F488320

General Info

Members Datasets Scaffolds Average Seq Length
1018 397 1018 320

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0730546|Ga0436365_0730546_908_2020
Length 370
Sequence MAAERLENKPCGGRYGDIVQAIGHTPLVELKRLSPKPGVRLWAKLESRNPTGSVKDRVARAMLEDAEEKGLIRPGQTILEPTSGNTGISLAMICSRKGYPLKVVMPENVTRERTELLRMYGAEIVYSEGAKGSNGAVELALDMAEKDASYYMPYQYGNQANPLAHYNGTALEILEELDEIAAFVAGLGTGGTLMGNGRRLKEELGDQVKIVAAEPMQGEPVQGLRSLEDGFIPPIIDLSLLDRKIFVTNTDAIVFTRRLLDEEGLFVGVSSGAIARVAVRIAGELDEGNVVFLVADDGWKYLSSGIYTRPLEEIENLDSTVWWRAETRRRAIPHLAGESCGPPARRPGGCWSRHAVTRRSRRWCTTPRRF

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
124 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
201 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
202 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
203 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
204 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
205 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
208 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
209 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
214 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
220 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
221 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
222 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
245 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
250 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
251 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
252 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
253 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
261 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
281 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
282 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
283 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
284 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
291 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
299 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
335 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
354 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
355 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
356 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
357 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
358 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
359 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
360 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
361 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
362 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
363 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
364 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
365 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
370 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
371 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
372 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
373 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
374 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
375 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
376 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
377 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
378 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
382 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
383 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
384 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
385 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
386 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
387 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
388 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
389 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
390 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
391 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
392 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
393 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
394 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 2.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0
Rhizoplane 9.04
Rhizosphere 83.69
Stem 0
Stem Tuber 0
Unclassified 5.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1003365 3300000546 Bacteria 1842
2 JGI24746J21847_1000941 3300001977 Bacteria 4566
3 JGI24748J21848_1000576 3300002074 Bacteria 3951
4 JGI24034J26672_10000425 3300002239 Bacteria 5469
5 JGI24742J22300_10000739 3300002244 Bacteria 4944
6 JGI25406J46586_10005180 3300003203 Bacteria 6046
7 JGI25407J50210_10000241 3300003373 Bacteria 9571
8 JGI25407J50210_10002334 3300003373 Bacteria 4454
9 JGI25407J50210_10007428 3300003373 Bacteria 2744
10 JGI25407J50210_10021674 3300003373 Bacteria 1669
11 JGI25404J52841_10000538 3300003659 Bacteria 5582
12 Ga0058861_10195417 3300004800 Bacteria 2290
13 Ga0058862_10069669 3300004803 Bacteria 2991
14 Ga0070658_10024325 3300005327 Bacteria 4860
15 Ga0070683_100001231 3300005329 Bacteria 19475
16 Ga0070683_100007506 3300005329 Bacteria 9216
17 Ga0070683_100017321 3300005329 Bacteria 6368
18 Ga0070683_100018543 3300005329 Bacteria 6167
19 Ga0070683_100198873 3300005329 Bacteria 1903
20 Ga0070677_10000956 3300005333 Bacteria 9336
21 Ga0070666_10018742 3300005335 Bacteria 4456
22 Ga0070682_100000023 3300005337 Bacteria 206016
23 Ga0070682_100000061 3300005337 Bacteria 105134
24 Ga0070682_100028676 3300005337 Bacteria 3349
25 Ga0068868_100050568 3300005338 Bacteria 3265
26 Ga0068868_100345810 3300005338 Bacteria 1273
27 Ga0070689_100457795 3300005340 Bacteria 1086
28 Ga0070691_10000004 3300005341 Bacteria 80156
29 Ga0070691_10013117 3300005341 Bacteria 3796
30 Ga0070687_100044085 3300005343 Bacteria 2270
31 Ga0070661_100000110 3300005344 Bacteria 68106
32 Ga0070661_100012352 3300005344 Bacteria 5975
33 Ga0070661_100313458 3300005344 Bacteria 1224
34 Ga0070692_10004822 3300005345 Bacteria 5672
35 Ga0070692_10055968 3300005345 Bacteria 2064
36 Ga0070668_100009891 3300005347 Bacteria 7063
37 Ga0070668_100457845 3300005347 Bacteria 1098
38 Ga0070669_100008089 3300005353 Bacteria 7515
39 Ga0070675_100000091 3300005354 Bacteria 52149
40 Ga0070675_100040732 3300005354 Bacteria 3793
41 Ga0070674_100000019 3300005356 Bacteria 89350
42 Ga0070674_100033227 3300005356 Bacteria 3432
43 Ga0070674_100219131 3300005356 Bacteria 1479
44 Ga0070673_100016927 3300005364 Bacteria 5170
45 Ga0070688_100000077 3300005365 Bacteria 48743
46 Ga0070688_100000937 3300005365 Bacteria 14631
47 Ga0070688_100010454 3300005365 Bacteria 5117
48 Ga0070688_100082357 3300005365 Bacteria 2086
49 Ga0070688_100169927 3300005365 Bacteria 1504
50 Ga0070659_100000026 3300005366 Bacteria 143542
51 Ga0070659_100005636 3300005366 Bacteria 9005
52 Ga0070659_100008534 3300005366 Bacteria 7487
53 Ga0070659_100023840 3300005366 Bacteria 4686
54 Ga0070667_100000597 3300005367 Bacteria 35219
55 Ga0070667_100083799 3300005367 Bacteria 2732
56 Ga0070703_10080181 3300005406 Bacteria 1110
57 Ga0070709_10050251 3300005434 Bacteria 2612
58 Ga0070709_10175990 3300005434 Bacteria 1499
59 Ga0070714_100000083 3300005435 Bacteria 81010
60 Ga0070714_100047079 3300005435 Bacteria 3662
61 Ga0070714_100107438 3300005435 Bacteria 2466
62 Ga0070714_100121368 3300005435 Bacteria 2325
63 Ga0070713_100000135 3300005436 Bacteria 48487
64 Ga0070713_100067402 3300005436 Bacteria 3013
65 Ga0070710_10000008 3300005437 Bacteria 198148
66 Ga0070710_10047985 3300005437 Bacteria 2384
67 Ga0070710_10063380 3300005437 Bacteria 2112
68 Ga0070710_10100161 3300005437 Bacteria 1724
69 Ga0070710_10139697 3300005437 Bacteria 1484
70 Ga0070711_100001500 3300005439 Bacteria 12830
71 Ga0070711_100049540 3300005439 Bacteria 2877
72 Ga0070711_100064726 3300005439 Bacteria 2556
73 Ga0070705_100000405 3300005440 Bacteria 24782
74 Ga0070705_100082905 3300005440 Bacteria 1974
75 Ga0070700_100000678 3300005441 Bacteria 16857
76 Ga0070700_100151277 3300005441 Bacteria 1587
77 Ga0070700_100213281 3300005441 Bacteria 1364
78 Ga0070708_100003595 3300005445 Bacteria 12161
79 Ga0070708_100007488 3300005445 Bacteria 8741
80 Ga0070708_100160799 3300005445 Bacteria 2093
81 Ga0070708_100289725 3300005445 Bacteria 1541
82 Ga0070663_100002413 3300005455 Bacteria 10511
83 Ga0070678_100044344 3300005456 Bacteria 3175
84 Ga0070662_100000001 3300005457 Bacteria 317995
85 Ga0070662_100088608 3300005457 Bacteria 2320
86 Ga0070662_100216048 3300005457 Bacteria 1528
87 Ga0070681_10036102 3300005458 Bacteria 4965
88 Ga0070681_10216594 3300005458 Bacteria 1831
89 Ga0068867_100001975 3300005459 Bacteria 14301
90 Ga0070685_10000061 3300005466 Bacteria 63408
91 Ga0070685_10000965 3300005466 Bacteria 15453
92 Ga0070685_10186359 3300005466 Bacteria 1339
93 Ga0070685_10224276 3300005466 Bacteria 1233
94 Ga0070706_100001344 3300005467 Bacteria 26148
95 Ga0070706_100031968 3300005467 Bacteria 4853
96 Ga0070706_100039789 3300005467 Bacteria 4339
97 Ga0070706_100102473 3300005467 Bacteria 2661
98 Ga0070706_100190541 3300005467 Bacteria 1916
99 Ga0070707_100002020 3300005468 Bacteria 19431
100 Ga0070707_100006384 3300005468 Bacteria 10963
101 Ga0070707_100101383 3300005468 Bacteria 2790
102 Ga0070707_100414541 3300005468 Bacteria 1307
103 Ga0070698_100144492 3300005471 Bacteria 2329
104 Ga0070698_100181710 3300005471 Bacteria 2042
105 Ga0070698_100360467 3300005471 Bacteria 1385
106 Ga0070698_100394293 3300005471 Bacteria 1317
107 Ga0070679_100003154 3300005530 Bacteria 15061
108 Ga0070679_100027205 3300005530 Bacteria 5626
109 Ga0070679_100072615 3300005530 Bacteria 3433
110 Ga0070684_100012176 3300005535 Bacteria 6880
111 Ga0070684_100013351 3300005535 Bacteria 6619
112 Ga0070684_100033293 3300005535 Bacteria 4399
113 Ga0070684_100120058 3300005535 Bacteria 2364
114 Ga0068853_100087760 3300005539 Bacteria 2730
115 Ga0070672_100000005 3300005543 Bacteria 121014
116 Ga0070686_100028068 3300005544 Bacteria 3410
117 Ga0070695_100120813 3300005545 Bacteria 1792
118 Ga0070696_100018841 3300005546 Bacteria 4672
119 Ga0070696_100420076 3300005546 Bacteria 1050
120 Ga0070665_100000022 3300005548 Bacteria 379286
121 Ga0070665_100006490 3300005548 Bacteria 11899
122 Ga0070665_100114028 3300005548 Bacteria 2705
123 Ga0070664_100105826 3300005564 Bacteria 2450
124 Ga0068857_100050806 3300005577 Bacteria 3677
125 Ga0068857_100274506 3300005577 Bacteria 1550
126 Ga0068854_100244806 3300005578 Bacteria 1429
127 Ga0068856_100005996 3300005614 Bacteria 11963
128 Ga0068856_100013340 3300005614 Bacteria 7955
129 Ga0068856_100171649 3300005614 Bacteria 2181
130 Ga0070702_100004581 3300005615 Bacteria 6328
131 Ga0070702_100005981 3300005615 Bacteria 5725
132 Ga0068852_100000037 3300005616 Bacteria 97602
133 Ga0068852_100008426 3300005616 Bacteria 7601
134 Ga0068852_100009794 3300005616 Bacteria 7124
135 Ga0068859_100132898 3300005617 Bacteria 2560
136 Ga0068864_100000043 3300005618 Bacteria 162928
137 Ga0068864_100144773 3300005618 Bacteria 2147
138 Ga0068866_10000005 3300005718 Bacteria 196339
139 Ga0068866_10000645 3300005718 Bacteria 15809
140 Ga0068866_10100790 3300005718 Bacteria 1593
141 Ga0068861_100044604 3300005719 Bacteria 3335
142 Ga0068851_10000741 3300005834 Bacteria 13966
143 Ga0068851_10119137 3300005834 Bacteria 1417
144 Ga0068870_10243870 3300005840 Bacteria 1111
145 Ga0068863_100004891 3300005841 Bacteria 13205
146 Ga0068863_100022537 3300005841 Bacteria 6014
147 Ga0068858_100000046 3300005842 Bacteria 127519
148 Ga0068858_100001657 3300005842 Bacteria 22764
149 Ga0068860_100002786 3300005843 Bacteria 18180
150 Ga0068860_100270418 3300005843 Bacteria 1658
151 Ga0068862_100001558 3300005844 Bacteria 20944
152 Ga0068862_100320521 3300005844 Bacteria 1430
153 Ga0081455_10004481 3300005937 Bacteria 15630
154 Ga0081455_10005837 3300005937 Bacteria 13391
155 Ga0081455_10110825 3300005937 Bacteria 2181
156 Ga0081455_10167081 3300005937 Bacteria 1680
157 Ga0081538_10000042 3300005981 Bacteria 115656
158 Ga0081538_10000270 3300005981 Bacteria 59449
159 Ga0081538_10001012 3300005981 Bacteria 29986
160 Ga0081538_10009117 3300005981 Bacteria 8324
161 Ga0081538_10011162 3300005981 Bacteria 7298
162 Ga0081538_10023057 3300005981 Bacteria 4485
163 Ga0081538_10032355 3300005981 Bacteria 3506
164 Ga0081538_10080216 3300005981 Bacteria 1742
165 Ga0081540_1000697 3300005983 Bacteria 31315
166 Ga0081540_1000855 3300005983 Bacteria 27644
167 Ga0081540_1001971 3300005983 Bacteria 17127
168 Ga0081539_10002753 3300005985 Bacteria 23665
169 Ga0081539_10006174 3300005985 Bacteria 11656
170 Ga0081539_10014136 3300005985 Bacteria 5933
171 Ga0081539_10017623 3300005985 Bacteria 5002
172 Ga0070717_10000004 3300006028 Bacteria 365525
173 Ga0070717_10020450 3300006028 Bacteria 5206
174 Ga0070717_10023884 3300006028 Bacteria 4850
175 Ga0070717_10037727 3300006028 Bacteria 3925
176 Ga0075365_10011703 3300006038 Bacteria 5170
177 Ga0075365_10046083 3300006038 Bacteria 2862
178 Ga0075365_10239732 3300006038 Bacteria 1274
179 Ga0075364_10129562 3300006051 Bacteria 1692
180 Ga0075432_10007258 3300006058 Bacteria 3774
181 Ga0070715_10000008 3300006163 Bacteria 189899
182 Ga0070712_100000008 3300006175 Bacteria 149644
183 Ga0070712_100005477 3300006175 Bacteria 7860
184 Ga0070712_100011732 3300006175 Bacteria 5566
185 Ga0070712_100025870 3300006175 Bacteria 3905
186 Ga0070712_100049467 3300006175 Bacteria 2919
187 Ga0097621_100124621 3300006237 Bacteria 2187
188 Ga0075428_100087343 3300006844 Bacteria 3401
189 Ga0075428_100424023 3300006844 Bacteria 1425
190 Ga0075430_100000024 3300006846 Bacteria 80210
191 Ga0075430_100014081 3300006846 Bacteria 6818
192 Ga0075431_100010016 3300006847 Bacteria 9522
193 Ga0075431_100016543 3300006847 Bacteria 7486
194 Ga0075431_100025100 3300006847 Bacteria 6110
195 Ga0075431_100059786 3300006847 Bacteria 3932
196 Ga0075433_10063177 3300006852 Bacteria 3244
197 Ga0075434_100183102 3300006871 Bacteria 2116
198 Ga0075434_100201644 3300006871 Bacteria 2009
199 Ga0075429_100004701 3300006880 Bacteria 11750
200 Ga0075429_100396864 3300006880 Bacteria 1208
201 Ga0068865_100000089 3300006881 Bacteria 47955
202 Ga0068865_100140322 3300006881 Bacteria 1821
203 Ga0097620_100132897 3300006931 Bacteria 2560
204 Ga0075435_100171108 3300007076 Bacteria 1832
205 Ga0105251_10054195 3300009011 Bacteria 1905
206 Ga0105240_10046441 3300009093 Bacteria 5503
207 Ga0111539_10028001 3300009094 Bacteria 6882
208 Ga0111539_10082333 3300009094 Bacteria 3785
209 Ga0111539_10461760 3300009094 Bacteria 1479
210 Ga0105245_10000640 3300009098 Bacteria 31823
211 Ga0105245_10001641 3300009098 Bacteria 20352
212 Ga0105245_10002937 3300009098 Bacteria 15306
213 Ga0105245_10004571 3300009098 Bacteria 12221
214 Ga0105245_10006204 3300009098 Bacteria 10514
215 Ga0105245_10468362 3300009098 Bacteria 1271
216 Ga0105247_10000591 3300009101 Bacteria 29455
217 Ga0114129_10003125 3300009147 Bacteria 23224
218 Ga0114129_10028895 3300009147 Bacteria 7856
219 Ga0114129_10034389 3300009147 Bacteria 7158
220 Ga0114129_10317706 3300009147 Bacteria 2071
221 Ga0114129_10438886 3300009147 Bacteria 1714
222 Ga0105243_10028842 3300009148 Bacteria 4264
223 Ga0105241_10142534 3300009174 Bacteria 1953
224 Ga0105242_10000052 3300009176 Bacteria 79244
225 Ga0105242_10008495 3300009176 Bacteria 7886
226 Ga0105242_10048190 3300009176 Bacteria 3463
227 Ga0105242_10131466 3300009176 Bacteria 2161
228 Ga0105242_10137973 3300009176 Bacteria 2113
229 Ga0105242_10358114 3300009176 Bacteria 1350
230 Ga0105248_10000017 3300009177 Bacteria 298089
231 Ga0105237_10005947 3300009545 Bacteria 13681
232 Ga0105237_10082040 3300009545 Bacteria 3215
233 Ga0105237_10212784 3300009545 Bacteria 1933
234 Ga0105237_10373415 3300009545 Bacteria 1431
235 Ga0105238_10000016 3300009551 Bacteria 236218
236 Ga0105238_10034900 3300009551 Bacteria 5116
237 Ga0105238_10147044 3300009551 Bacteria 2333
238 Ga0105249_10000368 3300009553 Bacteria 44712
239 Ga0105249_10001411 3300009553 Bacteria 21021
240 Ga0105249_10043801 3300009553 Bacteria 4071
241 Ga0105249_10392144 3300009553 Bacteria 1417
242 Ga0105239_10032590 3300010375 Bacteria 5726
243 Ga0105239_10093611 3300010375 Unclassified 3318
244 Ga0105239_10195947 3300010375 Bacteria 2262
245 Ga0105239_10461707 3300010375 Bacteria 1441
246 Ga0157371_10007417 3300013102 Bacteria 8883
247 Ga0157371_10088324 3300013102 Bacteria 2195
248 Ga0157371_10123030 3300013102 Bacteria 1845
249 Ga0157370_10003060 3300013104 Bacteria 19837
250 Ga0157370_10019536 3300013104 Bacteria 6791
251 Ga0157370_10032916 3300013104 Bacteria 5057
252 Ga0157369_10000105 3300013105 Bacteria 117996
253 Ga0157369_10112813 3300013105 Bacteria 2888
254 Ga0157369_10389745 3300013105 Bacteria 1445
255 Ga0157369_10400458 3300013105 Bacteria 1424
256 Ga0157374_10000785 3300013296 Bacteria 27837
257 Ga0157374_10014025 3300013296 Bacteria 7005
258 Ga0157378_10016184 3300013297 Bacteria 6532
259 Ga0163162_10155764 3300013306 Bacteria 2404
260 Ga0157372_10001649 3300013307 Bacteria 24237
261 Ga0157372_10018844 3300013307 Bacteria 7426
262 Ga0157372_10032213 3300013307 Bacteria 5745
263 Ga0157372_10047612 3300013307 Bacteria 4764
264 Ga0157375_10000717 3300013308 Bacteria 29235
265 Ga0157375_10005849 3300013308 Bacteria 10704
266 Ga0157375_10119655 3300013308 Bacteria 2741
267 Ga0157375_10307641 3300013308 Bacteria 1749
268 Ga0157380_10001737 3300014326 Bacteria 14372
269 Ga0157380_10269558 3300014326 Bacteria 1551
270 Ga0182008_10129764 3300014497 Bacteria 1256
271 Ga0157377_10003359 3300014745 Bacteria 7237
272 Ga0157377_10034398 3300014745 Bacteria 2773
273 Ga0157379_10005656 3300014968 Bacteria 10742
274 Ga0157379_10089872 3300014968 Bacteria 2755
275 Ga0157376_10006598 3300014969 Bacteria 8211
276 Ga0157376_10020347 3300014969 Bacteria 5132
277 Ga0163161_10000064 3300017792 Bacteria 108508
278 Ga0163161_10077888 3300017792 Bacteria 2436
279 Ga0197907_10465245 3300020069 Bacteria 3085
280 Ga0206356_10907411 3300020070 Bacteria 1179
281 Ga0206356_11750464 3300020070 Bacteria 2205
282 Ga0206349_1015741 3300020075 Bacteria 2758
283 Ga0206349_1625417 3300020075 Bacteria 4510
284 Ga0206355_1314388 3300020076 Bacteria 1502
285 Ga0206351_10180526 3300020077 Bacteria 3156
286 Ga0206351_10380651 3300020077 Bacteria 2856
287 Ga0206352_10040496 3300020078 Bacteria 6329
288 Ga0206352_10184859 3300020078 Bacteria 1577
289 Ga0206352_10364769 3300020078 Bacteria 1488
290 Ga0206350_10243056 3300020080 Bacteria 3121
291 Ga0206350_10534078 3300020080 Bacteria 3118
292 Ga0206350_10636958 3300020080 Bacteria 3250
293 Ga0206350_11049551 3300020080 Bacteria 3149
294 Ga0206354_10367263 3300020081 Bacteria 2549
295 Ga0206354_11250835 3300020081 Bacteria 1071
296 Ga0154015_1384123 3300020610 Bacteria 3712
297 Ga0154015_1473514 3300020610 Bacteria 1256
298 Ga0213873_10022808 3300021358 Bacteria 1486
299 Ga0213874_10000172 3300021377 Bacteria 11562
300 Ga0213874_10005393 3300021377 Bacteria 2977
301 Ga0213874_10014761 3300021377 Bacteria 2048
302 Ga0213876_10012939 3300021384 Bacteria 4436
303 Ga0213876_10016479 3300021384 Bacteria 3906
304 Ga0213876_10016638 3300021384 Bacteria 3886
305 Ga0213876_10049870 3300021384 Bacteria 2212
306 Ga0213876_10156666 3300021384 Bacteria 1211
307 Ga0213875_10000050 3300021388 Bacteria 143822
308 Ga0213875_10009480 3300021388 Bacteria 4931
309 Ga0213875_10043490 3300021388 Bacteria 2109
310 Ga0224712_10007833 3300022467 Bacteria 3130
311 Ga0224712_10009427 3300022467 Bacteria 2941
312 Ga0224712_10013711 3300022467 Bacteria 2589
313 Ga0224712_10061581 3300022467 Bacteria 1497
314 Ga0207426_1012827 3300025302 Bacteria 3132
315 Ga0207656_10001891 3300025321 Bacteria 6967
316 Ga0207713_1068109 3300025735 Bacteria 1324
317 Ga0207682_10000041 3300025893 Bacteria 52338
318 Ga0207692_10000006 3300025898 Bacteria 294686
319 Ga0207692_10071283 3300025898 Bacteria 1832
320 Ga0207642_10000005 3300025899 Bacteria 401934
321 Ga0207642_10015523 3300025899 Bacteria 2841
322 Ga0207710_10000684 3300025900 Bacteria 19039
323 Ga0207688_10002310 3300025901 Bacteria 10252
324 Ga0207688_10130382 3300025901 Bacteria 1474
325 Ga0207680_10002263 3300025903 Bacteria 8980
326 Ga0207685_10000012 3300025905 Bacteria 189900
327 Ga0207699_10063405 3300025906 Bacteria 2232
328 Ga0207684_10001406 3300025910 Bacteria 26157
329 Ga0207684_10026594 3300025910 Bacteria 4933
330 Ga0207684_10085754 3300025910 Bacteria 2682
331 Ga0207684_10160049 3300025910 Bacteria 1939
332 Ga0207654_10076779 3300025911 Bacteria 2000
333 Ga0207707_10006269 3300025912 Bacteria 10385
334 Ga0207695_10014458 3300025913 Bacteria 9348
335 Ga0207671_10004620 3300025914 Bacteria 13058
336 Ga0207671_10149884 3300025914 Bacteria 1802
337 Ga0207693_10000002 3300025915 Bacteria 304011
338 Ga0207693_10001233 3300025915 Bacteria 22785
339 Ga0207663_10001162 3300025916 Bacteria 12157
340 Ga0207663_10033866 3300025916 Bacteria 3048
341 Ga0207662_10041964 3300025918 Bacteria 2695
342 Ga0207657_10047518 3300025919 Bacteria 3752
343 Ga0207649_10000015 3300025920 Bacteria 245662
344 Ga0207649_10029420 3300025920 Bacteria 3244
345 Ga0207649_10276310 3300025920 Bacteria 1220
346 Ga0207649_10282229 3300025920 Bacteria 1208
347 Ga0207652_10006391 3300025921 Bacteria 9514
348 Ga0207652_10024377 3300025921 Bacteria 5019
349 Ga0207646_10015375 3300025922 Bacteria 7230
350 Ga0207646_10353964 3300025922 Bacteria 1327
351 Ga0207681_10006067 3300025923 Bacteria 7410
352 Ga0207681_10211717 3300025923 Bacteria 1494
353 Ga0207694_10000012 3300025924 Bacteria 411218
354 Ga0207659_10000147 3300025926 Bacteria 41347
355 Ga0207659_10303840 3300025926 Bacteria 1311
356 Ga0207687_10000040 3300025927 Bacteria 113598
357 Ga0207687_10000331 3300025927 Bacteria 31810
358 Ga0207687_10001806 3300025927 Bacteria 14723
359 Ga0207687_10053372 3300025927 Bacteria 2824
360 Ga0207700_10000003 3300025928 Bacteria 500797
361 Ga0207700_10062318 3300025928 Bacteria 2832
362 Ga0207700_10110794 3300025928 Bacteria 2208
363 Ga0207700_10377207 3300025928 Bacteria 1239
364 Ga0207664_10000006 3300025929 Bacteria 408702
365 Ga0207664_10014457 3300025929 Bacteria 5700
366 Ga0207664_10051077 3300025929 Bacteria 3263
367 Ga0207664_10089505 3300025929 Bacteria 2520
368 Ga0207664_10214760 3300025929 Bacteria 1666
369 Ga0207664_10386359 3300025929 Bacteria 1243
370 Ga0207664_10418384 3300025929 Bacteria 1193
371 Ga0207644_10372351 3300025931 Bacteria 1164
372 Ga0207690_10000017 3300025932 Bacteria 243513
373 Ga0207690_10004100 3300025932 Bacteria 8604
374 Ga0207690_10005455 3300025932 Bacteria 7497
375 Ga0207706_10000003 3300025933 Bacteria 345011
376 Ga0207706_10029063 3300025933 Bacteria 4937
377 Ga0207686_10000119 3300025934 Bacteria 64297
378 Ga0207686_10003997 3300025934 Bacteria 7914
379 Ga0207686_10024972 3300025934 Bacteria 3470
380 Ga0207686_10068904 3300025934 Bacteria 2268
381 Ga0207709_10001985 3300025935 Bacteria 13342
382 Ga0207669_10000029 3300025937 Bacteria 88351
383 Ga0207669_10000140 3300025937 Bacteria 34667
384 Ga0207704_10000018 3300025938 Bacteria 153994
385 Ga0207665_10219133 3300025939 Bacteria 1394
386 Ga0207691_10000028 3300025940 Bacteria 121090
387 Ga0207691_10194693 3300025940 Bacteria 1767
388 Ga0207711_10000011 3300025941 Bacteria 518817
389 Ga0207711_10049898 3300025941 Bacteria 3583
390 Ga0207689_10134061 3300025942 Bacteria 2039
391 Ga0207661_10000714 3300025944 Bacteria 21578
392 Ga0207661_10003496 3300025944 Bacteria 10911
393 Ga0207661_10005294 3300025944 Bacteria 9083
394 Ga0207661_10014089 3300025944 Bacteria 5850
395 Ga0207661_10015312 3300025944 Bacteria 5641
396 Ga0207661_10022934 3300025944 Bacteria 4709
397 Ga0207661_10220727 3300025944 Bacteria 1675
398 Ga0207661_10486988 3300025944 Bacteria 1126
399 Ga0207679_10202261 3300025945 Bacteria 1660
400 Ga0207679_10360355 3300025945 Bacteria 1270
401 Ga0207667_10216613 3300025949 Bacteria 1962
402 Ga0207651_10002542 3300025960 Bacteria 8713
403 Ga0207712_10000027 3300025961 Bacteria 263739
404 Ga0207712_10002082 3300025961 Bacteria 13106
405 Ga0207712_10085544 3300025961 Bacteria 2308
406 Ga0207712_10118328 3300025961 Bacteria 2000
407 Ga0207668_10019215 3300025972 Bacteria 4314
408 Ga0207640_10000205 3300025981 Bacteria 41887
409 Ga0207658_10000465 3300025986 Bacteria 37863
410 Ga0207677_10009593 3300026023 Bacteria 5448
411 Ga0207703_10000020 3300026035 Bacteria 251603
412 Ga0207703_10116317 3300026035 Bacteria 2289
413 Ga0207639_10073801 3300026041 Bacteria 2676
414 Ga0207678_10009775 3300026067 Bacteria 8435
415 Ga0207678_10033110 3300026067 Bacteria 4504
416 Ga0207678_10101339 3300026067 Bacteria 2459
417 Ga0207678_10234604 3300026067 Bacteria 1571
418 Ga0207708_10004102 3300026075 Bacteria 10718
419 Ga0207708_10009551 3300026075 Bacteria 7191
420 Ga0207708_10022857 3300026075 Bacteria 4722
421 Ga0207708_10061545 3300026075 Bacteria 2866
422 Ga0207708_10079636 3300026075 Bacteria 2517
423 Ga0207702_10000690 3300026078 Bacteria 36486
424 Ga0207702_10003502 3300026078 Bacteria 14309
425 Ga0207702_10022825 3300026078 Bacteria 5191
426 Ga0207702_10293814 3300026078 Bacteria 1540
427 Ga0207702_10296520 3300026078 Bacteria 1533
428 Ga0207641_10001193 3300026088 Bacteria 26064
429 Ga0207641_10002149 3300026088 Bacteria 18577
430 Ga0207648_10008953 3300026089 Bacteria 9628
431 Ga0207648_10307674 3300026089 Bacteria 1422
432 Ga0207676_10000042 3300026095 Bacteria 163475
433 Ga0207674_10037485 3300026116 Bacteria 5042
434 Ga0207674_10173692 3300026116 Bacteria 2108
435 Ga0207674_10286741 3300026116 Bacteria 1595
436 Ga0207674_10289820 3300026116 Bacteria 1586
437 Ga0207675_100014737 3300026118 Bacteria 7292
438 Ga0207675_100159493 3300026118 Bacteria 2151
439 Ga0207675_100217962 3300026118 Bacteria 1838
440 Ga0207683_10003514 3300026121 Bacteria 13672
441 Ga0207683_10191798 3300026121 Bacteria 1856
442 Ga0207683_10335749 3300026121 Bacteria 1385
443 Ga0207698_10000015 3300026142 Bacteria 207368
444 Ga0207698_10018608 3300026142 Bacteria 4739
445 Ga0207698_10039926 3300026142 Bacteria 3481
446 Ga0207428_10007595 3300027907 Bacteria 9884
447 Ga0207428_10045873 3300027907 Bacteria 3517
448 Ga0207428_10080156 3300027907 Bacteria 2551
449 Ga0268266_10000029 3300028379 Bacteria 424015
450 Ga0268265_10001048 3300028380 Bacteria 24851
451 Ga0268264_10000725 3300028381 Bacteria 37821
452 Ga0268264_10042318 3300028381 Bacteria 3771
453 Ga0268264_10217309 3300028381 Bacteria 1758
454 Ga0268264_10382828 3300028381 Bacteria 1348
455 Ga0265337_1000061 3300028556 Bacteria 49480
456 Ga0265337_1001815 3300028556 Bacteria 10247
457 Ga0265326_10000016 3300028558 Bacteria 154674
458 Ga0265326_10000067 3300028558 Bacteria 59507
459 Ga0265326_10001279 3300028558 Bacteria 8925
460 Ga0265319_1000010 3300028563 Bacteria 188773
461 Ga0265319_1000796 3300028563 Bacteria 20409
462 Ga0265319_1000847 3300028563 Bacteria 19536
463 Ga0265319_1011920 3300028563 Bacteria 3535
464 Ga0265334_10000003 3300028573 Bacteria 244354
465 Ga0265318_10000961 3300028577 Bacteria 18489
466 Ga0265318_10011281 3300028577 Bacteria 3853
467 Ga0265322_10000005 3300028654 Bacteria 246112
468 Ga0265336_10000060 3300028666 Bacteria 103055
469 Ga0265338_10000051 3300028800 Bacteria 211202
470 Ga0265338_10000234 3300028800 Bacteria 103028
471 Ga0265338_10005421 3300028800 Bacteria 16659
472 Ga0265338_10019449 3300028800 Bacteria 7204
473 Ga0265338_10029749 3300028800 Bacteria 5405
474 Ga0265324_10000510 3300029957 Bacteria 26678
475 Ga0265324_10007611 3300029957 Bacteria 4372
476 Ga0307511_10073950 3300030521 Bacteria 2460
477 Ga0265332_10023029 3300031238 Bacteria 2747
478 Ga0265328_10000563 3300031239 Bacteria 17200
479 Ga0265320_10000010 3300031240 Bacteria 250501
480 Ga0265320_10001744 3300031240 Bacteria 15420
481 Ga0265325_10006156 3300031241 Bacteria 7321
482 Ga0265340_10000014 3300031247 Bacteria 103055
483 Ga0265340_10033183 3300031247 Bacteria 2572
484 Ga0265331_10003612 3300031250 Bacteria 9895
485 Ga0265327_10000040 3300031251 Bacteria 291052
486 Ga0265327_10007890 3300031251 Bacteria 8068
487 Ga0265327_10014680 3300031251 Bacteria 5110
488 Ga0265327_10053485 3300031251 Bacteria 2095
489 Ga0265316_10301836 3300031344 Bacteria 1166
490 Ga0265314_10000208 3300031711 Bacteria 86855
491 Ga0265314_10022037 3300031711 Bacteria 4885
492 Ga0265314_10063741 3300031711 Bacteria 2499
493 Ga0307410_10023485 3300031852 Bacteria 3834
494 Ga0307410_10052995 3300031852 Bacteria 2743
495 Ga0307406_10047459 3300031901 Bacteria 2707
496 Ga0307406_10051417 3300031901 Bacteria 2616
497 Ga0307406_10127295 3300031901 Bacteria 1782
498 Ga0307406_10235095 3300031901 Bacteria 1371
499 Ga0307407_10089927 3300031903 Bacteria 1879
500 Ga0307409_100029080 3300031995 Bacteria 3949
501 Ga0307409_100029492 3300031995 Bacteria 3928
502 Ga0307409_100040412 3300031995 Bacteria 3472
503 Ga0307409_100092559 3300031995 Bacteria 2481
504 Ga0307409_100675596 3300031995 Bacteria 1029
505 Ga0307416_100025273 3300032002 Bacteria 4351
506 Ga0307416_100080230 3300032002 Bacteria 2753
507 Ga0307416_100102352 3300032002 Bacteria 2497
508 Ga0307416_100105250 3300032002 Bacteria 2469
509 Ga0307416_100141268 3300032002 Bacteria 2189
510 Ga0307416_100314133 3300032002 Bacteria 1565
511 Ga0307411_10028712 3300032005 Bacteria 3387
512 Ga0307415_100001546 3300032126 Bacteria 11063
513 Ga0307415_100005858 3300032126 Bacteria 6571
514 Ga0307415_100369356 3300032126 Bacteria 1214
515 Ga0373956_0005446 3300035119 Bacteria 5097
516 Ga0373955_0048898 3300035172 Bacteria 2295
517 Ga0373955_0133634 3300035172 Bacteria 1450
518 Ga0373961_0030544 3300035241 Bacteria 1500
519 Ga0373931_0025368 3300035691 Bacteria 3011
520 Ga0373927_0000006 3300035695 Bacteria 208965
521 Ga0373933_0006691 3300035724 Bacteria 6282
522 Ga0373933_0126249 3300035724 Bacteria 1605
523 Ga0373937_0001667 3300036401 Bacteria 18672
524 Ga0373937_0004436 3300036401 Bacteria 11927
525 Ga0373937_0190830 3300036401 Bacteria 1925
526 Ga0373937_0508124 3300036401 Bacteria 1145
527 Ga0310109_000315 3300036534 Bacteria 3470
528 Ga0373925_0503467 3300037068 Bacteria 994
529 Ga0395900_0008276 3300037418 Bacteria 10704
530 Ga0395900_0058250 3300037418 Bacteria 3977
531 Ga0395900_0268389 3300037418 Bacteria 1702
532 Ga0395898_0002400 3300037466 Bacteria 22246
533 Ga0395898_0049471 3300037466 Bacteria 4119
534 Ga0395898_0151434 3300037466 Bacteria 2219
535 Ga0395898_0289935 3300037466 Bacteria 1561
536 Ga0395898_0415425 3300037466 Bacteria 1282
537 Ga0395905_0259976 3300037471 Bacteria 1621
538 Ga0436364_0038128 3300037853 Bacteria 45811
539 Ga0436364_0216710 3300037853 Bacteria 4235
540 Ga0436364_0363596 3300037853 Bacteria 7972
541 Ga0436364_0378806 3300037853 Bacteria 3607
542 Ga0436364_0532382 3300037853 Bacteria 57757
543 Ga0436364_0645424 3300037853 Bacteria 11429
544 Ga0436364_0857403 3300037853 Bacteria 6641
545 Ga0436364_1002783 3300037853 Bacteria 2931
546 Ga0436364_1290040 3300037853 Bacteria 5926
547 Ga0436364_1552666 3300037853 Bacteria 1307
548 Ga0395901_0444783 3300038443 Bacteria 1326
549 Ga0436365_0235777 3300039437 Bacteria 8316
550 Ga0436365_0561226 3300039437 Bacteria 1172
551 Ga0436365_0656722 3300039437 Bacteria 22448
552 Ga0436365_0725610 3300039437 Bacteria 1879
553 Ga0436365_0730546 3300039437 Bacteria 16641
554 Ga0436365_1012617 3300039437 Bacteria 1151
555 Ga0436365_1022230 3300039437 Bacteria 2571
556 Ga0436365_1104539 3300039437 Bacteria 8346
557 Ga0436365_1199460 3300039437 Bacteria 4663
558 Ga0436365_1704131 3300039437 Bacteria 7402
559 Ga0436363_0116001 3300039450 Bacteria 48959
560 Ga0436363_0150822 3300039450 Bacteria 5226
561 Ga0436363_1208092 3300039450 Bacteria 1972
562 Ga0436363_1218786 3300039450 Bacteria 1322
563 Ga0436363_1432146 3300039450 Bacteria 7039
564 Ga0436363_1478257 3300039450 Bacteria 1557
565 Ga0436363_1499638 3300039450 Bacteria 11397
566 Ga0436363_1670627 3300039450 Bacteria 2560
567 Ga0436362_0046940 3300039453 Bacteria 1348
568 Ga0436362_0563621 3300039453 Bacteria 1095
569 Ga0436362_0681159 3300039453 Bacteria 1682
570 Ga0436362_0885374 3300039453 Bacteria 1695
571 Ga0436362_0920455 3300039453 Bacteria 3240
572 Ga0436362_0949373 3300039453 Bacteria 3289
573 Ga0451853_2799129 3300041512 Bacteria 1416
574 Ga0451577_0066833 3300042876 Bacteria 3206
575 Ga0466972_0061114 3300044658 Unclassified 1807
576 Ga0466972_0128973 3300044658 Unclassified 1191
577 Ga0453683_0032610 3300044673 Bacteria 3286
578 Ga0466965_0046560 3300044683 Bacteria 2147
579 Ga0466966_0044537 3300044684 Bacteria 2840
580 Ga0466966_0054784 3300044684 Bacteria 2526
581 Ga0466961_0003908 3300044693 Bacteria 9318
582 Ga0466961_0004518 3300044693 Bacteria 8725
583 Ga0466961_0019145 3300044693 Bacteria 4405
584 Ga0466961_0029816 3300044693 Unclassified 3505
585 Ga0466961_0050408 3300044693 Bacteria 2659
586 Ga0466963_0000415 3300044694 Bacteria 19583
587 Ga0466963_0002882 3300044694 Bacteria 9719
588 Ga0466963_0016311 3300044694 Bacteria 4617
589 Ga0466963_0019699 3300044694 Bacteria 4236
590 Ga0466963_0020516 3300044694 Bacteria 4156
591 Ga0466963_0021672 3300044694 Bacteria 4057
592 Ga0466963_0025064 3300044694 Bacteria 3801
593 Ga0466963_0037627 3300044694 Bacteria 3161
594 Ga0466963_0047724 3300044694 Bacteria 2827
595 Ga0466963_0060675 3300044694 Bacteria 2526
596 Ga0466963_0097585 3300044694 Bacteria 2008
597 Ga0466963_0125338 3300044694 Bacteria 1770
598 Ga0466963_0177733 3300044694 Bacteria 1485
599 Ga0466964_0016934 3300044706 Bacteria 2787
600 Ga0466964_0026274 3300044706 Bacteria 2279
601 Ga0466971_0036989 3300044719 Bacteria 2189
602 Ga0466971_0052608 3300044719 Bacteria 1834
603 Ga0466971_0118538 3300044719 Bacteria 1224
604 Ga0466971_0162134 3300044719 Bacteria 1047
605 Ga0466968_0019494 3300044735 Bacteria 2730
606 Ga0466968_0019833 3300044735 Bacteria 2710
607 Ga0466968_0036147 3300044735 Bacteria 2069
608 Ga0466970_0035604 3300044765 Bacteria 2637
609 Ga0466957_0001280 3300044842 Bacteria 13105
610 Ga0466957_0065408 3300044842 Bacteria 2239
611 Ga0466957_0069438 3300044842 Bacteria 2176
612 Ga0466957_0141908 3300044842 Bacteria 1548
613 Ga0466957_0205088 3300044842 Bacteria 1296
614 Ga0466957_0219195 3300044842 Bacteria 1256
615 Ga0466960_0000004 3300044901 Bacteria 84724
616 Ga0466960_0009744 3300044901 Bacteria 3973
617 Ga0466960_0037582 3300044901 Bacteria 2272
618 Ga0466960_0081124 3300044901 Bacteria 1635
619 Ga0466959_0002714 3300045049 Bacteria 11374
620 Ga0466959_0013190 3300045049 Bacteria 5987
621 Ga0466959_0020682 3300045049 Bacteria 4849
622 Ga0466959_0049699 3300045049 Bacteria 3081
623 Ga0466959_0066409 3300045049 Bacteria 2617
624 Ga0466959_0081306 3300045049 Bacteria 2335
625 Ga0466959_0148771 3300045049 Bacteria 1652
626 Ga0466959_0177297 3300045049 Bacteria 1492
627 Ga0466958_0000711 3300045836 Bacteria 14535
628 Ga0466958_0009077 3300045836 Bacteria 5525
629 Ga0466958_0013426 3300045836 Bacteria 4664
630 Ga0466958_0014181 3300045836 Bacteria 4549
631 Ga0466958_0015229 3300045836 Bacteria 4403
632 Ga0466958_0029928 3300045836 Bacteria 3230
633 Ga0466958_0038088 3300045836 Bacteria 2884
634 Ga0466958_0045373 3300045836 Bacteria 2650
635 Ga0466958_0097444 3300045836 Bacteria 1825
636 Ga0466958_0108348 3300045836 Bacteria 1733
637 Ga0466958_0126504 3300045836 Bacteria 1603
638 Ga0466958_0156801 3300045836 Bacteria 1437
639 Ga0466958_0158307 3300045836 Bacteria 1430
640 Ga0466967_0010925 3300045976 Bacteria 6843
641 Ga0466967_0041265 3300045976 Bacteria 3977
642 Ga0466967_0061214 3300045976 Bacteria 3339
643 Ga0466967_0074790 3300045976 Bacteria 3043
644 Ga0466967_0126554 3300045976 Bacteria 2367
645 Ga0466967_0128157 3300045976 Bacteria 2353
646 Ga0466967_0159296 3300045976 Bacteria 2117
647 Ga0466967_0168574 3300045976 Bacteria 2059
648 Ga0466967_0196676 3300045976 Bacteria 1908
649 Ga0466967_0380437 3300045976 Bacteria 1370
650 Ga0466967_0427957 3300045976 Bacteria 1291
651 Ga0466967_0513348 3300045976 Bacteria 1177
652 Ga0495592_0000176 3300046454 Bacteria 56403
653 Ga0495603_0000194 3300046455 Bacteria 31819
654 Ga0495603_0008081 3300046455 Bacteria 6357
655 Ga0495590_0077347 3300046457 Bacteria 1171
656 Ga0495629_0000806 3300046459 Bacteria 25376
657 Ga0495629_0003436 3300046459 Bacteria 11976
658 Ga0495629_0012055 3300046459 Bacteria 6266
659 Ga0495629_0041278 3300046459 Bacteria 3247
660 Ga0495629_0070965 3300046459 Bacteria 2431
661 Ga0495638_0087005 3300046460 Bacteria 1888
662 Ga0495641_0000004 3300046461 Bacteria 210501
663 Ga0495651_0002656 3300046462 Bacteria 13866
664 Ga0495651_0037463 3300046462 Bacteria 3775
665 Ga0495651_0184032 3300046462 Bacteria 1476
666 Ga0495653_0000231 3300046463 Bacteria 45492
667 Ga0495653_0007743 3300046463 Bacteria 8791
668 Ga0495653_0052740 3300046463 Bacteria 3116
669 Ga0495650_0000035 3300046471 Bacteria 403799
670 Ga0495582_0000002 3300046473 Bacteria 219909
671 Ga0495662_0000051 3300046476 Bacteria 40340
672 Ga0495662_0005718 3300046476 Bacteria 6217
673 Ga0495664_0000086 3300046477 Bacteria 45525
674 Ga0495584_0125085 3300046491 Bacteria 1303
675 Ga0495594_0000012 3300046499 Bacteria 105133
676 Ga0495596_0024370 3300046500 Bacteria 2450
677 Ga0495606_0000895 3300046507 Bacteria 44393
678 Ga0495608_0000013 3300046511 Bacteria 228481
679 Ga0495608_0000092 3300046511 Bacteria 64795
680 Ga0495618_0000054 3300046514 Bacteria 83787
681 Ga0495618_0000094 3300046514 Bacteria 64293
682 Ga0495618_0022690 3300046514 Bacteria 3877
683 Ga0495620_0032803 3300046515 Bacteria 2363
684 Ga0495620_0084845 3300046515 Bacteria 1277
685 Ga0495628_0002492 3300046516 Bacteria 16576
686 Ga0495628_0120326 3300046516 Bacteria 2015
687 Ga0495630_0000032 3300046517 Bacteria 134425
688 Ga0495630_0000328 3300046517 Bacteria 37847
689 Ga0495630_0001088 3300046517 Bacteria 18687
690 Ga0495630_0005122 3300046517 Bacteria 9222
691 Ga0495630_0054464 3300046517 Bacteria 2997
692 Ga0495630_0339366 3300046517 Bacteria 1149
693 Ga0495637_0112337 3300046520 Bacteria 1055
694 Ga0495644_0002998 3300046523 Bacteria 6691
695 Ga0495652_0000018 3300046529 Bacteria 201634
696 Ga0495652_0001501 3300046529 Bacteria 25686
697 Ga0495640_0006754 3300046533 Bacteria 9054
698 Ga0495640_0016804 3300046533 Bacteria 5470
699 Ga0495586_0001742 3300046535 Bacteria 11874
700 Ga0495587_0028299 3300046536 Bacteria 3408
701 Ga0495587_0075141 3300046536 Bacteria 1962
702 Ga0495621_0001476 3300046539 Bacteria 6101
703 Ga0495645_0000088 3300046543 Bacteria 63785
704 Ga0495645_0000535 3300046543 Bacteria 26139
705 Ga0495645_0055112 3300046543 Bacteria 2887
706 Ga0495622_0000353 3300046557 Bacteria 32367
707 Ga0495667_0000265 3300046559 Bacteria 34047
708 Ga0495667_0000725 3300046559 Bacteria 21166
709 Ga0495667_0055519 3300046559 Bacteria 2605
710 Ga0495656_0001416 3300046615 Bacteria 7842
711 Ga0495668_0160379 3300046616 Bacteria 1232
712 Ga0495634_0000002 3300046642 Bacteria 247842
713 Ga0495634_0000191 3300046642 Bacteria 56356
714 Ga0495634_0016540 3300046642 Bacteria 5273
715 Ga0495634_0165686 3300046642 Bacteria 1391
716 Ga0495625_0000243 3300046660 Bacteria 85589
717 Ga0495635_0000182 3300046663 Bacteria 39469
718 Ga0495635_0000709 3300046663 Bacteria 21497
719 Ga0495635_0097359 3300046663 Bacteria 2011
720 Ga0495588_0000266 3300046674 Bacteria 40474
721 Ga0495657_0000003 3300046675 Bacteria 279680
722 Ga0495657_0000006 3300046675 Bacteria 250610
723 Ga0495599_0132729 3300046678 Bacteria 1546
724 Ga0495599_0174331 3300046678 Bacteria 1327
725 Ga0495646_0066231 3300046680 Bacteria 2137
726 Ga0495647_0000005 3300046681 Bacteria 125996
727 Ga0495647_0001427 3300046681 Bacteria 7390
728 Ga0495647_0011078 3300046681 Bacteria 3082
729 Ga0495658_0000001 3300046683 Bacteria 385362
730 Ga0495658_0112517 3300046683 Bacteria 1638
731 Ga0495669_0000188 3300046684 Bacteria 38417
732 Ga0495669_0013142 3300046684 Bacteria 3526
733 Ga0495613_0000173 3300046689 Bacteria 62463
734 Ga0495613_0000233 3300046689 Bacteria 53074
735 Ga0495624_0000563 3300046690 Bacteria 29131
736 Ga0495624_0000600 3300046690 Bacteria 28092
737 Ga0495600_0002279 3300046809 Bacteria 10937
738 Ga0495600_0004809 3300046809 Bacteria 8108
739 Ga0495600_0007184 3300046809 Bacteria 6801
740 Ga0495600_0015795 3300046809 Bacteria 4780
741 Ga0495600_0105089 3300046809 Bacteria 1840
742 Ga0495600_0168896 3300046809 Bacteria 1412
743 Ga0495604_0000437 3300047317 Bacteria 37081
744 Ga0495604_0000509 3300047317 Bacteria 34149
745 Ga0495604_0101081 3300047317 Bacteria 2118
746 Ga0495636_0127956 3300047318 Bacteria 1128
747 Ga0495674_0000039 3300047319 Bacteria 97645
748 Ga0495674_0014499 3300047319 Bacteria 7375
749 Ga0495674_0194058 3300047319 Bacteria 1687
750 Ga0495676_0000320 3300047321 Bacteria 38969
751 Ga0495676_0009275 3300047321 Bacteria 8964
752 Ga0495676_0038900 3300047321 Bacteria 3946
753 Ga0495676_0250948 3300047321 Bacteria 1207
754 Ga0495680_0000113 3300047322 Bacteria 76525
755 Ga0495680_0000513 3300047322 Bacteria 43869
756 Ga0495680_0001447 3300047322 Bacteria 25583
757 Ga0495680_0005366 3300047322 Bacteria 12092
758 Ga0495680_0074534 3300047322 Bacteria 2577
759 Ga0495675_0000002 3300047444 Bacteria 216469
760 Ga0495675_0176154 3300047444 Bacteria 1311
761 Ga0495679_015058 3300047446 Bacteria 2840
762 Ga0495684_0002596 3300047471 Bacteria 14354
763 Ga0495684_0041166 3300047471 Bacteria 3541
764 Ga0495686_0085784 3300047472 Bacteria 1917
765 Ga0495602_0000034 3300048088 Bacteria 140722
766 Ga0495602_0000315 3300048088 Bacteria 44563
767 Ga0495602_0011907 3300048088 Bacteria 8971
768 Ga0495602_0080789 3300048088 Bacteria 2737
769 Ga0495614_0078482 3300048089 Bacteria 1429
770 Ga0496100_0000001 3300048903 Bacteria 530179
771 Ga0496100_0000136 3300048903 Bacteria 40939
772 Ga0496100_0000234 3300048903 Bacteria 29327
773 Ga0496100_0008447 3300048903 Bacteria 5742
774 Ga0496101_0000028 3300048904 Bacteria 198664
775 Ga0496101_0000382 3300048904 Bacteria 29327
776 Ga0496101_0005625 3300048904 Bacteria 7992
777 Ga0496102_0000096 3300048905 Bacteria 124941
778 Ga0496102_0000129 3300048905 Bacteria 104478
779 Ga0496102_0047357 3300048905 Bacteria 3906
780 Ga0496103_0000035 3300048906 Bacteria 182242
781 Ga0496103_0000087 3300048906 Bacteria 104566
782 Ga0496103_0005940 3300048906 Bacteria 7298
783 Ga0496103_0027889 3300048906 Bacteria 3425
784 Ga0496104_0000008 3300048907 Bacteria 516976
785 Ga0496104_0000010 3300048907 Bacteria 475255
786 Ga0496104_0000028 3300048907 Bacteria 203377
787 Ga0496104_0013374 3300048907 Bacteria 7395
788 Ga0496104_0043010 3300048907 Bacteria 4241
789 Ga0496104_0059462 3300048907 Bacteria 3618
790 Ga0496105_0000003 3300048908 Bacteria 713251
791 Ga0496105_0000005 3300048908 Bacteria 475797
792 Ga0496105_0000051 3300048908 Bacteria 90365
793 Ga0496105_0010992 3300048908 Bacteria 7133
794 Ga0496105_0016037 3300048908 Bacteria 5976
795 Ga0496105_0066139 3300048908 Bacteria 2984
796 Ga0496105_0081709 3300048908 Bacteria 2669
797 Ga0496105_0157387 3300048908 Bacteria 1865
798 Ga0496106_0000134 3300048909 Bacteria 55531
799 Ga0496106_0000172 3300048909 Bacteria 47232
800 Ga0496106_0000455 3300048909 Bacteria 29281
801 Ga0496106_0004709 3300048909 Bacteria 10107
802 Ga0496106_0021569 3300048909 Bacteria 4783
803 Ga0496107_0000002 3300048910 Bacteria 320871
804 Ga0496107_0000234 3300048910 Bacteria 29310
805 Ga0496108_0000004 3300048911 Bacteria 545055
806 Ga0496108_0000005 3300048911 Bacteria 535059
807 Ga0496108_0000721 3300048911 Bacteria 25679
808 Ga0496108_0005715 3300048911 Bacteria 10069
809 Ga0496108_0006524 3300048911 Bacteria 9461
810 Ga0496108_0016000 3300048911 Bacteria 6115
811 Ga0496108_0091865 3300048911 Bacteria 2580
812 Ga0496108_0197922 3300048911 Bacteria 1743
813 Ga0496108_0207400 3300048911 Bacteria 1701
814 Ga0496108_0216683 3300048911 Bacteria 1662
815 Ga0496108_0502181 3300048911 Bacteria 1059
816 Ga0496109_0000002 3300048912 Bacteria 443393
817 Ga0496109_0000011 3300048912 Bacteria 234908
818 Ga0496109_0000013 3300048912 Bacteria 227469
819 Ga0496109_0000389 3300048912 Bacteria 39934
820 Ga0496109_0001749 3300048912 Bacteria 18103
821 Ga0496109_0016118 3300048912 Bacteria 6531
822 Ga0496109_0066882 3300048912 Bacteria 3292
823 Ga0496109_0234550 3300048912 Bacteria 1727
824 Ga0496110_0000185 3300048913 Bacteria 39094
825 Ga0496110_0001335 3300048913 Bacteria 17714
826 Ga0496110_0001995 3300048913 Bacteria 15182
827 Ga0496110_0037267 3300048913 Bacteria 4226
828 Ga0496110_0054802 3300048913 Bacteria 3507
829 Ga0496110_0061760 3300048913 Bacteria 3308
830 Ga0496110_0077077 3300048913 Bacteria 2965
831 Ga0496110_0078101 3300048913 Bacteria 2947
832 Ga0496110_0392354 3300048913 Bacteria 1265
833 Ga0496111_0000103 3300048914 Bacteria 36804
834 Ga0496111_0001859 3300048914 Bacteria 12460
835 Ga0496111_0006437 3300048914 Bacteria 7625
836 Ga0496111_0010556 3300048914 Bacteria 6203
837 Ga0496111_0024177 3300048914 Bacteria 4275
838 Ga0496111_0071374 3300048914 Bacteria 2527
839 Ga0496111_0124566 3300048914 Bacteria 1905
840 Ga0496111_0227613 3300048914 Bacteria 1385
841 Ga0496112_0000661 3300048915 Bacteria 23981
842 Ga0496112_0001233 3300048915 Bacteria 19297
843 Ga0496112_0001703 3300048915 Bacteria 17163
844 Ga0496112_0040212 3300048915 Bacteria 4572
845 Ga0496112_0399898 3300048915 Bacteria 1313
846 Ga0496113_0000017 3300048916 Bacteria 74327
847 Ga0496113_0007454 3300048916 Bacteria 7044
848 Ga0496113_0009718 3300048916 Bacteria 6321
849 Ga0496113_0017673 3300048916 Bacteria 4956
850 Ga0496113_0023407 3300048916 Bacteria 4379
851 Ga0496113_0056331 3300048916 Bacteria 2951
852 Ga0496113_0093778 3300048916 Bacteria 2318
853 Ga0496113_0103177 3300048916 Bacteria 2212
854 Ga0496114_0000003 3300048917 Bacteria 630981
855 Ga0496114_0315326 3300048917 Bacteria 1381
856 Ga0496115_0000022 3300048918 Bacteria 164224
857 Ga0496115_0000408 3300048918 Bacteria 35443
858 Ga0496115_0015665 3300048918 Bacteria 5756
859 Ga0496115_0027710 3300048918 Bacteria 4434
860 Ga0496115_0028807 3300048918 Bacteria 4355
861 Ga0496115_0036332 3300048918 Bacteria 3900
862 Ga0496116_0000120 3300048919 Bacteria 166804
863 Ga0496118_0004106 3300048921 Bacteria 17626
864 Ga0496119_0009861 3300048922 Bacteria 8117
865 Ga0496119_0015154 3300048922 Bacteria 5965
866 Ga0496119_0098951 3300048922 Bacteria 1641
867 Ga0496120_0002756 3300048923 Bacteria 17134
868 Ga0496120_0031163 3300048923 Bacteria 3233
869 Ga0496121_0002900 3300048924 Bacteria 25168
870 Ga0496121_0005349 3300048924 Bacteria 16506
871 Ga0496121_0051254 3300048924 Bacteria 3478
872 Ga0496124_0267006 3300048927 Bacteria 1255
873 Ga0496126_0015537 3300048929 Bacteria 7650
874 Ga0496126_0057903 3300048929 Bacteria 3495
875 Ga0501031_0000272 3300049568 Bacteria 29278
876 Ga0501031_0010575 3300049568 Bacteria 6008
877 Ga0501032_0002738 3300049569 Bacteria 13725
878 Ga0501032_0015713 3300049569 Bacteria 5336
879 Ga0501033_0003448 3300049570 Bacteria 12998
880 Ga0501033_0056764 3300049570 Bacteria 2893
881 Ga0501034_0002876 3300049571 Bacteria 20017
882 Ga0501034_0035223 3300049571 Bacteria 5075
883 Ga0501034_0108701 3300049571 Bacteria 2764
884 Ga0501034_0176227 3300049571 Bacteria 2104
885 Ga0501034_0310807 3300049571 Bacteria 1510
886 Ga0501036_0018894 3300049572 Bacteria 5782
887 Ga0501036_0030448 3300049572 Bacteria 4558
888 Ga0501036_0247634 3300049572 Bacteria 1494
889 Ga0501037_0003467 3300049573 Bacteria 11448
890 Ga0501037_0018819 3300049573 Bacteria 5088
891 Ga0501038_0003846 3300049574 Bacteria 13960
892 Ga0501038_0347821 3300049574 Bacteria 1155
893 Ga0501039_0021888 3300049575 Bacteria 4905
894 Ga0501039_0068905 3300049575 Bacteria 2746
895 Ga0501041_0031944 3300049577 Bacteria 3182
896 Ga0501042_0010066 3300049578 Bacteria 6322
897 Ga0501042_0086233 3300049578 Bacteria 2252
898 Ga0501042_0120745 3300049578 Bacteria 1887
899 Ga0501042_0179788 3300049578 Bacteria 1526
900 Ga0501043_0003675 3300049579 Bacteria 12596
901 Ga0501043_0032176 3300049579 Bacteria 4122
902 Ga0501046_0004234 3300049580 Bacteria 13054
903 Ga0501046_0004261 3300049580 Bacteria 13022
904 Ga0501047_0003193 3300049581 Bacteria 15541
905 Ga0501047_0021038 3300049581 Bacteria 6266
906 Ga0501047_0051756 3300049581 Bacteria 3969
907 Ga0501047_0093418 3300049581 Bacteria 2887
908 Ga0501047_0186161 3300049581 Bacteria 1941
909 Ga0501048_0002902 3300049582 Bacteria 13084
910 Ga0501048_0005946 3300049582 Bacteria 9286
911 Ga0501048_0051449 3300049582 Bacteria 2932
912 Ga0501067_0000864 3300049583 Bacteria 16300
913 Ga0501067_0011384 3300049583 Bacteria 4926
914 Ga0501067_0032096 3300049583 Bacteria 2914
915 Ga0501067_0156469 3300049583 Bacteria 1270
916 Ga0501068_0065620 3300049584 Bacteria 2210
917 Ga0501068_0089473 3300049584 Bacteria 1898
918 Ga0501069_0013053 3300049585 Bacteria 4427
919 Ga0501069_0014239 3300049585 Bacteria 4248
920 Ga0501069_0014727 3300049585 Bacteria 4183
921 Ga0501070_0000603 3300049586 Bacteria 32865
922 Ga0501070_0007617 3300049586 Bacteria 9191
923 Ga0501070_0066070 3300049586 Bacteria 2995
924 Ga0501070_0329638 3300049586 Bacteria 1241
925 Ga0501070_0442685 3300049586 Bacteria 1048
926 Ga0501071_0030061 3300049587 Bacteria 3840
927 Ga0501072_0062732 3300049588 Bacteria 2931
928 Ga0501072_0192515 3300049588 Bacteria 1626
929 Ga0501073_0005549 3300049589 Bacteria 9436
930 Ga0501074_0026308 3300049590 Bacteria 4218
931 Ga0501074_0035338 3300049590 Bacteria 3620
932 Ga0501074_0129328 3300049590 Bacteria 1807
933 Ga0501075_0001603 3300049591 Bacteria 14813
934 Ga0501075_0049705 3300049591 Bacteria 3152
935 Ga0501077_0110823 3300049593 Bacteria 1739
936 Ga0501079_0041556 3300049741 Bacteria 3550
937 Ga0501079_0048854 3300049741 Bacteria 3265
938 Ga0501079_0095148 3300049741 Bacteria 2308
939 Ga0501080_0003769 3300049742 Bacteria 13389
940 Ga0501080_0198304 3300049742 Bacteria 1843
941 Ga0501083_0009148 3300049744 Bacteria 6998
942 Ga0501083_0025722 3300049744 Bacteria 4074
943 Ga0501035_0004600 3300049822 Bacteria 13082
944 Ga0501035_0064276 3300049822 Bacteria 3261
945 Ga0501044_0003139 3300049823 Bacteria 18693
946 Ga0501044_0024786 3300049823 Bacteria 6364
947 Ga0501044_0036180 3300049823 Bacteria 5165
948 Ga0501044_0050761 3300049823 Bacteria 4278
949 Ga0501045_0085562 3300049824 Bacteria 2327
950 Ga0501045_0220725 3300049824 Bacteria 1411
951 Ga0501212_010641 3300049851 Bacteria 1315
952 nmdc:mga00v17_46073_c1 3300050491 Bacteria 2637
953 nmdc:mga0yw44_15653_c1 3300050492 Bacteria 4070
954 nmdc:mga0yw44_216496_c1 3300050492 Bacteria 1268
955 nmdc:mga0yw44_8680_c1 3300050492 Bacteria 5081
956 nmdc:mga05p37_15634_c1 3300050507 Bacteria 9120
957 nmdc:mga05p37_1685_c1 3300050507 Bacteria 25708
958 nmdc:mga05p37_224323_c1 3300050507 Bacteria 2266
959 nmdc:mga05p37_240704_c1 3300050507 Bacteria 2176
960 nmdc:mga09592_791_c1 3300050508 Bacteria 24480
961 nmdc:mga0qj67_11680_c1 3300050509 Bacteria 6588
962 nmdc:mga0qj67_20491_c1 3300050509 Bacteria 5063
963 nmdc:mga0qj67_908_c1 3300050509 Bacteria 20357
964 nmdc:mga06r32_118032_c1 3300050510 Bacteria 2615
965 nmdc:mga08y16_10979_c1 3300050511 Bacteria 9510
966 nmdc:mga08y16_305620_c1 3300050511 Bacteria 1639
967 nmdc:mga08y16_327363_c1 3300050511 Bacteria 1577
968 nmdc:mga0n895_29896_c1 3300050512 Bacteria 5201
969 nmdc:mga0n895_70510_c1 3300050512 Bacteria 3464
970 nmdc:mga0n895_82535_c1 3300050512 Bacteria 3204
971 nmdc:mga0rr50_150572_c1 3300050513 Bacteria 1880
972 nmdc:mga0a205_120886_c1 3300050515 Bacteria 2518
973 nmdc:mga0a205_281_c1 3300050515 Bacteria 37267
974 Ga0495601_0000029 3300053077 Bacteria 111437
975 Ga0495601_0000444 3300053077 Bacteria 21636
976 Ga0495601_0000673 3300053077 Bacteria 18239
977 Ga0495601_0008993 3300053077 Bacteria 5897
978 Ga0495601_0009993 3300053077 Bacteria 5627
979 Ga0495601_0047138 3300053077 Bacteria 2713
980 Ga0495601_0159200 3300053077 Bacteria 1475
981 Ga0495601_0207466 3300053077 Bacteria 1280
982 Ga0495612_0000049 3300053078 Bacteria 54959
983 Ga0495612_0001200 3300053078 Bacteria 10676
984 Ga0495612_0004444 3300053078 Bacteria 5819
985 Ga0495655_0000010 3300053083 Bacteria 125615
986 Ga0495655_0005267 3300053083 Bacteria 2273
987 Ga0495655_0019605 3300053083 Bacteria 1504
988 Ga0495595_0000007 3300053084 Bacteria 228504
989 Ga0495595_0000547 3300053084 Bacteria 14350
990 Ga0495595_0000690 3300053084 Bacteria 12899
991 Ga0495619_0000001 3300053085 Bacteria 586054
992 Ga0495619_0000026 3300053085 Bacteria 167387
993 Ga0495619_0000067 3300053085 Bacteria 83418
994 Ga0495619_0000205 3300053085 Bacteria 42913
995 Ga0495619_0001750 3300053085 Bacteria 14429
996 Ga0495619_0002447 3300053085 Bacteria 12164
997 Ga0495619_0002937 3300053085 Bacteria 11078
998 Ga0495619_0015207 3300053085 Bacteria 4865
999 Ga0500566_0001360 3300053094 Bacteria 14314
1000 Ga0500641_0003315 3300053096 Bacteria 5697
1001 Ga0500641_0090229 3300053096 Bacteria 1308
1002 Ga0500556_0001310 3300053104 Bacteria 11176
1003 Ga0500614_000263 3300053123 Bacteria 13569
1004 Ga0500628_000024 3300053129 Bacteria 64538
1005 Ga0500616_0003202 3300053153 Bacteria 12713
1006 Ga0500616_0005227 3300053153 Bacteria 8881
1007 Ga0500616_0048757 3300053153 Bacteria 2244
1008 Ga0500599_002557 3300053736 Bacteria 2185
1009 Ga0501084_0091029 3300054114 Bacteria 2561
1010 Ga0501084_0100705 3300054114 Bacteria 2426
1011 Ga0501084_0184032 3300054114 Bacteria 1763
1012 Ga0590074_019718 3300059423 Bacteria 1158
1013 Ga0590077_029049 3300059426 Bacteria 1203
1014 Ga0501082_0070814 3300060353 Bacteria 3002
1015 Ga0501082_0104093 3300060353 Bacteria 2455
1016 Ga0501082_0221700 3300060353 Bacteria 1645
1017 Ga0466962_0007808 3300061719 Bacteria 5129
1018 Ga0530510_0200619 3300061734 Bacteria 1481

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0315326 Ga0496114_0315326_42_884 257
2 3300044842 Ga0466957_0219195 Ga0466957_0219195_18_878 263
3 3300003203 JGI25406J46586_10005180 JGI25406J46586_100051806 283
4 3300005458 Ga0070681_10216594 Ga0070681_102165941 283
5 3300005471 Ga0070698_100181710 Ga0070698_1001817103 284
6 3300037068 Ga0373925_0503467 Ga0373925_0503467_47_967 284
7 3300046660 Ga0495625_0000243 Ga0495625_0000243_15597_16511 284
8 3300047321 Ga0495676_0038900 Ga0495676_0038900_2591_3511 284
9 3300049581 Ga0501047_0021038 Ga0501047_0021038_2566_3480 284
10 3300049586 Ga0501070_0066070 Ga0501070_0066070_2029_2943 284
11 3300005546 Ga0070696_100018841 Ga0070696_1000188415 287
12 3300006871 Ga0075434_100183102 Ga0075434_1001831023 287
13 3300007076 Ga0075435_100171108 Ga0075435_1001711083 287
14 3300050512 nmdc:mga0n895_70510_c1 nmdc:mga0n895_70510_c1_1545_2474 287
15 3300050513 nmdc:mga0rr50_150572_c1 nmdc:mga0rr50_150572_c1_327_1256 287
16 3300004800 Ga0058861_10195417 Ga0058861_101954173 289
17 3300004803 Ga0058862_10069669 Ga0058862_100696693 289
18 3300005341 Ga0070691_10013117 Ga0070691_100131172 289
19 3300005445 Ga0070708_100007488 Ga0070708_1000074886 289
20 3300005445 Ga0070708_100160799 Ga0070708_1001607992 289
21 3300005445 Ga0070708_100289725 Ga0070708_1002897252 289
22 3300005467 Ga0070706_100001344 Ga0070706_10000134416 289
23 3300005467 Ga0070706_100039789 Ga0070706_1000397893 289
24 3300005467 Ga0070706_100190541 Ga0070706_1001905413 289
25 3300005468 Ga0070707_100002020 Ga0070707_10000202015 289
26 3300005468 Ga0070707_100006384 Ga0070707_10000638417 289
27 3300005468 Ga0070707_100414541 Ga0070707_1004145412 289
28 3300005471 Ga0070698_100144492 Ga0070698_1001444923 289
29 3300005471 Ga0070698_100360467 Ga0070698_1003604672 289
30 3300005471 Ga0070698_100394293 Ga0070698_1003942932 289
31 3300005530 Ga0070679_100072615 Ga0070679_1000726155 289
32 3300005577 Ga0068857_100050806 Ga0068857_1000508062 289
33 3300006028 Ga0070717_10020450 Ga0070717_100204504 289
34 3300010375 Ga0105239_10093611 Ga0105239_100936113 289
35 3300013307 Ga0157372_10018844 Ga0157372_100188447 289
36 3300020069 Ga0197907_10465245 Ga0197907_104652452 289
37 3300020070 Ga0206356_11750464 Ga0206356_117504642 289
38 3300020075 Ga0206349_1015741 Ga0206349_10157413 289
39 3300020075 Ga0206349_1625417 Ga0206349_16254172 289
40 3300020077 Ga0206351_10180526 Ga0206351_101805262 289
41 3300020077 Ga0206351_10380651 Ga0206351_103806513 289
42 3300020078 Ga0206352_10040496 Ga0206352_100404964 289
43 3300020078 Ga0206352_10364769 Ga0206352_103647692 289
44 3300020080 Ga0206350_10243056 Ga0206350_102430564 289
45 3300020080 Ga0206350_10534078 Ga0206350_105340783 289
46 3300020080 Ga0206350_10636958 Ga0206350_106369584 289
47 3300020080 Ga0206350_11049551 Ga0206350_110495512 289
48 3300022467 Ga0224712_10007833 Ga0224712_100078332 289
49 3300022467 Ga0224712_10009427 Ga0224712_100094273 289
50 3300022467 Ga0224712_10061581 Ga0224712_100615812 289
51 3300025910 Ga0207684_10001406 Ga0207684_1000140616 289
52 3300025910 Ga0207684_10026594 Ga0207684_100265943 289
53 3300025922 Ga0207646_10015375 Ga0207646_100153753 289
54 3300025922 Ga0207646_10353964 Ga0207646_103539642 289
55 3300025929 Ga0207664_10418384 Ga0207664_104183842 289
56 3300026116 Ga0207674_10037485 Ga0207674_100374854 289
57 3300028800 Ga0265338_10029749 Ga0265338_100297493 289
58 3300031247 Ga0265340_10033183 Ga0265340_100331834 289
59 3300035119 Ga0373956_0005446 Ga0373956_0005446_3568_4503 289
60 3300035172 Ga0373955_0048898 Ga0373955_0048898_1188_2123 289
61 3300035695 Ga0373927_0000006 Ga0373927_0000006_47699_48634 289
62 3300035724 Ga0373933_0006691 Ga0373933_0006691_2554_3489 289
63 3300035724 Ga0373933_0126249 Ga0373933_0126249_22_957 289
64 3300036534 Ga0310109_000315 Ga0310109_000315_614_1549 289
65 3300039450 Ga0436363_0150822 Ga0436363_0150822_230_1165 289
66 3300042876 Ga0451577_0066833 Ga0451577_0066833_111_1070 289
67 3300044658 Ga0466972_0061114 Ga0466972_0061114_527_1462 289
68 3300044658 Ga0466972_0128973 Ga0466972_0128973_41_976 289
69 3300044673 Ga0453683_0032610 Ga0453683_0032610_623_1582 289
70 3300044684 Ga0466966_0044537 Ga0466966_0044537_894_1829 289
71 3300044693 Ga0466961_0004518 Ga0466961_0004518_660_1595 289
72 3300044693 Ga0466961_0029816 Ga0466961_0029816_1815_2750 289
73 3300044694 Ga0466963_0097585 Ga0466963_0097585_11_946 289
74 3300045049 Ga0466959_0013190 Ga0466959_0013190_1645_2580 289
75 3300045049 Ga0466959_0020682 Ga0466959_0020682_2750_3685 289
76 3300045836 Ga0466958_0029928 Ga0466958_0029928_185_1120 289
77 3300013308 Ga0157375_10119655 Ga0157375_101196554 290
78 3300032002 Ga0307416_100102352 Ga0307416_1001023523 290
79 3300061734 Ga0530510_0200619 Ga0530510_0200619_228_1160 292
80 3300013105 Ga0157369_10389745 Ga0157369_103897452 295
81 3300031901 Ga0307406_10047459 Ga0307406_100474595 295
82 3300048906 Ga0496103_0005940 Ga0496103_0005940_97_1044 295
83 3300048919 Ga0496116_0000120 Ga0496116_0000120_132841_133788 295
84 3300048921 Ga0496118_0004106 Ga0496118_0004106_3512_4459 295
85 3300049568 Ga0501031_0000272 Ga0501031_0000272_21933_22880 295
86 3300049569 Ga0501032_0002738 Ga0501032_0002738_3237_4184 295
87 3300049570 Ga0501033_0056764 Ga0501033_0056764_1455_2402 295
88 3300049572 Ga0501036_0030448 Ga0501036_0030448_683_1630 295
89 3300049573 Ga0501037_0018819 Ga0501037_0018819_452_1399 295
90 3300049574 Ga0501038_0003846 Ga0501038_0003846_492_1439 295
91 3300049579 Ga0501043_0003675 Ga0501043_0003675_11454_12401 295
92 3300049580 Ga0501046_0004234 Ga0501046_0004234_654_1601 295
93 3300049581 Ga0501047_0003193 Ga0501047_0003193_2789_3736 295
94 3300049581 Ga0501047_0093418 Ga0501047_0093418_1575_2522 295
95 3300049582 Ga0501048_0002902 Ga0501048_0002902_11454_12401 295
96 3300049583 Ga0501067_0032096 Ga0501067_0032096_1042_2016 295
97 3300049585 Ga0501069_0014239 Ga0501069_0014239_602_1549 295
98 3300049585 Ga0501069_0014727 Ga0501069_0014727_3050_4024 295
99 3300049586 Ga0501070_0000603 Ga0501070_0000603_11454_12401 295
100 3300049586 Ga0501070_0329638 Ga0501070_0329638_110_1084 295
101 3300049590 Ga0501074_0035338 Ga0501074_0035338_559_1506 295
102 3300049741 Ga0501079_0048854 Ga0501079_0048854_345_1292 295
103 3300049741 Ga0501079_0095148 Ga0501079_0095148_1154_2101 295
104 3300049742 Ga0501080_0198304 Ga0501080_0198304_649_1596 295
105 3300049744 Ga0501083_0009148 Ga0501083_0009148_3406_4353 295
106 3300049744 Ga0501083_0025722 Ga0501083_0025722_2687_3634 295
107 3300049822 Ga0501035_0004600 Ga0501035_0004600_682_1629 295
108 3300049823 Ga0501044_0003139 Ga0501044_0003139_6293_7240 295
109 3300049823 Ga0501044_0024786 Ga0501044_0024786_3963_4910 295
110 3300054114 Ga0501084_0184032 Ga0501084_0184032_84_1031 295
111 3300060353 Ga0501082_0221700 Ga0501082_0221700_273_1220 295
112 3300005577 Ga0068857_100274506 Ga0068857_1002745063 296
113 3300053096 Ga0500641_0090229 Ga0500641_0090229_121_1080 296
114 3300005445 Ga0070708_100003595 Ga0070708_10000359512 298
115 3300005467 Ga0070706_100031968 Ga0070706_1000319685 298
116 3300005467 Ga0070706_100102473 Ga0070706_1001024732 298
117 3300005468 Ga0070707_100101383 Ga0070707_1001013833 298
118 3300025910 Ga0207684_10085754 Ga0207684_100857542 298
119 3300025910 Ga0207684_10160049 Ga0207684_101600492 298
120 3300005329 Ga0070683_100007506 Ga0070683_1000075066 299
121 3300005329 Ga0070683_100018543 Ga0070683_1000185436 299
122 3300005333 Ga0070677_10000956 Ga0070677_100009567 299
123 3300005344 Ga0070661_100012352 Ga0070661_1000123525 299
124 3300005356 Ga0070674_100000019 Ga0070674_10000001938 299
125 3300005364 Ga0070673_100016927 Ga0070673_1000169273 299
126 3300005366 Ga0070659_100023840 Ga0070659_1000238404 299
127 3300005457 Ga0070662_100000001 Ga0070662_100000001143 299
128 3300005458 Ga0070681_10036102 Ga0070681_100361023 299
129 3300005459 Ga0068867_100001975 Ga0068867_10000197513 299
130 3300005530 Ga0070679_100003154 Ga0070679_10000315412 299
131 3300005535 Ga0070684_100013351 Ga0070684_1000133514 299
132 3300005535 Ga0070684_100033293 Ga0070684_1000332932 299
133 3300005539 Ga0068853_100087760 Ga0068853_1000877602 299
134 3300005548 Ga0070665_100000022 Ga0070665_10000002278 299
135 3300005614 Ga0068856_100013340 Ga0068856_1000133409 299
136 3300005718 Ga0068866_10000005 Ga0068866_1000000567 299
137 3300005840 Ga0068870_10243870 Ga0068870_102438701 299
138 3300005842 Ga0068858_100001657 Ga0068858_1000016576 299
139 3300006163 Ga0070715_10000008 Ga0070715_10000008102 299
140 3300009147 Ga0114129_10028895 Ga0114129_100288956 299
141 3300009176 Ga0105242_10048190 Ga0105242_100481905 299
142 3300009545 Ga0105237_10082040 Ga0105237_100820403 299
143 3300009551 Ga0105238_10034900 Ga0105238_100349004 299
144 3300009553 Ga0105249_10000368 Ga0105249_100003686 299
145 3300013102 Ga0157371_10123030 Ga0157371_101230302 299
146 3300013104 Ga0157370_10003060 Ga0157370_100030602 299
147 3300013307 Ga0157372_10032213 Ga0157372_100322135 299
148 3300014326 Ga0157380_10001737 Ga0157380_1000173714 299
149 3300020078 Ga0206352_10184859 Ga0206352_101848591 299
150 3300020081 Ga0206354_10367263 Ga0206354_103672633 299
151 3300022467 Ga0224712_10013711 Ga0224712_100137114 299
152 3300025893 Ga0207682_10000041 Ga0207682_100000416 299
153 3300025899 Ga0207642_10000005 Ga0207642_10000005270 299
154 3300025905 Ga0207685_10000012 Ga0207685_10000012102 299
155 3300025912 Ga0207707_10006269 Ga0207707_100062694 299
156 3300025920 Ga0207649_10029420 Ga0207649_100294204 299
157 3300025921 Ga0207652_10024377 Ga0207652_100243774 299
158 3300025933 Ga0207706_10000003 Ga0207706_10000003185 299
159 3300025934 Ga0207686_10068904 Ga0207686_100689043 299
160 3300025937 Ga0207669_10000140 Ga0207669_1000014013 299
161 3300025944 Ga0207661_10005294 Ga0207661_100052946 299
162 3300025944 Ga0207661_10014089 Ga0207661_100140894 299
163 3300025944 Ga0207661_10022934 Ga0207661_100229346 299
164 3300025960 Ga0207651_10002542 Ga0207651_100025424 299
165 3300025961 Ga0207712_10000027 Ga0207712_10000027303 299
166 3300026035 Ga0207703_10000020 Ga0207703_10000020131 299
167 3300026041 Ga0207639_10073801 Ga0207639_100738013 299
168 3300026075 Ga0207708_10079636 Ga0207708_100796363 299
169 3300026078 Ga0207702_10022825 Ga0207702_100228257 299
170 3300026078 Ga0207702_10293814 Ga0207702_102938142 299
171 3300026089 Ga0207648_10008953 Ga0207648_100089537 299
172 3300026121 Ga0207683_10191798 Ga0207683_101917982 299
173 3300026142 Ga0207698_10039926 Ga0207698_100399266 299
174 3300028379 Ga0268266_10000029 Ga0268266_10000029372 299
175 3300028381 Ga0268264_10000725 Ga0268264_100007258 299
176 3300036401 Ga0373937_0190830 Ga0373937_0190830_678_1637 299
177 3300044694 Ga0466963_0002882 Ga0466963_0002882_4893_5852 299
178 3300044694 Ga0466963_0047724 Ga0466963_0047724_278_1243 299
179 3300044694 Ga0466963_0177733 Ga0466963_0177733_34_999 299
180 3300045976 Ga0466967_0010925 Ga0466967_0010925_5665_6630 299
181 3300045976 Ga0466967_0128157 Ga0466967_0128157_1033_1998 299
182 3300046455 Ga0495603_0000194 Ga0495603_0000194_18278_19237 299
183 3300046455 Ga0495603_0008081 Ga0495603_0008081_2049_3008 299
184 3300046461 Ga0495641_0000004 Ga0495641_0000004_135293_136252 299
185 3300046473 Ga0495582_0000002 Ga0495582_0000002_193242_194201 299
186 3300046517 Ga0495630_0339366 Ga0495630_0339366_111_1070 299
187 3300046539 Ga0495621_0001476 Ga0495621_0001476_1570_2529 299
188 3300046683 Ga0495658_0000001 Ga0495658_0000001_198067_199026 299
189 3300046809 Ga0495600_0168896 Ga0495600_0168896_17_976 299
190 3300047317 Ga0495604_0000437 Ga0495604_0000437_28581_29540 299
191 3300047321 Ga0495676_0000320 Ga0495676_0000320_25836_26795 299
192 3300047322 Ga0495680_0000513 Ga0495680_0000513_13841_14800 299
193 3300047446 Ga0495679_015058 Ga0495679_015058_1463_2422 299
194 3300048907 Ga0496104_0000008 Ga0496104_0000008_186568_187527 299
195 3300048908 Ga0496105_0000003 Ga0496105_0000003_186568_187527 299
196 3300048909 Ga0496106_0000172 Ga0496106_0000172_22404_23369 299
197 3300048913 Ga0496110_0001335 Ga0496110_0001335_8294_9253 299
198 3300049578 Ga0501042_0120745 Ga0501042_0120745_815_1774 299
199 3300049591 Ga0501075_0001603 Ga0501075_0001603_11607_12566 299
200 3300050492 nmdc:mga0yw44_216496_c1 nmdc:mga0yw44_216496_c1_283_1248 299
201 3300053077 Ga0495601_0000444 Ga0495601_0000444_16351_17310 299
202 3300053078 Ga0495612_0001200 Ga0495612_0001200_7833_8792 299
203 3300053123 Ga0500614_000263 Ga0500614_000263_5526_6485 299
204 3300003373 JGI25407J50210_10021674 JGI25407J50210_100216743 300
205 3300003659 JGI25404J52841_10000538 JGI25404J52841_100005382 300
206 3300005337 Ga0070682_100000023 Ga0070682_100000023223 300
207 3300005337 Ga0070682_100000061 Ga0070682_10000006184 300
208 3300005347 Ga0070668_100457845 Ga0070668_1004578451 300
209 3300005356 Ga0070674_100033227 Ga0070674_1000332276 300
210 3300005356 Ga0070674_100219131 Ga0070674_1002191311 300
211 3300005366 Ga0070659_100008534 Ga0070659_1000085346 300
212 3300005367 Ga0070667_100000597 Ga0070667_10000059710 300
213 3300005406 Ga0070703_10080181 Ga0070703_100801811 300
214 3300005434 Ga0070709_10050251 Ga0070709_100502512 300
215 3300005435 Ga0070714_100107438 Ga0070714_1001074382 300
216 3300005435 Ga0070714_100121368 Ga0070714_1001213683 300
217 3300005436 Ga0070713_100067402 Ga0070713_1000674023 300
218 3300005437 Ga0070710_10100161 Ga0070710_101001611 300
219 3300005437 Ga0070710_10139697 Ga0070710_101396972 300
220 3300005439 Ga0070711_100064726 Ga0070711_1000647261 300
221 3300005441 Ga0070700_100151277 Ga0070700_1001512772 300
222 3300005441 Ga0070700_100213281 Ga0070700_1002132811 300
223 3300005457 Ga0070662_100088608 Ga0070662_1000886082 300
224 3300005535 Ga0070684_100120058 Ga0070684_1001200582 300
225 3300005545 Ga0070695_100120813 Ga0070695_1001208131 300
226 3300005615 Ga0070702_100004581 Ga0070702_1000045819 300
227 3300005617 Ga0068859_100132898 Ga0068859_1001328982 300
228 3300005718 Ga0068866_10100790 Ga0068866_101007902 300
229 3300005719 Ga0068861_100044604 Ga0068861_1000446042 300
230 3300005834 Ga0068851_10000741 Ga0068851_100007415 300
231 3300005843 Ga0068860_100270418 Ga0068860_1002704182 300
232 3300005844 Ga0068862_100001558 Ga0068862_10000155826 300
233 3300005937 Ga0081455_10004481 Ga0081455_1000448111 300
234 3300005937 Ga0081455_10110825 Ga0081455_101108253 300
235 3300005981 Ga0081538_10011162 Ga0081538_100111622 300
236 3300005981 Ga0081538_10023057 Ga0081538_100230576 300
237 3300005983 Ga0081540_1000697 Ga0081540_100069712 300
238 3300005985 Ga0081539_10014136 Ga0081539_100141362 300
239 3300006038 Ga0075365_10011703 Ga0075365_100117034 300
240 3300006175 Ga0070712_100049467 Ga0070712_1000494675 300
241 3300006844 Ga0075428_100087343 Ga0075428_1000873432 300
242 3300006844 Ga0075428_100424023 Ga0075428_1004240232 300
243 3300006847 Ga0075431_100010016 Ga0075431_1000100168 300
244 3300006847 Ga0075431_100059786 Ga0075431_1000597863 300
245 3300006880 Ga0075429_100396864 Ga0075429_1003968641 300
246 3300006881 Ga0068865_100000089 Ga0068865_10000008925 300
247 3300006881 Ga0068865_100140322 Ga0068865_1001403222 300
248 3300006931 Ga0097620_100132897 Ga0097620_1001328973 300
249 3300009094 Ga0111539_10028001 Ga0111539_100280012 300
250 3300009094 Ga0111539_10461760 Ga0111539_104617601 300
251 3300009098 Ga0105245_10000640 Ga0105245_1000064025 300
252 3300009098 Ga0105245_10002937 Ga0105245_1000293721 300
253 3300009098 Ga0105245_10006204 Ga0105245_100062044 300
254 3300009147 Ga0114129_10034389 Ga0114129_100343897 300
255 3300009551 Ga0105238_10000016 Ga0105238_10000016222 300
256 3300009553 Ga0105249_10001411 Ga0105249_1000141117 300
257 3300009553 Ga0105249_10392144 Ga0105249_103921442 300
258 3300010375 Ga0105239_10461707 Ga0105239_104617071 300
259 3300013102 Ga0157371_10007417 Ga0157371_100074174 300
260 3300013104 Ga0157370_10019536 Ga0157370_100195367 300
261 3300013296 Ga0157374_10000785 Ga0157374_100007857 300
262 3300013307 Ga0157372_10001649 Ga0157372_1000164929 300
263 3300013308 Ga0157375_10000717 Ga0157375_100007176 300
264 3300013308 Ga0157375_10005849 Ga0157375_1000584913 300
265 3300020070 Ga0206356_10907411 Ga0206356_109074112 300
266 3300020081 Ga0206354_11250835 Ga0206354_112508351 300
267 3300020610 Ga0154015_1384123 Ga0154015_13841232 300
268 3300025302 Ga0207426_1012827 Ga0207426_10128276 300
269 3300025321 Ga0207656_10001891 Ga0207656_100018915 300
270 3300025901 Ga0207688_10130382 Ga0207688_101303822 300
271 3300025911 Ga0207654_10076779 Ga0207654_100767792 300
272 3300025924 Ga0207694_10000012 Ga0207694_10000012200 300
273 3300025927 Ga0207687_10000331 Ga0207687_100003316 300
274 3300025927 Ga0207687_10001806 Ga0207687_100018065 300
275 3300025928 Ga0207700_10110794 Ga0207700_101107942 300
276 3300025928 Ga0207700_10377207 Ga0207700_103772071 300
277 3300025929 Ga0207664_10214760 Ga0207664_102147601 300
278 3300025929 Ga0207664_10386359 Ga0207664_103863592 300
279 3300025932 Ga0207690_10005455 Ga0207690_100054556 300
280 3300025938 Ga0207704_10000018 Ga0207704_10000018122 300
281 3300025944 Ga0207661_10220727 Ga0207661_102207272 300
282 3300025961 Ga0207712_10002082 Ga0207712_100020828 300
283 3300025972 Ga0207668_10019215 Ga0207668_100192152 300
284 3300025981 Ga0207640_10000205 Ga0207640_100002058 300
285 3300025986 Ga0207658_10000465 Ga0207658_100004659 300
286 3300026035 Ga0207703_10116317 Ga0207703_101163171 300
287 3300026067 Ga0207678_10234604 Ga0207678_102346042 300
288 3300026075 Ga0207708_10004102 Ga0207708_100041022 300
289 3300026078 Ga0207702_10000690 Ga0207702_1000069023 300
290 3300026116 Ga0207674_10289820 Ga0207674_102898202 300
291 3300026118 Ga0207675_100159493 Ga0207675_1001594932 300
292 3300027907 Ga0207428_10007595 Ga0207428_100075952 300
293 3300027907 Ga0207428_10080156 Ga0207428_100801561 300
294 3300028380 Ga0268265_10001048 Ga0268265_1000104823 300
295 3300028381 Ga0268264_10042318 Ga0268264_100423182 300
296 3300028381 Ga0268264_10217309 Ga0268264_102173092 300
297 3300028381 Ga0268264_10382828 Ga0268264_103828282 300
298 3300028563 Ga0265319_1000010 Ga0265319_1000010114 300
299 3300028800 Ga0265338_10000051 Ga0265338_100000517 300
300 3300031241 Ga0265325_10006156 Ga0265325_100061567 300
301 3300031852 Ga0307410_10023485 Ga0307410_100234852 300
302 3300031901 Ga0307406_10127295 Ga0307406_101272953 300
303 3300031901 Ga0307406_10235095 Ga0307406_102350952 300
304 3300031903 Ga0307407_10089927 Ga0307407_100899272 300
305 3300031995 Ga0307409_100029080 Ga0307409_1000290807 300
306 3300031995 Ga0307409_100029492 Ga0307409_1000294922 300
307 3300031995 Ga0307409_100092559 Ga0307409_1000925595 300
308 3300031995 Ga0307409_100675596 Ga0307409_1006755961 300
309 3300032002 Ga0307416_100025273 Ga0307416_1000252732 300
310 3300032002 Ga0307416_100105250 Ga0307416_1001052501 300
311 3300032002 Ga0307416_100141268 Ga0307416_1001412681 300
312 3300032002 Ga0307416_100314133 Ga0307416_1003141332 300
313 3300032005 Ga0307411_10028712 Ga0307411_100287125 300
314 3300032126 Ga0307415_100001546 Ga0307415_1000015468 300
315 3300032126 Ga0307415_100005858 Ga0307415_1000058582 300
316 3300032126 Ga0307415_100369356 Ga0307415_1003693561 300
317 3300036401 Ga0373937_0004436 Ga0373937_0004436_2455_3423 300
318 3300037418 Ga0395900_0008276 Ga0395900_0008276_689_1657 300
319 3300037466 Ga0395898_0002400 Ga0395898_0002400_10692_11660 300
320 3300037466 Ga0395898_0415425 Ga0395898_0415425_83_1051 300
321 3300038443 Ga0395901_0444783 Ga0395901_0444783_219_1187 300
322 3300039450 Ga0436363_1670627 Ga0436363_1670627_111_1079 300
323 3300039453 Ga0436362_0563621 Ga0436362_0563621_18_986 300
324 3300044693 Ga0466961_0003908 Ga0466961_0003908_5122_6090 300
325 3300044693 Ga0466961_0050408 Ga0466961_0050408_240_1208 300
326 3300044694 Ga0466963_0016311 Ga0466963_0016311_2820_3788 300
327 3300044694 Ga0466963_0020516 Ga0466963_0020516_2053_3021 300
328 3300044694 Ga0466963_0125338 Ga0466963_0125338_648_1610 300
329 3300044706 Ga0466964_0026274 Ga0466964_0026274_134_1105 300
330 3300044719 Ga0466971_0118538 Ga0466971_0118538_24_989 300
331 3300044842 Ga0466957_0205088 Ga0466957_0205088_146_1114 300
332 3300045049 Ga0466959_0066409 Ga0466959_0066409_1232_2200 300
333 3300045049 Ga0466959_0148771 Ga0466959_0148771_104_1072 300
334 3300045836 Ga0466958_0014181 Ga0466958_0014181_2821_3789 300
335 3300045836 Ga0466958_0038088 Ga0466958_0038088_746_1708 300
336 3300045836 Ga0466958_0108348 Ga0466958_0108348_720_1688 300
337 3300045836 Ga0466958_0126504 Ga0466958_0126504_254_1222 300
338 3300045976 Ga0466967_0041265 Ga0466967_0041265_2744_3712 300
339 3300045976 Ga0466967_0126554 Ga0466967_0126554_119_1087 300
340 3300045976 Ga0466967_0159296 Ga0466967_0159296_206_1177 300
341 3300045976 Ga0466967_0380437 Ga0466967_0380437_203_1171 300
342 3300045976 Ga0466967_0427957 Ga0466967_0427957_247_1215 300
343 3300045976 Ga0466967_0513348 Ga0466967_0513348_87_1055 300
344 3300046457 Ga0495590_0077347 Ga0495590_0077347_119_1093 300
345 3300046459 Ga0495629_0070965 Ga0495629_0070965_845_1813 300
346 3300046462 Ga0495651_0002656 Ga0495651_0002656_8707_9675 300
347 3300046462 Ga0495651_0037463 Ga0495651_0037463_97_1059 300
348 3300046463 Ga0495653_0007743 Ga0495653_0007743_2570_3538 300
349 3300046476 Ga0495662_0005718 Ga0495662_0005718_400_1371 300
350 3300046499 Ga0495594_0000012 Ga0495594_0000012_76173_77135 300
351 3300046500 Ga0495596_0024370 Ga0495596_0024370_246_1220 300
352 3300046514 Ga0495618_0022690 Ga0495618_0022690_2366_3334 300
353 3300046515 Ga0495620_0032803 Ga0495620_0032803_32_997 300
354 3300046533 Ga0495640_0016804 Ga0495640_0016804_1368_2336 300
355 3300046535 Ga0495586_0001742 Ga0495586_0001742_9824_10789 300
356 3300046557 Ga0495622_0000353 Ga0495622_0000353_5798_6760 300
357 3300046559 Ga0495667_0000265 Ga0495667_0000265_17191_18153 300
358 3300046559 Ga0495667_0000725 Ga0495667_0000725_1667_2635 300
359 3300046663 Ga0495635_0000709 Ga0495635_0000709_27_995 300
360 3300046678 Ga0495599_0132729 Ga0495599_0132729_12_980 300
361 3300046681 Ga0495647_0000005 Ga0495647_0000005_37100_38065 300
362 3300046690 Ga0495624_0000600 Ga0495624_0000600_12472_13437 300
363 3300046809 Ga0495600_0004809 Ga0495600_0004809_5302_6270 300
364 3300046809 Ga0495600_0007184 Ga0495600_0007184_571_1533 300
365 3300047319 Ga0495674_0000039 Ga0495674_0000039_26080_27042 300
366 3300047319 Ga0495674_0014499 Ga0495674_0014499_3475_4443 300
367 3300047322 Ga0495680_0001447 Ga0495680_0001447_4240_5208 300
368 3300047322 Ga0495680_0005366 Ga0495680_0005366_5814_6776 300
369 3300047444 Ga0495675_0176154 Ga0495675_0176154_194_1156 300
370 3300047471 Ga0495684_0041166 Ga0495684_0041166_1788_2756 300
371 3300047472 Ga0495686_0085784 Ga0495686_0085784_693_1655 300
372 3300048088 Ga0495602_0011907 Ga0495602_0011907_3123_4091 300
373 3300048088 Ga0495602_0080789 Ga0495602_0080789_40_1020 300
374 3300048089 Ga0495614_0078482 Ga0495614_0078482_62_1030 300
375 3300048903 Ga0496100_0000136 Ga0496100_0000136_24387_25355 300
376 3300048904 Ga0496101_0005625 Ga0496101_0005625_3449_4417 300
377 3300048911 Ga0496108_0000005 Ga0496108_0000005_498902_499864 300
378 3300048911 Ga0496108_0000721 Ga0496108_0000721_20356_21318 300
379 3300048911 Ga0496108_0197922 Ga0496108_0197922_374_1342 300
380 3300048911 Ga0496108_0502181 Ga0496108_0502181_67_1035 300
381 3300048912 Ga0496109_0000002 Ga0496109_0000002_35228_36190 300
382 3300048912 Ga0496109_0000389 Ga0496109_0000389_1747_2709 300
383 3300048912 Ga0496109_0066882 Ga0496109_0066882_17_985 300
384 3300048913 Ga0496110_0078101 Ga0496110_0078101_301_1269 300
385 3300048913 Ga0496110_0392354 Ga0496110_0392354_119_1087 300
386 3300048914 Ga0496111_0124566 Ga0496111_0124566_599_1567 300
387 3300048915 Ga0496112_0000661 Ga0496112_0000661_10696_11658 300
388 3300048916 Ga0496113_0000017 Ga0496113_0000017_69462_70424 300
389 3300048916 Ga0496113_0093778 Ga0496113_0093778_433_1395 300
390 3300048924 Ga0496121_0051254 Ga0496121_0051254_2172_3143 300
391 3300049568 Ga0501031_0010575 Ga0501031_0010575_1063_2031 300
392 3300049575 Ga0501039_0068905 Ga0501039_0068905_104_1072 300
393 3300049577 Ga0501041_0031944 Ga0501041_0031944_1796_2764 300
394 3300049582 Ga0501048_0051449 Ga0501048_0051449_484_1452 300
395 3300049584 Ga0501068_0089473 Ga0501068_0089473_852_1814 300
396 3300049586 Ga0501070_0442685 Ga0501070_0442685_67_1035 300
397 3300049587 Ga0501071_0030061 Ga0501071_0030061_1851_2819 300
398 3300049588 Ga0501072_0062732 Ga0501072_0062732_1678_2646 300
399 3300049588 Ga0501072_0192515 Ga0501072_0192515_452_1420 300
400 3300049590 Ga0501074_0129328 Ga0501074_0129328_739_1707 300
401 3300049591 Ga0501075_0049705 Ga0501075_0049705_1672_2640 300
402 3300049593 Ga0501077_0110823 Ga0501077_0110823_368_1336 300
403 3300049741 Ga0501079_0041556 Ga0501079_0041556_2134_3102 300
404 3300049824 Ga0501045_0220725 Ga0501045_0220725_64_1032 300
405 3300050507 nmdc:mga05p37_15634_c1 nmdc:mga05p37_15634_c1_1637_2602 300
406 3300050510 nmdc:mga06r32_118032_c1 nmdc:mga06r32_118032_c1_128_1102 300
407 3300050511 nmdc:mga08y16_10979_c1 nmdc:mga08y16_10979_c1_3592_4560 300
408 3300050511 nmdc:mga08y16_305620_c1 nmdc:mga08y16_305620_c1_49_1014 300
409 3300053077 Ga0495601_0159200 Ga0495601_0159200_502_1464 300
410 3300053077 Ga0495601_0207466 Ga0495601_0207466_86_1054 300
411 3300053083 Ga0495655_0005267 Ga0495655_0005267_351_1313 300
412 3300053083 Ga0495655_0019605 Ga0495655_0019605_490_1464 300
413 3300053084 Ga0495595_0000690 Ga0495595_0000690_8605_9573 300
414 3300053085 Ga0495619_0000067 Ga0495619_0000067_46134_47096 300
415 3300053153 Ga0500616_0048757 Ga0500616_0048757_715_1683 300
416 3300059423 Ga0590074_019718 Ga0590074_019718_133_1101 300
417 3300059426 Ga0590077_029049 Ga0590077_029049_121_1089 300
418 3300060353 Ga0501082_0070814 Ga0501082_0070814_2009_2977 300
419 3300061719 Ga0466962_0007808 Ga0466962_0007808_629_1594 300
420 3300000546 LJNas_1003365 LJNas_10033651 301
421 3300001977 JGI24746J21847_1000941 JGI24746J21847_10009416 301
422 3300002074 JGI24748J21848_1000576 JGI24748J21848_10005762 301
423 3300002239 JGI24034J26672_10000425 JGI24034J26672_100004256 301
424 3300002244 JGI24742J22300_10000739 JGI24742J22300_100007395 301
425 3300003373 JGI25407J50210_10000241 JGI25407J50210_100002418 301
426 3300003373 JGI25407J50210_10002334 JGI25407J50210_100023345 301
427 3300003373 JGI25407J50210_10007428 JGI25407J50210_100074282 301
428 3300005327 Ga0070658_10024325 Ga0070658_100243256 301
429 3300005329 Ga0070683_100001231 Ga0070683_10000123117 301
430 3300005329 Ga0070683_100017321 Ga0070683_1000173216 301
431 3300005329 Ga0070683_100198873 Ga0070683_1001988731 301
432 3300005335 Ga0070666_10018742 Ga0070666_100187422 301
433 3300005337 Ga0070682_100028676 Ga0070682_1000286762 301
434 3300005338 Ga0068868_100050568 Ga0068868_1000505681 301
435 3300005338 Ga0068868_100345810 Ga0068868_1003458101 301
436 3300005340 Ga0070689_100457795 Ga0070689_1004577951 301
437 3300005341 Ga0070691_10000004 Ga0070691_1000000483 301
438 3300005343 Ga0070687_100044085 Ga0070687_1000440854 301
439 3300005344 Ga0070661_100000110 Ga0070661_10000011050 301
440 3300005344 Ga0070661_100313458 Ga0070661_1003134581 301
441 3300005345 Ga0070692_10004822 Ga0070692_100048221 301
442 3300005345 Ga0070692_10055968 Ga0070692_100559682 301
443 3300005347 Ga0070668_100009891 Ga0070668_1000098914 301
444 3300005353 Ga0070669_100008089 Ga0070669_1000080898 301
445 3300005354 Ga0070675_100000091 Ga0070675_10000009135 301
446 3300005354 Ga0070675_100040732 Ga0070675_1000407326 301
447 3300005365 Ga0070688_100000077 Ga0070688_10000007712 301
448 3300005365 Ga0070688_100000937 Ga0070688_1000009375 301
449 3300005365 Ga0070688_100010454 Ga0070688_1000104546 301
450 3300005365 Ga0070688_100082357 Ga0070688_1000823573 301
451 3300005365 Ga0070688_100169927 Ga0070688_1001699272 301
452 3300005366 Ga0070659_100000026 Ga0070659_100000026110 301
453 3300005366 Ga0070659_100005636 Ga0070659_1000056369 301
454 3300005367 Ga0070667_100083799 Ga0070667_1000837994 301
455 3300005434 Ga0070709_10175990 Ga0070709_101759902 301
456 3300005435 Ga0070714_100000083 Ga0070714_10000008327 301
457 3300005435 Ga0070714_100047079 Ga0070714_1000470793 301
458 3300005436 Ga0070713_100000135 Ga0070713_10000013539 301
459 3300005437 Ga0070710_10000008 Ga0070710_1000000888 301
460 3300005437 Ga0070710_10047985 Ga0070710_100479851 301
461 3300005437 Ga0070710_10063380 Ga0070710_100633802 301
462 3300005439 Ga0070711_100001500 Ga0070711_1000015004 301
463 3300005439 Ga0070711_100049540 Ga0070711_1000495403 301
464 3300005440 Ga0070705_100000405 Ga0070705_1000004055 301
465 3300005440 Ga0070705_100082905 Ga0070705_1000829051 301
466 3300005441 Ga0070700_100000678 Ga0070700_10000067821 301
467 3300005455 Ga0070663_100002413 Ga0070663_1000024131 301
468 3300005456 Ga0070678_100044344 Ga0070678_1000443446 301
469 3300005457 Ga0070662_100216048 Ga0070662_1002160482 301
470 3300005466 Ga0070685_10000061 Ga0070685_1000006116 301
471 3300005466 Ga0070685_10000965 Ga0070685_1000096517 301
472 3300005466 Ga0070685_10186359 Ga0070685_101863592 301
473 3300005466 Ga0070685_10224276 Ga0070685_102242761 301
474 3300005530 Ga0070679_100027205 Ga0070679_1000272051 301
475 3300005535 Ga0070684_100012176 Ga0070684_1000121766 301
476 3300005543 Ga0070672_100000005 Ga0070672_10000000588 301
477 3300005544 Ga0070686_100028068 Ga0070686_1000280682 301
478 3300005546 Ga0070696_100420076 Ga0070696_1004200761 301
479 3300005548 Ga0070665_100006490 Ga0070665_1000064907 301
480 3300005548 Ga0070665_100114028 Ga0070665_1001140282 301
481 3300005564 Ga0070664_100105826 Ga0070664_1001058262 301
482 3300005578 Ga0068854_100244806 Ga0068854_1002448062 301
483 3300005614 Ga0068856_100005996 Ga0068856_1000059968 301
484 3300005614 Ga0068856_100171649 Ga0068856_1001716494 301
485 3300005615 Ga0070702_100005981 Ga0070702_1000059814 301
486 3300005616 Ga0068852_100000037 Ga0068852_10000003741 301
487 3300005616 Ga0068852_100008426 Ga0068852_1000084266 301
488 3300005616 Ga0068852_100009794 Ga0068852_1000097947 301
489 3300005618 Ga0068864_100000043 Ga0068864_100000043124 301
490 3300005618 Ga0068864_100144773 Ga0068864_1001447732 301
491 3300005718 Ga0068866_10000645 Ga0068866_100006459 301
492 3300005834 Ga0068851_10119137 Ga0068851_101191372 301
493 3300005841 Ga0068863_100004891 Ga0068863_1000048915 301
494 3300005841 Ga0068863_100022537 Ga0068863_1000225376 301
495 3300005842 Ga0068858_100000046 Ga0068858_1000000466 301
496 3300005843 Ga0068860_100002786 Ga0068860_1000027862 301
497 3300005844 Ga0068862_100320521 Ga0068862_1003205212 301
498 3300005937 Ga0081455_10005837 Ga0081455_100058379 301
499 3300005937 Ga0081455_10167081 Ga0081455_101670813 301
500 3300005981 Ga0081538_10000042 Ga0081538_100000423 301
501 3300005981 Ga0081538_10000270 Ga0081538_1000027041 301
502 3300005981 Ga0081538_10001012 Ga0081538_1000101226 301
503 3300005981 Ga0081538_10009117 Ga0081538_100091172 301
504 3300005981 Ga0081538_10032355 Ga0081538_100323555 301
505 3300005981 Ga0081538_10080216 Ga0081538_100802163 301
506 3300005983 Ga0081540_1000855 Ga0081540_100085527 301
507 3300005983 Ga0081540_1001971 Ga0081540_100197110 301
508 3300005985 Ga0081539_10002753 Ga0081539_1000275332 301
509 3300005985 Ga0081539_10006174 Ga0081539_100061747 301
510 3300005985 Ga0081539_10017623 Ga0081539_100176237 301
511 3300006028 Ga0070717_10000004 Ga0070717_1000000492 301
512 3300006028 Ga0070717_10023884 Ga0070717_100238844 301
513 3300006028 Ga0070717_10037727 Ga0070717_100377275 301
514 3300006038 Ga0075365_10046083 Ga0075365_100460833 301
515 3300006038 Ga0075365_10239732 Ga0075365_102397322 301
516 3300006051 Ga0075364_10129562 Ga0075364_101295622 301
517 3300006058 Ga0075432_10007258 Ga0075432_100072585 301
518 3300006175 Ga0070712_100000008 Ga0070712_10000000862 301
519 3300006175 Ga0070712_100005477 Ga0070712_1000054776 301
520 3300006175 Ga0070712_100011732 Ga0070712_1000117322 301
521 3300006175 Ga0070712_100025870 Ga0070712_1000258706 301
522 3300006237 Ga0097621_100124621 Ga0097621_1001246211 301
523 3300006846 Ga0075430_100000024 Ga0075430_10000002462 301
524 3300006846 Ga0075430_100014081 Ga0075430_1000140817 301
525 3300006847 Ga0075431_100016543 Ga0075431_1000165435 301
526 3300006847 Ga0075431_100025100 Ga0075431_1000251004 301
527 3300006852 Ga0075433_10063177 Ga0075433_100631777 301
528 3300006871 Ga0075434_100201644 Ga0075434_1002016443 301
529 3300006880 Ga0075429_100004701 Ga0075429_10000470113 301
530 3300009011 Ga0105251_10054195 Ga0105251_100541953 301
531 3300009093 Ga0105240_10046441 Ga0105240_100464414 301
532 3300009094 Ga0111539_10082333 Ga0111539_100823331 301
533 3300009098 Ga0105245_10001641 Ga0105245_100016418 301
534 3300009098 Ga0105245_10004571 Ga0105245_100045712 301
535 3300009098 Ga0105245_10468362 Ga0105245_104683622 301
536 3300009101 Ga0105247_10000591 Ga0105247_100005917 301
537 3300009147 Ga0114129_10003125 Ga0114129_1000312528 301
538 3300009147 Ga0114129_10317706 Ga0114129_103177064 301
539 3300009147 Ga0114129_10438886 Ga0114129_104388862 301
540 3300009148 Ga0105243_10028842 Ga0105243_100288426 301
541 3300009174 Ga0105241_10142534 Ga0105241_101425342 301
542 3300009176 Ga0105242_10000052 Ga0105242_1000005263 301
543 3300009176 Ga0105242_10008495 Ga0105242_100084956 301
544 3300009176 Ga0105242_10131466 Ga0105242_101314662 301
545 3300009176 Ga0105242_10137973 Ga0105242_101379732 301
546 3300009176 Ga0105242_10358114 Ga0105242_103581141 301
547 3300009177 Ga0105248_10000017 Ga0105248_10000017264 301
548 3300009545 Ga0105237_10005947 Ga0105237_100059478 301
549 3300009545 Ga0105237_10212784 Ga0105237_102127843 301
550 3300009545 Ga0105237_10373415 Ga0105237_103734151 301
551 3300009551 Ga0105238_10147044 Ga0105238_101470443 301
552 3300009553 Ga0105249_10043801 Ga0105249_100438012 301
553 3300010375 Ga0105239_10032590 Ga0105239_100325908 301
554 3300010375 Ga0105239_10195947 Ga0105239_101959473 301
555 3300013102 Ga0157371_10088324 Ga0157371_100883243 301
556 3300013104 Ga0157370_10032916 Ga0157370_100329162 301
557 3300013105 Ga0157369_10000105 Ga0157369_1000010534 301
558 3300013105 Ga0157369_10112813 Ga0157369_101128133 301
559 3300013105 Ga0157369_10400458 Ga0157369_104004582 301
560 3300013296 Ga0157374_10014025 Ga0157374_100140259 301
561 3300013297 Ga0157378_10016184 Ga0157378_100161842 301
562 3300013306 Ga0163162_10155764 Ga0163162_101557641 301
563 3300013307 Ga0157372_10047612 Ga0157372_100476126 301
564 3300013308 Ga0157375_10307641 Ga0157375_103076411 301
565 3300014326 Ga0157380_10269558 Ga0157380_102695582 301
566 3300014497 Ga0182008_10129764 Ga0182008_101297642 301
567 3300014745 Ga0157377_10003359 Ga0157377_100033591 301
568 3300014745 Ga0157377_10034398 Ga0157377_100343982 301
569 3300014968 Ga0157379_10005656 Ga0157379_100056567 301
570 3300014968 Ga0157379_10089872 Ga0157379_100898724 301
571 3300014969 Ga0157376_10006598 Ga0157376_100065983 301
572 3300014969 Ga0157376_10020347 Ga0157376_100203473 301
573 3300017792 Ga0163161_10000064 Ga0163161_1000006449 301
574 3300017792 Ga0163161_10077888 Ga0163161_100778881 301
575 3300020076 Ga0206355_1314388 Ga0206355_13143883 301
576 3300020610 Ga0154015_1473514 Ga0154015_14735142 301
577 3300021358 Ga0213873_10022808 Ga0213873_100228082 301
578 3300021377 Ga0213874_10000172 Ga0213874_100001728 301
579 3300021377 Ga0213874_10005393 Ga0213874_100053932 301
580 3300021377 Ga0213874_10014761 Ga0213874_100147611 301
581 3300021384 Ga0213876_10012939 Ga0213876_100129395 301
582 3300021384 Ga0213876_10016479 Ga0213876_100164793 301
583 3300021384 Ga0213876_10016638 Ga0213876_100166384 301
584 3300021384 Ga0213876_10049870 Ga0213876_100498702 301
585 3300021384 Ga0213876_10156666 Ga0213876_101566661 301
586 3300021388 Ga0213875_10000050 Ga0213875_10000050134 301
587 3300021388 Ga0213875_10009480 Ga0213875_100094801 301
588 3300021388 Ga0213875_10043490 Ga0213875_100434901 301
589 3300025735 Ga0207713_1068109 Ga0207713_10681092 301
590 3300025898 Ga0207692_10000006 Ga0207692_10000006262 301
591 3300025898 Ga0207692_10071283 Ga0207692_100712832 301
592 3300025899 Ga0207642_10015523 Ga0207642_100155233 301
593 3300025900 Ga0207710_10000684 Ga0207710_100006849 301
594 3300025901 Ga0207688_10002310 Ga0207688_100023106 301
595 3300025903 Ga0207680_10002263 Ga0207680_100022639 301
596 3300025906 Ga0207699_10063405 Ga0207699_100634051 301
597 3300025913 Ga0207695_10014458 Ga0207695_100144584 301
598 3300025914 Ga0207671_10004620 Ga0207671_100046208 301
599 3300025914 Ga0207671_10149884 Ga0207671_101498843 301
600 3300025915 Ga0207693_10000002 Ga0207693_10000002279 301
601 3300025915 Ga0207693_10001233 Ga0207693_1000123324 301
602 3300025916 Ga0207663_10001162 Ga0207663_1000116215 301
603 3300025916 Ga0207663_10033866 Ga0207663_100338664 301
604 3300025918 Ga0207662_10041964 Ga0207662_100419643 301
605 3300025919 Ga0207657_10047518 Ga0207657_100475182 301
606 3300025920 Ga0207649_10000015 Ga0207649_10000015232 301
607 3300025920 Ga0207649_10276310 Ga0207649_102763102 301
608 3300025920 Ga0207649_10282229 Ga0207649_102822291 301
609 3300025921 Ga0207652_10006391 Ga0207652_100063919 301
610 3300025923 Ga0207681_10006067 Ga0207681_100060673 301
611 3300025923 Ga0207681_10211717 Ga0207681_102117172 301
612 3300025926 Ga0207659_10000147 Ga0207659_1000014728 301
613 3300025926 Ga0207659_10303840 Ga0207659_103038401 301
614 3300025927 Ga0207687_10000040 Ga0207687_1000004059 301
615 3300025927 Ga0207687_10053372 Ga0207687_100533721 301
616 3300025928 Ga0207700_10000003 Ga0207700_10000003116 301
617 3300025928 Ga0207700_10062318 Ga0207700_100623181 301
618 3300025929 Ga0207664_10000006 Ga0207664_10000006302 301
619 3300025929 Ga0207664_10014457 Ga0207664_100144571 301
620 3300025929 Ga0207664_10051077 Ga0207664_100510775 301
621 3300025929 Ga0207664_10089505 Ga0207664_100895054 301
622 3300025931 Ga0207644_10372351 Ga0207644_103723511 301
623 3300025932 Ga0207690_10000017 Ga0207690_100000179 301
624 3300025932 Ga0207690_10004100 Ga0207690_1000410010 301
625 3300025933 Ga0207706_10029063 Ga0207706_100290632 301
626 3300025934 Ga0207686_10000119 Ga0207686_1000011949 301
627 3300025934 Ga0207686_10003997 Ga0207686_100039975 301
628 3300025934 Ga0207686_10024972 Ga0207686_100249721 301
629 3300025935 Ga0207709_10001985 Ga0207709_1000198513 301
630 3300025937 Ga0207669_10000029 Ga0207669_1000002955 301
631 3300025939 Ga0207665_10219133 Ga0207665_102191332 301
632 3300025940 Ga0207691_10000028 Ga0207691_1000002842 301
633 3300025940 Ga0207691_10194693 Ga0207691_101946933 301
634 3300025941 Ga0207711_10000011 Ga0207711_10000011311 301
635 3300025941 Ga0207711_10049898 Ga0207711_100498982 301
636 3300025942 Ga0207689_10134061 Ga0207689_101340612 301
637 3300025944 Ga0207661_10000714 Ga0207661_1000071417 301
638 3300025944 Ga0207661_10003496 Ga0207661_1000349613 301
639 3300025944 Ga0207661_10015312 Ga0207661_100153125 301
640 3300025944 Ga0207661_10486988 Ga0207661_104869881 301
641 3300025945 Ga0207679_10202261 Ga0207679_102022612 301
642 3300025945 Ga0207679_10360355 Ga0207679_103603551 301
643 3300025949 Ga0207667_10216613 Ga0207667_102166132 301
644 3300025961 Ga0207712_10085544 Ga0207712_100855442 301
645 3300025961 Ga0207712_10118328 Ga0207712_101183282 301
646 3300026023 Ga0207677_10009593 Ga0207677_100095934 301
647 3300026067 Ga0207678_10009775 Ga0207678_100097754 301
648 3300026067 Ga0207678_10033110 Ga0207678_100331101 301
649 3300026067 Ga0207678_10101339 Ga0207678_101013392 301
650 3300026075 Ga0207708_10009551 Ga0207708_100095517 301
651 3300026075 Ga0207708_10022857 Ga0207708_100228572 301
652 3300026075 Ga0207708_10061545 Ga0207708_100615454 301
653 3300026078 Ga0207702_10003502 Ga0207702_1000350217 301
654 3300026078 Ga0207702_10296520 Ga0207702_102965202 301
655 3300026088 Ga0207641_10001193 Ga0207641_1000119316 301
656 3300026088 Ga0207641_10002149 Ga0207641_100021497 301
657 3300026089 Ga0207648_10307674 Ga0207648_103076742 301
658 3300026095 Ga0207676_10000042 Ga0207676_1000004246 301
659 3300026116 Ga0207674_10173692 Ga0207674_101736922 301
660 3300026116 Ga0207674_10286741 Ga0207674_102867412 301
661 3300026118 Ga0207675_100014737 Ga0207675_1000147376 301
662 3300026118 Ga0207675_100217962 Ga0207675_1002179623 301
663 3300026121 Ga0207683_10003514 Ga0207683_100035146 301
664 3300026121 Ga0207683_10335749 Ga0207683_103357492 301
665 3300026142 Ga0207698_10000015 Ga0207698_10000015163 301
666 3300026142 Ga0207698_10018608 Ga0207698_100186081 301
667 3300027907 Ga0207428_10045873 Ga0207428_100458735 301
668 3300028556 Ga0265337_1000061 Ga0265337_100006127 301
669 3300028556 Ga0265337_1001815 Ga0265337_10018155 301
670 3300028558 Ga0265326_10000016 Ga0265326_10000016120 301
671 3300028558 Ga0265326_10000067 Ga0265326_1000006716 301
672 3300028558 Ga0265326_10001279 Ga0265326_100012796 301
673 3300028563 Ga0265319_1000796 Ga0265319_10007967 301
674 3300028563 Ga0265319_1000847 Ga0265319_100084722 301
675 3300028563 Ga0265319_1011920 Ga0265319_10119204 301
676 3300028573 Ga0265334_10000003 Ga0265334_1000000310 301
677 3300028577 Ga0265318_10000961 Ga0265318_100009619 301
678 3300028577 Ga0265318_10011281 Ga0265318_100112812 301
679 3300028654 Ga0265322_10000005 Ga0265322_1000000593 301
680 3300028666 Ga0265336_10000060 Ga0265336_1000006094 301
681 3300028800 Ga0265338_10000234 Ga0265338_1000023495 301
682 3300028800 Ga0265338_10005421 Ga0265338_100054216 301
683 3300028800 Ga0265338_10019449 Ga0265338_100194495 301
684 3300029957 Ga0265324_10000510 Ga0265324_1000051019 301
685 3300029957 Ga0265324_10007611 Ga0265324_100076113 301
686 3300030521 Ga0307511_10073950 Ga0307511_100739502 301
687 3300031238 Ga0265332_10023029 Ga0265332_100230294 301
688 3300031239 Ga0265328_10000563 Ga0265328_100005636 301
689 3300031240 Ga0265320_10000010 Ga0265320_10000010139 301
690 3300031240 Ga0265320_10001744 Ga0265320_1000174414 301
691 3300031247 Ga0265340_10000014 Ga0265340_1000001419 301
692 3300031250 Ga0265331_10003612 Ga0265331_100036126 301
693 3300031251 Ga0265327_10000040 Ga0265327_10000040167 301
694 3300031251 Ga0265327_10007890 Ga0265327_100078905 301
695 3300031251 Ga0265327_10014680 Ga0265327_100146805 301
696 3300031251 Ga0265327_10053485 Ga0265327_100534852 301
697 3300031344 Ga0265316_10301836 Ga0265316_103018362 301
698 3300031711 Ga0265314_10000208 Ga0265314_1000020873 301
699 3300031711 Ga0265314_10022037 Ga0265314_100220375 301
700 3300031711 Ga0265314_10063741 Ga0265314_100637413 301
701 3300031852 Ga0307410_10052995 Ga0307410_100529954 301
702 3300031901 Ga0307406_10051417 Ga0307406_100514174 301
703 3300031995 Ga0307409_100040412 Ga0307409_1000404122 301
704 3300032002 Ga0307416_100080230 Ga0307416_1000802303 301
705 3300035172 Ga0373955_0133634 Ga0373955_0133634_81_1046 301
706 3300035241 Ga0373961_0030544 Ga0373961_0030544_502_1479 301
707 3300035691 Ga0373931_0025368 Ga0373931_0025368_37_1008 301
708 3300036401 Ga0373937_0001667 Ga0373937_0001667_17402_18367 301
709 3300036401 Ga0373937_0508124 Ga0373937_0508124_11_982 301
710 3300037418 Ga0395900_0058250 Ga0395900_0058250_2162_3136 301
711 3300037418 Ga0395900_0268389 Ga0395900_0268389_266_1240 301
712 3300037466 Ga0395898_0049471 Ga0395898_0049471_868_1842 301
713 3300037466 Ga0395898_0151434 Ga0395898_0151434_1122_2096 301
714 3300037466 Ga0395898_0289935 Ga0395898_0289935_565_1539 301
715 3300037471 Ga0395905_0259976 Ga0395905_0259976_319_1293 301
716 3300037853 Ga0436364_0038128 Ga0436364_0038128_30725_31696 301
717 3300037853 Ga0436364_0216710 Ga0436364_0216710_1860_2831 301
718 3300037853 Ga0436364_0363596 Ga0436364_0363596_3195_4166 301
719 3300037853 Ga0436364_0378806 Ga0436364_0378806_361_1332 301
720 3300037853 Ga0436364_0532382 Ga0436364_0532382_20846_21817 301
721 3300037853 Ga0436364_0645424 Ga0436364_0645424_7787_8758 301
722 3300037853 Ga0436364_0857403 Ga0436364_0857403_3681_4652 301
723 3300037853 Ga0436364_1002783 Ga0436364_1002783_794_1765 301
724 3300037853 Ga0436364_1290040 Ga0436364_1290040_3551_4522 301
725 3300037853 Ga0436364_1552666 Ga0436364_1552666_66_1037 301
726 3300039437 Ga0436365_0235777 Ga0436365_0235777_7118_8089 301
727 3300039437 Ga0436365_0561226 Ga0436365_0561226_97_1068 301
728 3300039437 Ga0436365_0656722 Ga0436365_0656722_6569_7540 301
729 3300039437 Ga0436365_0725610 Ga0436365_0725610_282_1253 301
730 3300039437 Ga0436365_0730546 Ga0436365_0730546_908_2020 301
731 3300039437 Ga0436365_1012617 Ga0436365_1012617_54_1025 301
732 3300039437 Ga0436365_1022230 Ga0436365_1022230_488_1459 301
733 3300039437 Ga0436365_1104539 Ga0436365_1104539_6574_7545 301
734 3300039437 Ga0436365_1199460 Ga0436365_1199460_1272_2243 301
735 3300039437 Ga0436365_1704131 Ga0436365_1704131_1976_2947 301
736 3300039450 Ga0436363_0116001 Ga0436363_0116001_33896_34867 301
737 3300039450 Ga0436363_1208092 Ga0436363_1208092_97_1068 301
738 3300039450 Ga0436363_1218786 Ga0436363_1218786_28_999 301
739 3300039450 Ga0436363_1432146 Ga0436363_1432146_3150_4121 301
740 3300039450 Ga0436363_1478257 Ga0436363_1478257_189_1160 301
741 3300039450 Ga0436363_1499638 Ga0436363_1499638_7998_8969 301
742 3300039453 Ga0436362_0046940 Ga0436362_0046940_94_1065 301
743 3300039453 Ga0436362_0681159 Ga0436362_0681159_77_1048 301
744 3300039453 Ga0436362_0885374 Ga0436362_0885374_674_1645 301
745 3300039453 Ga0436362_0920455 Ga0436362_0920455_206_1177 301
746 3300039453 Ga0436362_0949373 Ga0436362_0949373_1735_2706 301
747 3300041512 Ga0451853_2799129 Ga0451853_2799129_433_1398 301
748 3300044683 Ga0466965_0046560 Ga0466965_0046560_531_1502 301
749 3300044684 Ga0466966_0054784 Ga0466966_0054784_190_1161 301
750 3300044693 Ga0466961_0019145 Ga0466961_0019145_1421_2392 301
751 3300044694 Ga0466963_0000415 Ga0466963_0000415_8257_9228 301
752 3300044694 Ga0466963_0019699 Ga0466963_0019699_2861_3832 301
753 3300044694 Ga0466963_0021672 Ga0466963_0021672_1431_2402 301
754 3300044694 Ga0466963_0025064 Ga0466963_0025064_489_1460 301
755 3300044694 Ga0466963_0037627 Ga0466963_0037627_828_1799 301
756 3300044694 Ga0466963_0060675 Ga0466963_0060675_878_1849 301
757 3300044706 Ga0466964_0016934 Ga0466964_0016934_1605_2576 301
758 3300044719 Ga0466971_0036989 Ga0466971_0036989_753_1724 301
759 3300044719 Ga0466971_0052608 Ga0466971_0052608_188_1159 301
760 3300044719 Ga0466971_0162134 Ga0466971_0162134_32_1003 301
761 3300044735 Ga0466968_0019494 Ga0466968_0019494_156_1127 301
762 3300044735 Ga0466968_0019833 Ga0466968_0019833_380_1351 301
763 3300044735 Ga0466968_0036147 Ga0466968_0036147_765_1736 301
764 3300044765 Ga0466970_0035604 Ga0466970_0035604_43_1014 301
765 3300044842 Ga0466957_0001280 Ga0466957_0001280_10049_11020 301
766 3300044842 Ga0466957_0065408 Ga0466957_0065408_1200_2171 301
767 3300044842 Ga0466957_0069438 Ga0466957_0069438_498_1469 301
768 3300044842 Ga0466957_0141908 Ga0466957_0141908_549_1520 301
769 3300044901 Ga0466960_0000004 Ga0466960_0000004_13577_14551 301
770 3300044901 Ga0466960_0009744 Ga0466960_0009744_1300_2274 301
771 3300044901 Ga0466960_0037582 Ga0466960_0037582_316_1290 301
772 3300044901 Ga0466960_0081124 Ga0466960_0081124_314_1288 301
773 3300045049 Ga0466959_0002714 Ga0466959_0002714_5058_6029 301
774 3300045049 Ga0466959_0049699 Ga0466959_0049699_1887_2858 301
775 3300045049 Ga0466959_0081306 Ga0466959_0081306_316_1287 301
776 3300045049 Ga0466959_0177297 Ga0466959_0177297_466_1437 301
777 3300045836 Ga0466958_0000711 Ga0466958_0000711_9001_9972 301
778 3300045836 Ga0466958_0009077 Ga0466958_0009077_2669_3640 301
779 3300045836 Ga0466958_0013426 Ga0466958_0013426_2860_3831 301
780 3300045836 Ga0466958_0015229 Ga0466958_0015229_3264_4235 301
781 3300045836 Ga0466958_0045373 Ga0466958_0045373_1123_2094 301
782 3300045836 Ga0466958_0097444 Ga0466958_0097444_228_1199 301
783 3300045836 Ga0466958_0156801 Ga0466958_0156801_284_1255 301
784 3300045836 Ga0466958_0158307 Ga0466958_0158307_261_1232 301
785 3300045976 Ga0466967_0061214 Ga0466967_0061214_789_1760 301
786 3300045976 Ga0466967_0074790 Ga0466967_0074790_801_1778 301
787 3300045976 Ga0466967_0168574 Ga0466967_0168574_469_1443 301
788 3300045976 Ga0466967_0196676 Ga0466967_0196676_918_1889 301
789 3300046454 Ga0495592_0000176 Ga0495592_0000176_55241_56221 301
790 3300046459 Ga0495629_0000806 Ga0495629_0000806_19494_20459 301
791 3300046459 Ga0495629_0003436 Ga0495629_0003436_8403_9368 301
792 3300046459 Ga0495629_0012055 Ga0495629_0012055_3656_4624 301
793 3300046459 Ga0495629_0041278 Ga0495629_0041278_1472_2437 301
794 3300046460 Ga0495638_0087005 Ga0495638_0087005_458_1423 301
795 3300046462 Ga0495651_0184032 Ga0495651_0184032_340_1305 301
796 3300046463 Ga0495653_0000231 Ga0495653_0000231_32233_33204 301
797 3300046463 Ga0495653_0052740 Ga0495653_0052740_315_1295 301
798 3300046471 Ga0495650_0000035 Ga0495650_0000035_145498_146472 301
799 3300046476 Ga0495662_0000051 Ga0495662_0000051_5625_6605 301
800 3300046477 Ga0495664_0000086 Ga0495664_0000086_22897_23868 301
801 3300046491 Ga0495584_0125085 Ga0495584_0125085_168_1136 301
802 3300046507 Ga0495606_0000895 Ga0495606_0000895_36802_37767 301
803 3300046511 Ga0495608_0000013 Ga0495608_0000013_159642_160607 301
804 3300046511 Ga0495608_0000092 Ga0495608_0000092_15963_16943 301
805 3300046514 Ga0495618_0000054 Ga0495618_0000054_23909_24880 301
806 3300046514 Ga0495618_0000094 Ga0495618_0000094_45912_46892 301
807 3300046515 Ga0495620_0084845 Ga0495620_0084845_84_1049 301
808 3300046516 Ga0495628_0002492 Ga0495628_0002492_2087_3052 301
809 3300046516 Ga0495628_0120326 Ga0495628_0120326_381_1346 301
810 3300046517 Ga0495630_0000032 Ga0495630_0000032_15779_16744 301
811 3300046517 Ga0495630_0000328 Ga0495630_0000328_36679_37650 301
812 3300046517 Ga0495630_0001088 Ga0495630_0001088_14737_15702 301
813 3300046517 Ga0495630_0005122 Ga0495630_0005122_8045_9025 301
814 3300046517 Ga0495630_0054464 Ga0495630_0054464_390_1361 301
815 3300046520 Ga0495637_0112337 Ga0495637_0112337_36_1010 301
816 3300046523 Ga0495644_0002998 Ga0495644_0002998_3325_4305 301
817 3300046529 Ga0495652_0000018 Ga0495652_0000018_148247_149212 301
818 3300046529 Ga0495652_0001501 Ga0495652_0001501_12091_13056 301
819 3300046533 Ga0495640_0006754 Ga0495640_0006754_3603_4583 301
820 3300046536 Ga0495587_0028299 Ga0495587_0028299_1458_2423 301
821 3300046536 Ga0495587_0075141 Ga0495587_0075141_443_1408 301
822 3300046543 Ga0495645_0000088 Ga0495645_0000088_34630_35601 301
823 3300046543 Ga0495645_0000535 Ga0495645_0000535_22563_23534 301
824 3300046543 Ga0495645_0055112 Ga0495645_0055112_1638_2603 301
825 3300046559 Ga0495667_0055519 Ga0495667_0055519_1171_2136 301
826 3300046615 Ga0495656_0001416 Ga0495656_0001416_38_1003 301
827 3300046616 Ga0495668_0160379 Ga0495668_0160379_101_1081 301
828 3300046642 Ga0495634_0000002 Ga0495634_0000002_65391_66356 301
829 3300046642 Ga0495634_0000191 Ga0495634_0000191_12651_13616 301
830 3300046642 Ga0495634_0016540 Ga0495634_0016540_1322_2287 301
831 3300046642 Ga0495634_0165686 Ga0495634_0165686_107_1072 301
832 3300046663 Ga0495635_0000182 Ga0495635_0000182_6202_7182 301
833 3300046663 Ga0495635_0097359 Ga0495635_0097359_237_1202 301
834 3300046674 Ga0495588_0000266 Ga0495588_0000266_15744_16709 301
835 3300046675 Ga0495657_0000003 Ga0495657_0000003_210841_211806 301
836 3300046675 Ga0495657_0000006 Ga0495657_0000006_148554_149525 301
837 3300046678 Ga0495599_0174331 Ga0495599_0174331_27_1007 301
838 3300046680 Ga0495646_0066231 Ga0495646_0066231_360_1331 301
839 3300046681 Ga0495647_0001427 Ga0495647_0001427_1629_2609 301
840 3300046681 Ga0495647_0011078 Ga0495647_0011078_148_1113 301
841 3300046683 Ga0495658_0112517 Ga0495658_0112517_99_1079 301
842 3300046684 Ga0495669_0000188 Ga0495669_0000188_930_1910 301
843 3300046684 Ga0495669_0013142 Ga0495669_0013142_1770_2735 301
844 3300046689 Ga0495613_0000173 Ga0495613_0000173_47369_48349 301
845 3300046689 Ga0495613_0000233 Ga0495613_0000233_5146_6111 301
846 3300046690 Ga0495624_0000563 Ga0495624_0000563_11721_12686 301
847 3300046809 Ga0495600_0002279 Ga0495600_0002279_2069_3049 301
848 3300046809 Ga0495600_0015795 Ga0495600_0015795_1038_2009 301
849 3300046809 Ga0495600_0105089 Ga0495600_0105089_41_1021 301
850 3300047317 Ga0495604_0000509 Ga0495604_0000509_30188_31153 301
851 3300047317 Ga0495604_0101081 Ga0495604_0101081_1104_2069 301
852 3300047318 Ga0495636_0127956 Ga0495636_0127956_64_1038 301
853 3300047319 Ga0495674_0194058 Ga0495674_0194058_420_1391 301
854 3300047321 Ga0495676_0009275 Ga0495676_0009275_3973_4938 301
855 3300047321 Ga0495676_0250948 Ga0495676_0250948_69_1034 301
856 3300047322 Ga0495680_0000113 Ga0495680_0000113_50558_51538 301
857 3300047322 Ga0495680_0074534 Ga0495680_0074534_1116_2087 301
858 3300047444 Ga0495675_0000002 Ga0495675_0000002_210841_211806 301
859 3300047471 Ga0495684_0002596 Ga0495684_0002596_6367_7338 301
860 3300048088 Ga0495602_0000034 Ga0495602_0000034_23875_24840 301
861 3300048088 Ga0495602_0000315 Ga0495602_0000315_31748_32713 301
862 3300048903 Ga0496100_0000001 Ga0496100_0000001_24911_25876 301
863 3300048903 Ga0496100_0000234 Ga0496100_0000234_3296_4276 301
864 3300048903 Ga0496100_0008447 Ga0496100_0008447_780_1751 301
865 3300048904 Ga0496101_0000028 Ga0496101_0000028_24900_25865 301
866 3300048904 Ga0496101_0000382 Ga0496101_0000382_3296_4276 301
867 3300048905 Ga0496102_0000096 Ga0496102_0000096_72282_73253 301
868 3300048905 Ga0496102_0000129 Ga0496102_0000129_63162_64127 301
869 3300048905 Ga0496102_0047357 Ga0496102_0047357_2493_3467 301
870 3300048906 Ga0496103_0000035 Ga0496103_0000035_72095_73066 301
871 3300048906 Ga0496103_0000087 Ga0496103_0000087_63160_64125 301
872 3300048906 Ga0496103_0027889 Ga0496103_0027889_455_1432 301
873 3300048907 Ga0496104_0000010 Ga0496104_0000010_278943_279908 301
874 3300048907 Ga0496104_0000028 Ga0496104_0000028_2794_3765 301
875 3300048907 Ga0496104_0013374 Ga0496104_0013374_2690_3664 301
876 3300048907 Ga0496104_0043010 Ga0496104_0043010_1691_2656 301
877 3300048907 Ga0496104_0059462 Ga0496104_0059462_2151_3125 301
878 3300048908 Ga0496105_0000005 Ga0496105_0000005_278943_279908 301
879 3300048908 Ga0496105_0000051 Ga0496105_0000051_11386_12351 301
880 3300048908 Ga0496105_0010992 Ga0496105_0010992_3143_4117 301
881 3300048908 Ga0496105_0016037 Ga0496105_0016037_2673_3647 301
882 3300048908 Ga0496105_0066139 Ga0496105_0066139_1694_2668 301
883 3300048908 Ga0496105_0081709 Ga0496105_0081709_359_1417 301
884 3300048908 Ga0496105_0157387 Ga0496105_0157387_591_1562 301
885 3300048909 Ga0496106_0000134 Ga0496106_0000134_41197_42162 301
886 3300048909 Ga0496106_0000455 Ga0496106_0000455_25033_26013 301
887 3300048909 Ga0496106_0004709 Ga0496106_0004709_4990_5964 301
888 3300048909 Ga0496106_0021569 Ga0496106_0021569_1966_2943 301
889 3300048910 Ga0496107_0000002 Ga0496107_0000002_222612_223577 301
890 3300048910 Ga0496107_0000234 Ga0496107_0000234_3284_4264 301
891 3300048911 Ga0496108_0000004 Ga0496108_0000004_404606_405586 301
892 3300048911 Ga0496108_0005715 Ga0496108_0005715_5098_6063 301
893 3300048911 Ga0496108_0006524 Ga0496108_0006524_4333_5307 301
894 3300048911 Ga0496108_0016000 Ga0496108_0016000_3638_4603 301
895 3300048911 Ga0496108_0091865 Ga0496108_0091865_43_1017 301
896 3300048911 Ga0496108_0207400 Ga0496108_0207400_94_1062 301
897 3300048911 Ga0496108_0216683 Ga0496108_0216683_35_1012 301
898 3300048912 Ga0496109_0000011 Ga0496109_0000011_15182_16147 301
899 3300048912 Ga0496109_0000013 Ga0496109_0000013_87047_88027 301
900 3300048912 Ga0496109_0001749 Ga0496109_0001749_5409_6386 301
901 3300048912 Ga0496109_0016118 Ga0496109_0016118_4659_5633 301
902 3300048912 Ga0496109_0234550 Ga0496109_0234550_745_1710 301
903 3300048913 Ga0496110_0000185 Ga0496110_0000185_4311_5276 301
904 3300048913 Ga0496110_0001995 Ga0496110_0001995_849_1820 301
905 3300048913 Ga0496110_0037267 Ga0496110_0037267_2438_3412 301
906 3300048913 Ga0496110_0054802 Ga0496110_0054802_304_1278 301
907 3300048913 Ga0496110_0061760 Ga0496110_0061760_844_1809 301
908 3300048913 Ga0496110_0077077 Ga0496110_0077077_1561_2538 301
909 3300048914 Ga0496111_0000103 Ga0496111_0000103_12966_13931 301
910 3300048914 Ga0496111_0001859 Ga0496111_0001859_8790_9761 301
911 3300048914 Ga0496111_0006437 Ga0496111_0006437_5891_6856 301
912 3300048914 Ga0496111_0010556 Ga0496111_0010556_1333_2307 301
913 3300048914 Ga0496111_0024177 Ga0496111_0024177_21_986 301
914 3300048914 Ga0496111_0071374 Ga0496111_0071374_1247_2224 301
915 3300048914 Ga0496111_0227613 Ga0496111_0227613_271_1239 301
916 3300048915 Ga0496112_0001233 Ga0496112_0001233_6314_7285 301
917 3300048915 Ga0496112_0001703 Ga0496112_0001703_2380_3354 301
918 3300048915 Ga0496112_0040212 Ga0496112_0040212_679_1653 301
919 3300048915 Ga0496112_0399898 Ga0496112_0399898_139_1116 301
920 3300048916 Ga0496113_0007454 Ga0496113_0007454_2835_3800 301
921 3300048916 Ga0496113_0009718 Ga0496113_0009718_3295_4260 301
922 3300048916 Ga0496113_0017673 Ga0496113_0017673_3960_4934 301
923 3300048916 Ga0496113_0023407 Ga0496113_0023407_2374_3348 301
924 3300048916 Ga0496113_0056331 Ga0496113_0056331_889_1860 301
925 3300048916 Ga0496113_0103177 Ga0496113_0103177_954_1925 301
926 3300048917 Ga0496114_0000003 Ga0496114_0000003_433710_434675 301
927 3300048918 Ga0496115_0000022 Ga0496115_0000022_124862_125827 301
928 3300048918 Ga0496115_0000408 Ga0496115_0000408_20328_21293 301
929 3300048918 Ga0496115_0015665 Ga0496115_0015665_3583_4563 301
930 3300048918 Ga0496115_0027710 Ga0496115_0027710_1869_2840 301
931 3300048918 Ga0496115_0028807 Ga0496115_0028807_1534_2505 301
932 3300048918 Ga0496115_0036332 Ga0496115_0036332_2432_3406 301
933 3300048922 Ga0496119_0009861 Ga0496119_0009861_4336_5301 301
934 3300048922 Ga0496119_0015154 Ga0496119_0015154_4807_5772 301
935 3300048922 Ga0496119_0098951 Ga0496119_0098951_332_1297 301
936 3300048923 Ga0496120_0002756 Ga0496120_0002756_7642_8607 301
937 3300048923 Ga0496120_0031163 Ga0496120_0031163_780_1745 301
938 3300048924 Ga0496121_0002900 Ga0496121_0002900_1371_2345 301
939 3300048924 Ga0496121_0005349 Ga0496121_0005349_11032_11997 301
940 3300048927 Ga0496124_0267006 Ga0496124_0267006_145_1110 301
941 3300048929 Ga0496126_0015537 Ga0496126_0015537_1014_1979 301
942 3300048929 Ga0496126_0057903 Ga0496126_0057903_1280_2245 301
943 3300049569 Ga0501032_0015713 Ga0501032_0015713_1825_2799 301
944 3300049570 Ga0501033_0003448 Ga0501033_0003448_6190_7164 301
945 3300049571 Ga0501034_0002876 Ga0501034_0002876_6408_7376 301
946 3300049571 Ga0501034_0035223 Ga0501034_0035223_2217_3185 301
947 3300049571 Ga0501034_0108701 Ga0501034_0108701_484_1458 301
948 3300049571 Ga0501034_0176227 Ga0501034_0176227_433_1401 301
949 3300049571 Ga0501034_0310807 Ga0501034_0310807_508_1482 301
950 3300049572 Ga0501036_0018894 Ga0501036_0018894_954_1928 301
951 3300049572 Ga0501036_0247634 Ga0501036_0247634_246_1214 301
952 3300049573 Ga0501037_0003467 Ga0501037_0003467_10261_11235 301
953 3300049574 Ga0501038_0347821 Ga0501038_0347821_67_1035 301
954 3300049575 Ga0501039_0021888 Ga0501039_0021888_507_1481 301
955 3300049578 Ga0501042_0010066 Ga0501042_0010066_615_1589 301
956 3300049578 Ga0501042_0086233 Ga0501042_0086233_397_1362 301
957 3300049578 Ga0501042_0179788 Ga0501042_0179788_209_1174 301
958 3300049579 Ga0501043_0032176 Ga0501043_0032176_979_1953 301
959 3300049580 Ga0501046_0004261 Ga0501046_0004261_6573_7547 301
960 3300049581 Ga0501047_0051756 Ga0501047_0051756_891_1859 301
961 3300049581 Ga0501047_0186161 Ga0501047_0186161_870_1844 301
962 3300049582 Ga0501048_0005946 Ga0501048_0005946_338_1312 301
963 3300049583 Ga0501067_0000864 Ga0501067_0000864_963_1937 301
964 3300049583 Ga0501067_0011384 Ga0501067_0011384_2225_3193 301
965 3300049583 Ga0501067_0156469 Ga0501067_0156469_74_1045 301
966 3300049584 Ga0501068_0065620 Ga0501068_0065620_28_1002 301
967 3300049585 Ga0501069_0013053 Ga0501069_0013053_1504_2478 301
968 3300049586 Ga0501070_0007617 Ga0501070_0007617_29_1003 301
969 3300049589 Ga0501073_0005549 Ga0501073_0005549_7781_8755 301
970 3300049590 Ga0501074_0026308 Ga0501074_0026308_2381_3355 301
971 3300049742 Ga0501080_0003769 Ga0501080_0003769_4243_5217 301
972 3300049822 Ga0501035_0064276 Ga0501035_0064276_988_1962 301
973 3300049823 Ga0501044_0036180 Ga0501044_0036180_2932_3897 301
974 3300049823 Ga0501044_0050761 Ga0501044_0050761_2364_3338 301
975 3300049824 Ga0501045_0085562 Ga0501045_0085562_1157_2131 301
976 3300049851 Ga0501212_010641 Ga0501212_010641_323_1300 301
977 3300050491 nmdc:mga00v17_46073_c1 nmdc:mga00v17_46073_c1_1629_2597 301
978 3300050492 nmdc:mga0yw44_15653_c1 nmdc:mga0yw44_15653_c1_1943_2911 301
979 3300050492 nmdc:mga0yw44_8680_c1 nmdc:mga0yw44_8680_c1_3850_4818 301
980 3300050507 nmdc:mga05p37_1685_c1 nmdc:mga05p37_1685_c1_17857_18834 301
981 3300050507 nmdc:mga05p37_224323_c1 nmdc:mga05p37_224323_c1_877_1851 301
982 3300050507 nmdc:mga05p37_240704_c1 nmdc:mga05p37_240704_c1_351_1328 301
983 3300050508 nmdc:mga09592_791_c1 nmdc:mga09592_791_c1_154_1125 301
984 3300050509 nmdc:mga0qj67_11680_c1 nmdc:mga0qj67_11680_c1_2883_3860 301
985 3300050509 nmdc:mga0qj67_20491_c1 nmdc:mga0qj67_20491_c1_1634_2599 301
986 3300050509 nmdc:mga0qj67_908_c1 nmdc:mga0qj67_908_c1_17905_18882 301
987 3300050511 nmdc:mga08y16_327363_c1 nmdc:mga08y16_327363_c1_569_1543 301
988 3300050512 nmdc:mga0n895_29896_c1 nmdc:mga0n895_29896_c1_1416_2390 301
989 3300050512 nmdc:mga0n895_82535_c1 nmdc:mga0n895_82535_c1_676_1641 301
990 3300050515 nmdc:mga0a205_120886_c1 nmdc:mga0a205_120886_c1_1294_2271 301
991 3300050515 nmdc:mga0a205_281_c1 nmdc:mga0a205_281_c1_33467_34432 301
992 3300053077 Ga0495601_0000029 Ga0495601_0000029_63623_64588 301
993 3300053077 Ga0495601_0000673 Ga0495601_0000673_13069_14040 301
994 3300053077 Ga0495601_0008993 Ga0495601_0008993_1223_2188 301
995 3300053077 Ga0495601_0009993 Ga0495601_0009993_4414_5379 301
996 3300053077 Ga0495601_0047138 Ga0495601_0047138_900_1871 301
997 3300053078 Ga0495612_0000049 Ga0495612_0000049_47843_48814 301
998 3300053078 Ga0495612_0004444 Ga0495612_0004444_4504_5469 301
999 3300053083 Ga0495655_0000010 Ga0495655_0000010_84468_85433 301
1000 3300053084 Ga0495595_0000007 Ga0495595_0000007_159665_160630 301
1001 3300053084 Ga0495595_0000547 Ga0495595_0000547_9424_10404 301
1002 3300053085 Ga0495619_0000001 Ga0495619_0000001_384004_384987 301
1003 3300053085 Ga0495619_0000026 Ga0495619_0000026_11934_12899 301
1004 3300053085 Ga0495619_0000205 Ga0495619_0000205_21943_22908 301
1005 3300053085 Ga0495619_0001750 Ga0495619_0001750_2991_3977 301
1006 3300053085 Ga0495619_0002447 Ga0495619_0002447_8010_8975 301
1007 3300053085 Ga0495619_0002937 Ga0495619_0002937_6826_7791 301
1008 3300053085 Ga0495619_0015207 Ga0495619_0015207_2967_3932 301
1009 3300053094 Ga0500566_0001360 Ga0500566_0001360_974_1942 301
1010 3300053096 Ga0500641_0003315 Ga0500641_0003315_1403_2368 301
1011 3300053104 Ga0500556_0001310 Ga0500556_0001310_7537_8514 301
1012 3300053129 Ga0500628_000024 Ga0500628_000024_23972_24937 301
1013 3300053153 Ga0500616_0003202 Ga0500616_0003202_3861_4835 301
1014 3300053153 Ga0500616_0005227 Ga0500616_0005227_5211_6188 301
1015 3300053736 Ga0500599_002557 Ga0500599_002557_298_1275 301
1016 3300054114 Ga0501084_0091029 Ga0501084_0091029_591_1565 301
1017 3300054114 Ga0501084_0100705 Ga0501084_0100705_463_1428 301
1018 3300060353 Ga0501082_0104093 Ga0501082_0104093_1078_2052 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

18

296

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jc3-assembly3.cif.gz_F structure of o-acetylserine sulfhydrylase b from salmonella typhimurium 0.936 15 265
4i1y-assembly2.cif.gz_B the structure of cysteine synthase from mycobacterium ulcerans agy99 0.9304 14 266
2v03-assembly1.cif.gz_A-2 high resolution structure and catalysis of an o-acetylserine sulfhydrylase 0.9248 15 265
4aec-assembly1.cif.gz_B crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyase c 0.923 14 265
4i1y-assembly1.cif.gz_A the structure of cysteine synthase from mycobacterium ulcerans agy99 0.9212 14 266
ID Description Score Start End Superfamily
af_A0A0P0WXY8_178_256_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9611 157 210 3.40.50.1100
3rr2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9412 57 154 3.40.50.1100
af_Q2G0V4_40_140_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9391 57 154 3.40.50.1100
5b1iC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9327 56 155 3.40.50.1100
3vc3B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.931 50 152 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A3D2USF3-F1-model_v4 Cysteine synthase 0.9643 16 210 GO:0006535
GO:0016765
AF-A0A356CU36-F1-model_v4 Cysteine synthase B 0.9633 72 208 GO:0004124
AF-X1SBY9-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9618 14 176 GO:0019344
AF-X1NKG5-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9595 18 144 GO:0006535
AF-X1DN62-F1-model_v4 Tryptophan synthase beta chain-like PALP domain-containing protein 0.9563 14 216 GO:0006535

Feature Viewer

pLDDT pTM Quality
81.27 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map