932668 | 3300031548 | Bacteria | 566 |
| 441 | Ga0307514_10108568 | 3300031649 | Bacteria | 1972 |
| 442 | Ga0316575_10002608 | 3300031665 | Bacteria | 6073 |
| 443 | Ga0316579_10003332 | 3300031691 | Bacteria | 6242 |
| 444 | Ga0316579_10422801 | 3300031691 | Bacteria | 644 |
| 445 | Ga0265314_10022219 | 3300031711 | Bacteria | 4862 |
| 446 | Ga0316576_10002073 | 3300031727 | Bacteria | 11256 |
| 447 | Ga0316576_10204172 | 3300031727 | Bacteria | 1488 |
| 448 | Ga0316578_10000393 | 3300031728 | Bacteria | 14094 |
| 449 | Ga0316578_10158789 | 3300031728 | Bacteria | 1362 |
| 450 | Ga0307516_10001460 | 3300031730 | Bacteria | 32683 |
| 451 | Ga0307516_10041378 | 3300031730 | Bacteria | 4580 |
| 452 | Ga0307405_10456388 | 3300031731 | Bacteria | 1014 |
| 453 | Ga0316577_10029468 | 3300031733 | Bacteria | 3063 |
| 454 | Ga0307413_10096982 | 3300031824 | Bacteria | 1937 |
| 455 | Ga0307413_10481726 | 3300031824 | Bacteria | 992 |
| 456 | Ga0307413_11207694 | 3300031824 | Bacteria | 658 |
| 457 | Ga0307413_11921610 | 3300031824 | Bacteria | 532 |
| 458 | Ga0307518_10009673 | 3300031838 | Bacteria | 6883 |
| 459 | Ga0307410_10035590 | 3300031852 | Bacteria | 3235 |
| 460 | Ga0307410_10282119 | 3300031852 | Bacteria | 1304 |
| 461 | Ga0307406_10046095 | 3300031901 | Bacteria | 2741 |
| 462 | Ga0307406_10145830 | 3300031901 | Bacteria | 1682 |
| 463 | Ga0307406_11158689 | 3300031901 | Bacteria | 670 |
| 464 | Ga0307407_10022944 | 3300031903 | Bacteria | 3248 |
| 465 | Ga0307407_11451107 | 3300031903 | Bacteria | 542 |
| 466 | Ga0307412_10551037 | 3300031911 | Bacteria | 968 |
| 467 | Ga0307412_10822742 | 3300031911 | Bacteria | 808 |
| 468 | Ga0307409_100069879 | 3300031995 | Bacteria | 2785 |
| 469 | Ga0307409_100221069 | 3300031995 | Bacteria | 1710 |
| 470 | Ga0307409_100277771 | 3300031995 | Bacteria | 1546 |
| 471 | Ga0307409_101283505 | 3300031995 | Bacteria | 757 |
| 472 | Ga0307416_100365830 | 3300032002 | Bacteria | 1466 |
| 473 | Ga0307416_101094106 | 3300032002 | Bacteria | 901 |
| 474 | Ga0307416_102273067 | 3300032002 | Bacteria | 643 |
| 475 | Ga0307414_10224023 | 3300032004 | Bacteria | 1546 |
| 476 | Ga0307411_10000850 | 3300032005 | Bacteria | 11472 |
| 477 | Ga0307411_10289605 | 3300032005 | Bacteria | 1308 |
| 478 | Ga0307411_11303703 | 3300032005 | Bacteria | 662 |
| 479 | Ga0307415_100395947 | 3300032126 | Bacteria | 1177 |
| 480 | Ga0316583_10010654 | 3300032133 | Bacteria | 3315 |
| 481 | Ga0316583_10061685 | 3300032133 | Bacteria | 1313 |
| 482 | Ga0316585_10154369 | 3300032137 | Bacteria | 758 |
| 483 | Ga0316580_10010722 | 3300032139 | Bacteria | 2774 |
| 484 | Ga0316580_10081089 | 3300032139 | Bacteria | 992 |
| 485 | Ga0307507_10015626 | 3300033179 | Bacteria | 8907 |
| 486 | Ga0307507_10047289 | 3300033179 | Bacteria | 4205 |
| 487 | Ga0307510_10076915 | 3300033180 | Bacteria | 3277 |
| 488 | Ga0316596_1020082 | 3300033541 | Bacteria | 1698 |
| 489 | Ga0373948_0022376 | 3300034817 | Bacteria | 1218 |
| 490 | Ga0373928_0031819 | 3300035084 | Bacteria | 1173 |
| 491 | Ga0373929_0096214 | 3300035085 | Bacteria | 741 |
| 492 | Ga0373940_0013567 | 3300035088 | Bacteria | 1975 |
| 493 | Ga0373932_0025237 | 3300035112 | Bacteria | 1607 |
| 494 | Ga0373932_0034054 | 3300035112 | Bacteria | 1433 |
| 495 | Ga0373943_0801310 | 3300035170 | Bacteria | 561 |
| 496 | Ga0373955_1000875 | 3300035172 | Bacteria | 515 |
| 497 | Ga0316574_0007588 | 3300035398 | Bacteria | 5957 |
| 498 | Ga0316574_0182618 | 3300035398 | Bacteria | 1349 |
| 499 | Ga0316574_0325191 | 3300035398 | Bacteria | 976 |
| 500 | Ga0316574_0639565 | 3300035398 | Bacteria | 655 |
| 501 | Ga0373931_0047293 | 3300035691 | Bacteria | 2277 |
| 502 | Ga0316582_0001290 | 3300036647 | Bacteria | 10842 |
| 503 | Ga0316582_0119321 | 3300036647 | Bacteria | 1763 |
| 504 | Ga0316584_0005768 | 3300036712 | Bacteria | 8344 |
| 505 | Ga0316584_0006427 | 3300036712 | Bacteria | 7957 |
| 506 | Ga0316584_0028260 | 3300036712 | Bacteria | 4133 |
| 507 | Ga0316584_0056631 | 3300036712 | Bacteria | 2934 |
| 508 | Ga0373925_0341859 | 3300037068 | Bacteria | 1214 |
| 509 | Ga0373925_0916629 | 3300037068 | Bacteria | 722 |
| 510 | Ga0395900_0685437 | 3300037418 | Bacteria | 959 |
| 511 | Ga0395898_1280448 | 3300037466 | Bacteria | 663 |
| 512 | Ga0395905_0001958 | 3300037471 | Bacteria | 23568 |
| 513 | Ga0436364_0814508 | 3300037853 | Bacteria | 6441 |
| 514 | Ga0395901_0038670 | 3300038443 | Bacteria | 4935 |
| 515 | Ga0395901_0104465 | 3300038443 | Bacteria | 2973 |
| 516 | Ga0395901_0155976 | 3300038443 | Bacteria | 2398 |
| 517 | Ga0395901_0398040 | 3300038443 | Bacteria | 1415 |
| 518 | Ga0436365_0301162 | 3300039437 | Bacteria | 3663 |
| 519 | Ga0436363_1309788 | 3300039450 | Bacteria | 672 |
| 520 | Ga0436363_1589930 | 3300039450 | Bacteria | 683 |
| 521 | Ga0439436_0010782 | 3300041404 | Bacteria | 2784 |
| 522 | Ga0439436_0018666 | 3300041404 | Bacteria | 2073 |
| 523 | Ga0439436_0076691 | 3300041404 | Bacteria | 931 |
| 524 | Ga0439438_073999 | 3300041405 | Bacteria | 841 |
| 525 | Ga0439439_0003849 | 3300041406 | Bacteria | 3337 |
| 526 | Ga0439439_0123106 | 3300041406 | Bacteria | 724 |
| 527 | Ga0439447_012773 | 3300041407 | Bacteria | 2402 |
| 528 | Ga0439447_032115 | 3300041407 | Bacteria | 1314 |
| 529 | Ga0439461_0007746 | 3300041410 | Bacteria | 1912 |
| 530 | Ga0439461_0020941 | 3300041410 | Bacteria | 1299 |
| 531 | Ga0439466_0070440 | 3300041411 | Bacteria | 1114 |
| 532 | Ga0439466_0101741 | 3300041411 | Bacteria | 895 |
| 533 | Ga0439465_0012312 | 3300041413 | Bacteria | 2677 |
| 534 | Ga0451800_0803309 | 3300041459 | Unclassified | 899 |
| 535 | Ga0451802_1269109 | 3300041460 | Bacteria | 1025 |
| 536 | Ga0451833_0080370 | 3300041491 | Bacteria | 845 |
| 537 | Ga0451837_1419958 | 3300041494 | Bacteria | 1653 |
| 538 | Ga0451845_0914589 | 3300041501 | Bacteria | 793 |
| 539 | Ga0451847_0013531 | 3300041503 | Bacteria | 675 |
| 540 | Ga0451849_0339851 | 3300041505 | Bacteria | 3606 |
| 541 | Ga0451843_0253762 | 3300041509 | Bacteria | 760 |
| 542 | Ga0451843_1206146 | 3300041509 | Bacteria | 584 |
| 543 | Ga0451843_1772571 | 3300041509 | Bacteria | 599 |
| 544 | Ga0451853_0371860 | 3300041512 | Bacteria | 25651 |
| 545 | Ga0451853_2463512 | 3300041512 | Bacteria | 1325 |
| 546 | Ga0439431_0002697 | 3300041997 | Bacteria | 3901 |
| 547 | Ga0439431_0025503 | 3300041997 | Bacteria | 1444 |
| 548 | Ga0439433_0006460 | 3300041999 | Bacteria | 2522 |
| 549 | Ga0439433_0025770 | 3300041999 | Bacteria | 1329 |
| 550 | Ga0439433_0056272 | 3300041999 | Bacteria | 933 |
| 551 | Ga0439433_0075693 | 3300041999 | Bacteria | 814 |
| 552 | Ga0439442_020830 | 3300042002 | Bacteria | 1359 |
| 553 | Ga0439442_038499 | 3300042002 | Bacteria | 1002 |
| 554 | Ga0439445_0003652 | 3300042004 | Bacteria | 3454 |
| 555 | Ga0439432_001430 | 3300042006 | Bacteria | 8979 |
| 556 | Ga0439432_047206 | 3300042006 | Bacteria | 1351 |
| 557 | Ga0439449_0000791 | 3300042007 | Bacteria | 12215 |
| 558 | Ga0439449_0002046 | 3300042007 | Bacteria | 7942 |
| 559 | Ga0439449_0012758 | 3300042007 | Bacteria | 3160 |
| 560 | Ga0439452_003109 | 3300042010 | Bacteria | 5886 |
| 561 | Ga0439452_038430 | 3300042010 | Bacteria | 1136 |
| 562 | Ga0439457_018913 | 3300042014 | Bacteria | 1530 |
| 563 | Ga0439457_025777 | 3300042014 | Bacteria | 1300 |
| 564 | Ga0439457_026139 | 3300042014 | Bacteria | 1292 |
| 565 | Ga0439462_0007236 | 3300042015 | Bacteria | 2776 |
| 566 | Ga0439462_0012747 | 3300042015 | Bacteria | 2150 |
| 567 | Ga0439462_0119658 | 3300042015 | Bacteria | 732 |
| 568 | Ga0450897_018121 | 3300042128 | Bacteria | 737 |
| 569 | Ga0450894_001632 | 3300042131 | Bacteria | 3168 |
| 570 | Ga0450894_009610 | 3300042131 | Bacteria | 1255 |
| 571 | Ga0450898_023986 | 3300042134 | Bacteria | 1088 |
| 572 | Ga0450889_020336 | 3300042144 | Bacteria | 735 |
| 573 | Ga0450906_030582 | 3300042145 | Bacteria | 952 |
| 574 | Ga0450907_043258 | 3300042146 | Bacteria | 771 |
| 575 | Ga0439446_0011919 | 3300042156 | Bacteria | 2368 |
| 576 | Ga0439446_0247102 | 3300042156 | Bacteria | 614 |
| 577 | Ga0439446_0345635 | 3300042156 | Bacteria | 529 |
| 578 | Ga0450908_022151 | 3300042184 | Bacteria | 1114 |
| 579 | Ga0450909_001800 | 3300042185 | Bacteria | 3017 |
| 580 | Ga0439434_0012172 | 3300042435 | Bacteria | 2545 |
| 581 | Ga0439434_0012407 | 3300042435 | Bacteria | 2521 |
| 582 | Ga0439434_0092605 | 3300042435 | Bacteria | 968 |
| 583 | Ga0439459_0151166 | 3300042438 | Bacteria | 607 |
| 584 | Ga0439460_0151314 | 3300042461 | Bacteria | 774 |
| 585 | Ga0450893_0016581 | 3300042532 | Bacteria | 1248 |
| 586 | Ga0466969_0020496 | 3300044656 | Bacteria | 3423 |
| 587 | Ga0466969_0045057 | 3300044656 | Bacteria | 2190 |
| 588 | Ga0466972_0007057 | 3300044658 | Bacteria | 5637 |
| 589 | Ga0466972_0013289 | 3300044658 | Bacteria | 4133 |
| 590 | Ga0466972_0139847 | 3300044658 | Bacteria | 1139 |
| 591 | Ga0466972_0621125 | 3300044658 | Bacteria | 511 |
| 592 | Ga0466965_0446689 | 3300044683 | Bacteria | 719 |
| 593 | Ga0466966_0012619 | 3300044684 | Bacteria | 5600 |
| 594 | Ga0466966_0290131 | 3300044684 | Bacteria | 983 |
| 595 | Ga0466961_0019506 | 3300044693 | Bacteria | 4361 |
| 596 | Ga0466961_0026723 | 3300044693 | Bacteria | 3711 |
| 597 | Ga0466961_0171730 | 3300044693 | Bacteria | 1348 |
| 598 | Ga0466963_0023612 | 3300044694 | Bacteria | 3908 |
| 599 | Ga0466963_0046778 | 3300044694 | Bacteria | 2854 |
| 600 | Ga0466964_0045742 | 3300044706 | Bacteria | 1782 |
| 601 | Ga0466964_0046761 | 3300044706 | Bacteria | 1765 |
| 602 | Ga0466971_0013985 | 3300044719 | Bacteria | 3527 |
| 603 | Ga0466971_0235231 | 3300044719 | Bacteria | 870 |
| 604 | Ga0466968_0003477 | 3300044735 | Bacteria | 5823 |
| 605 | Ga0466968_0013252 | 3300044735 | Bacteria | 3240 |
| 606 | Ga0466968_0054924 | 3300044735 | Bacteria | 1708 |
| 607 | Ga0466968_0170000 | 3300044735 | Bacteria | 1010 |
| 608 | Ga0466970_0045561 | 3300044765 | Bacteria | 2336 |
| 609 | Ga0466970_0109183 | 3300044765 | Bacteria | 1510 |
| 610 | Ga0466970_0115115 | 3300044765 | Bacteria | 1470 |
| 611 | Ga0466970_0165459 | 3300044765 | Bacteria | 1224 |
| 612 | Ga0466970_0776843 | 3300044765 | Bacteria | 560 |
| 613 | Ga0466957_0204418 | 3300044842 | Bacteria | 1298 |
| 614 | Ga0466957_1301351 | 3300044842 | Bacteria | 527 |
| 615 | Ga0466960_0011715 | 3300044901 | Bacteria | 3680 |
| 616 | Ga0466960_0015043 | 3300044901 | Bacteria | 3329 |
| 617 | Ga0466960_0061209 | 3300044901 | Bacteria | 1847 |
| 618 | Ga0466960_0127334 | 3300044901 | Bacteria | 1340 |
| 619 | Ga0466960_0538870 | 3300044901 | Bacteria | 687 |
| 620 | Ga0466960_0562661 | 3300044901 | Bacteria | 673 |
| 621 | Ga0466960_0602736 | 3300044901 | Bacteria | 652 |
| 622 | Ga0466959_0027067 | 3300045049 | Bacteria | 4253 |
| 623 | Ga0466959_0146439 | 3300045049 | Bacteria | 1666 |
| 624 | Ga0466959_0361069 | 3300045049 | Bacteria | 990 |
| 625 | Ga0451576_0861574 | 3300045051 | Bacteria | 951 |
| 626 | Ga0466958_0001930 | 3300045836 | Bacteria | 10160 |
| 627 | Ga0466958_0258283 | 3300045836 | Bacteria | 1115 |
| 628 | Ga0466967_0042891 | 3300045976 | Bacteria | 3913 |
| 629 | Ga0466967_0195376 | 3300045976 | Bacteria | 1914 |
| 630 | Ga0466967_0219775 | 3300045976 | Bacteria | 1805 |
| 631 | Ga0466967_0234972 | 3300045976 | Bacteria | 1746 |
| 632 | Ga0466967_0331305 | 3300045976 | Bacteria | 1470 |
| 633 | Ga0466967_0492976 | 3300045976 | Bacteria | 1201 |
| 634 | Ga0466967_0499147 | 3300045976 | Bacteria | 1194 |
| 635 | Ga0466967_0877783 | 3300045976 | Bacteria | 892 |
| 636 | Ga0466967_2036727 | 3300045976 | Bacteria | 571 |
| 637 | Ga0495617_007078 | 3300046452 | Bacteria | 3912 |
| 638 | Ga0495627_031049 | 3300046453 | Bacteria | 1690 |
| 639 | Ga0495592_0046118 | 3300046454 | Bacteria | 3249 |
| 640 | Ga0495592_0236177 | 3300046454 | Bacteria | 1215 |
| 641 | Ga0495603_0011194 | 3300046455 | Bacteria | 5437 |
| 642 | Ga0495603_0020447 | 3300046455 | Bacteria | 4011 |
| 643 | Ga0495603_0064159 | 3300046455 | Bacteria | 2166 |
| 644 | Ga0495590_0101900 | 3300046457 | Bacteria | 1020 |
| 645 | Ga0495629_0000826 | 3300046459 | Bacteria | 25106 |
| 646 | Ga0495629_0089285 | 3300046459 | Bacteria | 2150 |
| 647 | Ga0495629_0129549 | 3300046459 | Bacteria | 1757 |
| 648 | Ga0495629_0183071 | 3300046459 | Bacteria | 1452 |
| 649 | Ga0495638_0134535 | 3300046460 | Bacteria | 1449 |
| 650 | Ga0495651_0039768 | 3300046462 | Bacteria | 3659 |
| 651 | Ga0495651_0067319 | 3300046462 | Bacteria | 2732 |
| 652 | Ga0495651_0551112 | 3300046462 | Bacteria | 732 |
| 653 | Ga0495653_0532159 | 3300046463 | Bacteria | 729 |
| 654 | Ga0495653_0811526 | 3300046463 | Bacteria | 562 |
| 655 | Ga0495650_0004071 | 3300046471 | Bacteria | 10225 |
| 656 | Ga0495650_0122923 | 3300046471 | Bacteria | 954 |
| 657 | Ga0495580_0274634 | 3300046472 | Bacteria | 1150 |
| 658 | Ga0495582_0080172 | 3300046473 | Bacteria | 1812 |
| 659 | Ga0495605_0003700 | 3300046474 | Bacteria | 9072 |
| 660 | Ga0495639_0001006 | 3300046475 | Bacteria | 12734 |
| 661 | Ga0495639_0003852 | 3300046475 | Bacteria | 6445 |
| 662 | Ga0495662_0005228 | 3300046476 | Bacteria | 6506 |
| 663 | Ga0495664_0556275 | 3300046477 | Bacteria | 683 |
| 664 | Ga0495584_0133047 | 3300046491 | Bacteria | 1262 |
| 665 | Ga0495594_0000177 | 3300046499 | Bacteria | 30788 |
| 666 | Ga0495594_0139607 | 3300046499 | Bacteria | 1374 |
| 667 | Ga0495583_0059830 | 3300046506 | Bacteria | 1705 |
| 668 | Ga0495606_0016399 | 3300046507 | Bacteria | 5650 |
| 669 | Ga0495608_0090288 | 3300046511 | Bacteria | 1982 |
| 670 | Ga0495608_0222705 | 3300046511 | Bacteria | 1183 |
| 671 | Ga0495610_0060642 | 3300046512 | Bacteria | 1800 |
| 672 | Ga0495616_0018753 | 3300046513 | Bacteria | 3790 |
| 673 | Ga0495618_0050137 | 3300046514 | Bacteria | 2636 |
| 674 | Ga0495620_0050344 | 3300046515 | Bacteria | 1777 |
| 675 | Ga0495628_0066026 | 3300046516 | Bacteria | 2828 |
| 676 | Ga0495628_0321781 | 3300046516 | Bacteria | 1141 |
| 677 | Ga0495628_0740758 | 3300046516 | Bacteria | 691 |
| 678 | Ga0495630_0684128 | 3300046517 | Bacteria | 785 |
| 679 | Ga0495631_0005737 | 3300046518 | Bacteria | 6475 |
| 680 | Ga0495632_0170772 | 3300046519 | Bacteria | 999 |
| 681 | Ga0495643_0005063 | 3300046522 | Bacteria | 9017 |
| 682 | Ga0495643_0095385 | 3300046522 | Bacteria | 1530 |
| 683 | Ga0495648_0013270 | 3300046524 | Bacteria | 6102 |
| 684 | Ga0495663_0009814 | 3300046525 | Bacteria | 2658 |
| 685 | Ga0495666_0010356 | 3300046526 | Bacteria | 4647 |
| 686 | Ga0495642_0010168 | 3300046528 | Bacteria | 3604 |
| 687 | Ga0495642_0532180 | 3300046528 | Bacteria | 521 |
| 688 | Ga0495652_0012460 | 3300046529 | Bacteria | 7666 |
| 689 | Ga0495654_0078989 | 3300046530 | Bacteria | 1546 |
| 690 | Ga0495665_0593313 | 3300046531 | Bacteria | 554 |
| 691 | Ga0495640_0009264 | 3300046533 | Bacteria | 7675 |
| 692 | Ga0495640_0145921 | 3300046533 | Bacteria | 1522 |
| 693 | Ga0495586_0089819 | 3300046535 | Bacteria | 1696 |
| 694 | Ga0495586_0470595 | 3300046535 | Bacteria | 725 |
| 695 | Ga0495587_0419179 | 3300046536 | Bacteria | 743 |
| 696 | Ga0495621_0322780 | 3300046539 | Bacteria | 643 |
| 697 | Ga0495645_0160416 | 3300046543 | Bacteria | 1555 |
| 698 | Ga0495645_0287484 | 3300046543 | Bacteria | 1079 |
| 699 | Ga0495645_0358971 | 3300046543 | Bacteria | 937 |
| 700 | Ga0495622_0047154 | 3300046557 | Bacteria | 2002 |
| 701 | Ga0495622_0065903 | 3300046557 | Bacteria | 1674 |
| 702 | Ga0495622_0101223 | 3300046557 | Bacteria | 1320 |
| 703 | Ga0495633_0042904 | 3300046558 | Bacteria | 2146 |
| 704 | Ga0495633_0573919 | 3300046558 | Bacteria | 507 |
| 705 | Ga0495656_0000073 | 3300046615 | Bacteria | 44754 |
| 706 | Ga0495668_0012473 | 3300046616 | Bacteria | 5038 |
| 707 | Ga0495634_0044708 | 3300046642 | Bacteria | 2996 |
| 708 | Ga0495611_0046736 | 3300046648 | Bacteria | 1941 |
| 709 | Ga0495625_0038753 | 3300046660 | Bacteria | 3486 |
| 710 | Ga0495625_0183547 | 3300046660 | Bacteria | 1389 |
| 711 | Ga0495635_0021267 | 3300046663 | Bacteria | 4522 |
| 712 | Ga0495635_0335406 | 3300046663 | Bacteria | 1010 |
| 713 | Ga0495659_0370794 | 3300046664 | Bacteria | 614 |
| 714 | Ga0495661_0029347 | 3300046665 | Bacteria | 3511 |
| 715 | Ga0495588_0002150 | 3300046674 | Bacteria | 8432 |
| 716 | Ga0495588_0089506 | 3300046674 | Bacteria | 1612 |
| 717 | Ga0495588_0096693 | 3300046674 | Bacteria | 1549 |
| 718 | Ga0495588_0242631 | 3300046674 | Bacteria | 950 |
| 719 | Ga0495588_0543978 | 3300046674 | Bacteria | 608 |
| 720 | Ga0495657_0099059 | 3300046675 | Bacteria | 1859 |
| 721 | Ga0495599_0271547 | 3300046678 | Bacteria | 1029 |
| 722 | Ga0495599_0275980 | 3300046678 | Bacteria | 1019 |
| 723 | Ga0495599_0554923 | 3300046678 | Bacteria | 672 |
| 724 | Ga0495623_0047241 | 3300046679 | Bacteria | 2732 |
| 725 | Ga0495658_0060684 | 3300046683 | Bacteria | 2169 |
| 726 | Ga0495658_0438519 | 3300046683 | Bacteria | 834 |
| 727 | Ga0495669_0383665 | 3300046684 | Bacteria | 680 |
| 728 | Ga0495613_0021244 | 3300046689 | Bacteria | 4841 |
| 729 | Ga0495613_0170537 | 3300046689 | Bacteria | 1544 |
| 730 | Ga0495613_0570427 | 3300046689 | Bacteria | 755 |
| 731 | Ga0495624_0021994 | 3300046690 | Bacteria | 4222 |
| 732 | Ga0495624_0065203 | 3300046690 | Bacteria | 2275 |
| 733 | Ga0495624_0699164 | 3300046690 | Bacteria | 602 |
| 734 | Ga0495670_0129399 | 3300046691 | Bacteria | 1315 |
| 735 | Ga0495649_0031727 | 3300046694 | Bacteria | 2912 |
| 736 | Ga0495589_0212769 | 3300046794 | Bacteria | 910 |
| 737 | Ga0495600_0125983 | 3300046809 | Bacteria | 1666 |
| 738 | Ga0495600_0166548 | 3300046809 | Bacteria | 1423 |
| 739 | Ga0495660_0208771 | 3300046810 | Bacteria | 927 |
| 740 | Ga0495581_0094891 | 3300047315 | Bacteria | 1732 |
| 741 | Ga0495581_0235632 | 3300047315 | Bacteria | 1070 |
| 742 | Ga0495604_0151764 | 3300047317 | Bacteria | 1645 |
| 743 | Ga0495604_0225515 | 3300047317 | Bacteria | 1288 |
| 744 | Ga0495604_0625339 | 3300047317 | Bacteria | 688 |
| 745 | Ga0495636_0009829 | 3300047318 | Bacteria | 3767 |
| 746 | Ga0495636_0063959 | 3300047318 | Bacteria | 1560 |
| 747 | Ga0495636_0367052 | 3300047318 | Bacteria | 681 |
| 748 | Ga0495674_0066221 | 3300047319 | Bacteria | 3135 |
| 749 | Ga0495674_0108554 | 3300047319 | Bacteria | 2354 |
| 750 | Ga0495676_0008000 | 3300047321 | Bacteria | 9694 |
| 751 | Ga0495676_0066306 | 3300047321 | Bacteria | 2798 |
| 752 | Ga0495676_0105305 | 3300047321 | Bacteria | 2080 |
| 753 | Ga0495680_0091481 | 3300047322 | Bacteria | 2280 |
| 754 | Ga0495687_001616 | 3300047443 | Bacteria | 20319 |
| 755 | Ga0495687_055125 | 3300047443 | Bacteria | 1663 |
| 756 | Ga0495687_084167 | 3300047443 | Bacteria | 1236 |
| 757 | Ga0495675_0006543 | 3300047444 | Bacteria | 7134 |
| 758 | Ga0495675_0668309 | 3300047444 | Bacteria | 584 |
| 759 | Ga0495677_0046213 | 3300047445 | Bacteria | 1598 |
| 760 | Ga0495677_0351579 | 3300047445 | Bacteria | 582 |
| 761 | Ga0495685_001871 | 3300047447 | Bacteria | 6504 |
| 762 | Ga0495685_005147 | 3300047447 | Bacteria | 4258 |
| 763 | Ga0495681_0064080 | 3300047470 | Bacteria | 1685 |
| 764 | Ga0495681_0198968 | 3300047470 | Bacteria | 814 |
| 765 | Ga0495684_0130016 | 3300047471 | Bacteria | 1892 |
| 766 | Ga0495686_0111878 | 3300047472 | Bacteria | 1636 |
| 767 | Ga0495686_0498386 | 3300047472 | Bacteria | 642 |
| 768 | Ga0495686_0509102 | 3300047472 | Bacteria | 633 |
| 769 | Ga0495686_0568431 | 3300047472 | Bacteria | 590 |
| 770 | Ga0495593_0090469 | 3300047673 | Bacteria | 1576 |
| 771 | Ga0495593_0096633 | 3300047673 | Bacteria | 1517 |
| 772 | Ga0495602_0446839 | 3300048088 | Bacteria | 913 |
| 773 | Ga0495614_0033238 | 3300048089 | Bacteria | 2219 |
| 774 | Ga0495626_0111202 | 3300048091 | Bacteria | 1186 |
| 775 | Ga0495626_0115705 | 3300048091 | Bacteria | 1157 |
| 776 | Ga0496100_0003006 | 3300048903 | Bacteria | 8695 |
| 777 | Ga0496100_0009927 | 3300048903 | Bacteria | 5369 |
| 778 | Ga0496100_0262922 | 3300048903 | Bacteria | 1280 |
| 779 | Ga0496101_0003437 | 3300048904 | Bacteria | 9883 |
| 780 | Ga0496101_0003632 | 3300048904 | Bacteria | 9631 |
| 781 | Ga0496101_0005647 | 3300048904 | Bacteria | 7980 |
| 782 | Ga0496101_0296101 | 3300048904 | Bacteria | 1267 |
| 783 | Ga0496101_0342137 | 3300048904 | Bacteria | 1175 |
| 784 | Ga0496101_0378587 | 3300048904 | Bacteria | 1113 |
| 785 | Ga0496101_0441698 | 3300048904 | Bacteria | 1026 |
| 786 | Ga0496101_1078930 | 3300048904 | Bacteria | 631 |
| 787 | Ga0496102_0000044 | 3300048905 | Bacteria | 187834 |
| 788 | Ga0496102_0005443 | 3300048905 | Bacteria | 10797 |
| 789 | Ga0496102_0014277 | 3300048905 | Bacteria | 6902 |
| 790 | Ga0496102_0074466 | 3300048905 | Bacteria | 3121 |
| 791 | Ga0496102_0347129 | 3300048905 | Bacteria | 1397 |
| 792 | Ga0496102_1100422 | 3300048905 | Bacteria | 714 |
| 793 | Ga0496103_0000123 | 3300048906 | Bacteria | 83794 |
| 794 | Ga0496103_0002209 | 3300048906 | Bacteria | 12338 |
| 795 | Ga0496103_0029536 | 3300048906 | Bacteria | 3332 |
| 796 | Ga0496103_0085105 | 3300048906 | Bacteria | 1992 |
| 797 | Ga0496103_0108051 | 3300048906 | Bacteria | 1765 |
| 798 | Ga0496104_0001352 | 3300048907 | Bacteria | 21226 |
| 799 | Ga0496104_0013914 | 3300048907 | Bacteria | 7259 |
| 800 | Ga0496104_0037452 | 3300048907 | Bacteria | 4536 |
| 801 | Ga0496104_0040299 | 3300048907 | Bacteria | 4378 |
| 802 | Ga0496104_0069434 | 3300048907 | Bacteria | 3349 |
| 803 | Ga0496104_0647129 | 3300048907 | Bacteria | 966 |
| 804 | Ga0496104_1466524 | 3300048907 | Bacteria | 585 |
| 805 | Ga0496105_0001642 | 3300048908 | Bacteria | 15921 |
| 806 | Ga0496105_0062883 | 3300048908 | Bacteria | 3062 |
| 807 | Ga0496105_0111863 | 3300048908 | Bacteria | 2253 |
| 808 | Ga0496105_0148916 | 3300048908 | Bacteria | 1924 |
| 809 | Ga0496105_0242187 | 3300048908 | Bacteria | 1463 |
| 810 | Ga0496105_1003590 | 3300048908 | Bacteria | 624 |
| 811 | Ga0496105_1196171 | 3300048908 | Bacteria | 560 |
| 812 | Ga0496106_0003811 | 3300048909 | Bacteria | 11238 |
| 813 | Ga0496106_0131730 | 3300048909 | Bacteria | 1961 |
| 814 | Ga0496106_0167838 | 3300048909 | Bacteria | 1738 |
| 815 | Ga0496106_0187073 | 3300048909 | Bacteria | 1645 |
| 816 | Ga0496107_0005200 | 3300048910 | Bacteria | 8888 |
| 817 | Ga0496107_0017687 | 3300048910 | Bacteria | 5016 |
| 818 | Ga0496107_0300023 | 3300048910 | Bacteria | 1196 |
| 819 | Ga0496107_0477407 | 3300048910 | Bacteria | 925 |
| 820 | Ga0496108_0001073 | 3300048911 | Bacteria | 21338 |
| 821 | Ga0496108_0010591 | 3300048911 | Bacteria | 7484 |
| 822 | Ga0496108_0221656 | 3300048911 | Bacteria | 1643 |
| 823 | Ga0496108_1160860 | 3300048911 | Bacteria | 654 |
| 824 | Ga0496109_0001427 | 3300048912 | Bacteria | 19839 |
| 825 | Ga0496109_0031889 | 3300048912 | Bacteria | 4734 |
| 826 | Ga0496109_0032893 | 3300048912 | Bacteria | 4665 |
| 827 | Ga0496109_0158597 | 3300048912 | Bacteria | 2119 |
| 828 | Ga0496109_0291856 | 3300048912 | Bacteria | 1537 |
| 829 | Ga0496109_0308043 | 3300048912 | Bacteria | 1494 |
| 830 | Ga0496109_0945495 | 3300048912 | Bacteria | 800 |
| 831 | Ga0496110_0019879 | 3300048913 | Bacteria | 5660 |
| 832 | Ga0496110_0091020 | 3300048913 | Bacteria | 2728 |
| 833 | Ga0496110_0114355 | 3300048913 | Bacteria | 2428 |
| 834 | Ga0496110_0114747 | 3300048913 | Bacteria | 2424 |
| 835 | Ga0496110_0118502 | 3300048913 | Bacteria | 2384 |
| 836 | Ga0496110_0212754 | 3300048913 | Bacteria | 1758 |
| 837 | Ga0496110_0632040 | 3300048913 | Bacteria | 970 |
| 838 | Ga0496110_1347307 | 3300048913 | Bacteria | 623 |
| 839 | Ga0496111_0002651 | 3300048914 | Bacteria | 10848 |
| 840 | Ga0496111_0088090 | 3300048914 | Bacteria | 2273 |
| 841 | Ga0496111_0102392 | 3300048914 | Bacteria | 2105 |
| 842 | Ga0496112_0105661 | 3300048915 | Bacteria | 2785 |
| 843 | Ga0496112_0144537 | 3300048915 | Bacteria | 2347 |
| 844 | Ga0496112_0903852 | 3300048915 | Bacteria | 805 |
| 845 | Ga0496113_0172971 | 3300048916 | Bacteria | 1711 |
| 846 | Ga0496113_0271922 | 3300048916 | Bacteria | 1354 |
| 847 | Ga0496113_1190826 | 3300048916 | Bacteria | 595 |
| 848 | Ga0496114_0003033 | 3300048917 | Bacteria | 12879 |
| 849 | Ga0496114_0014718 | 3300048917 | Bacteria | 6286 |
| 850 | Ga0496114_0025803 | 3300048917 | Bacteria | 4806 |
| 851 | Ga0496114_0028600 | 3300048917 | Bacteria | 4575 |
| 852 | Ga0496114_0085365 | 3300048917 | Bacteria | 2674 |
| 853 | Ga0496114_0093689 | 3300048917 | Bacteria | 2554 |
| 854 | Ga0496114_0159218 | 3300048917 | Bacteria | 1962 |
| 855 | Ga0496114_0160327 | 3300048917 | Bacteria | 1955 |
| 856 | Ga0496114_1177035 | 3300048917 | Bacteria | 652 |
| 857 | Ga0496114_1519473 | 3300048917 | Bacteria | 557 |
| 858 | Ga0496115_0018895 | 3300048918 | Bacteria | 5300 |
| 859 | Ga0496115_0217946 | 3300048918 | Bacteria | 1575 |
| 860 | Ga0496117_0345407 | 3300048920 | Bacteria | 770 |
| 861 | Ga0496118_0106977 | 3300048921 | Bacteria | 1869 |
| 862 | Ga0496119_0015393 | 3300048922 | Bacteria | 5893 |
| 863 | Ga0496121_0008995 | 3300048924 | Bacteria | 11580 |
| 864 | Ga0496121_0711222 | 3300048924 | Bacteria | 603 |
| 865 | Ga0496122_0260143 | 3300048925 | Bacteria | 964 |
| 866 | Ga0496125_0519795 | 3300048928 | Bacteria | 666 |
| 867 | Ga0496126_0000026 | 3300048929 | Bacteria | 422310 |
| 868 | Ga0495678_040874 | 3300049459 | Bacteria | 1860 |
| 869 | Ga0501320_019591 | 3300049536 | Bacteria | 773 |
| 870 | Ga0501325_056979 | 3300049541 | Bacteria | 509 |
| 871 | Ga0501031_0023018 | 3300049568 | Bacteria | 4063 |
| 872 | Ga0501031_0073073 | 3300049568 | Bacteria | 2233 |
| 873 | Ga0501031_0343690 | 3300049568 | Bacteria | 966 |
| 874 | Ga0501032_0173014 | 3300049569 | Bacteria | 1415 |
| 875 | Ga0501032_0320542 | 3300049569 | Bacteria | 1000 |
| 876 | Ga0501033_0189168 | 3300049570 | Bacteria | 1474 |
| 877 | Ga0501033_0192909 | 3300049570 | Bacteria | 1457 |
| 878 | Ga0501034_0023509 | 3300049571 | Bacteria | 6280 |
| 879 | Ga0501034_0481555 | 3300049571 | Bacteria | 1156 |
| 880 | Ga0501034_0742682 | 3300049571 | Bacteria | 877 |
| 881 | Ga0501034_1332925 | 3300049571 | Bacteria | 594 |
| 882 | Ga0501036_0166222 | 3300049572 | Bacteria | 1860 |
| 883 | Ga0501036_0632376 | 3300049572 | Bacteria | 887 |
| 884 | Ga0501037_0014653 | 3300049573 | Bacteria | 5769 |
| 885 | Ga0501037_0640389 | 3300049573 | Bacteria | 711 |
| 886 | Ga0501038_0528442 | 3300049574 | Bacteria | 899 |
| 887 | Ga0501039_0037309 | 3300049575 | Bacteria | 3750 |
| 888 | Ga0501039_0068441 | 3300049575 | Bacteria | 2757 |
| 889 | Ga0501039_0335445 | 3300049575 | Bacteria | 1188 |
| 890 | Ga0501040_0063758 | 3300049576 | Bacteria | 2536 |
| 891 | Ga0501040_0273327 | 3300049576 | Bacteria | 1207 |
| 892 | Ga0501040_0725630 | 3300049576 | Bacteria | 719 |
| 893 | Ga0501041_0027304 | 3300049577 | Bacteria | 3440 |
| 894 | Ga0501041_0048489 | 3300049577 | Bacteria | 2587 |
| 895 | Ga0501041_0249025 | 3300049577 | Bacteria | 1117 |
| 896 | Ga0501042_0048239 | 3300049578 | Bacteria | 3037 |
| 897 | Ga0501042_0064138 | 3300049578 | Bacteria | 2625 |
| 898 | Ga0501042_0406136 | 3300049578 | Bacteria | 987 |
| 899 | Ga0501042_0548212 | 3300049578 | Bacteria | 840 |
| 900 | Ga0501043_0053889 | 3300049579 | Bacteria | 3158 |
| 901 | Ga0501043_0291779 | 3300049579 | Bacteria | 1248 |
| 902 | Ga0501043_0675573 | 3300049579 | Bacteria | 756 |
| 903 | Ga0501046_0045749 | 3300049580 | Bacteria | 3475 |
| 904 | Ga0501046_0459756 | 3300049580 | Bacteria | 915 |
| 905 | Ga0501046_1274242 | 3300049580 | Bacteria | 503 |
| 906 | Ga0501047_0039795 | 3300049581 | Bacteria | 4547 |
| 907 | Ga0501048_0025305 | 3300049582 | Bacteria | 4325 |
| 908 | Ga0501048_0132673 | 3300049582 | Bacteria | 1760 |
| 909 | Ga0501067_0222949 | 3300049583 | Bacteria | 1050 |
| 910 | Ga0501068_0218630 | 3300049584 | Bacteria | 1211 |
| 911 | Ga0501069_0324543 | 3300049585 | Bacteria | 905 |
| 912 | Ga0501070_0003499 | 3300049586 | Bacteria | 13603 |
| 913 | Ga0501070_1334663 | 3300049586 | Bacteria | 547 |
| 914 | Ga0501071_0080329 | 3300049587 | Bacteria | 2384 |
| 915 | Ga0501071_0246643 | 3300049587 | Bacteria | 1347 |
| 916 | Ga0501071_0440933 | 3300049587 | Bacteria | 996 |
| 917 | Ga0501072_0016033 | 3300049588 | Bacteria | 5746 |
| 918 | Ga0501072_0019727 | 3300049588 | Bacteria | 5215 |
| 919 | Ga0501072_0617195 | 3300049588 | Bacteria | 854 |
| 920 | Ga0501074_0137136 | 3300049590 | Bacteria | 1750 |
| 921 | Ga0501074_0450420 | 3300049590 | Bacteria | 913 |
| 922 | Ga0501074_1290099 | 3300049590 | Bacteria | 512 |
| 923 | Ga0501075_0121026 | 3300049591 | Bacteria | 1992 |
| 924 | Ga0501075_0156975 | 3300049591 | Bacteria | 1735 |
| 925 | Ga0501076_0037194 | 3300049592 | Bacteria | 3816 |
| 926 | Ga0501076_0121735 | 3300049592 | Bacteria | 2113 |
| 927 | Ga0501076_0433121 | 3300049592 | Bacteria | 1082 |
| 928 | Ga0501076_0553768 | 3300049592 | Bacteria | 948 |
| 929 | Ga0501077_0039288 | 3300049593 | Bacteria | 3014 |
| 930 | Ga0501077_0147522 | 3300049593 | Bacteria | 1492 |
| 931 | Ga0501077_0694437 | 3300049593 | Bacteria | 654 |
| 932 | Ga0501079_0068644 | 3300049741 | Bacteria | 2736 |
| 933 | Ga0501080_0328331 | 3300049742 | Bacteria | 1384 |
| 934 | Ga0501081_0038825 | 3300049743 | Bacteria | 3256 |
| 935 | Ga0501081_0164928 | 3300049743 | Bacteria | 1598 |
| 936 | Ga0501081_1278983 | 3300049743 | Bacteria | 556 |
| 937 | Ga0501083_0201281 | 3300049744 | Bacteria | 1299 |
| 938 | Ga0501083_0708608 | 3300049744 | Bacteria | 655 |
| 939 | Ga0501035_0035383 | 3300049822 | Bacteria | 4532 |
| 940 | Ga0501044_0000854 | 3300049823 | Bacteria | 36617 |
| 941 | Ga0501044_0426551 | 3300049823 | Bacteria | 1235 |
| 942 | Ga0501045_0077963 | 3300049824 | Bacteria | 2442 |
| 943 | Ga0501045_0118141 | 3300049824 | Bacteria | 1968 |
| 944 | Ga0501045_0298601 | 3300049824 | Bacteria | 1199 |
| 945 | Ga0501045_0345218 | 3300049824 | Bacteria | 1108 |
| 946 | nmdc:mga03683_304756_c1 | 3300050489 | Bacteria | 748 |
| 947 | nmdc:mga03683_508175_c1 | 3300050489 | Bacteria | 584 |
| 948 | nmdc:mga03n38_27148_c1 | 3300050490 | Bacteria | 2372 |
| 949 | nmdc:mga03n38_6707_c1 | 3300050490 | Bacteria | 4023 |
| 950 | nmdc:mga03n38_911639_c1 | 3300050490 | Bacteria | 517 |
| 951 | nmdc:mga0yw44_43246_c1 | 3300050492 | Bacteria | 2689 |
| 952 | nmdc:mga0yw44_521209_c1 | 3300050492 | Bacteria | 807 |
| 953 | nmdc:mga0yw44_84242_c1 | 3300050492 | Bacteria | 1998 |
| 954 | nmdc:mga0k408_250805_c1 | 3300050493 | Bacteria | 1057 |
| 955 | nmdc:mga0k408_26286_c1 | 3300050493 | Bacteria | 3299 |
| 956 | nmdc:mga0k408_743818_c1 | 3300050493 | Bacteria | 573 |
| 957 | nmdc:mga06z11_308684_c1 | 3300050494 | Bacteria | 942 |
| 958 | nmdc:mga06z11_338566_c1 | 3300050494 | Bacteria | 899 |
| 959 | nmdc:mga04h51_114965_c1 | 3300050495 | Bacteria | 996 |
| 960 | nmdc:mga07m45_542831_c1 | 3300050496 | Bacteria | 672 |
| 961 | nmdc:mga07m45_64778_c1 | 3300050496 | Bacteria | 2074 |
| 962 | nmdc:mga05p37_1106233_c1 | 3300050507 | Bacteria | 829 |
| 963 | nmdc:mga05p37_391874_c1 | 3300050507 | Bacteria | 1624 |
| 964 | nmdc:mga05p37_63568_c1 | 3300050507 | Bacteria | 4542 |
| 965 | nmdc:mga0qj67_104126_c1 | 3300050509 | Bacteria | 2289 |
| 966 | nmdc:mga06r32_116320_c1 | 3300050510 | Bacteria | 2634 |
| 967 | nmdc:mga0n895_18784_c1 | 3300050512 | Bacteria | 5880 |
| 968 | nmdc:mga0rr50_14251_c1 | 3300050513 | Bacteria | 5207 |
| 969 | nmdc:mga0a205_98967_c2 | 3300050515 | Bacteria | 1883 |
| 970 | nmdc:mga0sz30_353798_c1 | 3300050516 | Bacteria | 656 |
| 971 | Ga0495619_0162262 | 3300053085 | Bacteria | 1544 |
| 972 | Ga0500643_215482 | 3300053087 | Bacteria | 515 |
| 973 | Ga0500644_0018445 | 3300053088 | Bacteria | 2044 |
| 974 | Ga0500646_0053454 | 3300053090 | Bacteria | 1171 |
| 975 | Ga0500650_0174622 | 3300053098 | Bacteria | 986 |
| 976 | Ga0500554_030720 | 3300053102 | Bacteria | 1581 |
| 977 | Ga0500562_001750 | 3300053108 | Bacteria | 5417 |
| 978 | Ga0500568_0180783 | 3300053139 | Bacteria | 775 |
| 979 | Ga0500573_0143528 | 3300053140 | Bacteria | 1313 |
| 980 | Ga0500586_004324 | 3300053145 | Bacteria | 3464 |
| 981 | Ga0500590_031916 | 3300053148 | Bacteria | 2731 |
| 982 | Ga0500600_0069878 | 3300053149 | Bacteria | 1929 |
| 983 | Ga0500619_000013 | 3300053154 | Bacteria | 56987 |
| 984 | Ga0501084_0017861 | 3300054114 | Bacteria | 5905 |
| 985 | Ga0501084_0119084 | 3300054114 | Bacteria | 2219 |
| 986 | Ga0590071_002328 | 3300059421 | Bacteria | 4799 |
| 987 | Ga0501082_0079810 | 3300060353 | Bacteria | 2824 |
| 988 | Ga0501082_0575828 | 3300060353 | Bacteria | 985 |
| 989 | Ga0466962_0026001 | 3300061719 | Bacteria | 2810 |
| 990 | Ga0466962_0182206 | 3300061719 | Bacteria | 1024 |
| 991 | Ga0466962_0204940 | 3300061719 | Bacteria | 964 |
| 992 | Ga0530510_0035937 | 3300061734 | Bacteria | 3571 |
| 993 | Ga0530510_0370493 | 3300061734 | Bacteria | 1077 |
| 994 | Ga0530510_0474942 | 3300061734 | Bacteria | 947 |
| 995 | Ga0530510_1295287 | 3300061734 | Bacteria | 559 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300030522 | Ga0307512_10053040 | Ga0307512_100530403 | 107 |
| 2 | 3300031456 | Ga0307513_10098869 | Ga0307513_100988692 | 107 |
| 3 | 3300031649 | Ga0307514_10108568 | Ga0307514_101085682 | 107 |
| 4 | 3300041494 | Ga0451837_1419958 | Ga0451837_1419958_837_1235 | 107 |
| 5 | 3300046660 | Ga0495625_0038753 | Ga0495625_0038753_2258_2656 | 107 |
| 6 | 3300053149 | Ga0500600_0069878 | Ga0500600_0069878_1334_1732 | 107 |
| 7 | 3300049541 | Ga0501325_056979 | Ga0501325_056979_123_494 | 112 |
| 8 | 3300028379 | Ga0268266_11108744 | Ga0268266_111087442 | 116 |
| 9 | 3300053140 | Ga0500573_0143528 | Ga0500573_0143528_554_952 | 117 |
| 10 | 3300014969 | Ga0157376_10894255 | Ga0157376_108942552 | 118 |
| 11 | 3300047472 | Ga0495686_0498386 | Ga0495686_0498386_30_392 | 118 |
| 12 | 3300049586 | Ga0501070_0003499 | Ga0501070_0003499_13229_13591 | 118 |
| 13 | 3300053102 | Ga0500554_030720 | Ga0500554_030720_111_491 | 118 |
| 14 | 3300044842 | Ga0466957_1301351 | Ga0466957_1301351_50_448 | 119 |
| 15 | 3300048913 | Ga0496110_0632040 | Ga0496110_0632040_17_382 | 119 |
| 16 | iso_pu_bacteria | 2728369276 | 2729905317 | 119 |
| 17 | 3300005617 | Ga0068859_100111455 | Ga0068859_1001114554 | 120 |
| 18 | 3300005719 | Ga0068861_101379145 | Ga0068861_1013791452 | 120 |
| 19 | 3300006931 | Ga0097620_100111448 | Ga0097620_1001114484 | 120 |
| 20 | 3300009101 | Ga0105247_10006155 | Ga0105247_100061559 | 120 |
| 21 | 3300009147 | Ga0114129_10678086 | Ga0114129_106780861 | 120 |
| 22 | 3300009148 | Ga0105243_10051593 | Ga0105243_100515934 | 120 |
| 23 | 3300013296 | Ga0157374_10208145 | Ga0157374_102081452 | 120 |
| 24 | 3300025898 | Ga0207692_10000532 | Ga0207692_100005329 | 120 |
| 25 | 3300025900 | Ga0207710_10005704 | Ga0207710_100057042 | 120 |
| 26 | 3300025944 | Ga0207661_10237536 | Ga0207661_102375362 | 120 |
| 27 | 3300026121 | Ga0207683_10665235 | Ga0207683_106652352 | 120 |
| 28 | 3300026142 | Ga0207698_11084800 | Ga0207698_110848002 | 120 |
| 29 | 3300030731 | Ga0316177_1113942 | Ga0316177_11139422 | 120 |
| 30 | 3300032005 | Ga0307411_10000850 | Ga0307411_100008502 | 120 |
| 31 | 3300035398 | Ga0316574_0325191 | Ga0316574_0325191_274_654 | 120 |
| 32 | 3300036712 | Ga0316584_0028260 | Ga0316584_0028260_2114_2488 | 120 |
| 33 | 3300037068 | Ga0373925_0916629 | Ga0373925_0916629_65_433 | 120 |
| 34 | 3300041459 | Ga0451800_0803309 | Ga0451800_0803309_255_623 | 120 |
| 35 | 3300044658 | Ga0466972_0013289 | Ga0466972_0013289_1846_2226 | 120 |
| 36 | 3300044658 | Ga0466972_0621125 | Ga0466972_0621125_16_384 | 120 |
| 37 | 3300044683 | Ga0466965_0446689 | Ga0466965_0446689_280_660 | 120 |
| 38 | 3300044735 | Ga0466968_0013252 | Ga0466968_0013252_1898_2278 | 120 |
| 39 | 3300044765 | Ga0466970_0109183 | Ga0466970_0109183_1090_1458 | 120 |
| 40 | 3300044901 | Ga0466960_0538870 | Ga0466960_0538870_307_675 | 120 |
| 41 | 3300044901 | Ga0466960_0602736 | Ga0466960_0602736_98_466 | 120 |
| 42 | 3300045976 | Ga0466967_0492976 | Ga0466967_0492976_747_1115 | 120 |
| 43 | 3300046459 | Ga0495629_0129549 | Ga0495629_0129549_14_382 | 120 |
| 44 | 3300046794 | Ga0495589_0212769 | Ga0495589_0212769_37_405 | 120 |
| 45 | 3300048091 | Ga0495626_0111202 | Ga0495626_0111202_808_1176 | 120 |
| 46 | 3300048905 | Ga0496102_0000044 | Ga0496102_0000044_17919_18317 | 120 |
| 47 | 3300048906 | Ga0496103_0000123 | Ga0496103_0000123_66242_66640 | 120 |
| 48 | 3300048920 | Ga0496117_0345407 | Ga0496117_0345407_141_539 | 120 |
| 49 | 3300048921 | Ga0496118_0106977 | Ga0496118_0106977_1398_1796 | 120 |
| 50 | 3300048922 | Ga0496119_0015393 | Ga0496119_0015393_4391_4789 | 120 |
| 51 | 3300049572 | Ga0501036_0166222 | Ga0501036_0166222_856_1254 | 120 |
| 52 | 3300049576 | Ga0501040_0725630 | Ga0501040_0725630_340_708 | 120 |
| 53 | 3300049587 | Ga0501071_0440933 | Ga0501071_0440933_313_693 | 120 |
| 54 | 3300049590 | Ga0501074_0450420 | Ga0501074_0450420_288_686 | 120 |
| 55 | 3300049591 | Ga0501075_0121026 | Ga0501075_0121026_125_505 | 120 |
| 56 | 3300049592 | Ga0501076_0433121 | Ga0501076_0433121_30_410 | 120 |
| 57 | 3300049593 | Ga0501077_0694437 | Ga0501077_0694437_216_596 | 120 |
| 58 | 3300049824 | Ga0501045_0298601 | Ga0501045_0298601_543_923 | 120 |
| 59 | 3300050507 | nmdc:mga05p37_391874_c1 | nmdc:mga05p37_391874_c1_1212_1598 | 120 |
| 60 | 3300061734 | Ga0530510_0370493 | Ga0530510_0370493_45_425 | 120 |
| 61 | 3300005983 | Ga0081540_1007386 | Ga0081540_10073864 | 121 |
| 62 | 3300005983 | Ga0081540_1016146 | Ga0081540_10161462 | 121 |
| 63 | 3300009036 | Ga0105244_10197529 | Ga0105244_101975292 | 121 |
| 64 | 3300009147 | Ga0114129_10942226 | Ga0114129_109422262 | 121 |
| 65 | 3300009177 | Ga0105248_10038947 | Ga0105248_100389476 | 121 |
| 66 | 3300035112 | Ga0373932_0025237 | Ga0373932_0025237_921_1292 | 121 |
| 67 | 3300035172 | Ga0373955_1000875 | Ga0373955_1000875_22_393 | 121 |
| 68 | 3300035398 | Ga0316574_0007588 | Ga0316574_0007588_2685_3056 | 121 |
| 69 | 3300036647 | Ga0316582_0001290 | Ga0316582_0001290_3168_3539 | 121 |
| 70 | 3300036712 | Ga0316584_0006427 | Ga0316584_0006427_5011_5382 | 121 |
| 71 | 3300042461 | Ga0439460_0151314 | Ga0439460_0151314_299_670 | 121 |
| 72 | 3300044735 | Ga0466968_0003477 | Ga0466968_0003477_3045_3416 | 121 |
| 73 | 3300045051 | Ga0451576_0861574 | Ga0451576_0861574_86_457 | 121 |
| 74 | 3300046511 | Ga0495608_0090288 | Ga0495608_0090288_645_1016 | 121 |
| 75 | 3300046684 | Ga0495669_0383665 | Ga0495669_0383665_294_665 | 121 |
| 76 | 3300049572 | Ga0501036_0632376 | Ga0501036_0632376_458_856 | 121 |
| 77 | 3300050489 | nmdc:mga03683_508175_c1 | nmdc:mga03683_508175_c1_63_434 | 121 |
| 78 | 3300050507 | nmdc:mga05p37_1106233_c1 | nmdc:mga05p37_1106233_c1_332_703 | 121 |
| 79 | 3300005467 | Ga0070706_100090329 | Ga0070706_1000903292 | 122 |
| 80 | 3300005468 | Ga0070707_100062969 | Ga0070707_1000629692 | 122 |
| 81 | 3300014969 | Ga0157376_10984409 | Ga0157376_109844092 | 122 |
| 82 | 3300025922 | Ga0207646_10168149 | Ga0207646_101681493 | 122 |
| 83 | 3300025931 | Ga0207644_11043055 | Ga0207644_110430552 | 122 |
| 84 | 3300049536 | Ga0501320_019591 | Ga0501320_019591_321_722 | 122 |
| 85 | 3300013307 | Ga0157372_11219675 | Ga0157372_112196752 | 123 |
| 86 | 3300026142 | Ga0207698_11321224 | Ga0207698_113212242 | 123 |
| 87 | 3300041410 | Ga0439461_0020941 | Ga0439461_0020941_341_718 | 123 |
| 88 | 3300045976 | Ga0466967_0331305 | Ga0466967_0331305_531_908 | 123 |
| 89 | 3300045976 | Ga0466967_0877783 | Ga0466967_0877783_254_640 | 123 |
| 90 | 3300049568 | Ga0501031_0023018 | Ga0501031_0023018_426_803 | 123 |
| 91 | 3300049571 | Ga0501034_1332925 | Ga0501034_1332925_21_398 | 123 |
| 92 | 3300049575 | Ga0501039_0068441 | Ga0501039_0068441_2158_2535 | 123 |
| 93 | 3300049577 | Ga0501041_0027304 | Ga0501041_0027304_470_847 | 123 |
| 94 | 3300049578 | Ga0501042_0048239 | Ga0501042_0048239_1734_2111 | 123 |
| 95 | 3300049582 | Ga0501048_0132673 | Ga0501048_0132673_988_1365 | 123 |
| 96 | 3300049587 | Ga0501071_0080329 | Ga0501071_0080329_1705_2082 | 123 |
| 97 | 3300049588 | Ga0501072_0019727 | Ga0501072_0019727_2498_2875 | 123 |
| 98 | 3300049588 | Ga0501072_0617195 | Ga0501072_0617195_86_463 | 123 |
| 99 | 3300049590 | Ga0501074_0137136 | Ga0501074_0137136_1363_1740 | 123 |
| 100 | 3300049592 | Ga0501076_0121735 | Ga0501076_0121735_991_1368 | 123 |
| 101 | 3300049743 | Ga0501081_0038825 | Ga0501081_0038825_2753_3130 | 123 |
| 102 | 3300049743 | Ga0501081_1278983 | Ga0501081_1278983_16_393 | 123 |
| 103 | 3300049824 | Ga0501045_0118141 | Ga0501045_0118141_413_790 | 123 |
| 104 | 3300054114 | Ga0501084_0017861 | Ga0501084_0017861_3320_3697 | 123 |
| 105 | 3300005841 | Ga0068863_100146957 | Ga0068863_1001469573 | 124 |
| 106 | 3300006038 | Ga0075365_10071999 | Ga0075365_100719992 | 124 |
| 107 | 3300006038 | Ga0075365_10211734 | Ga0075365_102117341 | 124 |
| 108 | 3300006038 | Ga0075365_10220873 | Ga0075365_102208732 | 124 |
| 109 | 3300006042 | Ga0075368_10150401 | Ga0075368_101504012 | 124 |
| 110 | 3300006048 | Ga0075363_100592895 | Ga0075363_1005928952 | 124 |
| 111 | 3300006051 | Ga0075364_10029290 | Ga0075364_100292901 | 124 |
| 112 | 3300006051 | Ga0075364_10458701 | Ga0075364_104587012 | 124 |
| 113 | 3300006178 | Ga0075367_10390720 | Ga0075367_103907202 | 124 |
| 114 | 3300006353 | Ga0075370_10947642 | Ga0075370_109476422 | 124 |
| 115 | 3300026088 | Ga0207641_11333372 | Ga0207641_113333722 | 124 |
| 116 | 3300031995 | Ga0307409_100069879 | Ga0307409_1000698793 | 124 |
| 117 | 3300050490 | nmdc:mga03n38_6707_c1 | nmdc:mga03n38_6707_c1_799_1179 | 124 |
| 118 | 3300050492 | nmdc:mga0yw44_43246_c1 | nmdc:mga0yw44_43246_c1_1654_2034 | 124 |
| 119 | 3300050492 | nmdc:mga0yw44_521209_c1 | nmdc:mga0yw44_521209_c1_133_513 | 124 |
| 120 | 3300050494 | nmdc:mga06z11_308684_c1 | nmdc:mga06z11_308684_c1_341_721 | 124 |
| 121 | 3300050496 | nmdc:mga07m45_64778_c1 | nmdc:mga07m45_64778_c1_296_676 | 124 |
| 122 | 3300002077 | JGI24744J21845_10008927 | JGI24744J21845_100089272 | 125 |
| 123 | iso_pu_bacteria | 2558860280 | 2559426176 | 126 |
| 124 | iso_pu_bacteria | 2616644814 | 2616693470 | 126 |
| 125 | iso_pu_bacteria | 2643221711 | 2644607862 | 126 |
| 126 | iso_pu_bacteria | 2738543013 | 2739247849 | 126 |
| 127 | iso_pu_bacteria | 2791355406 | 2793980085 | 126 |
| 128 | iso_pu_bacteria | 2842733646 | 2842734119 | 126 |
| 129 | iso_pu_bacteria | 2856858025 | 2856863314 | 126 |
| 130 | iso_pu_bacteria | 2858868258 | 2858874511 | 126 |
| 131 | iso_pu_bacteria | 2885192300 | 2885195364 | 126 |
| 132 | iso_pu_bacteria | 2899370129 | 2899372111 | 126 |
| 133 | iso_pu_bacteria | 2902582711 | 2902582960 | 126 |
| 134 | iso_pu_bacteria | 2919704043 | 2919704965 | 126 |
| 135 | iso_pu_bacteria | 2997600082 | 2997601797 | 126 |
| 136 | iso_pu_bacteria | 649633069 | 649814921 | 126 |
| 137 | iso_pu_bacteria | 8008574985 | 8008575993 | 126 |
| 138 | iso_pu_bacteria | 8047893842 | 8047900101 | 126 |
| 139 | iso_pu_bacteria | 8048356638 | 8048358826 | 126 |
| 140 | iso_pu_bacteria | 8048369669 | 8048377048 | 126 |
| 141 | iso_pu_bacteria | 8048379754 | 8048386103 | 126 |
| 142 | iso_pu_bacteria | 8056829672 | 8056834290 | 126 |
| 143 | 3300006038 | Ga0075365_10271109 | Ga0075365_102711092 | 127 |
| 144 | 3300026142 | Ga0207698_10993240 | Ga0207698_109932402 | 127 |
| 145 | 3300037853 | Ga0436364_0814508 | Ga0436364_0814508_1091_1492 | 127 |
| 146 | 3300044694 | Ga0466963_0046778 | Ga0466963_0046778_180_578 | 127 |
| 147 | 3300044706 | Ga0466964_0045742 | Ga0466964_0045742_619_1017 | 127 |
| 148 | 3300044719 | Ga0466971_0013985 | Ga0466971_0013985_206_604 | 127 |
| 149 | 3300044842 | Ga0466957_0204418 | Ga0466957_0204418_414_812 | 127 |
| 150 | 3300044901 | Ga0466960_0011715 | Ga0466960_0011715_2172_2570 | 127 |
| 151 | 3300045049 | Ga0466959_0361069 | Ga0466959_0361069_284_682 | 127 |
| 152 | 3300045976 | Ga0466967_0234972 | Ga0466967_0234972_1170_1568 | 127 |
| 153 | 3300048929 | Ga0496126_0000026 | Ga0496126_0000026_116303_116701 | 127 |
| 154 | 3300050492 | nmdc:mga0yw44_84242_c1 | nmdc:mga0yw44_84242_c1_34_423 | 127 |
| 155 | 3300061719 | Ga0466962_0026001 | Ga0466962_0026001_1438_1836 | 127 |
| 156 | 3300005366 | Ga0070659_100152307 | Ga0070659_1001523072 | 128 |
| 157 | 3300013250 | Ga0171462_1004 | Ga0171462_1004652 | 128 |
| 158 | 3300017792 | Ga0163161_10098765 | Ga0163161_100987654 | 128 |
| 159 | 3300025921 | Ga0207652_11355563 | Ga0207652_113555632 | 128 |
| 160 | 3300025932 | Ga0207690_10419978 | Ga0207690_104199781 | 128 |
| 161 | 3300031728 | Ga0316578_10158789 | Ga0316578_101587891 | 128 |
| 162 | 3300031824 | Ga0307413_10481726 | Ga0307413_104817262 | 128 |
| 163 | 3300031901 | Ga0307406_10145830 | Ga0307406_101458302 | 128 |
| 164 | 3300032139 | Ga0316580_10010722 | Ga0316580_100107221 | 128 |
| 165 | 3300035398 | Ga0316574_0182618 | Ga0316574_0182618_179_577 | 128 |
| 166 | 3300036647 | Ga0316582_0119321 | Ga0316582_0119321_221_619 | 128 |
| 167 | 3300037466 | Ga0395898_1280448 | Ga0395898_1280448_141_536 | 128 |
| 168 | 3300038443 | Ga0395901_0155976 | Ga0395901_0155976_517_912 | 128 |
| 169 | 3300041503 | Ga0451847_0013531 | Ga0451847_0013531_85_480 | 128 |
| 170 | 3300046543 | Ga0495645_0287484 | Ga0495645_0287484_388_837 | 128 |
| 171 | 3300048917 | Ga0496114_0159218 | Ga0496114_0159218_349_774 | 128 |
| 172 | iso_pu_bacteria | 2501939600 | 2501941712 | 128 |
| 173 | 3300002987 | JGI25159J45721_1018451 | JGI25159J45721_10184511 | 129 |
| 174 | 3300003781 | Ga0055536_1021586 | Ga0055536_10215862 | 129 |
| 175 | 3300003784 | Ga0055534_1001074 | Ga0055534_10010745 | 129 |
| 176 | 3300005262 | Ga0065165_1023608 | Ga0065165_10236083 | 129 |
| 177 | 3300013105 | Ga0157369_10310155 | Ga0157369_103101552 | 129 |
| 178 | 3300025284 | Ga0209130_1006006 | Ga0209130_10060062 | 129 |
| 179 | 3300025291 | Ga0209675_1005102 | Ga0209675_10051023 | 129 |
| 180 | 3300025292 | Ga0209676_1006325 | Ga0209676_10063252 | 129 |
| 181 | 3300025295 | Ga0209564_1045945 | Ga0209564_10459452 | 129 |
| 182 | 3300025298 | Ga0209050_1064932 | Ga0209050_10649322 | 129 |
| 183 | 3300025303 | Ga0209051_1021425 | Ga0209051_10214254 | 129 |
| 184 | 3300025304 | Ga0209257_1021959 | Ga0209257_10219592 | 129 |
| 185 | 3300049576 | Ga0501040_0063758 | Ga0501040_0063758_1164_1571 | 129 |
| 186 | 3300049580 | Ga0501046_1274242 | Ga0501046_1274242_80_475 | 129 |
| 187 | 3300049586 | Ga0501070_1334663 | Ga0501070_1334663_34_441 | 129 |
| 188 | 3300002067 | JGI24735J21928_10172920 | JGI24735J21928_101729202 | 130 |
| 189 | 3300002074 | JGI24748J21848_1008115 | JGI24748J21848_10081152 | 130 |
| 190 | 3300002244 | JGI24742J22300_10001686 | JGI24742J22300_100016863 | 130 |
| 191 | 3300003320 | rootH2_10034964 | rootH2_100349643 | 130 |
| 192 | 3300003322 | rootL2_10026840 | rootL2_100268402 | 130 |
| 193 | 3300005288 | Ga0065714_10304250 | Ga0065714_103042501 | 130 |
| 194 | 3300005293 | Ga0065715_10265259 | Ga0065715_102652592 | 130 |
| 195 | 3300005327 | Ga0070658_10090488 | Ga0070658_100904883 | 130 |
| 196 | 3300005328 | Ga0070676_10070662 | Ga0070676_100706622 | 130 |
| 197 | 3300005328 | Ga0070676_10112415 | Ga0070676_101124152 | 130 |
| 198 | 3300005330 | Ga0070690_100371934 | Ga0070690_1003719342 | 130 |
| 199 | 3300005331 | Ga0070670_100449115 | Ga0070670_1004491152 | 130 |
| 200 | 3300005331 | Ga0070670_101161066 | Ga0070670_1011610662 | 130 |
| 201 | 3300005331 | Ga0070670_101206962 | Ga0070670_1012069621 | 130 |
| 202 | 3300005335 | Ga0070666_10140479 | Ga0070666_101404792 | 130 |
| 203 | 3300005335 | Ga0070666_10186907 | Ga0070666_101869072 | 130 |
| 204 | 3300005336 | Ga0070680_100413145 | Ga0070680_1004131452 | 130 |
| 205 | 3300005337 | Ga0070682_101082412 | Ga0070682_1010824122 | 130 |
| 206 | 3300005337 | Ga0070682_101673269 | Ga0070682_1016732691 | 130 |
| 207 | 3300005338 | Ga0068868_100016515 | Ga0068868_1000165153 | 130 |
| 208 | 3300005338 | Ga0068868_101073879 | Ga0068868_1010738792 | 130 |
| 209 | 3300005338 | Ga0068868_101465723 | Ga0068868_1014657231 | 130 |
| 210 | 3300005339 | Ga0070660_100207859 | Ga0070660_1002078592 | 130 |
| 211 | 3300005339 | Ga0070660_100805747 | Ga0070660_1008057471 | 130 |
| 212 | 3300005340 | Ga0070689_100025236 | Ga0070689_1000252362 | 130 |
| 213 | 3300005341 | Ga0070691_10225640 | Ga0070691_102256402 | 130 |
| 214 | 3300005345 | Ga0070692_10154673 | Ga0070692_101546732 | 130 |
| 215 | 3300005347 | Ga0070668_100018680 | Ga0070668_1000186804 | 130 |
| 216 | 3300005347 | Ga0070668_100332893 | Ga0070668_1003328932 | 130 |
| 217 | 3300005353 | Ga0070669_100064693 | Ga0070669_1000646932 | 130 |
| 218 | 3300005353 | Ga0070669_100244349 | Ga0070669_1002443492 | 130 |
| 219 | 3300005354 | Ga0070675_100173253 | Ga0070675_1001732532 | 130 |
| 220 | 3300005354 | Ga0070675_100356422 | Ga0070675_1003564222 | 130 |
| 221 | 3300005354 | Ga0070675_100793664 | Ga0070675_1007936642 | 130 |
| 222 | 3300005355 | Ga0070671_100766453 | Ga0070671_1007664532 | 130 |
| 223 | 3300005356 | Ga0070674_100008012 | Ga0070674_1000080125 | 130 |
| 224 | 3300005356 | Ga0070674_100021660 | Ga0070674_1000216602 | 130 |
| 225 | 3300005356 | Ga0070674_100341654 | Ga0070674_1003416541 | 130 |
| 226 | 3300005356 | Ga0070674_101411477 | Ga0070674_1014114771 | 130 |
| 227 | 3300005364 | Ga0070673_100042639 | Ga0070673_1000426393 | 130 |
| 228 | 3300005364 | Ga0070673_100575249 | Ga0070673_1005752492 | 130 |
| 229 | 3300005364 | Ga0070673_101812787 | Ga0070673_1018127871 | 130 |
| 230 | 3300005366 | Ga0070659_100407126 | Ga0070659_1004071262 | 130 |
| 231 | 3300005366 | Ga0070659_100413861 | Ga0070659_1004138612 | 130 |
| 232 | 3300005367 | Ga0070667_100027114 | Ga0070667_1000271146 | 130 |
| 233 | 3300005367 | Ga0070667_100036634 | Ga0070667_1000366343 | 130 |
| 234 | 3300005434 | Ga0070709_10199704 | Ga0070709_101997042 | 130 |
| 235 | 3300005435 | Ga0070714_100105406 | Ga0070714_1001054064 | 130 |
| 236 | 3300005436 | Ga0070713_100079692 | Ga0070713_1000796923 | 130 |
| 237 | 3300005437 | Ga0070710_10039279 | Ga0070710_100392793 | 130 |
| 238 | 3300005438 | Ga0070701_10017100 | Ga0070701_100171001 | 130 |
| 239 | 3300005439 | Ga0070711_100014147 | Ga0070711_1000141472 | 130 |
| 240 | 3300005440 | Ga0070705_100048274 | Ga0070705_1000482742 | 130 |
| 241 | 3300005440 | Ga0070705_100071395 | Ga0070705_1000713952 | 130 |
| 242 | 3300005441 | Ga0070700_100053452 | Ga0070700_1000534522 | 130 |
| 243 | 3300005441 | Ga0070700_100176358 | Ga0070700_1001763581 | 130 |
| 244 | 3300005441 | Ga0070700_100807657 | Ga0070700_1008076572 | 130 |
| 245 | 3300005444 | Ga0070694_100173161 | Ga0070694_1001731611 | 130 |
| 246 | 3300005445 | Ga0070708_102150063 | Ga0070708_1021500631 | 130 |
| 247 | 3300005455 | Ga0070663_100558960 | Ga0070663_1005589602 | 130 |
| 248 | 3300005456 | Ga0070678_100001294 | Ga0070678_1000012948 | 130 |
| 249 | 3300005456 | Ga0070678_100078800 | Ga0070678_1000788004 | 130 |
| 250 | 3300005456 | Ga0070678_100086545 | Ga0070678_1000865454 | 130 |
| 251 | 3300005456 | Ga0070678_100784048 | Ga0070678_1007840482 | 130 |
| 252 | 3300005457 | Ga0070662_100257279 | Ga0070662_1002572792 | 130 |
| 253 | 3300005457 | Ga0070662_101398133 | Ga0070662_1013981331 | 130 |
| 254 | 3300005458 | Ga0070681_10144431 | Ga0070681_101444313 | 130 |
| 255 | 3300005458 | Ga0070681_10442928 | Ga0070681_104429282 | 130 |
| 256 | 3300005459 | Ga0068867_100008440 | Ga0068867_1000084405 | 130 |
| 257 | 3300005459 | Ga0068867_100293167 | Ga0068867_1002931672 | 130 |
| 258 | 3300005466 | Ga0070685_10439347 | Ga0070685_104393472 | 130 |
| 259 | 3300005468 | Ga0070707_100528875 | Ga0070707_1005288752 | 130 |
| 260 | 3300005518 | Ga0070699_100180201 | Ga0070699_1001802012 | 130 |
| 261 | 3300005518 | Ga0070699_101159005 | Ga0070699_1011590052 | 130 |
| 262 | 3300005530 | Ga0070679_100269820 | Ga0070679_1002698202 | 130 |
| 263 | 3300005530 | Ga0070679_100955777 | Ga0070679_1009557772 | 130 |
| 264 | 3300005535 | Ga0070684_100369695 | Ga0070684_1003696952 | 130 |
| 265 | 3300005539 | Ga0068853_100036947 | Ga0068853_1000369473 | 130 |
| 266 | 3300005539 | Ga0068853_100107809 | Ga0068853_1001078092 | 130 |
| 267 | 3300005539 | Ga0068853_100315093 | Ga0068853_1003150932 | 130 |
| 268 | 3300005543 | Ga0070672_100151280 | Ga0070672_1001512802 | 130 |
| 269 | 3300005543 | Ga0070672_100548114 | Ga0070672_1005481142 | 130 |
| 270 | 3300005544 | Ga0070686_100093953 | Ga0070686_1000939532 | 130 |
| 271 | 3300005545 | Ga0070695_100045120 | Ga0070695_1000451202 | 130 |
| 272 | 3300005546 | Ga0070696_100066279 | Ga0070696_1000662793 | 130 |
| 273 | 3300005546 | Ga0070696_100172963 | Ga0070696_1001729631 | 130 |
| 274 | 3300005547 | Ga0070693_100031922 | Ga0070693_1000319223 | 130 |
| 275 | 3300005547 | Ga0070693_101161568 | Ga0070693_1011615681 | 130 |
| 276 | 3300005547 | Ga0070693_101171658 | Ga0070693_1011716582 | 130 |
| 277 | 3300005548 | Ga0070665_100042922 | Ga0070665_1000429222 | 130 |
| 278 | 3300005548 | Ga0070665_100051263 | Ga0070665_1000512636 | 130 |
| 279 | 3300005548 | Ga0070665_100383285 | Ga0070665_1003832852 | 130 |
| 280 | 3300005548 | Ga0070665_100534506 | Ga0070665_1005345062 | 130 |
| 281 | 3300005548 | Ga0070665_100910509 | Ga0070665_1009105092 | 130 |
| 282 | 3300005548 | Ga0070665_101304798 | Ga0070665_1013047982 | 130 |
| 283 | 3300005548 | Ga0070665_101662619 | Ga0070665_1016626191 | 130 |
| 284 | 3300005549 | Ga0070704_100024045 | Ga0070704_1000240455 | 130 |
| 285 | 3300005563 | Ga0068855_100114588 | Ga0068855_1001145884 | 130 |
| 286 | 3300005563 | Ga0068855_100855039 | Ga0068855_1008550392 | 130 |
| 287 | 3300005564 | Ga0070664_101332470 | Ga0070664_1013324701 | 130 |
| 288 | 3300005578 | Ga0068854_100023417 | Ga0068854_1000234172 | 130 |
| 289 | 3300005578 | Ga0068854_100045135 | Ga0068854_1000451353 | 130 |
| 290 | 3300005615 | Ga0070702_100024373 | Ga0070702_1000243732 | 130 |
| 291 | 3300005615 | Ga0070702_100199986 | Ga0070702_1001999861 | 130 |
| 292 | 3300005616 | Ga0068852_100549006 | Ga0068852_1005490062 | 130 |
| 293 | 3300005617 | Ga0068859_100037263 | Ga0068859_1000372633 | 130 |
| 294 | 3300005617 | Ga0068859_100293493 | Ga0068859_1002934931 | 130 |
| 295 | 3300005617 | Ga0068859_101260357 | Ga0068859_1012603572 | 130 |
| 296 | 3300005618 | Ga0068864_101975244 | Ga0068864_1019752441 | 130 |
| 297 | 3300005718 | Ga0068866_10001530 | Ga0068866_100015305 | 130 |
| 298 | 3300005719 | Ga0068861_100038370 | Ga0068861_1000383704 | 130 |
| 299 | 3300005834 | Ga0068851_10337315 | Ga0068851_103373151 | 130 |
| 300 | 3300005841 | Ga0068863_100373813 | Ga0068863_1003738132 | 130 |
| 301 | 3300005841 | Ga0068863_101056975 | Ga0068863_1010569752 | 130 |
| 302 | 3300005842 | Ga0068858_100267655 | Ga0068858_1002676552 | 130 |
| 303 | 3300005843 | Ga0068860_100011938 | Ga0068860_1000119385 | 130 |
| 304 | 3300005844 | Ga0068862_100047952 | Ga0068862_1000479522 | 130 |
| 305 | 3300005844 | Ga0068862_100610275 | Ga0068862_1006102751 | 130 |
| 306 | 3300005844 | Ga0068862_101376999 | Ga0068862_1013769992 | 130 |
| 307 | 3300005981 | Ga0081538_10046032 | Ga0081538_100460322 | 130 |
| 308 | 3300005981 | Ga0081538_10091673 | Ga0081538_100916732 | 130 |
| 309 | 3300005983 | Ga0081540_1167435 | Ga0081540_11674352 | 130 |
| 310 | 3300005985 | Ga0081539_10000299 | Ga0081539_100002995 | 130 |
| 311 | 3300005985 | Ga0081539_10006277 | Ga0081539_1000627711 | 130 |
| 312 | 3300006028 | Ga0070717_10010702 | Ga0070717_100107023 | 130 |
| 313 | 3300006028 | Ga0070717_10066969 | Ga0070717_100669695 | 130 |
| 314 | 3300006028 | Ga0070717_10120662 | Ga0070717_101206623 | 130 |
| 315 | 3300006042 | Ga0075368_10143308 | Ga0075368_101433082 | 130 |
| 316 | 3300006048 | Ga0075363_100023402 | Ga0075363_1000234023 | 130 |
| 317 | 3300006048 | Ga0075363_100696964 | Ga0075363_1006969641 | 130 |
| 318 | 3300006163 | Ga0070715_10052427 | Ga0070715_100524272 | 130 |
| 319 | 3300006173 | Ga0070716_100068576 | Ga0070716_1000685763 | 130 |
| 320 | 3300006173 | Ga0070716_101393205 | Ga0070716_1013932052 | 130 |
| 321 | 3300006175 | Ga0070712_100008934 | Ga0070712_1000089346 | 130 |
| 322 | 3300006175 | Ga0070712_100345257 | Ga0070712_1003452572 | 130 |
| 323 | 3300006177 | Ga0075362_10060502 | Ga0075362_100605022 | 130 |
| 324 | 3300006177 | Ga0075362_10720379 | Ga0075362_107203792 | 130 |
| 325 | 3300006195 | Ga0075366_10208717 | Ga0075366_102087172 | 130 |
| 326 | 3300006195 | Ga0075366_10268627 | Ga0075366_102686272 | 130 |
| 327 | 3300006353 | Ga0075370_10368658 | Ga0075370_103686582 | 130 |
| 328 | 3300006358 | Ga0068871_100398100 | Ga0068871_1003981002 | 130 |
| 329 | 3300006844 | Ga0075428_100018822 | Ga0075428_1000188229 | 130 |
| 330 | 3300006844 | Ga0075428_100354231 | Ga0075428_1003542311 | 130 |
| 331 | 3300006846 | Ga0075430_100072971 | Ga0075430_1000729714 | 130 |
| 332 | 3300006847 | Ga0075431_100042432 | Ga0075431_1000424328 | 130 |
| 333 | 3300006847 | Ga0075431_101084318 | Ga0075431_1010843182 | 130 |
| 334 | 3300006852 | Ga0075433_10182552 | Ga0075433_101825522 | 130 |
| 335 | 3300006852 | Ga0075433_11767433 | Ga0075433_117674331 | 130 |
| 336 | 3300006871 | Ga0075434_100367206 | Ga0075434_1003672062 | 130 |
| 337 | 3300006881 | Ga0068865_100125572 | Ga0068865_1001255723 | 130 |
| 338 | 3300006881 | Ga0068865_100129560 | Ga0068865_1001295602 | 130 |
| 339 | 3300006931 | Ga0097620_100037262 | Ga0097620_1000372623 | 130 |
| 340 | 3300006931 | Ga0097620_100293499 | Ga0097620_1002934992 | 130 |
| 341 | 3300006931 | Ga0097620_101260336 | Ga0097620_1012603362 | 130 |
| 342 | 3300007076 | Ga0075435_100014526 | Ga0075435_1000145266 | 130 |
| 343 | 3300009011 | Ga0105251_10017909 | Ga0105251_100179092 | 130 |
| 344 | 3300009092 | Ga0105250_10092247 | Ga0105250_100922472 | 130 |
| 345 | 3300009093 | Ga0105240_10074931 | Ga0105240_100749313 | 130 |
| 346 | 3300009093 | Ga0105240_11384836 | Ga0105240_113848362 | 130 |
| 347 | 3300009093 | Ga0105240_12236665 | Ga0105240_122366652 | 130 |
| 348 | 3300009093 | Ga0105240_12472115 | Ga0105240_124721151 | 130 |
| 349 | 3300009098 | Ga0105245_10009348 | Ga0105245_100093483 | 130 |
| 350 | 3300009098 | Ga0105245_10368583 | Ga0105245_103685832 | 130 |
| 351 | 3300009098 | Ga0105245_11653112 | Ga0105245_116531121 | 130 |
| 352 | 3300009101 | Ga0105247_10010073 | Ga0105247_100100734 | 130 |
| 353 | 3300009101 | Ga0105247_11080438 | Ga0105247_110804382 | 130 |
| 354 | 3300009101 | Ga0105247_11651280 | Ga0105247_116512801 | 130 |
| 355 | 3300009147 | Ga0114129_10017668 | Ga0114129_1001766810 | 130 |
| 356 | 3300009148 | Ga0105243_10897620 | Ga0105243_108976202 | 130 |
| 357 | 3300009174 | Ga0105241_11225501 | Ga0105241_112255012 | 130 |
| 358 | 3300009176 | Ga0105242_10042876 | Ga0105242_100428763 | 130 |
| 359 | 3300009177 | Ga0105248_10143185 | Ga0105248_101431853 | 130 |
| 360 | 3300009177 | Ga0105248_10859441 | Ga0105248_108594412 | 130 |
| 361 | 3300009177 | Ga0105248_11240489 | Ga0105248_112404892 | 130 |
| 362 | 3300009545 | Ga0105237_10318849 | Ga0105237_103188492 | 130 |
| 363 | 3300009545 | Ga0105237_11013762 | Ga0105237_110137622 | 130 |
| 364 | 3300009545 | Ga0105237_11314535 | Ga0105237_113145351 | 130 |
| 365 | 3300009551 | Ga0105238_10024517 | Ga0105238_100245176 | 130 |
| 366 | 3300009551 | Ga0105238_10300619 | Ga0105238_103006192 | 130 |
| 367 | 3300009553 | Ga0105249_11822231 | Ga0105249_118222311 | 130 |
| 368 | 3300010375 | Ga0105239_10142382 | Ga0105239_101423822 | 130 |
| 369 | 3300010375 | Ga0105239_10171478 | Ga0105239_101714782 | 130 |
| 370 | 3300010375 | Ga0105239_10420894 | Ga0105239_104208942 | 130 |
| 371 | 3300010375 | Ga0105239_12761492 | Ga0105239_127614921 | 130 |
| 372 | 3300011119 | Ga0105246_10114745 | Ga0105246_101147452 | 130 |
| 373 | 3300011119 | Ga0105246_11917460 | Ga0105246_119174601 | 130 |
| 374 | 3300013102 | Ga0157371_10190717 | Ga0157371_101907172 | 130 |
| 375 | 3300013104 | Ga0157370_11678116 | Ga0157370_116781162 | 130 |
| 376 | 3300013105 | Ga0157369_10331275 | Ga0157369_103312752 | 130 |
| 377 | 3300013296 | Ga0157374_10493822 | Ga0157374_104938222 | 130 |
| 378 | 3300013297 | Ga0157378_10021612 | Ga0157378_100216126 | 130 |
| 379 | 3300013306 | Ga0163162_10084317 | Ga0163162_100843172 | 130 |
| 380 | 3300013306 | Ga0163162_10142108 | Ga0163162_101421082 | 130 |
| 381 | 3300013306 | Ga0163162_10332349 | Ga0163162_103323492 | 130 |
| 382 | 3300013306 | Ga0163162_10654578 | Ga0163162_106545782 | 130 |
| 383 | 3300013307 | Ga0157372_10102729 | Ga0157372_101027292 | 130 |
| 384 | 3300013308 | Ga0157375_10210678 | Ga0157375_102106782 | 130 |
| 385 | 3300013308 | Ga0157375_10224591 | Ga0157375_102245912 | 130 |
| 386 | 3300013308 | Ga0157375_10614737 | Ga0157375_106147372 | 130 |
| 387 | 3300013308 | Ga0157375_10731172 | Ga0157375_107311722 | 130 |
| 388 | 3300013308 | Ga0157375_11403674 | Ga0157375_114036742 | 130 |
| 389 | 3300014326 | Ga0157380_10049476 | Ga0157380_100494763 | 130 |
| 390 | 3300014497 | Ga0182008_10001482 | Ga0182008_1000148210 | 130 |
| 391 | 3300014497 | Ga0182008_10749493 | Ga0182008_107494931 | 130 |
| 392 | 3300014745 | Ga0157377_10073172 | Ga0157377_100731723 | 130 |
| 393 | 3300014745 | Ga0157377_10333652 | Ga0157377_103336522 | 130 |
| 394 | 3300014968 | Ga0157379_10143086 | Ga0157379_101430862 | 130 |
| 395 | 3300014968 | Ga0157379_10207813 | Ga0157379_102078132 | 130 |
| 396 | 3300014968 | Ga0157379_10300546 | Ga0157379_103005462 | 130 |
| 397 | 3300014968 | Ga0157379_11222599 | Ga0157379_112225991 | 130 |
| 398 | 3300014969 | Ga0157376_11044620 | Ga0157376_110446202 | 130 |
| 399 | 3300014969 | Ga0157376_12384402 | Ga0157376_123844021 | 130 |
| 400 | 3300015262 | Ga0182007_10000321 | Ga0182007_100003219 | 130 |
| 401 | 3300015265 | Ga0182005_1037556 | Ga0182005_10375562 | 130 |
| 402 | 3300015683 | Ga0183362_10003 | Ga0183362_10003350 | 130 |
| 403 | 3300017792 | Ga0163161_10073709 | Ga0163161_100737093 | 130 |
| 404 | 3300017792 | Ga0163161_10743269 | Ga0163161_107432692 | 130 |
| 405 | 3300017792 | Ga0163161_11172797 | Ga0163161_111727972 | 130 |
| 406 | 3300017792 | Ga0163161_11448280 | Ga0163161_114482802 | 130 |
| 407 | 3300021384 | Ga0213876_10028695 | Ga0213876_100286952 | 130 |
| 408 | 3300022467 | Ga0224712_10046356 | Ga0224712_100463562 | 130 |
| 409 | 3300025297 | Ga0209758_1008881 | Ga0209758_10088818 | 130 |
| 410 | 3300025302 | Ga0207426_1068224 | Ga0207426_10682242 | 130 |
| 411 | 3300025711 | Ga0207696_1185139 | Ga0207696_11851391 | 130 |
| 412 | 3300025735 | Ga0207713_1032370 | Ga0207713_10323702 | 130 |
| 413 | 3300025893 | Ga0207682_10112758 | Ga0207682_101127583 | 130 |
| 414 | 3300025898 | Ga0207692_10014167 | Ga0207692_100141672 | 130 |
| 415 | 3300025899 | Ga0207642_10005216 | Ga0207642_100052165 | 130 |
| 416 | 3300025899 | Ga0207642_10365176 | Ga0207642_103651762 | 130 |
| 417 | 3300025900 | Ga0207710_10013402 | Ga0207710_100134024 | 130 |
| 418 | 3300025900 | Ga0207710_10203756 | Ga0207710_102037562 | 130 |
| 419 | 3300025901 | Ga0207688_10105007 | Ga0207688_101050072 | 130 |
| 420 | 3300025901 | Ga0207688_10479698 | Ga0207688_104796981 | 130 |
| 421 | 3300025903 | Ga0207680_10273418 | Ga0207680_102734182 | 130 |
| 422 | 3300025907 | Ga0207645_10133496 | Ga0207645_101334962 | 130 |
| 423 | 3300025907 | Ga0207645_10591921 | Ga0207645_105919212 | 130 |
| 424 | 3300025908 | Ga0207643_10051860 | Ga0207643_100518602 | 130 |
| 425 | 3300025910 | Ga0207684_11190203 | Ga0207684_111902032 | 130 |
| 426 | 3300025911 | Ga0207654_10100282 | Ga0207654_101002821 | 130 |
| 427 | 3300025912 | Ga0207707_10091702 | Ga0207707_100917023 | 130 |
| 428 | 3300025912 | Ga0207707_10257787 | Ga0207707_102577872 | 130 |
| 429 | 3300025913 | Ga0207695_10369810 | Ga0207695_103698102 | 130 |
| 430 | 3300025914 | Ga0207671_10319052 | Ga0207671_103190522 | 130 |
| 431 | 3300025914 | Ga0207671_10724174 | Ga0207671_107241741 | 130 |
| 432 | 3300025915 | Ga0207693_10022554 | Ga0207693_100225545 | 130 |
| 433 | 3300025915 | Ga0207693_10155484 | Ga0207693_101554842 | 130 |
| 434 | 3300025915 | Ga0207693_10240116 | Ga0207693_102401162 | 130 |
| 435 | 3300025916 | Ga0207663_10020680 | Ga0207663_100206803 | 130 |
| 436 | 3300025917 | Ga0207660_10098925 | Ga0207660_100989252 | 130 |
| 437 | 3300025917 | Ga0207660_10207307 | Ga0207660_102073072 | 130 |
| 438 | 3300025917 | Ga0207660_10416852 | Ga0207660_104168522 | 130 |
| 439 | 3300025918 | Ga0207662_10192237 | Ga0207662_101922372 | 130 |
| 440 | 3300025919 | Ga0207657_10241729 | Ga0207657_102417292 | 130 |
| 441 | 3300025919 | Ga0207657_10325893 | Ga0207657_103258932 | 130 |
| 442 | 3300025919 | Ga0207657_10376376 | Ga0207657_103763762 | 130 |
| 443 | 3300025919 | Ga0207657_10769224 | Ga0207657_107692242 | 130 |
| 444 | 3300025921 | Ga0207652_10331988 | Ga0207652_103319882 | 130 |
| 445 | 3300025921 | Ga0207652_10571534 | Ga0207652_105715342 | 130 |
| 446 | 3300025921 | Ga0207652_10748062 | Ga0207652_107480622 | 130 |
| 447 | 3300025923 | Ga0207681_10060858 | Ga0207681_100608582 | 130 |
| 448 | 3300025923 | Ga0207681_10263604 | Ga0207681_102636042 | 130 |
| 449 | 3300025924 | Ga0207694_10065630 | Ga0207694_100656303 | 130 |
| 450 | 3300025925 | Ga0207650_10644367 | Ga0207650_106443671 | 130 |
| 451 | 3300025925 | Ga0207650_11388262 | Ga0207650_113882622 | 130 |
| 452 | 3300025926 | Ga0207659_10188988 | Ga0207659_101889883 | 130 |
| 453 | 3300025926 | Ga0207659_10203087 | Ga0207659_102030872 | 130 |
| 454 | 3300025926 | Ga0207659_10562722 | Ga0207659_105627222 | 130 |
| 455 | 3300025926 | Ga0207659_10669363 | Ga0207659_106693632 | 130 |
| 456 | 3300025927 | Ga0207687_10008069 | Ga0207687_100080693 | 130 |
| 457 | 3300025927 | Ga0207687_10030326 | Ga0207687_100303263 | 130 |
| 458 | 3300025928 | Ga0207700_10462442 | Ga0207700_104624422 | 130 |
| 459 | 3300025928 | Ga0207700_10766761 | Ga0207700_107667612 | 130 |
| 460 | 3300025929 | Ga0207664_10068766 | Ga0207664_100687662 | 130 |
| 461 | 3300025931 | Ga0207644_10844881 | Ga0207644_108448812 | 130 |
| 462 | 3300025932 | Ga0207690_10172027 | Ga0207690_101720272 | 130 |
| 463 | 3300025932 | Ga0207690_10367526 | Ga0207690_103675262 | 130 |
| 464 | 3300025932 | Ga0207690_10386997 | Ga0207690_103869972 | 130 |
| 465 | 3300025932 | Ga0207690_11013745 | Ga0207690_110137452 | 130 |
| 466 | 3300025933 | Ga0207706_10046195 | Ga0207706_100461953 | 130 |
| 467 | 3300025935 | Ga0207709_10012850 | Ga0207709_100128505 | 130 |
| 468 | 3300025935 | Ga0207709_11615274 | Ga0207709_116152741 | 130 |
| 469 | 3300025936 | Ga0207670_10644665 | Ga0207670_106446652 | 130 |
| 470 | 3300025937 | Ga0207669_10010595 | Ga0207669_100105952 | 130 |
| 471 | 3300025937 | Ga0207669_10086942 | Ga0207669_100869422 | 130 |
| 472 | 3300025937 | Ga0207669_10286496 | Ga0207669_102864962 | 130 |
| 473 | 3300025937 | Ga0207669_11089017 | Ga0207669_110890172 | 130 |
| 474 | 3300025938 | Ga0207704_10001963 | Ga0207704_100019636 | 130 |
| 475 | 3300025938 | Ga0207704_10159079 | Ga0207704_101590792 | 130 |
| 476 | 3300025938 | Ga0207704_10688319 | Ga0207704_106883192 | 130 |
| 477 | 3300025939 | Ga0207665_10013758 | Ga0207665_100137583 | 130 |
| 478 | 3300025940 | Ga0207691_10012135 | Ga0207691_100121354 | 130 |
| 479 | 3300025940 | Ga0207691_10683048 | Ga0207691_106830482 | 130 |
| 480 | 3300025941 | Ga0207711_10089795 | Ga0207711_100897952 | 130 |
| 481 | 3300025941 | Ga0207711_10823973 | Ga0207711_108239732 | 130 |
| 482 | 3300025941 | Ga0207711_10903854 | Ga0207711_109038542 | 130 |
| 483 | 3300025941 | Ga0207711_11417763 | Ga0207711_114177632 | 130 |
| 484 | 3300025942 | Ga0207689_10104805 | Ga0207689_101048052 | 130 |
| 485 | 3300025944 | Ga0207661_10446308 | Ga0207661_104463082 | 130 |
| 486 | 3300025945 | Ga0207679_11720307 | Ga0207679_117203072 | 130 |
| 487 | 3300025949 | Ga0207667_10353033 | Ga0207667_103530332 | 130 |
| 488 | 3300025949 | Ga0207667_11067545 | Ga0207667_110675452 | 130 |
| 489 | 3300025949 | Ga0207667_11301264 | Ga0207667_113012642 | 130 |
| 490 | 3300025960 | Ga0207651_10001558 | Ga0207651_100015587 | 130 |
| 491 | 3300025960 | Ga0207651_10778370 | Ga0207651_107783701 | 130 |
| 492 | 3300025961 | Ga0207712_10413268 | Ga0207712_104132682 | 130 |
| 493 | 3300025961 | Ga0207712_10424765 | Ga0207712_104247651 | 130 |
| 494 | 3300025972 | Ga0207668_10012098 | Ga0207668_100120986 | 130 |
| 495 | 3300025981 | Ga0207640_10073446 | Ga0207640_100734462 | 130 |
| 496 | 3300025981 | Ga0207640_10210114 | Ga0207640_102101142 | 130 |
| 497 | 3300025986 | Ga0207658_10004918 | Ga0207658_100049189 | 130 |
| 498 | 3300025986 | Ga0207658_10029493 | Ga0207658_100294932 | 130 |
| 499 | 3300026023 | Ga0207677_10011807 | Ga0207677_100118073 | 130 |
| 500 | 3300026023 | Ga0207677_10065995 | Ga0207677_100659952 | 130 |
| 501 | 3300026023 | Ga0207677_10297832 | Ga0207677_102978322 | 130 |
| 502 | 3300026035 | Ga0207703_10096913 | Ga0207703_100969133 | 130 |
| 503 | 3300026035 | Ga0207703_10185395 | Ga0207703_101853952 | 130 |
| 504 | 3300026041 | Ga0207639_10015661 | Ga0207639_100156612 | 130 |
| 505 | 3300026041 | Ga0207639_10027103 | Ga0207639_100271035 | 130 |
| 506 | 3300026067 | Ga0207678_10114498 | Ga0207678_101144982 | 130 |
| 507 | 3300026067 | Ga0207678_10505399 | Ga0207678_105053992 | 130 |
| 508 | 3300026067 | Ga0207678_10799330 | Ga0207678_107993302 | 130 |
| 509 | 3300026075 | Ga0207708_10051067 | Ga0207708_100510672 | 130 |
| 510 | 3300026075 | Ga0207708_10323234 | Ga0207708_103232342 | 130 |
| 511 | 3300026078 | Ga0207702_10691622 | Ga0207702_106916222 | 130 |
| 512 | 3300026088 | Ga0207641_10163572 | Ga0207641_101635722 | 130 |
| 513 | 3300026089 | Ga0207648_10066671 | Ga0207648_100666712 | 130 |
| 514 | 3300026089 | Ga0207648_10323752 | Ga0207648_103237521 | 130 |
| 515 | 3300026089 | Ga0207648_10371651 | Ga0207648_103716512 | 130 |
| 516 | 3300026089 | Ga0207648_11661497 | Ga0207648_116614972 | 130 |
| 517 | 3300026095 | Ga0207676_10277669 | Ga0207676_102776692 | 130 |
| 518 | 3300026095 | Ga0207676_10335749 | Ga0207676_103357492 | 130 |
| 519 | 3300026095 | Ga0207676_10390358 | Ga0207676_103903582 | 130 |
| 520 | 3300026095 | Ga0207676_11210054 | Ga0207676_112100542 | 130 |
| 521 | 3300026095 | Ga0207676_11249253 | Ga0207676_112492532 | 130 |
| 522 | 3300026118 | Ga0207675_100058616 | Ga0207675_1000586162 | 130 |
| 523 | 3300026118 | Ga0207675_100138746 | Ga0207675_1001387462 | 130 |
| 524 | 3300026118 | Ga0207675_100740156 | Ga0207675_1007401562 | 130 |
| 525 | 3300026121 | Ga0207683_10062809 | Ga0207683_100628092 | 130 |
| 526 | 3300026121 | Ga0207683_10081042 | Ga0207683_100810422 | 130 |
| 527 | 3300026121 | Ga0207683_10115571 | Ga0207683_101155712 | 130 |
| 528 | 3300026121 | Ga0207683_10232151 | Ga0207683_102321513 | 130 |
| 529 | 3300026121 | Ga0207683_10323035 | Ga0207683_103230352 | 130 |
| 530 | 3300026121 | Ga0207683_10617951 | Ga0207683_106179512 | 130 |
| 531 | 3300026121 | Ga0207683_11113099 | Ga0207683_111130992 | 130 |
| 532 | 3300026142 | Ga0207698_10209663 | Ga0207698_102096632 | 130 |
| 533 | 3300027866 | Ga0209813_10161325 | Ga0209813_101613251 | 130 |
| 534 | 3300027876 | Ga0209974_10224326 | Ga0209974_102243262 | 130 |
| 535 | 3300027907 | Ga0207428_10111254 | Ga0207428_101112542 | 130 |
| 536 | 3300028379 | Ga0268266_10016681 | Ga0268266_100166813 | 130 |
| 537 | 3300028379 | Ga0268266_10204779 | Ga0268266_102047792 | 130 |
| 538 | 3300028379 | Ga0268266_10208375 | Ga0268266_102083752 | 130 |
| 539 | 3300028379 | Ga0268266_10222587 | Ga0268266_102225872 | 130 |
| 540 | 3300028379 | Ga0268266_10435207 | Ga0268266_104352072 | 130 |
| 541 | 3300028379 | Ga0268266_10480135 | Ga0268266_104801352 | 130 |
| 542 | 3300028380 | Ga0268265_10316918 | Ga0268265_103169182 | 130 |
| 543 | 3300028381 | Ga0268264_10030902 | Ga0268264_100309022 | 130 |
| 544 | 3300028556 | Ga0265337_1031514 | Ga0265337_10315142 | 130 |
| 545 | 3300028577 | Ga0265318_10325930 | Ga0265318_103259302 | 130 |
| 546 | 3300028666 | Ga0265336_10061960 | Ga0265336_100619602 | 130 |
| 547 | 3300028786 | Ga0307517_10130253 | Ga0307517_101302532 | 130 |
| 548 | 3300028794 | Ga0307515_10000487 | Ga0307515_1000048736 | 130 |
| 549 | 3300028794 | Ga0307515_10056940 | Ga0307515_100569404 | 130 |
| 550 | 3300030521 | Ga0307511_10000159 | Ga0307511_1000015953 | 130 |
| 551 | 3300030521 | Ga0307511_10001103 | Ga0307511_1000110310 | 130 |
| 552 | 3300031240 | Ga0265320_10000429 | Ga0265320_100004292 | 130 |
| 553 | 3300031250 | Ga0265331_10197765 | Ga0265331_101977652 | 130 |
| 554 | 3300031251 | Ga0265327_10003277 | Ga0265327_1000327712 | 130 |
| 555 | 3300031344 | Ga0265316_10037489 | Ga0265316_100374892 | 130 |
| 556 | 3300031456 | Ga0307513_10025548 | Ga0307513_100255484 | 130 |
| 557 | 3300031456 | Ga0307513_10032587 | Ga0307513_100325875 | 130 |
| 558 | 3300031456 | Ga0307513_10033683 | Ga0307513_100336837 | 130 |
| 559 | 3300031456 | Ga0307513_10308731 | Ga0307513_103087312 | 130 |
| 560 | 3300031456 | Ga0307513_10441643 | Ga0307513_104416432 | 130 |
| 561 | 3300031456 | Ga0307513_10445830 | Ga0307513_104458302 | 130 |
| 562 | 3300031456 | Ga0307513_10448606 | Ga0307513_104486062 | 130 |
| 563 | 3300031507 | Ga0307509_10036922 | Ga0307509_100369222 | 130 |
| 564 | 3300031548 | Ga0307408_100214815 | Ga0307408_1002148152 | 130 |
| 565 | 3300031548 | Ga0307408_100269808 | Ga0307408_1002698082 | 130 |
| 566 | 3300031548 | Ga0307408_100556305 | Ga0307408_1005563051 | 130 |
| 567 | 3300031548 | Ga0307408_101932668 | Ga0307408_1019326682 | 130 |
| 568 | 3300031665 | Ga0316575_10002608 | Ga0316575_100026082 | 130 |
| 569 | 3300031691 | Ga0316579_10003332 | Ga0316579_100033325 | 130 |
| 570 | 3300031691 | Ga0316579_10422801 | Ga0316579_104228011 | 130 |
| 571 | 3300031711 | Ga0265314_10022219 | Ga0265314_100222194 | 130 |
| 572 | 3300031727 | Ga0316576_10002073 | Ga0316576_100020738 | 130 |
| 573 | 3300031727 | Ga0316576_10204172 | Ga0316576_102041722 | 130 |
| 574 | 3300031728 | Ga0316578_10000393 | Ga0316578_100003939 | 130 |
| 575 | 3300031730 | Ga0307516_10001460 | Ga0307516_100014609 | 130 |
| 576 | 3300031730 | Ga0307516_10041378 | Ga0307516_100413783 | 130 |
| 577 | 3300031731 | Ga0307405_10456388 | Ga0307405_104563882 | 130 |
| 578 | 3300031733 | Ga0316577_10029468 | Ga0316577_100294685 | 130 |
| 579 | 3300031824 | Ga0307413_10096982 | Ga0307413_100969822 | 130 |
| 580 | 3300031824 | Ga0307413_11207694 | Ga0307413_112076941 | 130 |
| 581 | 3300031824 | Ga0307413_11921610 | Ga0307413_119216101 | 130 |
| 582 | 3300031838 | Ga0307518_10009673 | Ga0307518_100096739 | 130 |
| 583 | 3300031852 | Ga0307410_10035590 | Ga0307410_100355902 | 130 |
| 584 | 3300031852 | Ga0307410_10282119 | Ga0307410_102821191 | 130 |
| 585 | 3300031901 | Ga0307406_10046095 | Ga0307406_100460952 | 130 |
| 586 | 3300031901 | Ga0307406_11158689 | Ga0307406_111586891 | 130 |
| 587 | 3300031903 | Ga0307407_10022944 | Ga0307407_100229442 | 130 |
| 588 | 3300031903 | Ga0307407_11451107 | Ga0307407_114511071 | 130 |
| 589 | 3300031911 | Ga0307412_10551037 | Ga0307412_105510372 | 130 |
| 590 | 3300031911 | Ga0307412_10822742 | Ga0307412_108227422 | 130 |
| 591 | 3300031995 | Ga0307409_100221069 | Ga0307409_1002210692 | 130 |
| 592 | 3300031995 | Ga0307409_100277771 | Ga0307409_1002777712 | 130 |
| 593 | 3300031995 | Ga0307409_101283505 | Ga0307409_1012835052 | 130 |
| 594 | 3300032002 | Ga0307416_100365830 | Ga0307416_1003658302 | 130 |
| 595 | 3300032002 | Ga0307416_101094106 | Ga0307416_1010941062 | 130 |
| 596 | 3300032002 | Ga0307416_102273067 | Ga0307416_1022730672 | 130 |
| 597 | 3300032004 | Ga0307414_10224023 | Ga0307414_102240232 | 130 |
| 598 | 3300032005 | Ga0307411_10289605 | Ga0307411_102896052 | 130 |
| 599 | 3300032005 | Ga0307411_11303703 | Ga0307411_113037032 | 130 |
| 600 | 3300032126 | Ga0307415_100395947 | Ga0307415_1003959472 | 130 |
| 601 | 3300032133 | Ga0316583_10010654 | Ga0316583_100106544 | 130 |
| 602 | 3300032133 | Ga0316583_10061685 | Ga0316583_100616851 | 130 |
| 603 | 3300032137 | Ga0316585_10154369 | Ga0316585_101543691 | 130 |
| 604 | 3300032139 | Ga0316580_10081089 | Ga0316580_100810891 | 130 |
| 605 | 3300033179 | Ga0307507_10015626 | Ga0307507_100156267 | 130 |
| 606 | 3300033179 | Ga0307507_10047289 | Ga0307507_100472895 | 130 |
| 607 | 3300033180 | Ga0307510_10076915 | Ga0307510_100769152 | 130 |
| 608 | 3300033541 | Ga0316596_1020082 | Ga0316596_10200822 | 130 |
| 609 | 3300034817 | Ga0373948_0022376 | Ga0373948_0022376_25_423 | 130 |
| 610 | 3300035084 | Ga0373928_0031819 | Ga0373928_0031819_607_1005 | 130 |
| 611 | 3300035085 | Ga0373929_0096214 | Ga0373929_0096214_272_676 | 130 |
| 612 | 3300035088 | Ga0373940_0013567 | Ga0373940_0013567_193_591 | 130 |
| 613 | 3300035112 | Ga0373932_0034054 | Ga0373932_0034054_220_618 | 130 |
| 614 | 3300035170 | Ga0373943_0801310 | Ga0373943_0801310_93_491 | 130 |
| 615 | 3300035398 | Ga0316574_0639565 | Ga0316574_0639565_212_616 | 130 |
| 616 | 3300035691 | Ga0373931_0047293 | Ga0373931_0047293_832_1236 | 130 |
| 617 | 3300036712 | Ga0316584_0005768 | Ga0316584_0005768_4503_4913 | 130 |
| 618 | 3300036712 | Ga0316584_0056631 | Ga0316584_0056631_142_546 | 130 |
| 619 | 3300037068 | Ga0373925_0341859 | Ga0373925_0341859_603_1001 | 130 |
| 620 | 3300037418 | Ga0395900_0685437 | Ga0395900_0685437_108_500 | 130 |
| 621 | 3300037471 | Ga0395905_0001958 | Ga0395905_0001958_5824_6240 | 130 |
| 622 | 3300038443 | Ga0395901_0038670 | Ga0395901_0038670_693_1085 | 130 |
| 623 | 3300038443 | Ga0395901_0104465 | Ga0395901_0104465_1088_1486 | 130 |
| 624 | 3300038443 | Ga0395901_0398040 | Ga0395901_0398040_633_1055 | 130 |
| 625 | 3300039437 | Ga0436365_0301162 | Ga0436365_0301162_1725_2123 | 130 |
| 626 | 3300039450 | Ga0436363_1309788 | Ga0436363_1309788_24_437 | 130 |
| 627 | 3300039450 | Ga0436363_1589930 | Ga0436363_1589930_24_422 | 130 |
| 628 | 3300041404 | Ga0439436_0010782 | Ga0439436_0010782_1955_2353 | 130 |
| 629 | 3300041404 | Ga0439436_0018666 | Ga0439436_0018666_1624_2022 | 130 |
| 630 | 3300041404 | Ga0439436_0076691 | Ga0439436_0076691_171_587 | 130 |
| 631 | 3300041405 | Ga0439438_073999 | Ga0439438_073999_413_811 | 130 |
| 632 | 3300041406 | Ga0439439_0003849 | Ga0439439_0003849_1414_1812 | 130 |
| 633 | 3300041406 | Ga0439439_0123106 | Ga0439439_0123106_311_709 | 130 |
| 634 | 3300041407 | Ga0439447_012773 | Ga0439447_012773_1317_1715 | 130 |
| 635 | 3300041407 | Ga0439447_032115 | Ga0439447_032115_244_642 | 130 |
| 636 | 3300041410 | Ga0439461_0007746 | Ga0439461_0007746_1375_1779 | 130 |
| 637 | 3300041411 | Ga0439466_0070440 | Ga0439466_0070440_71_469 | 130 |
| 638 | 3300041411 | Ga0439466_0101741 | Ga0439466_0101741_97_495 | 130 |
| 639 | 3300041413 | Ga0439465_0012312 | Ga0439465_0012312_2176_2574 | 130 |
| 640 | 3300041460 | Ga0451802_1269109 | Ga0451802_1269109_561_977 | 130 |
| 641 | 3300041491 | Ga0451833_0080370 | Ga0451833_0080370_275_679 | 130 |
| 642 | 3300041501 | Ga0451845_0914589 | Ga0451845_0914589_64_462 | 130 |
| 643 | 3300041505 | Ga0451849_0339851 | Ga0451849_0339851_2694_3125 | 130 |
| 644 | 3300041509 | Ga0451843_0253762 | Ga0451843_0253762_291_722 | 130 |
| 645 | 3300041509 | Ga0451843_1206146 | Ga0451843_1206146_79_477 | 130 |
| 646 | 3300041509 | Ga0451843_1772571 | Ga0451843_1772571_43_447 | 130 |
| 647 | 3300041512 | Ga0451853_0371860 | Ga0451853_0371860_10820_11251 | 130 |
| 648 | 3300041512 | Ga0451853_2463512 | Ga0451853_2463512_487_885 | 130 |
| 649 | 3300041997 | Ga0439431_0002697 | Ga0439431_0002697_1515_1913 | 130 |
| 650 | 3300041997 | Ga0439431_0025503 | Ga0439431_0025503_114_530 | 130 |
| 651 | 3300041999 | Ga0439433_0006460 | Ga0439433_0006460_1921_2319 | 130 |
| 652 | 3300041999 | Ga0439433_0025770 | Ga0439433_0025770_209_619 | 130 |
| 653 | 3300041999 | Ga0439433_0056272 | Ga0439433_0056272_112_522 | 130 |
| 654 | 3300041999 | Ga0439433_0075693 | Ga0439433_0075693_255_653 | 130 |
| 655 | 3300042002 | Ga0439442_020830 | Ga0439442_020830_420_818 | 130 |
| 656 | 3300042002 | Ga0439442_038499 | Ga0439442_038499_396_794 | 130 |
| 657 | 3300042004 | Ga0439445_0003652 | Ga0439445_0003652_650_1048 | 130 |
| 658 | 3300042006 | Ga0439432_001430 | Ga0439432_001430_6615_7013 | 130 |
| 659 | 3300042006 | Ga0439432_047206 | Ga0439432_047206_306_704 | 130 |
| 660 | 3300042007 | Ga0439449_0000791 | Ga0439449_0000791_5551_5949 | 130 |
| 661 | 3300042007 | Ga0439449_0002046 | Ga0439449_0002046_4962_5360 | 130 |
| 662 | 3300042007 | Ga0439449_0012758 | Ga0439449_0012758_1364_1762 | 130 |
| 663 | 3300042010 | Ga0439452_003109 | Ga0439452_003109_1717_2115 | 130 |
| 664 | 3300042010 | Ga0439452_038430 | Ga0439452_038430_40_438 | 130 |
| 665 | 3300042014 | Ga0439457_018913 | Ga0439457_018913_943_1341 | 130 |
| 666 | 3300042014 | Ga0439457_025777 | Ga0439457_025777_290_688 | 130 |
| 667 | 3300042014 | Ga0439457_026139 | Ga0439457_026139_856_1272 | 130 |
| 668 | 3300042015 | Ga0439462_0007236 | Ga0439462_0007236_1528_1926 | 130 |
| 669 | 3300042015 | Ga0439462_0012747 | Ga0439462_0012747_771_1169 | 130 |
| 670 | 3300042015 | Ga0439462_0119658 | Ga0439462_0119658_231_641 | 130 |
| 671 | 3300042128 | Ga0450897_018121 | Ga0450897_018121_32_430 | 130 |
| 672 | 3300042131 | Ga0450894_001632 | Ga0450894_001632_2178_2576 | 130 |
| 673 | 3300042131 | Ga0450894_009610 | Ga0450894_009610_25_429 | 130 |
| 674 | 3300042134 | Ga0450898_023986 | Ga0450898_023986_160_558 | 130 |
| 675 | 3300042144 | Ga0450889_020336 | Ga0450889_020336_165_563 | 130 |
| 676 | 3300042145 | Ga0450906_030582 | Ga0450906_030582_55_453 | 130 |
| 677 | 3300042146 | Ga0450907_043258 | Ga0450907_043258_248_646 | 130 |
| 678 | 3300042156 | Ga0439446_0011919 | Ga0439446_0011919_1220_1618 | 130 |
| 679 | 3300042156 | Ga0439446_0247102 | Ga0439446_0247102_201_599 | 130 |
| 680 | 3300042156 | Ga0439446_0345635 | Ga0439446_0345635_36_446 | 130 |
| 681 | 3300042184 | Ga0450908_022151 | Ga0450908_022151_192_590 | 130 |
| 682 | 3300042185 | Ga0450909_001800 | Ga0450909_001800_650_1048 | 130 |
| 683 | 3300042435 | Ga0439434_0012172 | Ga0439434_0012172_183_581 | 130 |
| 684 | 3300042435 | Ga0439434_0012407 | Ga0439434_0012407_770_1168 | 130 |
| 685 | 3300042435 | Ga0439434_0092605 | Ga0439434_0092605_527_931 | 130 |
| 686 | 3300042438 | Ga0439459_0151166 | Ga0439459_0151166_115_513 | 130 |
| 687 | 3300042532 | Ga0450893_0016581 | Ga0450893_0016581_76_474 | 130 |
| 688 | 3300044656 | Ga0466969_0020496 | Ga0466969_0020496_487_885 | 130 |
| 689 | 3300044656 | Ga0466969_0045057 | Ga0466969_0045057_233_637 | 130 |
| 690 | 3300044658 | Ga0466972_0007057 | Ga0466972_0007057_5048_5446 | 130 |
| 691 | 3300044658 | Ga0466972_0139847 | Ga0466972_0139847_326_724 | 130 |
| 692 | 3300044684 | Ga0466966_0012619 | Ga0466966_0012619_1635_2033 | 130 |
| 693 | 3300044684 | Ga0466966_0290131 | Ga0466966_0290131_381_785 | 130 |
| 694 | 3300044693 | Ga0466961_0019506 | Ga0466961_0019506_2243_2641 | 130 |
| 695 | 3300044693 | Ga0466961_0026723 | Ga0466961_0026723_679_1083 | 130 |
| 696 | 3300044693 | Ga0466961_0171730 | Ga0466961_0171730_678_1082 | 130 |
| 697 | 3300044694 | Ga0466963_0023612 | Ga0466963_0023612_120_518 | 130 |
| 698 | 3300044706 | Ga0466964_0046761 | Ga0466964_0046761_1140_1538 | 130 |
| 699 | 3300044719 | Ga0466971_0235231 | Ga0466971_0235231_133_537 | 130 |
| 700 | 3300044735 | Ga0466968_0054924 | Ga0466968_0054924_41_439 | 130 |
| 701 | 3300044735 | Ga0466968_0170000 | Ga0466968_0170000_407_805 | 130 |
| 702 | 3300044765 | Ga0466970_0045561 | Ga0466970_0045561_1672_2076 | 130 |
| 703 | 3300044765 | Ga0466970_0115115 | Ga0466970_0115115_295_699 | 130 |
| 704 | 3300044765 | Ga0466970_0165459 | Ga0466970_0165459_55_453 | 130 |
| 705 | 3300044765 | Ga0466970_0776843 | Ga0466970_0776843_30_428 | 130 |
| 706 | 3300044901 | Ga0466960_0015043 | Ga0466960_0015043_1338_1736 | 130 |
| 707 | 3300044901 | Ga0466960_0061209 | Ga0466960_0061209_279_677 | 130 |
| 708 | 3300044901 | Ga0466960_0127334 | Ga0466960_0127334_514_912 | 130 |
| 709 | 3300044901 | Ga0466960_0562661 | Ga0466960_0562661_172_570 | 130 |
| 710 | 3300045049 | Ga0466959_0027067 | Ga0466959_0027067_823_1221 | 130 |
| 711 | 3300045049 | Ga0466959_0146439 | Ga0466959_0146439_298_696 | 130 |
| 712 | 3300045836 | Ga0466958_0001930 | Ga0466958_0001930_3217_3615 | 130 |
| 713 | 3300045836 | Ga0466958_0258283 | Ga0466958_0258283_259_657 | 130 |
| 714 | 3300045976 | Ga0466967_0042891 | Ga0466967_0042891_2180_2578 | 130 |
| 715 | 3300045976 | Ga0466967_0195376 | Ga0466967_0195376_168_566 | 130 |
| 716 | 3300045976 | Ga0466967_0219775 | Ga0466967_0219775_953_1351 | 130 |
| 717 | 3300045976 | Ga0466967_0499147 | Ga0466967_0499147_571_981 | 130 |
| 718 | 3300045976 | Ga0466967_2036727 | Ga0466967_2036727_43_441 | 130 |
| 719 | 3300046452 | Ga0495617_007078 | Ga0495617_007078_89_511 | 130 |
| 720 | 3300046453 | Ga0495627_031049 | Ga0495627_031049_1084_1506 | 130 |
| 721 | 3300046454 | Ga0495592_0046118 | Ga0495592_0046118_2065_2463 | 130 |
| 722 | 3300046454 | Ga0495592_0236177 | Ga0495592_0236177_744_1154 | 130 |
| 723 | 3300046455 | Ga0495603_0011194 | Ga0495603_0011194_1453_1851 | 130 |
| 724 | 3300046455 | Ga0495603_0020447 | Ga0495603_0020447_719_1141 | 130 |
| 725 | 3300046455 | Ga0495603_0064159 | Ga0495603_0064159_539_937 | 130 |
| 726 | 3300046457 | Ga0495590_0101900 | Ga0495590_0101900_281_703 | 130 |
| 727 | 3300046459 | Ga0495629_0000826 | Ga0495629_0000826_12074_12472 | 130 |
| 728 | 3300046459 | Ga0495629_0089285 | Ga0495629_0089285_751_1149 | 130 |
| 729 | 3300046459 | Ga0495629_0183071 | Ga0495629_0183071_610_1008 | 130 |
| 730 | 3300046460 | Ga0495638_0134535 | Ga0495638_0134535_793_1215 | 130 |
| 731 | 3300046462 | Ga0495651_0039768 | Ga0495651_0039768_739_1137 | 130 |
| 732 | 3300046462 | Ga0495651_0067319 | Ga0495651_0067319_410_823 | 130 |
| 733 | 3300046462 | Ga0495651_0551112 | Ga0495651_0551112_42_464 | 130 |
| 734 | 3300046463 | Ga0495653_0532159 | Ga0495653_0532159_191_604 | 130 |
| 735 | 3300046463 | Ga0495653_0811526 | Ga0495653_0811526_61_483 | 130 |
| 736 | 3300046471 | Ga0495650_0004071 | Ga0495650_0004071_5569_5985 | 130 |
| 737 | 3300046471 | Ga0495650_0122923 | Ga0495650_0122923_480_890 | 130 |
| 738 | 3300046472 | Ga0495580_0274634 | Ga0495580_0274634_714_1112 | 130 |
| 739 | 3300046473 | Ga0495582_0080172 | Ga0495582_0080172_1047_1445 | 130 |
| 740 | 3300046474 | Ga0495605_0003700 | Ga0495605_0003700_2539_2961 | 130 |
| 741 | 3300046475 | Ga0495639_0001006 | Ga0495639_0001006_8858_9271 | 130 |
| 742 | 3300046475 | Ga0495639_0003852 | Ga0495639_0003852_598_996 | 130 |
| 743 | 3300046476 | Ga0495662_0005228 | Ga0495662_0005228_2749_3147 | 130 |
| 744 | 3300046477 | Ga0495664_0556275 | Ga0495664_0556275_73_495 | 130 |
| 745 | 3300046491 | Ga0495584_0133047 | Ga0495584_0133047_364_786 | 130 |
| 746 | 3300046499 | Ga0495594_0000177 | Ga0495594_0000177_11274_11672 | 130 |
| 747 | 3300046499 | Ga0495594_0139607 | Ga0495594_0139607_681_1079 | 130 |
| 748 | 3300046506 | Ga0495583_0059830 | Ga0495583_0059830_779_1201 | 130 |
| 749 | 3300046507 | Ga0495606_0016399 | Ga0495606_0016399_1939_2361 | 130 |
| 750 | 3300046511 | Ga0495608_0222705 | Ga0495608_0222705_733_1131 | 130 |
| 751 | 3300046512 | Ga0495610_0060642 | Ga0495610_0060642_26_448 | 130 |
| 752 | 3300046513 | Ga0495616_0018753 | Ga0495616_0018753_2732_3154 | 130 |
| 753 | 3300046514 | Ga0495618_0050137 | Ga0495618_0050137_1963_2385 | 130 |
| 754 | 3300046515 | Ga0495620_0050344 | Ga0495620_0050344_365_787 | 130 |
| 755 | 3300046516 | Ga0495628_0066026 | Ga0495628_0066026_184_582 | 130 |
| 756 | 3300046516 | Ga0495628_0321781 | Ga0495628_0321781_595_993 | 130 |
| 757 | 3300046516 | Ga0495628_0740758 | Ga0495628_0740758_148_561 | 130 |
| 758 | 3300046517 | Ga0495630_0684128 | Ga0495630_0684128_87_485 | 130 |
| 759 | 3300046518 | Ga0495631_0005737 | Ga0495631_0005737_4112_4534 | 130 |
| 760 | 3300046519 | Ga0495632_0170772 | Ga0495632_0170772_10_432 | 130 |
| 761 | 3300046522 | Ga0495643_0005063 | Ga0495643_0005063_6807_7205 | 130 |
| 762 | 3300046522 | Ga0495643_0095385 | Ga0495643_0095385_510_920 | 130 |
| 763 | 3300046524 | Ga0495648_0013270 | Ga0495648_0013270_4686_5108 | 130 |
| 764 | 3300046525 | Ga0495663_0009814 | Ga0495663_0009814_441_854 | 130 |
| 765 | 3300046526 | Ga0495666_0010356 | Ga0495666_0010356_3507_3929 | 130 |
| 766 | 3300046528 | Ga0495642_0010168 | Ga0495642_0010168_1403_1816 | 130 |
| 767 | 3300046528 | Ga0495642_0532180 | Ga0495642_0532180_41_439 | 130 |
| 768 | 3300046529 | Ga0495652_0012460 | Ga0495652_0012460_5408_5806 | 130 |
| 769 | 3300046530 | Ga0495654_0078989 | Ga0495654_0078989_382_804 | 130 |
| 770 | 3300046531 | Ga0495665_0593313 | Ga0495665_0593313_108_530 | 130 |
| 771 | 3300046533 | Ga0495640_0009264 | Ga0495640_0009264_6994_7416 | 130 |
| 772 | 3300046533 | Ga0495640_0145921 | Ga0495640_0145921_970_1368 | 130 |
| 773 | 3300046535 | Ga0495586_0089819 | Ga0495586_0089819_1017_1415 | 130 |
| 774 | 3300046535 | Ga0495586_0470595 | Ga0495586_0470595_84_482 | 130 |
| 775 | 3300046536 | Ga0495587_0419179 | Ga0495587_0419179_288_701 | 130 |
| 776 | 3300046539 | Ga0495621_0322780 | Ga0495621_0322780_219_632 | 130 |
| 777 | 3300046543 | Ga0495645_0160416 | Ga0495645_0160416_94_492 | 130 |
| 778 | 3300046543 | Ga0495645_0358971 | Ga0495645_0358971_506_904 | 130 |
| 779 | 3300046557 | Ga0495622_0047154 | Ga0495622_0047154_1455_1877 | 130 |
| 780 | 3300046557 | Ga0495622_0065903 | Ga0495622_0065903_931_1329 | 130 |
| 781 | 3300046557 | Ga0495622_0101223 | Ga0495622_0101223_408_806 | 130 |
| 782 | 3300046558 | Ga0495633_0042904 | Ga0495633_0042904_1062_1484 | 130 |
| 783 | 3300046558 | Ga0495633_0573919 | Ga0495633_0573919_81_479 | 130 |
| 784 | 3300046615 | Ga0495656_0000073 | Ga0495656_0000073_26518_26931 | 130 |
| 785 | 3300046616 | Ga0495668_0012473 | Ga0495668_0012473_2907_3329 | 130 |
| 786 | 3300046642 | Ga0495634_0044708 | Ga0495634_0044708_103_501 | 130 |
| 787 | 3300046648 | Ga0495611_0046736 | Ga0495611_0046736_978_1400 | 130 |
| 788 | 3300046660 | Ga0495625_0183547 | Ga0495625_0183547_669_1091 | 130 |
| 789 | 3300046663 | Ga0495635_0021267 | Ga0495635_0021267_4025_4423 | 130 |
| 790 | 3300046663 | Ga0495635_0335406 | Ga0495635_0335406_32_430 | 130 |
| 791 | 3300046664 | Ga0495659_0370794 | Ga0495659_0370794_142_540 | 130 |
| 792 | 3300046665 | Ga0495661_0029347 | Ga0495661_0029347_1023_1445 | 130 |
| 793 | 3300046674 | Ga0495588_0002150 | Ga0495588_0002150_496_894 | 130 |
| 794 | 3300046674 | Ga0495588_0089506 | Ga0495588_0089506_395_793 | 130 |
| 795 | 3300046674 | Ga0495588_0096693 | Ga0495588_0096693_73_471 | 130 |
| 796 | 3300046674 | Ga0495588_0242631 | Ga0495588_0242631_378_776 | 130 |
| 797 | 3300046674 | Ga0495588_0543978 | Ga0495588_0543978_169_567 | 130 |
| 798 | 3300046675 | Ga0495657_0099059 | Ga0495657_0099059_1167_1565 | 130 |
| 799 | 3300046678 | Ga0495599_0271547 | Ga0495599_0271547_288_686 | 130 |
| 800 | 3300046678 | Ga0495599_0275980 | Ga0495599_0275980_99_497 | 130 |
| 801 | 3300046678 | Ga0495599_0554923 | Ga0495599_0554923_141_563 | 130 |
| 802 | 3300046679 | Ga0495623_0047241 | Ga0495623_0047241_1408_1806 | 130 |
| 803 | 3300046683 | Ga0495658_0060684 | Ga0495658_0060684_417_815 | 130 |
| 804 | 3300046683 | Ga0495658_0438519 | Ga0495658_0438519_273_686 | 130 |
| 805 | 3300046689 | Ga0495613_0021244 | Ga0495613_0021244_1737_2135 | 130 |
| 806 | 3300046689 | Ga0495613_0170537 | Ga0495613_0170537_30_452 | 130 |
| 807 | 3300046689 | Ga0495613_0570427 | Ga0495613_0570427_54_452 | 130 |
| 808 | 3300046690 | Ga0495624_0021994 | Ga0495624_0021994_435_833 | 130 |
| 809 | 3300046690 | Ga0495624_0065203 | Ga0495624_0065203_1031_1429 | 130 |
| 810 | 3300046690 | Ga0495624_0699164 | Ga0495624_0699164_179_592 | 130 |
| 811 | 3300046691 | Ga0495670_0129399 | Ga0495670_0129399_149_547 | 130 |
| 812 | 3300046694 | Ga0495649_0031727 | Ga0495649_0031727_975_1373 | 130 |
| 813 | 3300046809 | Ga0495600_0125983 | Ga0495600_0125983_662_1060 | 130 |
| 814 | 3300046809 | Ga0495600_0166548 | Ga0495600_0166548_536_958 | 130 |
| 815 | 3300046810 | Ga0495660_0208771 | Ga0495660_0208771_79_501 | 130 |
| 816 | 3300047315 | Ga0495581_0094891 | Ga0495581_0094891_1247_1645 | 130 |
| 817 | 3300047315 | Ga0495581_0235632 | Ga0495581_0235632_388_786 | 130 |
| 818 | 3300047317 | Ga0495604_0151764 | Ga0495604_0151764_180_578 | 130 |
| 819 | 3300047317 | Ga0495604_0225515 | Ga0495604_0225515_413_811 | 130 |
| 820 | 3300047317 | Ga0495604_0625339 | Ga0495604_0625339_215_637 | 130 |
| 821 | 3300047318 | Ga0495636_0009829 | Ga0495636_0009829_63_461 | 130 |
| 822 | 3300047318 | Ga0495636_0063959 | Ga0495636_0063959_1115_1513 | 130 |
| 823 | 3300047318 | Ga0495636_0367052 | Ga0495636_0367052_267_665 | 130 |
| 824 | 3300047319 | Ga0495674_0066221 | Ga0495674_0066221_1991_2413 | 130 |
| 825 | 3300047319 | Ga0495674_0108554 | Ga0495674_0108554_69_467 | 130 |
| 826 | 3300047321 | Ga0495676_0008000 | Ga0495676_0008000_4677_5075 | 130 |
| 827 | 3300047321 | Ga0495676_0066306 | Ga0495676_0066306_1264_1686 | 130 |
| 828 | 3300047321 | Ga0495676_0105305 | Ga0495676_0105305_951_1349 | 130 |
| 829 | 3300047322 | Ga0495680_0091481 | Ga0495680_0091481_1162_1560 | 130 |
| 830 | 3300047443 | Ga0495687_001616 | Ga0495687_001616_8727_9125 | 130 |
| 831 | 3300047443 | Ga0495687_055125 | Ga0495687_055125_215_637 | 130 |
| 832 | 3300047443 | Ga0495687_084167 | Ga0495687_084167_341_739 | 130 |
| 833 | 3300047444 | Ga0495675_0006543 | Ga0495675_0006543_2127_2525 | 130 |
| 834 | 3300047444 | Ga0495675_0668309 | Ga0495675_0668309_38_436 | 130 |
| 835 | 3300047445 | Ga0495677_0046213 | Ga0495677_0046213_1040_1438 | 130 |
| 836 | 3300047445 | Ga0495677_0351579 | Ga0495677_0351579_127_549 | 130 |
| 837 | 3300047447 | Ga0495685_001871 | Ga0495685_001871_1136_1534 | 130 |
| 838 | 3300047447 | Ga0495685_005147 | Ga0495685_005147_2484_2906 | 130 |
| 839 | 3300047470 | Ga0495681_0064080 | Ga0495681_0064080_74_472 | 130 |
| 840 | 3300047470 | Ga0495681_0198968 | Ga0495681_0198968_239_652 | 130 |
| 841 | 3300047471 | Ga0495684_0130016 | Ga0495684_0130016_817_1215 | 130 |
| 842 | 3300047472 | Ga0495686_0111878 | Ga0495686_0111878_297_719 | 130 |
| 843 | 3300047472 | Ga0495686_0509102 | Ga0495686_0509102_188_586 | 130 |
| 844 | 3300047472 | Ga0495686_0568431 | Ga0495686_0568431_164_577 | 130 |
| 845 | 3300047673 | Ga0495593_0090469 | Ga0495593_0090469_134_532 | 130 |
| 846 | 3300047673 | Ga0495593_0096633 | Ga0495593_0096633_624_1046 | 130 |
| 847 | 3300048088 | Ga0495602_0446839 | Ga0495602_0446839_120_518 | 130 |
| 848 | 3300048089 | Ga0495614_0033238 | Ga0495614_0033238_100_498 | 130 |
| 849 | 3300048091 | Ga0495626_0115705 | Ga0495626_0115705_484_882 | 130 |
| 850 | 3300048903 | Ga0496100_0003006 | Ga0496100_0003006_3626_4024 | 130 |
| 851 | 3300048903 | Ga0496100_0009927 | Ga0496100_0009927_4843_5256 | 130 |
| 852 | 3300048903 | Ga0496100_0262922 | Ga0496100_0262922_542_940 | 130 |
| 853 | 3300048904 | Ga0496101_0003437 | Ga0496101_0003437_328_741 | 130 |
| 854 | 3300048904 | Ga0496101_0003632 | Ga0496101_0003632_2931_3329 | 130 |
| 855 | 3300048904 | Ga0496101_0005647 | Ga0496101_0005647_3370_3768 | 130 |
| 856 | 3300048904 | Ga0496101_0296101 | Ga0496101_0296101_511_909 | 130 |
| 857 | 3300048904 | Ga0496101_0342137 | Ga0496101_0342137_14_412 | 130 |
| 858 | 3300048904 | Ga0496101_0378587 | Ga0496101_0378587_514_912 | 130 |
| 859 | 3300048904 | Ga0496101_0441698 | Ga0496101_0441698_497_895 | 130 |
| 860 | 3300048904 | Ga0496101_1078930 | Ga0496101_1078930_59_457 | 130 |
| 861 | 3300048905 | Ga0496102_0005443 | Ga0496102_0005443_8602_9000 | 130 |
| 862 | 3300048905 | Ga0496102_0014277 | Ga0496102_0014277_84_482 | 130 |
| 863 | 3300048905 | Ga0496102_0074466 | Ga0496102_0074466_2046_2444 | 130 |
| 864 | 3300048905 | Ga0496102_0347129 | Ga0496102_0347129_178_576 | 130 |
| 865 | 3300048905 | Ga0496102_1100422 | Ga0496102_1100422_289_687 | 130 |
| 866 | 3300048906 | Ga0496103_0002209 | Ga0496103_0002209_11827_12225 | 130 |
| 867 | 3300048906 | Ga0496103_0029536 | Ga0496103_0029536_649_1062 | 130 |
| 868 | 3300048906 | Ga0496103_0085105 | Ga0496103_0085105_990_1388 | 130 |
| 869 | 3300048906 | Ga0496103_0108051 | Ga0496103_0108051_275_673 | 130 |
| 870 | 3300048907 | Ga0496104_0001352 | Ga0496104_0001352_14148_14546 | 130 |
| 871 | 3300048907 | Ga0496104_0013914 | Ga0496104_0013914_4988_5401 | 130 |
| 872 | 3300048907 | Ga0496104_0037452 | Ga0496104_0037452_2308_2706 | 130 |
| 873 | 3300048907 | Ga0496104_0040299 | Ga0496104_0040299_779_1177 | 130 |
| 874 | 3300048907 | Ga0496104_0069434 | Ga0496104_0069434_2093_2491 | 130 |
| 875 | 3300048907 | Ga0496104_0647129 | Ga0496104_0647129_483_881 | 130 |
| 876 | 3300048907 | Ga0496104_1466524 | Ga0496104_1466524_151_549 | 130 |
| 877 | 3300048908 | Ga0496105_0001642 | Ga0496105_0001642_14481_14894 | 130 |
| 878 | 3300048908 | Ga0496105_0062883 | Ga0496105_0062883_2264_2662 | 130 |
| 879 | 3300048908 | Ga0496105_0111863 | Ga0496105_0111863_376_774 | 130 |
| 880 | 3300048908 | Ga0496105_0148916 | Ga0496105_0148916_1398_1796 | 130 |
| 881 | 3300048908 | Ga0496105_0242187 | Ga0496105_0242187_36_434 | 130 |
| 882 | 3300048908 | Ga0496105_1003590 | Ga0496105_1003590_13_411 | 130 |
| 883 | 3300048908 | Ga0496105_1196171 | Ga0496105_1196171_38_436 | 130 |
| 884 | 3300048909 | Ga0496106_0003811 | Ga0496106_0003811_409_822 | 130 |
| 885 | 3300048909 | Ga0496106_0131730 | Ga0496106_0131730_930_1328 | 130 |
| 886 | 3300048909 | Ga0496106_0167838 | Ga0496106_0167838_1235_1633 | 130 |
| 887 | 3300048909 | Ga0496106_0187073 | Ga0496106_0187073_972_1370 | 130 |
| 888 | 3300048910 | Ga0496107_0005200 | Ga0496107_0005200_4289_4687 | 130 |
| 889 | 3300048910 | Ga0496107_0017687 | Ga0496107_0017687_157_570 | 130 |
| 890 | 3300048910 | Ga0496107_0300023 | Ga0496107_0300023_568_966 | 130 |
| 891 | 3300048910 | Ga0496107_0477407 | Ga0496107_0477407_431_829 | 130 |
| 892 | 3300048911 | Ga0496108_0001073 | Ga0496108_0001073_11193_11591 | 130 |
| 893 | 3300048911 | Ga0496108_0010591 | Ga0496108_0010591_6624_7037 | 130 |
| 894 | 3300048911 | Ga0496108_0221656 | Ga0496108_0221656_572_985 | 130 |
| 895 | 3300048911 | Ga0496108_1160860 | Ga0496108_1160860_182_580 | 130 |
| 896 | 3300048912 | Ga0496109_0001427 | Ga0496109_0001427_7479_7877 | 130 |
| 897 | 3300048912 | Ga0496109_0031889 | Ga0496109_0031889_1056_1454 | 130 |
| 898 | 3300048912 | Ga0496109_0032893 | Ga0496109_0032893_2177_2590 | 130 |
| 899 | 3300048912 | Ga0496109_0158597 | Ga0496109_0158597_21_434 | 130 |
| 900 | 3300048912 | Ga0496109_0291856 | Ga0496109_0291856_453_851 | 130 |
| 901 | 3300048912 | Ga0496109_0308043 | Ga0496109_0308043_412_810 | 130 |
| 902 | 3300048912 | Ga0496109_0945495 | Ga0496109_0945495_33_431 | 130 |
| 903 | 3300048913 | Ga0496110_0019879 | Ga0496110_0019879_2566_2979 | 130 |
| 904 | 3300048913 | Ga0496110_0091020 | Ga0496110_0091020_653_1066 | 130 |
| 905 | 3300048913 | Ga0496110_0114355 | Ga0496110_0114355_1535_1933 | 130 |
| 906 | 3300048913 | Ga0496110_0114747 | Ga0496110_0114747_703_1116 | 130 |
| 907 | 3300048913 | Ga0496110_0118502 | Ga0496110_0118502_835_1233 | 130 |
| 908 | 3300048913 | Ga0496110_0212754 | Ga0496110_0212754_40_438 | 130 |
| 909 | 3300048913 | Ga0496110_1347307 | Ga0496110_1347307_155_553 | 130 |
| 910 | 3300048914 | Ga0496111_0002651 | Ga0496111_0002651_4799_5212 | 130 |
| 911 | 3300048914 | Ga0496111_0088090 | Ga0496111_0088090_439_837 | 130 |
| 912 | 3300048914 | Ga0496111_0102392 | Ga0496111_0102392_589_1002 | 130 |
| 913 | 3300048915 | Ga0496112_0105661 | Ga0496112_0105661_1037_1435 | 130 |
| 914 | 3300048915 | Ga0496112_0144537 | Ga0496112_0144537_1273_1671 | 130 |
| 915 | 3300048915 | Ga0496112_0903852 | Ga0496112_0903852_238_636 | 130 |
| 916 | 3300048916 | Ga0496113_0172971 | Ga0496113_0172971_957_1355 | 130 |
| 917 | 3300048916 | Ga0496113_0271922 | Ga0496113_0271922_490_903 | 130 |
| 918 | 3300048916 | Ga0496113_1190826 | Ga0496113_1190826_12_425 | 130 |
| 919 | 3300048917 | Ga0496114_0003033 | Ga0496114_0003033_5111_5509 | 130 |
| 920 | 3300048917 | Ga0496114_0014718 | Ga0496114_0014718_1588_1986 | 130 |
| 921 | 3300048917 | Ga0496114_0025803 | Ga0496114_0025803_89_502 | 130 |
| 922 | 3300048917 | Ga0496114_0028600 | Ga0496114_0028600_634_1032 | 130 |
| 923 | 3300048917 | Ga0496114_0085365 | Ga0496114_0085365_2079_2477 | 130 |
| 924 | 3300048917 | Ga0496114_0093689 | Ga0496114_0093689_1842_2264 | 130 |
| 925 | 3300048917 | Ga0496114_0160327 | Ga0496114_0160327_977_1399 | 130 |
| 926 | 3300048917 | Ga0496114_1177035 | Ga0496114_1177035_219_617 | 130 |
| 927 | 3300048917 | Ga0496114_1519473 | Ga0496114_1519473_84_482 | 130 |
| 928 | 3300048918 | Ga0496115_0018895 | Ga0496115_0018895_4733_5131 | 130 |
| 929 | 3300048918 | Ga0496115_0217946 | Ga0496115_0217946_838_1236 | 130 |
| 930 | 3300048924 | Ga0496121_0008995 | Ga0496121_0008995_7432_7830 | 130 |
| 931 | 3300048924 | Ga0496121_0711222 | Ga0496121_0711222_122_523 | 130 |
| 932 | 3300048925 | Ga0496122_0260143 | Ga0496122_0260143_208_615 | 130 |
| 933 | 3300048928 | Ga0496125_0519795 | Ga0496125_0519795_21_419 | 130 |
| 934 | 3300049459 | Ga0495678_040874 | Ga0495678_040874_1187_1585 | 130 |
| 935 | 3300049568 | Ga0501031_0073073 | Ga0501031_0073073_630_1040 | 130 |
| 936 | 3300049568 | Ga0501031_0343690 | Ga0501031_0343690_154_564 | 130 |
| 937 | 3300049569 | Ga0501032_0173014 | Ga0501032_0173014_937_1335 | 130 |
| 938 | 3300049569 | Ga0501032_0320542 | Ga0501032_0320542_117_515 | 130 |
| 939 | 3300049570 | Ga0501033_0189168 | Ga0501033_0189168_262_672 | 130 |
| 940 | 3300049570 | Ga0501033_0192909 | Ga0501033_0192909_920_1318 | 130 |
| 941 | 3300049571 | Ga0501034_0023509 | Ga0501034_0023509_973_1371 | 130 |
| 942 | 3300049571 | Ga0501034_0481555 | Ga0501034_0481555_672_1070 | 130 |
| 943 | 3300049571 | Ga0501034_0742682 | Ga0501034_0742682_133_537 | 130 |
| 944 | 3300049573 | Ga0501037_0014653 | Ga0501037_0014653_1149_1547 | 130 |
| 945 | 3300049573 | Ga0501037_0640389 | Ga0501037_0640389_221_619 | 130 |
| 946 | 3300049574 | Ga0501038_0528442 | Ga0501038_0528442_280_690 | 130 |
| 947 | 3300049575 | Ga0501039_0037309 | Ga0501039_0037309_2333_2743 | 130 |
| 948 | 3300049575 | Ga0501039_0335445 | Ga0501039_0335445_755_1153 | 130 |
| 949 | 3300049576 | Ga0501040_0273327 | Ga0501040_0273327_87_485 | 130 |
| 950 | 3300049577 | Ga0501041_0048489 | Ga0501041_0048489_1561_1971 | 130 |
| 951 | 3300049577 | Ga0501041_0249025 | Ga0501041_0249025_623_1027 | 130 |
| 952 | 3300049578 | Ga0501042_0064138 | Ga0501042_0064138_1931_2341 | 130 |
| 953 | 3300049578 | Ga0501042_0406136 | Ga0501042_0406136_42_452 | 130 |
| 954 | 3300049578 | Ga0501042_0548212 | Ga0501042_0548212_378_776 | 130 |
| 955 | 3300049579 | Ga0501043_0053889 | Ga0501043_0053889_1061_1459 | 130 |
| 956 | 3300049579 | Ga0501043_0291779 | Ga0501043_0291779_650_1048 | 130 |
| 957 | 3300049579 | Ga0501043_0675573 | Ga0501043_0675573_159_569 | 130 |
| 958 | 3300049580 | Ga0501046_0045749 | Ga0501046_0045749_1590_1988 | 130 |
| 959 | 3300049580 | Ga0501046_0459756 | Ga0501046_0459756_269_679 | 130 |
| 960 | 3300049581 | Ga0501047_0039795 | Ga0501047_0039795_775_1173 | 130 |
| 961 | 3300049582 | Ga0501048_0025305 | Ga0501048_0025305_56_454 | 130 |
| 962 | 3300049583 | Ga0501067_0222949 | Ga0501067_0222949_453_857 | 130 |
| 963 | 3300049584 | Ga0501068_0218630 | Ga0501068_0218630_432_842 | 130 |
| 964 | 3300049585 | Ga0501069_0324543 | Ga0501069_0324543_439_849 | 130 |
| 965 | 3300049587 | Ga0501071_0246643 | Ga0501071_0246643_639_1049 | 130 |
| 966 | 3300049588 | Ga0501072_0016033 | Ga0501072_0016033_4361_4771 | 130 |
| 967 | 3300049590 | Ga0501074_1290099 | Ga0501074_1290099_88_492 | 130 |
| 968 | 3300049591 | Ga0501075_0156975 | Ga0501075_0156975_285_695 | 130 |
| 969 | 3300049592 | Ga0501076_0037194 | Ga0501076_0037194_1433_1843 | 130 |
| 970 | 3300049592 | Ga0501076_0553768 | Ga0501076_0553768_269_676 | 130 |
| 971 | 3300049593 | Ga0501077_0039288 | Ga0501077_0039288_912_1322 | 130 |
| 972 | 3300049593 | Ga0501077_0147522 | Ga0501077_0147522_144_548 | 130 |
| 973 | 3300049741 | Ga0501079_0068644 | Ga0501079_0068644_988_1398 | 130 |
| 974 | 3300049742 | Ga0501080_0328331 | Ga0501080_0328331_559_969 | 130 |
| 975 | 3300049743 | Ga0501081_0164928 | Ga0501081_0164928_911_1321 | 130 |
| 976 | 3300049744 | Ga0501083_0201281 | Ga0501083_0201281_207_617 | 130 |
| 977 | 3300049744 | Ga0501083_0708608 | Ga0501083_0708608_63_461 | 130 |
| 978 | 3300049822 | Ga0501035_0035383 | Ga0501035_0035383_3102_3500 | 130 |
| 979 | 3300049823 | Ga0501044_0000854 | Ga0501044_0000854_19027_19425 | 130 |
| 980 | 3300049823 | Ga0501044_0426551 | Ga0501044_0426551_51_449 | 130 |
| 981 | 3300049824 | Ga0501045_0077963 | Ga0501045_0077963_210_620 | 130 |
| 982 | 3300049824 | Ga0501045_0345218 | Ga0501045_0345218_311_709 | 130 |
| 983 | 3300050489 | nmdc:mga03683_304756_c1 | nmdc:mga03683_304756_c1_139_537 | 130 |
| 984 | 3300050490 | nmdc:mga03n38_27148_c1 | nmdc:mga03n38_27148_c1_39_437 | 130 |
| 985 | 3300050490 | nmdc:mga03n38_911639_c1 | nmdc:mga03n38_911639_c1_66_479 | 130 |
| 986 | 3300050493 | nmdc:mga0k408_250805_c1 | nmdc:mga0k408_250805_c1_217_615 | 130 |
| 987 | 3300050493 | nmdc:mga0k408_26286_c1 | nmdc:mga0k408_26286_c1_386_784 | 130 |
| 988 | 3300050493 | nmdc:mga0k408_743818_c1 | nmdc:mga0k408_743818_c1_137_535 | 130 |
| 989 | 3300050494 | nmdc:mga06z11_338566_c1 | nmdc:mga06z11_338566_c1_131_529 | 130 |
| 990 | 3300050495 | nmdc:mga04h51_114965_c1 | nmdc:mga04h51_114965_c1_561_959 | 130 |
| 991 | 3300050496 | nmdc:mga07m45_542831_c1 | nmdc:mga07m45_542831_c1_55_465 | 130 |
| 992 | 3300050507 | nmdc:mga05p37_63568_c1 | nmdc:mga05p37_63568_c1_2718_3116 | 130 |
| 993 | 3300050509 | nmdc:mga0qj67_104126_c1 | nmdc:mga0qj67_104126_c1_155_553 | 130 |
| 994 | 3300050510 | nmdc:mga06r32_116320_c1 | nmdc:mga06r32_116320_c1_1681_2079 | 130 |
| 995 | 3300050512 | nmdc:mga0n895_18784_c1 | nmdc:mga0n895_18784_c1_149_547 | 130 |
| 996 | 3300050513 | nmdc:mga0rr50_14251_c1 | nmdc:mga0rr50_14251_c1_3122_3520 | 130 |
| 997 | 3300050515 | nmdc:mga0a205_98967_c2 | nmdc:mga0a205_98967_c2_912_1316 | 130 |
| 998 | 3300050516 | nmdc:mga0sz30_353798_c1 | nmdc:mga0sz30_353798_c1_111_509 | 130 |
| 999 | 3300053085 | Ga0495619_0162262 | Ga0495619_0162262_766_1164 | 130 |
| 1000 | 3300053087 | Ga0500643_215482 | Ga0500643_215482_96_500 | 130 |
| 1001 | 3300053088 | Ga0500644_0018445 | Ga0500644_0018445_1344_1748 | 130 |
| 1002 | 3300053090 | Ga0500646_0053454 | Ga0500646_0053454_689_1108 | 130 |
| 1003 | 3300053098 | Ga0500650_0174622 | Ga0500650_0174622_524_922 | 130 |
| 1004 | 3300053108 | Ga0500562_001750 | Ga0500562_001750_3741_4145 | 130 |
| 1005 | 3300053139 | Ga0500568_0180783 | Ga0500568_0180783_249_653 | 130 |
| 1006 | 3300053145 | Ga0500586_004324 | Ga0500586_004324_255_659 | 130 |
| 1007 | 3300053148 | Ga0500590_031916 | Ga0500590_031916_863_1273 | 130 |
| 1008 | 3300053154 | Ga0500619_000013 | Ga0500619_000013_40715_41128 | 130 |
| 1009 | 3300054114 | Ga0501084_0119084 | Ga0501084_0119084_1677_2087 | 130 |
| 1010 | 3300059421 | Ga0590071_002328 | Ga0590071_002328_2615_3028 | 130 |
| 1011 | 3300060353 | Ga0501082_0079810 | Ga0501082_0079810_585_995 | 130 |
| 1012 | 3300060353 | Ga0501082_0575828 | Ga0501082_0575828_37_447 | 130 |
| 1013 | 3300061719 | Ga0466962_0182206 | Ga0466962_0182206_240_644 | 130 |
| 1014 | 3300061719 | Ga0466962_0204940 | Ga0466962_0204940_436_834 | 130 |
| 1015 | 3300061734 | Ga0530510_0035937 | Ga0530510_0035937_1085_1495 | 130 |
| 1016 | 3300061734 | Ga0530510_0474942 | Ga0530510_0474942_524_934 | 130 |
| 1017 | 3300061734 | Ga0530510_1295287 | Ga0530510_1295287_43_453 | 130 |
| 1018 | iso_pu_bacteria | 2866612099 | 2866613216 | 130 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d7j-assembly1.cif.gz_D | sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor | 0.9837 | 2 | 130 |
| 3d7j-assembly1.cif.gz_D | sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor | 0.9688 | 2 | 130 |
| 2dtt-assembly1.cif.gz_A | crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin | 0.8756 | 2 | 128 |
| 2dtt-assembly1.cif.gz_A | crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin | 0.8524 | 2 | 128 |
| 2dtt-assembly2.cif.gz_E | crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin | 0.8448 | 2 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3d7jC00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9745 | 2 | 130 | 3.30.479.10 |
| 3d7jC00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.9597 | 2 | 130 | 3.30.479.10 |
| af_Q3TQ88_34_148_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.8385 | 111 | 130 | 2.60.40.10 |
| af_Q58668_4_160_3.30.479.10 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.8193 | 9 | 130 | 3.30.479.10 |
| 1y13C00 | Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD | 0.8055 | 2 | 130 | 3.30.479.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A841CCW2-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9946 | 35 | 130 |
GO:0016829
GO:0046872 |
| AF-A0A2R8AFA4-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9882 | 1 | 130 |
GO:0046872
GO:0070497 |
| AF-A0A1V2QES6-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9861 | 1 | 129 |
GO:0046872
GO:0070497 |
| AF-A0A1Q9SV15-F1-model_v4 | deleted | 0.9855 | 1 | 130 |
|
| AF-L0DYM8-F1-model_v4 | 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) | 0.9853 | 1 | 130 |
GO:0046872
GO:0070497 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar