F488320
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1018 | 397 | 1018 | 320 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0730546|Ga0436365_0730546_908_2020 |
| Length | 370 |
| Sequence | MAAERLENKPCGGRYGDIVQAIGHTPLVELKRLSPKPGVRLWAKLESRNPTGSVKDRVARAMLEDAEEKGLIRPGQTILEPTSGNTGISLAMICSRKGYPLKVVMPENVTRERTELLRMYGAEIVYSEGAKGSNGAVELALDMAEKDASYYMPYQYGNQANPLAHYNGTALEILEELDEIAAFVAGLGTGGTLMGNGRRLKEELGDQVKIVAAEPMQGEPVQGLRSLEDGFIPPIIDLSLLDRKIFVTNTDAIVFTRRLLDEEGLFVGVSSGAIARVAVRIAGELDEGNVVFLVADDGWKYLSSGIYTRPLEEIENLDSTVWWRAETRRRAIPHLAGESCGPPARRPGGCWSRHAVTRRSRRWCTTPRRF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 124 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 130 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 133 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 209 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 213 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 214 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 243 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 244 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 245 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 246 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 249 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 250 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 251 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 252 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 253 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 254 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 255 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 258 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 259 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 333 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 334 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 335 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 370 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 372 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 387 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 389 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 390 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 391 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 392 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 394 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 397 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.45 |
| Metatranscriptomes | 2.55 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.87 |
| Nodule | 0 |
| Rhizoplane | 9.04 |
| Rhizosphere | 83.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1003365 | 3300000546 | Bacteria | 1842 |
| 2 | JGI24746J21847_1000941 | 3300001977 | Bacteria | 4566 |
| 3 | JGI24748J21848_1000576 | 3300002074 | Bacteria | 3951 |
| 4 | JGI24034J26672_10000425 | 3300002239 | Bacteria | 5469 |
| 5 | JGI24742J22300_10000739 | 3300002244 | Bacteria | 4944 |
| 6 | JGI25406J46586_10005180 | 3300003203 | Bacteria | 6046 |
| 7 | JGI25407J50210_10000241 | 3300003373 | Bacteria | 9571 |
| 8 | JGI25407J50210_10002334 | 3300003373 | Bacteria | 4454 |
| 9 | JGI25407J50210_10007428 | 3300003373 | Bacteria | 2744 |
| 10 | JGI25407J50210_10021674 | 3300003373 | Bacteria | 1669 |
| 11 | JGI25404J52841_10000538 | 3300003659 | Bacteria | 5582 |
| 12 | Ga0058861_10195417 | 3300004800 | Bacteria | 2290 |
| 13 | Ga0058862_10069669 | 3300004803 | Bacteria | 2991 |
| 14 | Ga0070658_10024325 | 3300005327 | Bacteria | 4860 |
| 15 | Ga0070683_100001231 | 3300005329 | Bacteria | 19475 |
| 16 | Ga0070683_100007506 | 3300005329 | Bacteria | 9216 |
| 17 | Ga0070683_100017321 | 3300005329 | Bacteria | 6368 |
| 18 | Ga0070683_100018543 | 3300005329 | Bacteria | 6167 |
| 19 | Ga0070683_100198873 | 3300005329 | Bacteria | 1903 |
| 20 | Ga0070677_10000956 | 3300005333 | Bacteria | 9336 |
| 21 | Ga0070666_10018742 | 3300005335 | Bacteria | 4456 |
| 22 | Ga0070682_100000023 | 3300005337 | Bacteria | 206016 |
| 23 | Ga0070682_100000061 | 3300005337 | Bacteria | 105134 |
| 24 | Ga0070682_100028676 | 3300005337 | Bacteria | 3349 |
| 25 | Ga0068868_100050568 | 3300005338 | Bacteria | 3265 |
| 26 | Ga0068868_100345810 | 3300005338 | Bacteria | 1273 |
| 27 | Ga0070689_100457795 | 3300005340 | Bacteria | 1086 |
| 28 | Ga0070691_10000004 | 3300005341 | Bacteria | 80156 |
| 29 | Ga0070691_10013117 | 3300005341 | Bacteria | 3796 |
| 30 | Ga0070687_100044085 | 3300005343 | Bacteria | 2270 |
| 31 | Ga0070661_100000110 | 3300005344 | Bacteria | 68106 |
| 32 | Ga0070661_100012352 | 3300005344 | Bacteria | 5975 |
| 33 | Ga0070661_100313458 | 3300005344 | Bacteria | 1224 |
| 34 | Ga0070692_10004822 | 3300005345 | Bacteria | 5672 |
| 35 | Ga0070692_10055968 | 3300005345 | Bacteria | 2064 |
| 36 | Ga0070668_100009891 | 3300005347 | Bacteria | 7063 |
| 37 | Ga0070668_100457845 | 3300005347 | Bacteria | 1098 |
| 38 | Ga0070669_100008089 | 3300005353 | Bacteria | 7515 |
| 39 | Ga0070675_100000091 | 3300005354 | Bacteria | 52149 |
| 40 | Ga0070675_100040732 | 3300005354 | Bacteria | 3793 |
| 41 | Ga0070674_100000019 | 3300005356 | Bacteria | 89350 |
| 42 | Ga0070674_100033227 | 3300005356 | Bacteria | 3432 |
| 43 | Ga0070674_100219131 | 3300005356 | Bacteria | 1479 |
| 44 | Ga0070673_100016927 | 3300005364 | Bacteria | 5170 |
| 45 | Ga0070688_100000077 | 3300005365 | Bacteria | 48743 |
| 46 | Ga0070688_100000937 | 3300005365 | Bacteria | 14631 |
| 47 | Ga0070688_100010454 | 3300005365 | Bacteria | 5117 |
| 48 | Ga0070688_100082357 | 3300005365 | Bacteria | 2086 |
| 49 | Ga0070688_100169927 | 3300005365 | Bacteria | 1504 |
| 50 | Ga0070659_100000026 | 3300005366 | Bacteria | 143542 |
| 51 | Ga0070659_100005636 | 3300005366 | Bacteria | 9005 |
| 52 | Ga0070659_100008534 | 3300005366 | Bacteria | 7487 |
| 53 | Ga0070659_100023840 | 3300005366 | Bacteria | 4686 |
| 54 | Ga0070667_100000597 | 3300005367 | Bacteria | 35219 |
| 55 | Ga0070667_100083799 | 3300005367 | Bacteria | 2732 |
| 56 | Ga0070703_10080181 | 3300005406 | Bacteria | 1110 |
| 57 | Ga0070709_10050251 | 3300005434 | Bacteria | 2612 |
| 58 | Ga0070709_10175990 | 3300005434 | Bacteria | 1499 |
| 59 | Ga0070714_100000083 | 3300005435 | Bacteria | 81010 |
| 60 | Ga0070714_100047079 | 3300005435 | Bacteria | 3662 |
| 61 | Ga0070714_100107438 | 3300005435 | Bacteria | 2466 |
| 62 | Ga0070714_100121368 | 3300005435 | Bacteria | 2325 |
| 63 | Ga0070713_100000135 | 3300005436 | Bacteria | 48487 |
| 64 | Ga0070713_100067402 | 3300005436 | Bacteria | 3013 |
| 65 | Ga0070710_10000008 | 3300005437 | Bacteria | 198148 |
| 66 | Ga0070710_10047985 | 3300005437 | Bacteria | 2384 |
| 67 | Ga0070710_10063380 | 3300005437 | Bacteria | 2112 |
| 68 | Ga0070710_10100161 | 3300005437 | Bacteria | 1724 |
| 69 | Ga0070710_10139697 | 3300005437 | Bacteria | 1484 |
| 70 | Ga0070711_100001500 | 3300005439 | Bacteria | 12830 |
| 71 | Ga0070711_100049540 | 3300005439 | Bacteria | 2877 |
| 72 | Ga0070711_100064726 | 3300005439 | Bacteria | 2556 |
| 73 | Ga0070705_100000405 | 3300005440 | Bacteria | 24782 |
| 74 | Ga0070705_100082905 | 3300005440 | Bacteria | 1974 |
| 75 | Ga0070700_100000678 | 3300005441 | Bacteria | 16857 |
| 76 | Ga0070700_100151277 | 3300005441 | Bacteria | 1587 |
| 77 | Ga0070700_100213281 | 3300005441 | Bacteria | 1364 |
| 78 | Ga0070708_100003595 | 3300005445 | Bacteria | 12161 |
| 79 | Ga0070708_100007488 | 3300005445 | Bacteria | 8741 |
| 80 | Ga0070708_100160799 | 3300005445 | Bacteria | 2093 |
| 81 | Ga0070708_100289725 | 3300005445 | Bacteria | 1541 |
| 82 | Ga0070663_100002413 | 3300005455 | Bacteria | 10511 |
| 83 | Ga0070678_100044344 | 3300005456 | Bacteria | 3175 |
| 84 | Ga0070662_100000001 | 3300005457 | Bacteria | 317995 |
| 85 | Ga0070662_100088608 | 3300005457 | Bacteria | 2320 |
| 86 | Ga0070662_100216048 | 3300005457 | Bacteria | 1528 |
| 87 | Ga0070681_10036102 | 3300005458 | Bacteria | 4965 |
| 88 | Ga0070681_10216594 | 3300005458 | Bacteria | 1831 |
| 89 | Ga0068867_100001975 | 3300005459 | Bacteria | 14301 |
| 90 | Ga0070685_10000061 | 3300005466 | Bacteria | 63408 |
| 91 | Ga0070685_10000965 | 3300005466 | Bacteria | 15453 |
| 92 | Ga0070685_10186359 | 3300005466 | Bacteria | 1339 |
| 93 | Ga0070685_10224276 | 3300005466 | Bacteria | 1233 |
| 94 | Ga0070706_100001344 | 3300005467 | Bacteria | 26148 |
| 95 | Ga0070706_100031968 | 3300005467 | Bacteria | 4853 |
| 96 | Ga0070706_100039789 | 3300005467 | Bacteria | 4339 |
| 97 | Ga0070706_100102473 | 3300005467 | Bacteria | 2661 |
| 98 | Ga0070706_100190541 | 3300005467 | Bacteria | 1916 |
| 99 | Ga0070707_100002020 | 3300005468 | Bacteria | 19431 |
| 100 | Ga0070707_100006384 | 3300005468 | Bacteria | 10963 |
| 101 | Ga0070707_100101383 | 3300005468 | Bacteria | 2790 |
| 102 | Ga0070707_100414541 | 3300005468 | Bacteria | 1307 |
| 103 | Ga0070698_100144492 | 3300005471 | Bacteria | 2329 |
| 104 | Ga0070698_100181710 | 3300005471 | Bacteria | 2042 |
| 105 | Ga0070698_100360467 | 3300005471 | Bacteria | 1385 |
| 106 | Ga0070698_100394293 | 3300005471 | Bacteria | 1317 |
| 107 | Ga0070679_100003154 | 3300005530 | Bacteria | 15061 |
| 108 | Ga0070679_100027205 | 3300005530 | Bacteria | 5626 |
| 109 | Ga0070679_100072615 | 3300005530 | Bacteria | 3433 |
| 110 | Ga0070684_100012176 | 3300005535 | Bacteria | 6880 |
| 111 | Ga0070684_100013351 | 3300005535 | Bacteria | 6619 |
| 112 | Ga0070684_100033293 | 3300005535 | Bacteria | 4399 |
| 113 | Ga0070684_100120058 | 3300005535 | Bacteria | 2364 |
| 114 | Ga0068853_100087760 | 3300005539 | Bacteria | 2730 |
| 115 | Ga0070672_100000005 | 3300005543 | Bacteria | 121014 |
| 116 | Ga0070686_100028068 | 3300005544 | Bacteria | 3410 |
| 117 | Ga0070695_100120813 | 3300005545 | Bacteria | 1792 |
| 118 | Ga0070696_100018841 | 3300005546 | Bacteria | 4672 |
| 119 | Ga0070696_100420076 | 3300005546 | Bacteria | 1050 |
| 120 | Ga0070665_100000022 | 3300005548 | Bacteria | 379286 |
| 121 | Ga0070665_100006490 | 3300005548 | Bacteria | 11899 |
| 122 | Ga0070665_100114028 | 3300005548 | Bacteria | 2705 |
| 123 | Ga0070664_100105826 | 3300005564 | Bacteria | 2450 |
| 124 | Ga0068857_100050806 | 3300005577 | Bacteria | 3677 |
| 125 | Ga0068857_100274506 | 3300005577 | Bacteria | 1550 |
| 126 | Ga0068854_100244806 | 3300005578 | Bacteria | 1429 |
| 127 | Ga0068856_100005996 | 3300005614 | Bacteria | 11963 |
| 128 | Ga0068856_100013340 | 3300005614 | Bacteria | 7955 |
| 129 | Ga0068856_100171649 | 3300005614 | Bacteria | 2181 |
| 130 | Ga0070702_100004581 | 3300005615 | Bacteria | 6328 |
| 131 | Ga0070702_100005981 | 3300005615 | Bacteria | 5725 |
| 132 | Ga0068852_100000037 | 3300005616 | Bacteria | 97602 |
| 133 | Ga0068852_100008426 | 3300005616 | Bacteria | 7601 |
| 134 | Ga0068852_100009794 | 3300005616 | Bacteria | 7124 |
| 135 | Ga0068859_100132898 | 3300005617 | Bacteria | 2560 |
| 136 | Ga0068864_100000043 | 3300005618 | Bacteria | 162928 |
| 137 | Ga0068864_100144773 | 3300005618 | Bacteria | 2147 |
| 138 | Ga0068866_10000005 | 3300005718 | Bacteria | 196339 |
| 139 | Ga0068866_10000645 | 3300005718 | Bacteria | 15809 |
| 140 | Ga0068866_10100790 | 3300005718 | Bacteria | 1593 |
| 141 | Ga0068861_100044604 | 3300005719 | Bacteria | 3335 |
| 142 | Ga0068851_10000741 | 3300005834 | Bacteria | 13966 |
| 143 | Ga0068851_10119137 | 3300005834 | Bacteria | 1417 |
| 144 | Ga0068870_10243870 | 3300005840 | Bacteria | 1111 |
| 145 | Ga0068863_100004891 | 3300005841 | Bacteria | 13205 |
| 146 | Ga0068863_100022537 | 3300005841 | Bacteria | 6014 |
| 147 | Ga0068858_100000046 | 3300005842 | Bacteria | 127519 |
| 148 | Ga0068858_100001657 | 3300005842 | Bacteria | 22764 |
| 149 | Ga0068860_100002786 | 3300005843 | Bacteria | 18180 |
| 150 | Ga0068860_100270418 | 3300005843 | Bacteria | 1658 |
| 151 | Ga0068862_100001558 | 3300005844 | Bacteria | 20944 |
| 152 | Ga0068862_100320521 | 3300005844 | Bacteria | 1430 |
| 153 | Ga0081455_10004481 | 3300005937 | Bacteria | 15630 |
| 154 | Ga0081455_10005837 | 3300005937 | Bacteria | 13391 |
| 155 | Ga0081455_10110825 | 3300005937 | Bacteria | 2181 |
| 156 | Ga0081455_10167081 | 3300005937 | Bacteria | 1680 |
| 157 | Ga0081538_10000042 | 3300005981 | Bacteria | 115656 |
| 158 | Ga0081538_10000270 | 3300005981 | Bacteria | 59449 |
| 159 | Ga0081538_10001012 | 3300005981 | Bacteria | 29986 |
| 160 | Ga0081538_10009117 | 3300005981 | Bacteria | 8324 |
| 161 | Ga0081538_10011162 | 3300005981 | Bacteria | 7298 |
| 162 | Ga0081538_10023057 | 3300005981 | Bacteria | 4485 |
| 163 | Ga0081538_10032355 | 3300005981 | Bacteria | 3506 |
| 164 | Ga0081538_10080216 | 3300005981 | Bacteria | 1742 |
| 165 | Ga0081540_1000697 | 3300005983 | Bacteria | 31315 |
| 166 | Ga0081540_1000855 | 3300005983 | Bacteria | 27644 |
| 167 | Ga0081540_1001971 | 3300005983 | Bacteria | 17127 |
| 168 | Ga0081539_10002753 | 3300005985 | Bacteria | 23665 |
| 169 | Ga0081539_10006174 | 3300005985 | Bacteria | 11656 |
| 170 | Ga0081539_10014136 | 3300005985 | Bacteria | 5933 |
| 171 | Ga0081539_10017623 | 3300005985 | Bacteria | 5002 |
| 172 | Ga0070717_10000004 | 3300006028 | Bacteria | 365525 |
| 173 | Ga0070717_10020450 | 3300006028 | Bacteria | 5206 |
| 174 | Ga0070717_10023884 | 3300006028 | Bacteria | 4850 |
| 175 | Ga0070717_10037727 | 3300006028 | Bacteria | 3925 |
| 176 | Ga0075365_10011703 | 3300006038 | Bacteria | 5170 |
| 177 | Ga0075365_10046083 | 3300006038 | Bacteria | 2862 |
| 178 | Ga0075365_10239732 | 3300006038 | Bacteria | 1274 |
| 179 | Ga0075364_10129562 | 3300006051 | Bacteria | 1692 |
| 180 | Ga0075432_10007258 | 3300006058 | Bacteria | 3774 |
| 181 | Ga0070715_10000008 | 3300006163 | Bacteria | 189899 |
| 182 | Ga0070712_100000008 | 3300006175 | Bacteria | 149644 |
| 183 | Ga0070712_100005477 | 3300006175 | Bacteria | 7860 |
| 184 | Ga0070712_100011732 | 3300006175 | Bacteria | 5566 |
| 185 | Ga0070712_100025870 | 3300006175 | Bacteria | 3905 |
| 186 | Ga0070712_100049467 | 3300006175 | Bacteria | 2919 |
| 187 | Ga0097621_100124621 | 3300006237 | Bacteria | 2187 |
| 188 | Ga0075428_100087343 | 3300006844 | Bacteria | 3401 |
| 189 | Ga0075428_100424023 | 3300006844 | Bacteria | 1425 |
| 190 | Ga0075430_100000024 | 3300006846 | Bacteria | 80210 |
| 191 | Ga0075430_100014081 | 3300006846 | Bacteria | 6818 |
| 192 | Ga0075431_100010016 | 3300006847 | Bacteria | 9522 |
| 193 | Ga0075431_100016543 | 3300006847 | Bacteria | 7486 |
| 194 | Ga0075431_100025100 | 3300006847 | Bacteria | 6110 |
| 195 | Ga0075431_100059786 | 3300006847 | Bacteria | 3932 |
| 196 | Ga0075433_10063177 | 3300006852 | Bacteria | 3244 |
| 197 | Ga0075434_100183102 | 3300006871 | Bacteria | 2116 |
| 198 | Ga0075434_100201644 | 3300006871 | Bacteria | 2009 |
| 199 | Ga0075429_100004701 | 3300006880 | Bacteria | 11750 |
| 200 | Ga0075429_100396864 | 3300006880 | Bacteria | 1208 |
| 201 | Ga0068865_100000089 | 3300006881 | Bacteria | 47955 |
| 202 | Ga0068865_100140322 | 3300006881 | Bacteria | 1821 |
| 203 | Ga0097620_100132897 | 3300006931 | Bacteria | 2560 |
| 204 | Ga0075435_100171108 | 3300007076 | Bacteria | 1832 |
| 205 | Ga0105251_10054195 | 3300009011 | Bacteria | 1905 |
| 206 | Ga0105240_10046441 | 3300009093 | Bacteria | 5503 |
| 207 | Ga0111539_10028001 | 3300009094 | Bacteria | 6882 |
| 208 | Ga0111539_10082333 | 3300009094 | Bacteria | 3785 |
| 209 | Ga0111539_10461760 | 3300009094 | Bacteria | 1479 |
| 210 | Ga0105245_10000640 | 3300009098 | Bacteria | 31823 |
| 211 | Ga0105245_10001641 | 3300009098 | Bacteria | 20352 |
| 212 | Ga0105245_10002937 | 3300009098 | Bacteria | 15306 |
| 213 | Ga0105245_10004571 | 3300009098 | Bacteria | 12221 |
| 214 | Ga0105245_10006204 | 3300009098 | Bacteria | 10514 |
| 215 | Ga0105245_10468362 | 3300009098 | Bacteria | 1271 |
| 216 | Ga0105247_10000591 | 3300009101 | Bacteria | 29455 |
| 217 | Ga0114129_10003125 | 3300009147 | Bacteria | 23224 |
| 218 | Ga0114129_10028895 | 3300009147 | Bacteria | 7856 |
| 219 | Ga0114129_10034389 | 3300009147 | Bacteria | 7158 |
| 220 | Ga0114129_10317706 | 3300009147 | Bacteria | 2071 |
| 221 | Ga0114129_10438886 | 3300009147 | Bacteria | 1714 |
| 222 | Ga0105243_10028842 | 3300009148 | Bacteria | 4264 |
| 223 | Ga0105241_10142534 | 3300009174 | Bacteria | 1953 |
| 224 | Ga0105242_10000052 | 3300009176 | Bacteria | 79244 |
| 225 | Ga0105242_10008495 | 3300009176 | Bacteria | 7886 |
| 226 | Ga0105242_10048190 | 3300009176 | Bacteria | 3463 |
| 227 | Ga0105242_10131466 | 3300009176 | Bacteria | 2161 |
| 228 | Ga0105242_10137973 | 3300009176 | Bacteria | 2113 |
| 229 | Ga0105242_10358114 | 3300009176 | Bacteria | 1350 |
| 230 | Ga0105248_10000017 | 3300009177 | Bacteria | 298089 |
| 231 | Ga0105237_10005947 | 3300009545 | Bacteria | 13681 |
| 232 | Ga0105237_10082040 | 3300009545 | Bacteria | 3215 |
| 233 | Ga0105237_10212784 | 3300009545 | Bacteria | 1933 |
| 234 | Ga0105237_10373415 | 3300009545 | Bacteria | 1431 |
| 235 | Ga0105238_10000016 | 3300009551 | Bacteria | 236218 |
| 236 | Ga0105238_10034900 | 3300009551 | Bacteria | 5116 |
| 237 | Ga0105238_10147044 | 3300009551 | Bacteria | 2333 |
| 238 | Ga0105249_10000368 | 3300009553 | Bacteria | 44712 |
| 239 | Ga0105249_10001411 | 3300009553 | Bacteria | 21021 |
| 240 | Ga0105249_10043801 | 3300009553 | Bacteria | 4071 |
| 241 | Ga0105249_10392144 | 3300009553 | Bacteria | 1417 |
| 242 | Ga0105239_10032590 | 3300010375 | Bacteria | 5726 |
| 243 | Ga0105239_10093611 | 3300010375 | Unclassified | 3318 |
| 244 | Ga0105239_10195947 | 3300010375 | Bacteria | 2262 |
| 245 | Ga0105239_10461707 | 3300010375 | Bacteria | 1441 |
| 246 | Ga0157371_10007417 | 3300013102 | Bacteria | 8883 |
| 247 | Ga0157371_10088324 | 3300013102 | Bacteria | 2195 |
| 248 | Ga0157371_10123030 | 3300013102 | Bacteria | 1845 |
| 249 | Ga0157370_10003060 | 3300013104 | Bacteria | 19837 |
| 250 | Ga0157370_10019536 | 3300013104 | Bacteria | 6791 |
| 251 | Ga0157370_10032916 | 3300013104 | Bacteria | 5057 |
| 252 | Ga0157369_10000105 | 3300013105 | Bacteria | 117996 |
| 253 | Ga0157369_10112813 | 3300013105 | Bacteria | 2888 |
| 254 | Ga0157369_10389745 | 3300013105 | Bacteria | 1445 |
| 255 | Ga0157369_10400458 | 3300013105 | Bacteria | 1424 |
| 256 | Ga0157374_10000785 | 3300013296 | Bacteria | 27837 |
| 257 | Ga0157374_10014025 | 3300013296 | Bacteria | 7005 |
| 258 | Ga0157378_10016184 | 3300013297 | Bacteria | 6532 |
| 259 | Ga0163162_10155764 | 3300013306 | Bacteria | 2404 |
| 260 | Ga0157372_10001649 | 3300013307 | Bacteria | 24237 |
| 261 | Ga0157372_10018844 | 3300013307 | Bacteria | 7426 |
| 262 | Ga0157372_10032213 | 3300013307 | Bacteria | 5745 |
| 263 | Ga0157372_10047612 | 3300013307 | Bacteria | 4764 |
| 264 | Ga0157375_10000717 | 3300013308 | Bacteria | 29235 |
| 265 | Ga0157375_10005849 | 3300013308 | Bacteria | 10704 |
| 266 | Ga0157375_10119655 | 3300013308 | Bacteria | 2741 |
| 267 | Ga0157375_10307641 | 3300013308 | Bacteria | 1749 |
| 268 | Ga0157380_10001737 | 3300014326 | Bacteria | 14372 |
| 269 | Ga0157380_10269558 | 3300014326 | Bacteria | 1551 |
| 270 | Ga0182008_10129764 | 3300014497 | Bacteria | 1256 |
| 271 | Ga0157377_10003359 | 3300014745 | Bacteria | 7237 |
| 272 | Ga0157377_10034398 | 3300014745 | Bacteria | 2773 |
| 273 | Ga0157379_10005656 | 3300014968 | Bacteria | 10742 |
| 274 | Ga0157379_10089872 | 3300014968 | Bacteria | 2755 |
| 275 | Ga0157376_10006598 | 3300014969 | Bacteria | 8211 |
| 276 | Ga0157376_10020347 | 3300014969 | Bacteria | 5132 |
| 277 | Ga0163161_10000064 | 3300017792 | Bacteria | 108508 |
| 278 | Ga0163161_10077888 | 3300017792 | Bacteria | 2436 |
| 279 | Ga0197907_10465245 | 3300020069 | Bacteria | 3085 |
| 280 | Ga0206356_10907411 | 3300020070 | Bacteria | 1179 |
| 281 | Ga0206356_11750464 | 3300020070 | Bacteria | 2205 |
| 282 | Ga0206349_1015741 | 3300020075 | Bacteria | 2758 |
| 283 | Ga0206349_1625417 | 3300020075 | Bacteria | 4510 |
| 284 | Ga0206355_1314388 | 3300020076 | Bacteria | 1502 |
| 285 | Ga0206351_10180526 | 3300020077 | Bacteria | 3156 |
| 286 | Ga0206351_10380651 | 3300020077 | Bacteria | 2856 |
| 287 | Ga0206352_10040496 | 3300020078 | Bacteria | 6329 |
| 288 | Ga0206352_10184859 | 3300020078 | Bacteria | 1577 |
| 289 | Ga0206352_10364769 | 3300020078 | Bacteria | 1488 |
| 290 | Ga0206350_10243056 | 3300020080 | Bacteria | 3121 |
| 291 | Ga0206350_10534078 | 3300020080 | Bacteria | 3118 |
| 292 | Ga0206350_10636958 | 3300020080 | Bacteria | 3250 |
| 293 | Ga0206350_11049551 | 3300020080 | Bacteria | 3149 |
| 294 | Ga0206354_10367263 | 3300020081 | Bacteria | 2549 |
| 295 | Ga0206354_11250835 | 3300020081 | Bacteria | 1071 |
| 296 | Ga0154015_1384123 | 3300020610 | Bacteria | 3712 |
| 297 | Ga0154015_1473514 | 3300020610 | Bacteria | 1256 |
| 298 | Ga0213873_10022808 | 3300021358 | Bacteria | 1486 |
| 299 | Ga0213874_10000172 | 3300021377 | Bacteria | 11562 |
| 300 | Ga0213874_10005393 | 3300021377 | Bacteria | 2977 |
| 301 | Ga0213874_10014761 | 3300021377 | Bacteria | 2048 |
| 302 | Ga0213876_10012939 | 3300021384 | Bacteria | 4436 |
| 303 | Ga0213876_10016479 | 3300021384 | Bacteria | 3906 |
| 304 | Ga0213876_10016638 | 3300021384 | Bacteria | 3886 |
| 305 | Ga0213876_10049870 | 3300021384 | Bacteria | 2212 |
| 306 | Ga0213876_10156666 | 3300021384 | Bacteria | 1211 |
| 307 | Ga0213875_10000050 | 3300021388 | Bacteria | 143822 |
| 308 | Ga0213875_10009480 | 3300021388 | Bacteria | 4931 |
| 309 | Ga0213875_10043490 | 3300021388 | Bacteria | 2109 |
| 310 | Ga0224712_10007833 | 3300022467 | Bacteria | 3130 |
| 311 | Ga0224712_10009427 | 3300022467 | Bacteria | 2941 |
| 312 | Ga0224712_10013711 | 3300022467 | Bacteria | 2589 |
| 313 | Ga0224712_10061581 | 3300022467 | Bacteria | 1497 |
| 314 | Ga0207426_1012827 | 3300025302 | Bacteria | 3132 |
| 315 | Ga0207656_10001891 | 3300025321 | Bacteria | 6967 |
| 316 | Ga0207713_1068109 | 3300025735 | Bacteria | 1324 |
| 317 | Ga0207682_10000041 | 3300025893 | Bacteria | 52338 |
| 318 | Ga0207692_10000006 | 3300025898 | Bacteria | 294686 |
| 319 | Ga0207692_10071283 | 3300025898 | Bacteria | 1832 |
| 320 | Ga0207642_10000005 | 3300025899 | Bacteria | 401934 |
| 321 | Ga0207642_10015523 | 3300025899 | Bacteria | 2841 |
| 322 | Ga0207710_10000684 | 3300025900 | Bacteria | 19039 |
| 323 | Ga0207688_10002310 | 3300025901 | Bacteria | 10252 |
| 324 | Ga0207688_10130382 | 3300025901 | Bacteria | 1474 |
| 325 | Ga0207680_10002263 | 3300025903 | Bacteria | 8980 |
| 326 | Ga0207685_10000012 | 3300025905 | Bacteria | 189900 |
| 327 | Ga0207699_10063405 | 3300025906 | Bacteria | 2232 |
| 328 | Ga0207684_10001406 | 3300025910 | Bacteria | 26157 |
| 329 | Ga0207684_10026594 | 3300025910 | Bacteria | 4933 |
| 330 | Ga0207684_10085754 | 3300025910 | Bacteria | 2682 |
| 331 | Ga0207684_10160049 | 3300025910 | Bacteria | 1939 |
| 332 | Ga0207654_10076779 | 3300025911 | Bacteria | 2000 |
| 333 | Ga0207707_10006269 | 3300025912 | Bacteria | 10385 |
| 334 | Ga0207695_10014458 | 3300025913 | Bacteria | 9348 |
| 335 | Ga0207671_10004620 | 3300025914 | Bacteria | 13058 |
| 336 | Ga0207671_10149884 | 3300025914 | Bacteria | 1802 |
| 337 | Ga0207693_10000002 | 3300025915 | Bacteria | 304011 |
| 338 | Ga0207693_10001233 | 3300025915 | Bacteria | 22785 |
| 339 | Ga0207663_10001162 | 3300025916 | Bacteria | 12157 |
| 340 | Ga0207663_10033866 | 3300025916 | Bacteria | 3048 |
| 341 | Ga0207662_10041964 | 3300025918 | Bacteria | 2695 |
| 342 | Ga0207657_10047518 | 3300025919 | Bacteria | 3752 |
| 343 | Ga0207649_10000015 | 3300025920 | Bacteria | 245662 |
| 344 | Ga0207649_10029420 | 3300025920 | Bacteria | 3244 |
| 345 | Ga0207649_10276310 | 3300025920 | Bacteria | 1220 |
| 346 | Ga0207649_10282229 | 3300025920 | Bacteria | 1208 |
| 347 | Ga0207652_10006391 | 3300025921 | Bacteria | 9514 |
| 348 | Ga0207652_10024377 | 3300025921 | Bacteria | 5019 |
| 349 | Ga0207646_10015375 | 3300025922 | Bacteria | 7230 |
| 350 | Ga0207646_10353964 | 3300025922 | Bacteria | 1327 |
| 351 | Ga0207681_10006067 | 3300025923 | Bacteria | 7410 |
| 352 | Ga0207681_10211717 | 3300025923 | Bacteria | 1494 |
| 353 | Ga0207694_10000012 | 3300025924 | Bacteria | 411218 |
| 354 | Ga0207659_10000147 | 3300025926 | Bacteria | 41347 |
| 355 | Ga0207659_10303840 | 3300025926 | Bacteria | 1311 |
| 356 | Ga0207687_10000040 | 3300025927 | Bacteria | 113598 |
| 357 | Ga0207687_10000331 | 3300025927 | Bacteria | 31810 |
| 358 | Ga0207687_10001806 | 3300025927 | Bacteria | 14723 |
| 359 | Ga0207687_10053372 | 3300025927 | Bacteria | 2824 |
| 360 | Ga0207700_10000003 | 3300025928 | Bacteria | 500797 |
| 361 | Ga0207700_10062318 | 3300025928 | Bacteria | 2832 |
| 362 | Ga0207700_10110794 | 3300025928 | Bacteria | 2208 |
| 363 | Ga0207700_10377207 | 3300025928 | Bacteria | 1239 |
| 364 | Ga0207664_10000006 | 3300025929 | Bacteria | 408702 |
| 365 | Ga0207664_10014457 | 3300025929 | Bacteria | 5700 |
| 366 | Ga0207664_10051077 | 3300025929 | Bacteria | 3263 |
| 367 | Ga0207664_10089505 | 3300025929 | Bacteria | 2520 |
| 368 | Ga0207664_10214760 | 3300025929 | Bacteria | 1666 |
| 369 | Ga0207664_10386359 | 3300025929 | Bacteria | 1243 |
| 370 | Ga0207664_10418384 | 3300025929 | Bacteria | 1193 |
| 371 | Ga0207644_10372351 | 3300025931 | Bacteria | 1164 |
| 372 | Ga0207690_10000017 | 3300025932 | Bacteria | 243513 |
| 373 | Ga0207690_10004100 | 3300025932 | Bacteria | 8604 |
| 374 | Ga0207690_10005455 | 3300025932 | Bacteria | 7497 |
| 375 | Ga0207706_10000003 | 3300025933 | Bacteria | 345011 |
| 376 | Ga0207706_10029063 | 3300025933 | Bacteria | 4937 |
| 377 | Ga0207686_10000119 | 3300025934 | Bacteria | 64297 |
| 378 | Ga0207686_10003997 | 3300025934 | Bacteria | 7914 |
| 379 | Ga0207686_10024972 | 3300025934 | Bacteria | 3470 |
| 380 | Ga0207686_10068904 | 3300025934 | Bacteria | 2268 |
| 381 | Ga0207709_10001985 | 3300025935 | Bacteria | 13342 |
| 382 | Ga0207669_10000029 | 3300025937 | Bacteria | 88351 |
| 383 | Ga0207669_10000140 | 3300025937 | Bacteria | 34667 |
| 384 | Ga0207704_10000018 | 3300025938 | Bacteria | 153994 |
| 385 | Ga0207665_10219133 | 3300025939 | Bacteria | 1394 |
| 386 | Ga0207691_10000028 | 3300025940 | Bacteria | 121090 |
| 387 | Ga0207691_10194693 | 3300025940 | Bacteria | 1767 |
| 388 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 389 | Ga0207711_10049898 | 3300025941 | Bacteria | 3583 |
| 390 | Ga0207689_10134061 | 3300025942 | Bacteria | 2039 |
| 391 | Ga0207661_10000714 | 3300025944 | Bacteria | 21578 |
| 392 | Ga0207661_10003496 | 3300025944 | Bacteria | 10911 |
| 393 | Ga0207661_10005294 | 3300025944 | Bacteria | 9083 |
| 394 | Ga0207661_10014089 | 3300025944 | Bacteria | 5850 |
| 395 | Ga0207661_10015312 | 3300025944 | Bacteria | 5641 |
| 396 | Ga0207661_10022934 | 3300025944 | Bacteria | 4709 |
| 397 | Ga0207661_10220727 | 3300025944 | Bacteria | 1675 |
| 398 | Ga0207661_10486988 | 3300025944 | Bacteria | 1126 |
| 399 | Ga0207679_10202261 | 3300025945 | Bacteria | 1660 |
| 400 | Ga0207679_10360355 | 3300025945 | Bacteria | 1270 |
| 401 | Ga0207667_10216613 | 3300025949 | Bacteria | 1962 |
| 402 | Ga0207651_10002542 | 3300025960 | Bacteria | 8713 |
| 403 | Ga0207712_10000027 | 3300025961 | Bacteria | 263739 |
| 404 | Ga0207712_10002082 | 3300025961 | Bacteria | 13106 |
| 405 | Ga0207712_10085544 | 3300025961 | Bacteria | 2308 |
| 406 | Ga0207712_10118328 | 3300025961 | Bacteria | 2000 |
| 407 | Ga0207668_10019215 | 3300025972 | Bacteria | 4314 |
| 408 | Ga0207640_10000205 | 3300025981 | Bacteria | 41887 |
| 409 | Ga0207658_10000465 | 3300025986 | Bacteria | 37863 |
| 410 | Ga0207677_10009593 | 3300026023 | Bacteria | 5448 |
| 411 | Ga0207703_10000020 | 3300026035 | Bacteria | 251603 |
| 412 | Ga0207703_10116317 | 3300026035 | Bacteria | 2289 |
| 413 | Ga0207639_10073801 | 3300026041 | Bacteria | 2676 |
| 414 | Ga0207678_10009775 | 3300026067 | Bacteria | 8435 |
| 415 | Ga0207678_10033110 | 3300026067 | Bacteria | 4504 |
| 416 | Ga0207678_10101339 | 3300026067 | Bacteria | 2459 |
| 417 | Ga0207678_10234604 | 3300026067 | Bacteria | 1571 |
| 418 | Ga0207708_10004102 | 3300026075 | Bacteria | 10718 |
| 419 | Ga0207708_10009551 | 3300026075 | Bacteria | 7191 |
| 420 | Ga0207708_10022857 | 3300026075 | Bacteria | 4722 |
| 421 | Ga0207708_10061545 | 3300026075 | Bacteria | 2866 |
| 422 | Ga0207708_10079636 | 3300026075 | Bacteria | 2517 |
| 423 | Ga0207702_10000690 | 3300026078 | Bacteria | 36486 |
| 424 | Ga0207702_10003502 | 3300026078 | Bacteria | 14309 |
| 425 | Ga0207702_10022825 | 3300026078 | Bacteria | 5191 |
| 426 | Ga0207702_10293814 | 3300026078 | Bacteria | 1540 |
| 427 | Ga0207702_10296520 | 3300026078 | Bacteria | 1533 |
| 428 | Ga0207641_10001193 | 3300026088 | Bacteria | 26064 |
| 429 | Ga0207641_10002149 | 3300026088 | Bacteria | 18577 |
| 430 | Ga0207648_10008953 | 3300026089 | Bacteria | 9628 |
| 431 | Ga0207648_10307674 | 3300026089 | Bacteria | 1422 |
| 432 | Ga0207676_10000042 | 3300026095 | Bacteria | 163475 |
| 433 | Ga0207674_10037485 | 3300026116 | Bacteria | 5042 |
| 434 | Ga0207674_10173692 | 3300026116 | Bacteria | 2108 |
| 435 | Ga0207674_10286741 | 3300026116 | Bacteria | 1595 |
| 436 | Ga0207674_10289820 | 3300026116 | Bacteria | 1586 |
| 437 | Ga0207675_100014737 | 3300026118 | Bacteria | 7292 |
| 438 | Ga0207675_100159493 | 3300026118 | Bacteria | 2151 |
| 439 | Ga0207675_100217962 | 3300026118 | Bacteria | 1838 |
| 440 | Ga0207683_10003514 | 3300026121 | Bacteria | 13672 |
| 441 | Ga0207683_10191798 | 3300026121 | Bacteria | 1856 |
| 442 | Ga0207683_10335749 | 3300026121 | Bacteria | 1385 |
| 443 | Ga0207698_10000015 | 3300026142 | Bacteria | 207368 |
| 444 | Ga0207698_10018608 | 3300026142 | Bacteria | 4739 |
| 445 | Ga0207698_10039926 | 3300026142 | Bacteria | 3481 |
| 446 | Ga0207428_10007595 | 3300027907 | Bacteria | 9884 |
| 447 | Ga0207428_10045873 | 3300027907 | Bacteria | 3517 |
| 448 | Ga0207428_10080156 | 3300027907 | Bacteria | 2551 |
| 449 | Ga0268266_10000029 | 3300028379 | Bacteria | 424015 |
| 450 | Ga0268265_10001048 | 3300028380 | Bacteria | 24851 |
| 451 | Ga0268264_10000725 | 3300028381 | Bacteria | 37821 |
| 452 | Ga0268264_10042318 | 3300028381 | Bacteria | 3771 |
| 453 | Ga0268264_10217309 | 3300028381 | Bacteria | 1758 |
| 454 | Ga0268264_10382828 | 3300028381 | Bacteria | 1348 |
| 455 | Ga0265337_1000061 | 3300028556 | Bacteria | 49480 |
| 456 | Ga0265337_1001815 | 3300028556 | Bacteria | 10247 |
| 457 | Ga0265326_10000016 | 3300028558 | Bacteria | 154674 |
| 458 | Ga0265326_10000067 | 3300028558 | Bacteria | 59507 |
| 459 | Ga0265326_10001279 | 3300028558 | Bacteria | 8925 |
| 460 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 461 | Ga0265319_1000796 | 3300028563 | Bacteria | 20409 |
| 462 | Ga0265319_1000847 | 3300028563 | Bacteria | 19536 |
| 463 | Ga0265319_1011920 | 3300028563 | Bacteria | 3535 |
| 464 | Ga0265334_10000003 | 3300028573 | Bacteria | 244354 |
| 465 | Ga0265318_10000961 | 3300028577 | Bacteria | 18489 |
| 466 | Ga0265318_10011281 | 3300028577 | Bacteria | 3853 |
| 467 | Ga0265322_10000005 | 3300028654 | Bacteria | 246112 |
| 468 | Ga0265336_10000060 | 3300028666 | Bacteria | 103055 |
| 469 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 470 | Ga0265338_10000234 | 3300028800 | Bacteria | 103028 |
| 471 | Ga0265338_10005421 | 3300028800 | Bacteria | 16659 |
| 472 | Ga0265338_10019449 | 3300028800 | Bacteria | 7204 |
| 473 | Ga0265338_10029749 | 3300028800 | Bacteria | 5405 |
| 474 | Ga0265324_10000510 | 3300029957 | Bacteria | 26678 |
| 475 | Ga0265324_10007611 | 3300029957 | Bacteria | 4372 |
| 476 | Ga0307511_10073950 | 3300030521 | Bacteria | 2460 |
| 477 | Ga0265332_10023029 | 3300031238 | Bacteria | 2747 |
| 478 | Ga0265328_10000563 | 3300031239 | Bacteria | 17200 |
| 479 | Ga0265320_10000010 | 3300031240 | Bacteria | 250501 |
| 480 | Ga0265320_10001744 | 3300031240 | Bacteria | 15420 |
| 481 | Ga0265325_10006156 | 3300031241 | Bacteria | 7321 |
| 482 | Ga0265340_10000014 | 3300031247 | Bacteria | 103055 |
| 483 | Ga0265340_10033183 | 3300031247 | Bacteria | 2572 |
| 484 | Ga0265331_10003612 | 3300031250 | Bacteria | 9895 |
| 485 | Ga0265327_10000040 | 3300031251 | Bacteria | 291052 |
| 486 | Ga0265327_10007890 | 3300031251 | Bacteria | 8068 |
| 487 | Ga0265327_10014680 | 3300031251 | Bacteria | 5110 |
| 488 | Ga0265327_10053485 | 3300031251 | Bacteria | 2095 |
| 489 | Ga0265316_10301836 | 3300031344 | Bacteria | 1166 |
| 490 | Ga0265314_10000208 | 3300031711 | Bacteria | 86855 |
| 491 | Ga0265314_10022037 | 3300031711 | Bacteria | 4885 |
| 492 | Ga0265314_10063741 | 3300031711 | Bacteria | 2499 |
| 493 | Ga0307410_10023485 | 3300031852 | Bacteria | 3834 |
| 494 | Ga0307410_10052995 | 3300031852 | Bacteria | 2743 |
| 495 | Ga0307406_10047459 | 3300031901 | Bacteria | 2707 |
| 496 | Ga0307406_10051417 | 3300031901 | Bacteria | 2616 |
| 497 | Ga0307406_10127295 | 3300031901 | Bacteria | 1782 |
| 498 | Ga0307406_10235095 | 3300031901 | Bacteria | 1371 |
| 499 | Ga0307407_10089927 | 3300031903 | Bacteria | 1879 |
| 500 | Ga0307409_100029080 | 3300031995 | Bacteria | 3949 |
| 501 | Ga0307409_100029492 | 3300031995 | Bacteria | 3928 |
| 502 | Ga0307409_100040412 | 3300031995 | Bacteria | 3472 |
| 503 | Ga0307409_100092559 | 3300031995 | Bacteria | 2481 |
| 504 | Ga0307409_100675596 | 3300031995 | Bacteria | 1029 |
| 505 | Ga0307416_100025273 | 3300032002 | Bacteria | 4351 |
| 506 | Ga0307416_100080230 | 3300032002 | Bacteria | 2753 |
| 507 | Ga0307416_100102352 | 3300032002 | Bacteria | 2497 |
| 508 | Ga0307416_100105250 | 3300032002 | Bacteria | 2469 |
| 509 | Ga0307416_100141268 | 3300032002 | Bacteria | 2189 |
| 510 | Ga0307416_100314133 | 3300032002 | Bacteria | 1565 |
| 511 | Ga0307411_10028712 | 3300032005 | Bacteria | 3387 |
| 512 | Ga0307415_100001546 | 3300032126 | Bacteria | 11063 |
| 513 | Ga0307415_100005858 | 3300032126 | Bacteria | 6571 |
| 514 | Ga0307415_100369356 | 3300032126 | Bacteria | 1214 |
| 515 | Ga0373956_0005446 | 3300035119 | Bacteria | 5097 |
| 516 | Ga0373955_0048898 | 3300035172 | Bacteria | 2295 |
| 517 | Ga0373955_0133634 | 3300035172 | Bacteria | 1450 |
| 518 | Ga0373961_0030544 | 3300035241 | Bacteria | 1500 |
| 519 | Ga0373931_0025368 | 3300035691 | Bacteria | 3011 |
| 520 | Ga0373927_0000006 | 3300035695 | Bacteria | 208965 |
| 521 | Ga0373933_0006691 | 3300035724 | Bacteria | 6282 |
| 522 | Ga0373933_0126249 | 3300035724 | Bacteria | 1605 |
| 523 | Ga0373937_0001667 | 3300036401 | Bacteria | 18672 |
| 524 | Ga0373937_0004436 | 3300036401 | Bacteria | 11927 |
| 525 | Ga0373937_0190830 | 3300036401 | Bacteria | 1925 |
| 526 | Ga0373937_0508124 | 3300036401 | Bacteria | 1145 |
| 527 | Ga0310109_000315 | 3300036534 | Bacteria | 3470 |
| 528 | Ga0373925_0503467 | 3300037068 | Bacteria | 994 |
| 529 | Ga0395900_0008276 | 3300037418 | Bacteria | 10704 |
| 530 | Ga0395900_0058250 | 3300037418 | Bacteria | 3977 |
| 531 | Ga0395900_0268389 | 3300037418 | Bacteria | 1702 |
| 532 | Ga0395898_0002400 | 3300037466 | Bacteria | 22246 |
| 533 | Ga0395898_0049471 | 3300037466 | Bacteria | 4119 |
| 534 | Ga0395898_0151434 | 3300037466 | Bacteria | 2219 |
| 535 | Ga0395898_0289935 | 3300037466 | Bacteria | 1561 |
| 536 | Ga0395898_0415425 | 3300037466 | Bacteria | 1282 |
| 537 | Ga0395905_0259976 | 3300037471 | Bacteria | 1621 |
| 538 | Ga0436364_0038128 | 3300037853 | Bacteria | 45811 |
| 539 | Ga0436364_0216710 | 3300037853 | Bacteria | 4235 |
| 540 | Ga0436364_0363596 | 3300037853 | Bacteria | 7972 |
| 541 | Ga0436364_0378806 | 3300037853 | Bacteria | 3607 |
| 542 | Ga0436364_0532382 | 3300037853 | Bacteria | 57757 |
| 543 | Ga0436364_0645424 | 3300037853 | Bacteria | 11429 |
| 544 | Ga0436364_0857403 | 3300037853 | Bacteria | 6641 |
| 545 | Ga0436364_1002783 | 3300037853 | Bacteria | 2931 |
| 546 | Ga0436364_1290040 | 3300037853 | Bacteria | 5926 |
| 547 | Ga0436364_1552666 | 3300037853 | Bacteria | 1307 |
| 548 | Ga0395901_0444783 | 3300038443 | Bacteria | 1326 |
| 549 | Ga0436365_0235777 | 3300039437 | Bacteria | 8316 |
| 550 | Ga0436365_0561226 | 3300039437 | Bacteria | 1172 |
| 551 | Ga0436365_0656722 | 3300039437 | Bacteria | 22448 |
| 552 | Ga0436365_0725610 | 3300039437 | Bacteria | 1879 |
| 553 | Ga0436365_0730546 | 3300039437 | Bacteria | 16641 |
| 554 | Ga0436365_1012617 | 3300039437 | Bacteria | 1151 |
| 555 | Ga0436365_1022230 | 3300039437 | Bacteria | 2571 |
| 556 | Ga0436365_1104539 | 3300039437 | Bacteria | 8346 |
| 557 | Ga0436365_1199460 | 3300039437 | Bacteria | 4663 |
| 558 | Ga0436365_1704131 | 3300039437 | Bacteria | 7402 |
| 559 | Ga0436363_0116001 | 3300039450 | Bacteria | 48959 |
| 560 | Ga0436363_0150822 | 3300039450 | Bacteria | 5226 |
| 561 | Ga0436363_1208092 | 3300039450 | Bacteria | 1972 |
| 562 | Ga0436363_1218786 | 3300039450 | Bacteria | 1322 |
| 563 | Ga0436363_1432146 | 3300039450 | Bacteria | 7039 |
| 564 | Ga0436363_1478257 | 3300039450 | Bacteria | 1557 |
| 565 | Ga0436363_1499638 | 3300039450 | Bacteria | 11397 |
| 566 | Ga0436363_1670627 | 3300039450 | Bacteria | 2560 |
| 567 | Ga0436362_0046940 | 3300039453 | Bacteria | 1348 |
| 568 | Ga0436362_0563621 | 3300039453 | Bacteria | 1095 |
| 569 | Ga0436362_0681159 | 3300039453 | Bacteria | 1682 |
| 570 | Ga0436362_0885374 | 3300039453 | Bacteria | 1695 |
| 571 | Ga0436362_0920455 | 3300039453 | Bacteria | 3240 |
| 572 | Ga0436362_0949373 | 3300039453 | Bacteria | 3289 |
| 573 | Ga0451853_2799129 | 3300041512 | Bacteria | 1416 |
| 574 | Ga0451577_0066833 | 3300042876 | Bacteria | 3206 |
| 575 | Ga0466972_0061114 | 3300044658 | Unclassified | 1807 |
| 576 | Ga0466972_0128973 | 3300044658 | Unclassified | 1191 |
| 577 | Ga0453683_0032610 | 3300044673 | Bacteria | 3286 |
| 578 | Ga0466965_0046560 | 3300044683 | Bacteria | 2147 |
| 579 | Ga0466966_0044537 | 3300044684 | Bacteria | 2840 |
| 580 | Ga0466966_0054784 | 3300044684 | Bacteria | 2526 |
| 581 | Ga0466961_0003908 | 3300044693 | Bacteria | 9318 |
| 582 | Ga0466961_0004518 | 3300044693 | Bacteria | 8725 |
| 583 | Ga0466961_0019145 | 3300044693 | Bacteria | 4405 |
| 584 | Ga0466961_0029816 | 3300044693 | Unclassified | 3505 |
| 585 | Ga0466961_0050408 | 3300044693 | Bacteria | 2659 |
| 586 | Ga0466963_0000415 | 3300044694 | Bacteria | 19583 |
| 587 | Ga0466963_0002882 | 3300044694 | Bacteria | 9719 |
| 588 | Ga0466963_0016311 | 3300044694 | Bacteria | 4617 |
| 589 | Ga0466963_0019699 | 3300044694 | Bacteria | 4236 |
| 590 | Ga0466963_0020516 | 3300044694 | Bacteria | 4156 |
| 591 | Ga0466963_0021672 | 3300044694 | Bacteria | 4057 |
| 592 | Ga0466963_0025064 | 3300044694 | Bacteria | 3801 |
| 593 | Ga0466963_0037627 | 3300044694 | Bacteria | 3161 |
| 594 | Ga0466963_0047724 | 3300044694 | Bacteria | 2827 |
| 595 | Ga0466963_0060675 | 3300044694 | Bacteria | 2526 |
| 596 | Ga0466963_0097585 | 3300044694 | Bacteria | 2008 |
| 597 | Ga0466963_0125338 | 3300044694 | Bacteria | 1770 |
| 598 | Ga0466963_0177733 | 3300044694 | Bacteria | 1485 |
| 599 | Ga0466964_0016934 | 3300044706 | Bacteria | 2787 |
| 600 | Ga0466964_0026274 | 3300044706 | Bacteria | 2279 |
| 601 | Ga0466971_0036989 | 3300044719 | Bacteria | 2189 |
| 602 | Ga0466971_0052608 | 3300044719 | Bacteria | 1834 |
| 603 | Ga0466971_0118538 | 3300044719 | Bacteria | 1224 |
| 604 | Ga0466971_0162134 | 3300044719 | Bacteria | 1047 |
| 605 | Ga0466968_0019494 | 3300044735 | Bacteria | 2730 |
| 606 | Ga0466968_0019833 | 3300044735 | Bacteria | 2710 |
| 607 | Ga0466968_0036147 | 3300044735 | Bacteria | 2069 |
| 608 | Ga0466970_0035604 | 3300044765 | Bacteria | 2637 |
| 609 | Ga0466957_0001280 | 3300044842 | Bacteria | 13105 |
| 610 | Ga0466957_0065408 | 3300044842 | Bacteria | 2239 |
| 611 | Ga0466957_0069438 | 3300044842 | Bacteria | 2176 |
| 612 | Ga0466957_0141908 | 3300044842 | Bacteria | 1548 |
| 613 | Ga0466957_0205088 | 3300044842 | Bacteria | 1296 |
| 614 | Ga0466957_0219195 | 3300044842 | Bacteria | 1256 |
| 615 | Ga0466960_0000004 | 3300044901 | Bacteria | 84724 |
| 616 | Ga0466960_0009744 | 3300044901 | Bacteria | 3973 |
| 617 | Ga0466960_0037582 | 3300044901 | Bacteria | 2272 |
| 618 | Ga0466960_0081124 | 3300044901 | Bacteria | 1635 |
| 619 | Ga0466959_0002714 | 3300045049 | Bacteria | 11374 |
| 620 | Ga0466959_0013190 | 3300045049 | Bacteria | 5987 |
| 621 | Ga0466959_0020682 | 3300045049 | Bacteria | 4849 |
| 622 | Ga0466959_0049699 | 3300045049 | Bacteria | 3081 |
| 623 | Ga0466959_0066409 | 3300045049 | Bacteria | 2617 |
| 624 | Ga0466959_0081306 | 3300045049 | Bacteria | 2335 |
| 625 | Ga0466959_0148771 | 3300045049 | Bacteria | 1652 |
| 626 | Ga0466959_0177297 | 3300045049 | Bacteria | 1492 |
| 627 | Ga0466958_0000711 | 3300045836 | Bacteria | 14535 |
| 628 | Ga0466958_0009077 | 3300045836 | Bacteria | 5525 |
| 629 | Ga0466958_0013426 | 3300045836 | Bacteria | 4664 |
| 630 | Ga0466958_0014181 | 3300045836 | Bacteria | 4549 |
| 631 | Ga0466958_0015229 | 3300045836 | Bacteria | 4403 |
| 632 | Ga0466958_0029928 | 3300045836 | Bacteria | 3230 |
| 633 | Ga0466958_0038088 | 3300045836 | Bacteria | 2884 |
| 634 | Ga0466958_0045373 | 3300045836 | Bacteria | 2650 |
| 635 | Ga0466958_0097444 | 3300045836 | Bacteria | 1825 |
| 636 | Ga0466958_0108348 | 3300045836 | Bacteria | 1733 |
| 637 | Ga0466958_0126504 | 3300045836 | Bacteria | 1603 |
| 638 | Ga0466958_0156801 | 3300045836 | Bacteria | 1437 |
| 639 | Ga0466958_0158307 | 3300045836 | Bacteria | 1430 |
| 640 | Ga0466967_0010925 | 3300045976 | Bacteria | 6843 |
| 641 | Ga0466967_0041265 | 3300045976 | Bacteria | 3977 |
| 642 | Ga0466967_0061214 | 3300045976 | Bacteria | 3339 |
| 643 | Ga0466967_0074790 | 3300045976 | Bacteria | 3043 |
| 644 | Ga0466967_0126554 | 3300045976 | Bacteria | 2367 |
| 645 | Ga0466967_0128157 | 3300045976 | Bacteria | 2353 |
| 646 | Ga0466967_0159296 | 3300045976 | Bacteria | 2117 |
| 647 | Ga0466967_0168574 | 3300045976 | Bacteria | 2059 |
| 648 | Ga0466967_0196676 | 3300045976 | Bacteria | 1908 |
| 649 | Ga0466967_0380437 | 3300045976 | Bacteria | 1370 |
| 650 | Ga0466967_0427957 | 3300045976 | Bacteria | 1291 |
| 651 | Ga0466967_0513348 | 3300045976 | Bacteria | 1177 |
| 652 | Ga0495592_0000176 | 3300046454 | Bacteria | 56403 |
| 653 | Ga0495603_0000194 | 3300046455 | Bacteria | 31819 |
| 654 | Ga0495603_0008081 | 3300046455 | Bacteria | 6357 |
| 655 | Ga0495590_0077347 | 3300046457 | Bacteria | 1171 |
| 656 | Ga0495629_0000806 | 3300046459 | Bacteria | 25376 |
| 657 | Ga0495629_0003436 | 3300046459 | Bacteria | 11976 |
| 658 | Ga0495629_0012055 | 3300046459 | Bacteria | 6266 |
| 659 | Ga0495629_0041278 | 3300046459 | Bacteria | 3247 |
| 660 | Ga0495629_0070965 | 3300046459 | Bacteria | 2431 |
| 661 | Ga0495638_0087005 | 3300046460 | Bacteria | 1888 |
| 662 | Ga0495641_0000004 | 3300046461 | Bacteria | 210501 |
| 663 | Ga0495651_0002656 | 3300046462 | Bacteria | 13866 |
| 664 | Ga0495651_0037463 | 3300046462 | Bacteria | 3775 |
| 665 | Ga0495651_0184032 | 3300046462 | Bacteria | 1476 |
| 666 | Ga0495653_0000231 | 3300046463 | Bacteria | 45492 |
| 667 | Ga0495653_0007743 | 3300046463 | Bacteria | 8791 |
| 668 | Ga0495653_0052740 | 3300046463 | Bacteria | 3116 |
| 669 | Ga0495650_0000035 | 3300046471 | Bacteria | 403799 |
| 670 | Ga0495582_0000002 | 3300046473 | Bacteria | 219909 |
| 671 | Ga0495662_0000051 | 3300046476 | Bacteria | 40340 |
| 672 | Ga0495662_0005718 | 3300046476 | Bacteria | 6217 |
| 673 | Ga0495664_0000086 | 3300046477 | Bacteria | 45525 |
| 674 | Ga0495584_0125085 | 3300046491 | Bacteria | 1303 |
| 675 | Ga0495594_0000012 | 3300046499 | Bacteria | 105133 |
| 676 | Ga0495596_0024370 | 3300046500 | Bacteria | 2450 |
| 677 | Ga0495606_0000895 | 3300046507 | Bacteria | 44393 |
| 678 | Ga0495608_0000013 | 3300046511 | Bacteria | 228481 |
| 679 | Ga0495608_0000092 | 3300046511 | Bacteria | 64795 |
| 680 | Ga0495618_0000054 | 3300046514 | Bacteria | 83787 |
| 681 | Ga0495618_0000094 | 3300046514 | Bacteria | 64293 |
| 682 | Ga0495618_0022690 | 3300046514 | Bacteria | 3877 |
| 683 | Ga0495620_0032803 | 3300046515 | Bacteria | 2363 |
| 684 | Ga0495620_0084845 | 3300046515 | Bacteria | 1277 |
| 685 | Ga0495628_0002492 | 3300046516 | Bacteria | 16576 |
| 686 | Ga0495628_0120326 | 3300046516 | Bacteria | 2015 |
| 687 | Ga0495630_0000032 | 3300046517 | Bacteria | 134425 |
| 688 | Ga0495630_0000328 | 3300046517 | Bacteria | 37847 |
| 689 | Ga0495630_0001088 | 3300046517 | Bacteria | 18687 |
| 690 | Ga0495630_0005122 | 3300046517 | Bacteria | 9222 |
| 691 | Ga0495630_0054464 | 3300046517 | Bacteria | 2997 |
| 692 | Ga0495630_0339366 | 3300046517 | Bacteria | 1149 |
| 693 | Ga0495637_0112337 | 3300046520 | Bacteria | 1055 |
| 694 | Ga0495644_0002998 | 3300046523 | Bacteria | 6691 |
| 695 | Ga0495652_0000018 | 3300046529 | Bacteria | 201634 |
| 696 | Ga0495652_0001501 | 3300046529 | Bacteria | 25686 |
| 697 | Ga0495640_0006754 | 3300046533 | Bacteria | 9054 |
| 698 | Ga0495640_0016804 | 3300046533 | Bacteria | 5470 |
| 699 | Ga0495586_0001742 | 3300046535 | Bacteria | 11874 |
| 700 | Ga0495587_0028299 | 3300046536 | Bacteria | 3408 |
| 701 | Ga0495587_0075141 | 3300046536 | Bacteria | 1962 |
| 702 | Ga0495621_0001476 | 3300046539 | Bacteria | 6101 |
| 703 | Ga0495645_0000088 | 3300046543 | Bacteria | 63785 |
| 704 | Ga0495645_0000535 | 3300046543 | Bacteria | 26139 |
| 705 | Ga0495645_0055112 | 3300046543 | Bacteria | 2887 |
| 706 | Ga0495622_0000353 | 3300046557 | Bacteria | 32367 |
| 707 | Ga0495667_0000265 | 3300046559 | Bacteria | 34047 |
| 708 | Ga0495667_0000725 | 3300046559 | Bacteria | 21166 |
| 709 | Ga0495667_0055519 | 3300046559 | Bacteria | 2605 |
| 710 | Ga0495656_0001416 | 3300046615 | Bacteria | 7842 |
| 711 | Ga0495668_0160379 | 3300046616 | Bacteria | 1232 |
| 712 | Ga0495634_0000002 | 3300046642 | Bacteria | 247842 |
| 713 | Ga0495634_0000191 | 3300046642 | Bacteria | 56356 |
| 714 | Ga0495634_0016540 | 3300046642 | Bacteria | 5273 |
| 715 | Ga0495634_0165686 | 3300046642 | Bacteria | 1391 |
| 716 | Ga0495625_0000243 | 3300046660 | Bacteria | 85589 |
| 717 | Ga0495635_0000182 | 3300046663 | Bacteria | 39469 |
| 718 | Ga0495635_0000709 | 3300046663 | Bacteria | 21497 |
| 719 | Ga0495635_0097359 | 3300046663 | Bacteria | 2011 |
| 720 | Ga0495588_0000266 | 3300046674 | Bacteria | 40474 |
| 721 | Ga0495657_0000003 | 3300046675 | Bacteria | 279680 |
| 722 | Ga0495657_0000006 | 3300046675 | Bacteria | 250610 |
| 723 | Ga0495599_0132729 | 3300046678 | Bacteria | 1546 |
| 724 | Ga0495599_0174331 | 3300046678 | Bacteria | 1327 |
| 725 | Ga0495646_0066231 | 3300046680 | Bacteria | 2137 |
| 726 | Ga0495647_0000005 | 3300046681 | Bacteria | 125996 |
| 727 | Ga0495647_0001427 | 3300046681 | Bacteria | 7390 |
| 728 | Ga0495647_0011078 | 3300046681 | Bacteria | 3082 |
| 729 | Ga0495658_0000001 | 3300046683 | Bacteria | 385362 |
| 730 | Ga0495658_0112517 | 3300046683 | Bacteria | 1638 |
| 731 | Ga0495669_0000188 | 3300046684 | Bacteria | 38417 |
| 732 | Ga0495669_0013142 | 3300046684 | Bacteria | 3526 |
| 733 | Ga0495613_0000173 | 3300046689 | Bacteria | 62463 |
| 734 | Ga0495613_0000233 | 3300046689 | Bacteria | 53074 |
| 735 | Ga0495624_0000563 | 3300046690 | Bacteria | 29131 |
| 736 | Ga0495624_0000600 | 3300046690 | Bacteria | 28092 |
| 737 | Ga0495600_0002279 | 3300046809 | Bacteria | 10937 |
| 738 | Ga0495600_0004809 | 3300046809 | Bacteria | 8108 |
| 739 | Ga0495600_0007184 | 3300046809 | Bacteria | 6801 |
| 740 | Ga0495600_0015795 | 3300046809 | Bacteria | 4780 |
| 741 | Ga0495600_0105089 | 3300046809 | Bacteria | 1840 |
| 742 | Ga0495600_0168896 | 3300046809 | Bacteria | 1412 |
| 743 | Ga0495604_0000437 | 3300047317 | Bacteria | 37081 |
| 744 | Ga0495604_0000509 | 3300047317 | Bacteria | 34149 |
| 745 | Ga0495604_0101081 | 3300047317 | Bacteria | 2118 |
| 746 | Ga0495636_0127956 | 3300047318 | Bacteria | 1128 |
| 747 | Ga0495674_0000039 | 3300047319 | Bacteria | 97645 |
| 748 | Ga0495674_0014499 | 3300047319 | Bacteria | 7375 |
| 749 | Ga0495674_0194058 | 3300047319 | Bacteria | 1687 |
| 750 | Ga0495676_0000320 | 3300047321 | Bacteria | 38969 |
| 751 | Ga0495676_0009275 | 3300047321 | Bacteria | 8964 |
| 752 | Ga0495676_0038900 | 3300047321 | Bacteria | 3946 |
| 753 | Ga0495676_0250948 | 3300047321 | Bacteria | 1207 |
| 754 | Ga0495680_0000113 | 3300047322 | Bacteria | 76525 |
| 755 | Ga0495680_0000513 | 3300047322 | Bacteria | 43869 |
| 756 | Ga0495680_0001447 | 3300047322 | Bacteria | 25583 |
| 757 | Ga0495680_0005366 | 3300047322 | Bacteria | 12092 |
| 758 | Ga0495680_0074534 | 3300047322 | Bacteria | 2577 |
| 759 | Ga0495675_0000002 | 3300047444 | Bacteria | 216469 |
| 760 | Ga0495675_0176154 | 3300047444 | Bacteria | 1311 |
| 761 | Ga0495679_015058 | 3300047446 | Bacteria | 2840 |
| 762 | Ga0495684_0002596 | 3300047471 | Bacteria | 14354 |
| 763 | Ga0495684_0041166 | 3300047471 | Bacteria | 3541 |
| 764 | Ga0495686_0085784 | 3300047472 | Bacteria | 1917 |
| 765 | Ga0495602_0000034 | 3300048088 | Bacteria | 140722 |
| 766 | Ga0495602_0000315 | 3300048088 | Bacteria | 44563 |
| 767 | Ga0495602_0011907 | 3300048088 | Bacteria | 8971 |
| 768 | Ga0495602_0080789 | 3300048088 | Bacteria | 2737 |
| 769 | Ga0495614_0078482 | 3300048089 | Bacteria | 1429 |
| 770 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 771 | Ga0496100_0000136 | 3300048903 | Bacteria | 40939 |
| 772 | Ga0496100_0000234 | 3300048903 | Bacteria | 29327 |
| 773 | Ga0496100_0008447 | 3300048903 | Bacteria | 5742 |
| 774 | Ga0496101_0000028 | 3300048904 | Bacteria | 198664 |
| 775 | Ga0496101_0000382 | 3300048904 | Bacteria | 29327 |
| 776 | Ga0496101_0005625 | 3300048904 | Bacteria | 7992 |
| 777 | Ga0496102_0000096 | 3300048905 | Bacteria | 124941 |
| 778 | Ga0496102_0000129 | 3300048905 | Bacteria | 104478 |
| 779 | Ga0496102_0047357 | 3300048905 | Bacteria | 3906 |
| 780 | Ga0496103_0000035 | 3300048906 | Bacteria | 182242 |
| 781 | Ga0496103_0000087 | 3300048906 | Bacteria | 104566 |
| 782 | Ga0496103_0005940 | 3300048906 | Bacteria | 7298 |
| 783 | Ga0496103_0027889 | 3300048906 | Bacteria | 3425 |
| 784 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 785 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 786 | Ga0496104_0000028 | 3300048907 | Bacteria | 203377 |
| 787 | Ga0496104_0013374 | 3300048907 | Bacteria | 7395 |
| 788 | Ga0496104_0043010 | 3300048907 | Bacteria | 4241 |
| 789 | Ga0496104_0059462 | 3300048907 | Bacteria | 3618 |
| 790 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 791 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 792 | Ga0496105_0000051 | 3300048908 | Bacteria | 90365 |
| 793 | Ga0496105_0010992 | 3300048908 | Bacteria | 7133 |
| 794 | Ga0496105_0016037 | 3300048908 | Bacteria | 5976 |
| 795 | Ga0496105_0066139 | 3300048908 | Bacteria | 2984 |
| 796 | Ga0496105_0081709 | 3300048908 | Bacteria | 2669 |
| 797 | Ga0496105_0157387 | 3300048908 | Bacteria | 1865 |
| 798 | Ga0496106_0000134 | 3300048909 | Bacteria | 55531 |
| 799 | Ga0496106_0000172 | 3300048909 | Bacteria | 47232 |
| 800 | Ga0496106_0000455 | 3300048909 | Bacteria | 29281 |
| 801 | Ga0496106_0004709 | 3300048909 | Bacteria | 10107 |
| 802 | Ga0496106_0021569 | 3300048909 | Bacteria | 4783 |
| 803 | Ga0496107_0000002 | 3300048910 | Bacteria | 320871 |
| 804 | Ga0496107_0000234 | 3300048910 | Bacteria | 29310 |
| 805 | Ga0496108_0000004 | 3300048911 | Bacteria | 545055 |
| 806 | Ga0496108_0000005 | 3300048911 | Bacteria | 535059 |
| 807 | Ga0496108_0000721 | 3300048911 | Bacteria | 25679 |
| 808 | Ga0496108_0005715 | 3300048911 | Bacteria | 10069 |
| 809 | Ga0496108_0006524 | 3300048911 | Bacteria | 9461 |
| 810 | Ga0496108_0016000 | 3300048911 | Bacteria | 6115 |
| 811 | Ga0496108_0091865 | 3300048911 | Bacteria | 2580 |
| 812 | Ga0496108_0197922 | 3300048911 | Bacteria | 1743 |
| 813 | Ga0496108_0207400 | 3300048911 | Bacteria | 1701 |
| 814 | Ga0496108_0216683 | 3300048911 | Bacteria | 1662 |
| 815 | Ga0496108_0502181 | 3300048911 | Bacteria | 1059 |
| 816 | Ga0496109_0000002 | 3300048912 | Bacteria | 443393 |
| 817 | Ga0496109_0000011 | 3300048912 | Bacteria | 234908 |
| 818 | Ga0496109_0000013 | 3300048912 | Bacteria | 227469 |
| 819 | Ga0496109_0000389 | 3300048912 | Bacteria | 39934 |
| 820 | Ga0496109_0001749 | 3300048912 | Bacteria | 18103 |
| 821 | Ga0496109_0016118 | 3300048912 | Bacteria | 6531 |
| 822 | Ga0496109_0066882 | 3300048912 | Bacteria | 3292 |
| 823 | Ga0496109_0234550 | 3300048912 | Bacteria | 1727 |
| 824 | Ga0496110_0000185 | 3300048913 | Bacteria | 39094 |
| 825 | Ga0496110_0001335 | 3300048913 | Bacteria | 17714 |
| 826 | Ga0496110_0001995 | 3300048913 | Bacteria | 15182 |
| 827 | Ga0496110_0037267 | 3300048913 | Bacteria | 4226 |
| 828 | Ga0496110_0054802 | 3300048913 | Bacteria | 3507 |
| 829 | Ga0496110_0061760 | 3300048913 | Bacteria | 3308 |
| 830 | Ga0496110_0077077 | 3300048913 | Bacteria | 2965 |
| 831 | Ga0496110_0078101 | 3300048913 | Bacteria | 2947 |
| 832 | Ga0496110_0392354 | 3300048913 | Bacteria | 1265 |
| 833 | Ga0496111_0000103 | 3300048914 | Bacteria | 36804 |
| 834 | Ga0496111_0001859 | 3300048914 | Bacteria | 12460 |
| 835 | Ga0496111_0006437 | 3300048914 | Bacteria | 7625 |
| 836 | Ga0496111_0010556 | 3300048914 | Bacteria | 6203 |
| 837 | Ga0496111_0024177 | 3300048914 | Bacteria | 4275 |
| 838 | Ga0496111_0071374 | 3300048914 | Bacteria | 2527 |
| 839 | Ga0496111_0124566 | 3300048914 | Bacteria | 1905 |
| 840 | Ga0496111_0227613 | 3300048914 | Bacteria | 1385 |
| 841 | Ga0496112_0000661 | 3300048915 | Bacteria | 23981 |
| 842 | Ga0496112_0001233 | 3300048915 | Bacteria | 19297 |
| 843 | Ga0496112_0001703 | 3300048915 | Bacteria | 17163 |
| 844 | Ga0496112_0040212 | 3300048915 | Bacteria | 4572 |
| 845 | Ga0496112_0399898 | 3300048915 | Bacteria | 1313 |
| 846 | Ga0496113_0000017 | 3300048916 | Bacteria | 74327 |
| 847 | Ga0496113_0007454 | 3300048916 | Bacteria | 7044 |
| 848 | Ga0496113_0009718 | 3300048916 | Bacteria | 6321 |
| 849 | Ga0496113_0017673 | 3300048916 | Bacteria | 4956 |
| 850 | Ga0496113_0023407 | 3300048916 | Bacteria | 4379 |
| 851 | Ga0496113_0056331 | 3300048916 | Bacteria | 2951 |
| 852 | Ga0496113_0093778 | 3300048916 | Bacteria | 2318 |
| 853 | Ga0496113_0103177 | 3300048916 | Bacteria | 2212 |
| 854 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 855 | Ga0496114_0315326 | 3300048917 | Bacteria | 1381 |
| 856 | Ga0496115_0000022 | 3300048918 | Bacteria | 164224 |
| 857 | Ga0496115_0000408 | 3300048918 | Bacteria | 35443 |
| 858 | Ga0496115_0015665 | 3300048918 | Bacteria | 5756 |
| 859 | Ga0496115_0027710 | 3300048918 | Bacteria | 4434 |
| 860 | Ga0496115_0028807 | 3300048918 | Bacteria | 4355 |
| 861 | Ga0496115_0036332 | 3300048918 | Bacteria | 3900 |
| 862 | Ga0496116_0000120 | 3300048919 | Bacteria | 166804 |
| 863 | Ga0496118_0004106 | 3300048921 | Bacteria | 17626 |
| 864 | Ga0496119_0009861 | 3300048922 | Bacteria | 8117 |
| 865 | Ga0496119_0015154 | 3300048922 | Bacteria | 5965 |
| 866 | Ga0496119_0098951 | 3300048922 | Bacteria | 1641 |
| 867 | Ga0496120_0002756 | 3300048923 | Bacteria | 17134 |
| 868 | Ga0496120_0031163 | 3300048923 | Bacteria | 3233 |
| 869 | Ga0496121_0002900 | 3300048924 | Bacteria | 25168 |
| 870 | Ga0496121_0005349 | 3300048924 | Bacteria | 16506 |
| 871 | Ga0496121_0051254 | 3300048924 | Bacteria | 3478 |
| 872 | Ga0496124_0267006 | 3300048927 | Bacteria | 1255 |
| 873 | Ga0496126_0015537 | 3300048929 | Bacteria | 7650 |
| 874 | Ga0496126_0057903 | 3300048929 | Bacteria | 3495 |
| 875 | Ga0501031_0000272 | 3300049568 | Bacteria | 29278 |
| 876 | Ga0501031_0010575 | 3300049568 | Bacteria | 6008 |
| 877 | Ga0501032_0002738 | 3300049569 | Bacteria | 13725 |
| 878 | Ga0501032_0015713 | 3300049569 | Bacteria | 5336 |
| 879 | Ga0501033_0003448 | 3300049570 | Bacteria | 12998 |
| 880 | Ga0501033_0056764 | 3300049570 | Bacteria | 2893 |
| 881 | Ga0501034_0002876 | 3300049571 | Bacteria | 20017 |
| 882 | Ga0501034_0035223 | 3300049571 | Bacteria | 5075 |
| 883 | Ga0501034_0108701 | 3300049571 | Bacteria | 2764 |
| 884 | Ga0501034_0176227 | 3300049571 | Bacteria | 2104 |
| 885 | Ga0501034_0310807 | 3300049571 | Bacteria | 1510 |
| 886 | Ga0501036_0018894 | 3300049572 | Bacteria | 5782 |
| 887 | Ga0501036_0030448 | 3300049572 | Bacteria | 4558 |
| 888 | Ga0501036_0247634 | 3300049572 | Bacteria | 1494 |
| 889 | Ga0501037_0003467 | 3300049573 | Bacteria | 11448 |
| 890 | Ga0501037_0018819 | 3300049573 | Bacteria | 5088 |
| 891 | Ga0501038_0003846 | 3300049574 | Bacteria | 13960 |
| 892 | Ga0501038_0347821 | 3300049574 | Bacteria | 1155 |
| 893 | Ga0501039_0021888 | 3300049575 | Bacteria | 4905 |
| 894 | Ga0501039_0068905 | 3300049575 | Bacteria | 2746 |
| 895 | Ga0501041_0031944 | 3300049577 | Bacteria | 3182 |
| 896 | Ga0501042_0010066 | 3300049578 | Bacteria | 6322 |
| 897 | Ga0501042_0086233 | 3300049578 | Bacteria | 2252 |
| 898 | Ga0501042_0120745 | 3300049578 | Bacteria | 1887 |
| 899 | Ga0501042_0179788 | 3300049578 | Bacteria | 1526 |
| 900 | Ga0501043_0003675 | 3300049579 | Bacteria | 12596 |
| 901 | Ga0501043_0032176 | 3300049579 | Bacteria | 4122 |
| 902 | Ga0501046_0004234 | 3300049580 | Bacteria | 13054 |
| 903 | Ga0501046_0004261 | 3300049580 | Bacteria | 13022 |
| 904 | Ga0501047_0003193 | 3300049581 | Bacteria | 15541 |
| 905 | Ga0501047_0021038 | 3300049581 | Bacteria | 6266 |
| 906 | Ga0501047_0051756 | 3300049581 | Bacteria | 3969 |
| 907 | Ga0501047_0093418 | 3300049581 | Bacteria | 2887 |
| 908 | Ga0501047_0186161 | 3300049581 | Bacteria | 1941 |
| 909 | Ga0501048_0002902 | 3300049582 | Bacteria | 13084 |
| 910 | Ga0501048_0005946 | 3300049582 | Bacteria | 9286 |
| 911 | Ga0501048_0051449 | 3300049582 | Bacteria | 2932 |
| 912 | Ga0501067_0000864 | 3300049583 | Bacteria | 16300 |
| 913 | Ga0501067_0011384 | 3300049583 | Bacteria | 4926 |
| 914 | Ga0501067_0032096 | 3300049583 | Bacteria | 2914 |
| 915 | Ga0501067_0156469 | 3300049583 | Bacteria | 1270 |
| 916 | Ga0501068_0065620 | 3300049584 | Bacteria | 2210 |
| 917 | Ga0501068_0089473 | 3300049584 | Bacteria | 1898 |
| 918 | Ga0501069_0013053 | 3300049585 | Bacteria | 4427 |
| 919 | Ga0501069_0014239 | 3300049585 | Bacteria | 4248 |
| 920 | Ga0501069_0014727 | 3300049585 | Bacteria | 4183 |
| 921 | Ga0501070_0000603 | 3300049586 | Bacteria | 32865 |
| 922 | Ga0501070_0007617 | 3300049586 | Bacteria | 9191 |
| 923 | Ga0501070_0066070 | 3300049586 | Bacteria | 2995 |
| 924 | Ga0501070_0329638 | 3300049586 | Bacteria | 1241 |
| 925 | Ga0501070_0442685 | 3300049586 | Bacteria | 1048 |
| 926 | Ga0501071_0030061 | 3300049587 | Bacteria | 3840 |
| 927 | Ga0501072_0062732 | 3300049588 | Bacteria | 2931 |
| 928 | Ga0501072_0192515 | 3300049588 | Bacteria | 1626 |
| 929 | Ga0501073_0005549 | 3300049589 | Bacteria | 9436 |
| 930 | Ga0501074_0026308 | 3300049590 | Bacteria | 4218 |
| 931 | Ga0501074_0035338 | 3300049590 | Bacteria | 3620 |
| 932 | Ga0501074_0129328 | 3300049590 | Bacteria | 1807 |
| 933 | Ga0501075_0001603 | 3300049591 | Bacteria | 14813 |
| 934 | Ga0501075_0049705 | 3300049591 | Bacteria | 3152 |
| 935 | Ga0501077_0110823 | 3300049593 | Bacteria | 1739 |
| 936 | Ga0501079_0041556 | 3300049741 | Bacteria | 3550 |
| 937 | Ga0501079_0048854 | 3300049741 | Bacteria | 3265 |
| 938 | Ga0501079_0095148 | 3300049741 | Bacteria | 2308 |
| 939 | Ga0501080_0003769 | 3300049742 | Bacteria | 13389 |
| 940 | Ga0501080_0198304 | 3300049742 | Bacteria | 1843 |
| 941 | Ga0501083_0009148 | 3300049744 | Bacteria | 6998 |
| 942 | Ga0501083_0025722 | 3300049744 | Bacteria | 4074 |
| 943 | Ga0501035_0004600 | 3300049822 | Bacteria | 13082 |
| 944 | Ga0501035_0064276 | 3300049822 | Bacteria | 3261 |
| 945 | Ga0501044_0003139 | 3300049823 | Bacteria | 18693 |
| 946 | Ga0501044_0024786 | 3300049823 | Bacteria | 6364 |
| 947 | Ga0501044_0036180 | 3300049823 | Bacteria | 5165 |
| 948 | Ga0501044_0050761 | 3300049823 | Bacteria | 4278 |
| 949 | Ga0501045_0085562 | 3300049824 | Bacteria | 2327 |
| 950 | Ga0501045_0220725 | 3300049824 | Bacteria | 1411 |
| 951 | Ga0501212_010641 | 3300049851 | Bacteria | 1315 |
| 952 | nmdc:mga00v17_46073_c1 | 3300050491 | Bacteria | 2637 |
| 953 | nmdc:mga0yw44_15653_c1 | 3300050492 | Bacteria | 4070 |
| 954 | nmdc:mga0yw44_216496_c1 | 3300050492 | Bacteria | 1268 |
| 955 | nmdc:mga0yw44_8680_c1 | 3300050492 | Bacteria | 5081 |
| 956 | nmdc:mga05p37_15634_c1 | 3300050507 | Bacteria | 9120 |
| 957 | nmdc:mga05p37_1685_c1 | 3300050507 | Bacteria | 25708 |
| 958 | nmdc:mga05p37_224323_c1 | 3300050507 | Bacteria | 2266 |
| 959 | nmdc:mga05p37_240704_c1 | 3300050507 | Bacteria | 2176 |
| 960 | nmdc:mga09592_791_c1 | 3300050508 | Bacteria | 24480 |
| 961 | nmdc:mga0qj67_11680_c1 | 3300050509 | Bacteria | 6588 |
| 962 | nmdc:mga0qj67_20491_c1 | 3300050509 | Bacteria | 5063 |
| 963 | nmdc:mga0qj67_908_c1 | 3300050509 | Bacteria | 20357 |
| 964 | nmdc:mga06r32_118032_c1 | 3300050510 | Bacteria | 2615 |
| 965 | nmdc:mga08y16_10979_c1 | 3300050511 | Bacteria | 9510 |
| 966 | nmdc:mga08y16_305620_c1 | 3300050511 | Bacteria | 1639 |
| 967 | nmdc:mga08y16_327363_c1 | 3300050511 | Bacteria | 1577 |
| 968 | nmdc:mga0n895_29896_c1 | 3300050512 | Bacteria | 5201 |
| 969 | nmdc:mga0n895_70510_c1 | 3300050512 | Bacteria | 3464 |
| 970 | nmdc:mga0n895_82535_c1 | 3300050512 | Bacteria | 3204 |
| 971 | nmdc:mga0rr50_150572_c1 | 3300050513 | Bacteria | 1880 |
| 972 | nmdc:mga0a205_120886_c1 | 3300050515 | Bacteria | 2518 |
| 973 | nmdc:mga0a205_281_c1 | 3300050515 | Bacteria | 37267 |
| 974 | Ga0495601_0000029 | 3300053077 | Bacteria | 111437 |
| 975 | Ga0495601_0000444 | 3300053077 | Bacteria | 21636 |
| 976 | Ga0495601_0000673 | 3300053077 | Bacteria | 18239 |
| 977 | Ga0495601_0008993 | 3300053077 | Bacteria | 5897 |
| 978 | Ga0495601_0009993 | 3300053077 | Bacteria | 5627 |
| 979 | Ga0495601_0047138 | 3300053077 | Bacteria | 2713 |
| 980 | Ga0495601_0159200 | 3300053077 | Bacteria | 1475 |
| 981 | Ga0495601_0207466 | 3300053077 | Bacteria | 1280 |
| 982 | Ga0495612_0000049 | 3300053078 | Bacteria | 54959 |
| 983 | Ga0495612_0001200 | 3300053078 | Bacteria | 10676 |
| 984 | Ga0495612_0004444 | 3300053078 | Bacteria | 5819 |
| 985 | Ga0495655_0000010 | 3300053083 | Bacteria | 125615 |
| 986 | Ga0495655_0005267 | 3300053083 | Bacteria | 2273 |
| 987 | Ga0495655_0019605 | 3300053083 | Bacteria | 1504 |
| 988 | Ga0495595_0000007 | 3300053084 | Bacteria | 228504 |
| 989 | Ga0495595_0000547 | 3300053084 | Bacteria | 14350 |
| 990 | Ga0495595_0000690 | 3300053084 | Bacteria | 12899 |
| 991 | Ga0495619_0000001 | 3300053085 | Bacteria | 586054 |
| 992 | Ga0495619_0000026 | 3300053085 | Bacteria | 167387 |
| 993 | Ga0495619_0000067 | 3300053085 | Bacteria | 83418 |
| 994 | Ga0495619_0000205 | 3300053085 | Bacteria | 42913 |
| 995 | Ga0495619_0001750 | 3300053085 | Bacteria | 14429 |
| 996 | Ga0495619_0002447 | 3300053085 | Bacteria | 12164 |
| 997 | Ga0495619_0002937 | 3300053085 | Bacteria | 11078 |
| 998 | Ga0495619_0015207 | 3300053085 | Bacteria | 4865 |
| 999 | Ga0500566_0001360 | 3300053094 | Bacteria | 14314 |
| 1000 | Ga0500641_0003315 | 3300053096 | Bacteria | 5697 |
| 1001 | Ga0500641_0090229 | 3300053096 | Bacteria | 1308 |
| 1002 | Ga0500556_0001310 | 3300053104 | Bacteria | 11176 |
| 1003 | Ga0500614_000263 | 3300053123 | Bacteria | 13569 |
| 1004 | Ga0500628_000024 | 3300053129 | Bacteria | 64538 |
| 1005 | Ga0500616_0003202 | 3300053153 | Bacteria | 12713 |
| 1006 | Ga0500616_0005227 | 3300053153 | Bacteria | 8881 |
| 1007 | Ga0500616_0048757 | 3300053153 | Bacteria | 2244 |
| 1008 | Ga0500599_002557 | 3300053736 | Bacteria | 2185 |
| 1009 | Ga0501084_0091029 | 3300054114 | Bacteria | 2561 |
| 1010 | Ga0501084_0100705 | 3300054114 | Bacteria | 2426 |
| 1011 | Ga0501084_0184032 | 3300054114 | Bacteria | 1763 |
| 1012 | Ga0590074_019718 | 3300059423 | Bacteria | 1158 |
| 1013 | Ga0590077_029049 | 3300059426 | Bacteria | 1203 |
| 1014 | Ga0501082_0070814 | 3300060353 | Bacteria | 3002 |
| 1015 | Ga0501082_0104093 | 3300060353 | Bacteria | 2455 |
| 1016 | Ga0501082_0221700 | 3300060353 | Bacteria | 1645 |
| 1017 | Ga0466962_0007808 | 3300061719 | Bacteria | 5129 |
| 1018 | Ga0530510_0200619 | 3300061734 | Bacteria | 1481 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_0315326 | Ga0496114_0315326_42_884 | 257 |
| 2 | 3300044842 | Ga0466957_0219195 | Ga0466957_0219195_18_878 | 263 |
| 3 | 3300003203 | JGI25406J46586_10005180 | JGI25406J46586_100051806 | 283 |
| 4 | 3300005458 | Ga0070681_10216594 | Ga0070681_102165941 | 283 |
| 5 | 3300005471 | Ga0070698_100181710 | Ga0070698_1001817103 | 284 |
| 6 | 3300037068 | Ga0373925_0503467 | Ga0373925_0503467_47_967 | 284 |
| 7 | 3300046660 | Ga0495625_0000243 | Ga0495625_0000243_15597_16511 | 284 |
| 8 | 3300047321 | Ga0495676_0038900 | Ga0495676_0038900_2591_3511 | 284 |
| 9 | 3300049581 | Ga0501047_0021038 | Ga0501047_0021038_2566_3480 | 284 |
| 10 | 3300049586 | Ga0501070_0066070 | Ga0501070_0066070_2029_2943 | 284 |
| 11 | 3300005546 | Ga0070696_100018841 | Ga0070696_1000188415 | 287 |
| 12 | 3300006871 | Ga0075434_100183102 | Ga0075434_1001831023 | 287 |
| 13 | 3300007076 | Ga0075435_100171108 | Ga0075435_1001711083 | 287 |
| 14 | 3300050512 | nmdc:mga0n895_70510_c1 | nmdc:mga0n895_70510_c1_1545_2474 | 287 |
| 15 | 3300050513 | nmdc:mga0rr50_150572_c1 | nmdc:mga0rr50_150572_c1_327_1256 | 287 |
| 16 | 3300004800 | Ga0058861_10195417 | Ga0058861_101954173 | 289 |
| 17 | 3300004803 | Ga0058862_10069669 | Ga0058862_100696693 | 289 |
| 18 | 3300005341 | Ga0070691_10013117 | Ga0070691_100131172 | 289 |
| 19 | 3300005445 | Ga0070708_100007488 | Ga0070708_1000074886 | 289 |
| 20 | 3300005445 | Ga0070708_100160799 | Ga0070708_1001607992 | 289 |
| 21 | 3300005445 | Ga0070708_100289725 | Ga0070708_1002897252 | 289 |
| 22 | 3300005467 | Ga0070706_100001344 | Ga0070706_10000134416 | 289 |
| 23 | 3300005467 | Ga0070706_100039789 | Ga0070706_1000397893 | 289 |
| 24 | 3300005467 | Ga0070706_100190541 | Ga0070706_1001905413 | 289 |
| 25 | 3300005468 | Ga0070707_100002020 | Ga0070707_10000202015 | 289 |
| 26 | 3300005468 | Ga0070707_100006384 | Ga0070707_10000638417 | 289 |
| 27 | 3300005468 | Ga0070707_100414541 | Ga0070707_1004145412 | 289 |
| 28 | 3300005471 | Ga0070698_100144492 | Ga0070698_1001444923 | 289 |
| 29 | 3300005471 | Ga0070698_100360467 | Ga0070698_1003604672 | 289 |
| 30 | 3300005471 | Ga0070698_100394293 | Ga0070698_1003942932 | 289 |
| 31 | 3300005530 | Ga0070679_100072615 | Ga0070679_1000726155 | 289 |
| 32 | 3300005577 | Ga0068857_100050806 | Ga0068857_1000508062 | 289 |
| 33 | 3300006028 | Ga0070717_10020450 | Ga0070717_100204504 | 289 |
| 34 | 3300010375 | Ga0105239_10093611 | Ga0105239_100936113 | 289 |
| 35 | 3300013307 | Ga0157372_10018844 | Ga0157372_100188447 | 289 |
| 36 | 3300020069 | Ga0197907_10465245 | Ga0197907_104652452 | 289 |
| 37 | 3300020070 | Ga0206356_11750464 | Ga0206356_117504642 | 289 |
| 38 | 3300020075 | Ga0206349_1015741 | Ga0206349_10157413 | 289 |
| 39 | 3300020075 | Ga0206349_1625417 | Ga0206349_16254172 | 289 |
| 40 | 3300020077 | Ga0206351_10180526 | Ga0206351_101805262 | 289 |
| 41 | 3300020077 | Ga0206351_10380651 | Ga0206351_103806513 | 289 |
| 42 | 3300020078 | Ga0206352_10040496 | Ga0206352_100404964 | 289 |
| 43 | 3300020078 | Ga0206352_10364769 | Ga0206352_103647692 | 289 |
| 44 | 3300020080 | Ga0206350_10243056 | Ga0206350_102430564 | 289 |
| 45 | 3300020080 | Ga0206350_10534078 | Ga0206350_105340783 | 289 |
| 46 | 3300020080 | Ga0206350_10636958 | Ga0206350_106369584 | 289 |
| 47 | 3300020080 | Ga0206350_11049551 | Ga0206350_110495512 | 289 |
| 48 | 3300022467 | Ga0224712_10007833 | Ga0224712_100078332 | 289 |
| 49 | 3300022467 | Ga0224712_10009427 | Ga0224712_100094273 | 289 |
| 50 | 3300022467 | Ga0224712_10061581 | Ga0224712_100615812 | 289 |
| 51 | 3300025910 | Ga0207684_10001406 | Ga0207684_1000140616 | 289 |
| 52 | 3300025910 | Ga0207684_10026594 | Ga0207684_100265943 | 289 |
| 53 | 3300025922 | Ga0207646_10015375 | Ga0207646_100153753 | 289 |
| 54 | 3300025922 | Ga0207646_10353964 | Ga0207646_103539642 | 289 |
| 55 | 3300025929 | Ga0207664_10418384 | Ga0207664_104183842 | 289 |
| 56 | 3300026116 | Ga0207674_10037485 | Ga0207674_100374854 | 289 |
| 57 | 3300028800 | Ga0265338_10029749 | Ga0265338_100297493 | 289 |
| 58 | 3300031247 | Ga0265340_10033183 | Ga0265340_100331834 | 289 |
| 59 | 3300035119 | Ga0373956_0005446 | Ga0373956_0005446_3568_4503 | 289 |
| 60 | 3300035172 | Ga0373955_0048898 | Ga0373955_0048898_1188_2123 | 289 |
| 61 | 3300035695 | Ga0373927_0000006 | Ga0373927_0000006_47699_48634 | 289 |
| 62 | 3300035724 | Ga0373933_0006691 | Ga0373933_0006691_2554_3489 | 289 |
| 63 | 3300035724 | Ga0373933_0126249 | Ga0373933_0126249_22_957 | 289 |
| 64 | 3300036534 | Ga0310109_000315 | Ga0310109_000315_614_1549 | 289 |
| 65 | 3300039450 | Ga0436363_0150822 | Ga0436363_0150822_230_1165 | 289 |
| 66 | 3300042876 | Ga0451577_0066833 | Ga0451577_0066833_111_1070 | 289 |
| 67 | 3300044658 | Ga0466972_0061114 | Ga0466972_0061114_527_1462 | 289 |
| 68 | 3300044658 | Ga0466972_0128973 | Ga0466972_0128973_41_976 | 289 |
| 69 | 3300044673 | Ga0453683_0032610 | Ga0453683_0032610_623_1582 | 289 |
| 70 | 3300044684 | Ga0466966_0044537 | Ga0466966_0044537_894_1829 | 289 |
| 71 | 3300044693 | Ga0466961_0004518 | Ga0466961_0004518_660_1595 | 289 |
| 72 | 3300044693 | Ga0466961_0029816 | Ga0466961_0029816_1815_2750 | 289 |
| 73 | 3300044694 | Ga0466963_0097585 | Ga0466963_0097585_11_946 | 289 |
| 74 | 3300045049 | Ga0466959_0013190 | Ga0466959_0013190_1645_2580 | 289 |
| 75 | 3300045049 | Ga0466959_0020682 | Ga0466959_0020682_2750_3685 | 289 |
| 76 | 3300045836 | Ga0466958_0029928 | Ga0466958_0029928_185_1120 | 289 |
| 77 | 3300013308 | Ga0157375_10119655 | Ga0157375_101196554 | 290 |
| 78 | 3300032002 | Ga0307416_100102352 | Ga0307416_1001023523 | 290 |
| 79 | 3300061734 | Ga0530510_0200619 | Ga0530510_0200619_228_1160 | 292 |
| 80 | 3300013105 | Ga0157369_10389745 | Ga0157369_103897452 | 295 |
| 81 | 3300031901 | Ga0307406_10047459 | Ga0307406_100474595 | 295 |
| 82 | 3300048906 | Ga0496103_0005940 | Ga0496103_0005940_97_1044 | 295 |
| 83 | 3300048919 | Ga0496116_0000120 | Ga0496116_0000120_132841_133788 | 295 |
| 84 | 3300048921 | Ga0496118_0004106 | Ga0496118_0004106_3512_4459 | 295 |
| 85 | 3300049568 | Ga0501031_0000272 | Ga0501031_0000272_21933_22880 | 295 |
| 86 | 3300049569 | Ga0501032_0002738 | Ga0501032_0002738_3237_4184 | 295 |
| 87 | 3300049570 | Ga0501033_0056764 | Ga0501033_0056764_1455_2402 | 295 |
| 88 | 3300049572 | Ga0501036_0030448 | Ga0501036_0030448_683_1630 | 295 |
| 89 | 3300049573 | Ga0501037_0018819 | Ga0501037_0018819_452_1399 | 295 |
| 90 | 3300049574 | Ga0501038_0003846 | Ga0501038_0003846_492_1439 | 295 |
| 91 | 3300049579 | Ga0501043_0003675 | Ga0501043_0003675_11454_12401 | 295 |
| 92 | 3300049580 | Ga0501046_0004234 | Ga0501046_0004234_654_1601 | 295 |
| 93 | 3300049581 | Ga0501047_0003193 | Ga0501047_0003193_2789_3736 | 295 |
| 94 | 3300049581 | Ga0501047_0093418 | Ga0501047_0093418_1575_2522 | 295 |
| 95 | 3300049582 | Ga0501048_0002902 | Ga0501048_0002902_11454_12401 | 295 |
| 96 | 3300049583 | Ga0501067_0032096 | Ga0501067_0032096_1042_2016 | 295 |
| 97 | 3300049585 | Ga0501069_0014239 | Ga0501069_0014239_602_1549 | 295 |
| 98 | 3300049585 | Ga0501069_0014727 | Ga0501069_0014727_3050_4024 | 295 |
| 99 | 3300049586 | Ga0501070_0000603 | Ga0501070_0000603_11454_12401 | 295 |
| 100 | 3300049586 | Ga0501070_0329638 | Ga0501070_0329638_110_1084 | 295 |
| 101 | 3300049590 | Ga0501074_0035338 | Ga0501074_0035338_559_1506 | 295 |
| 102 | 3300049741 | Ga0501079_0048854 | Ga0501079_0048854_345_1292 | 295 |
| 103 | 3300049741 | Ga0501079_0095148 | Ga0501079_0095148_1154_2101 | 295 |
| 104 | 3300049742 | Ga0501080_0198304 | Ga0501080_0198304_649_1596 | 295 |
| 105 | 3300049744 | Ga0501083_0009148 | Ga0501083_0009148_3406_4353 | 295 |
| 106 | 3300049744 | Ga0501083_0025722 | Ga0501083_0025722_2687_3634 | 295 |
| 107 | 3300049822 | Ga0501035_0004600 | Ga0501035_0004600_682_1629 | 295 |
| 108 | 3300049823 | Ga0501044_0003139 | Ga0501044_0003139_6293_7240 | 295 |
| 109 | 3300049823 | Ga0501044_0024786 | Ga0501044_0024786_3963_4910 | 295 |
| 110 | 3300054114 | Ga0501084_0184032 | Ga0501084_0184032_84_1031 | 295 |
| 111 | 3300060353 | Ga0501082_0221700 | Ga0501082_0221700_273_1220 | 295 |
| 112 | 3300005577 | Ga0068857_100274506 | Ga0068857_1002745063 | 296 |
| 113 | 3300053096 | Ga0500641_0090229 | Ga0500641_0090229_121_1080 | 296 |
| 114 | 3300005445 | Ga0070708_100003595 | Ga0070708_10000359512 | 298 |
| 115 | 3300005467 | Ga0070706_100031968 | Ga0070706_1000319685 | 298 |
| 116 | 3300005467 | Ga0070706_100102473 | Ga0070706_1001024732 | 298 |
| 117 | 3300005468 | Ga0070707_100101383 | Ga0070707_1001013833 | 298 |
| 118 | 3300025910 | Ga0207684_10085754 | Ga0207684_100857542 | 298 |
| 119 | 3300025910 | Ga0207684_10160049 | Ga0207684_101600492 | 298 |
| 120 | 3300005329 | Ga0070683_100007506 | Ga0070683_1000075066 | 299 |
| 121 | 3300005329 | Ga0070683_100018543 | Ga0070683_1000185436 | 299 |
| 122 | 3300005333 | Ga0070677_10000956 | Ga0070677_100009567 | 299 |
| 123 | 3300005344 | Ga0070661_100012352 | Ga0070661_1000123525 | 299 |
| 124 | 3300005356 | Ga0070674_100000019 | Ga0070674_10000001938 | 299 |
| 125 | 3300005364 | Ga0070673_100016927 | Ga0070673_1000169273 | 299 |
| 126 | 3300005366 | Ga0070659_100023840 | Ga0070659_1000238404 | 299 |
| 127 | 3300005457 | Ga0070662_100000001 | Ga0070662_100000001143 | 299 |
| 128 | 3300005458 | Ga0070681_10036102 | Ga0070681_100361023 | 299 |
| 129 | 3300005459 | Ga0068867_100001975 | Ga0068867_10000197513 | 299 |
| 130 | 3300005530 | Ga0070679_100003154 | Ga0070679_10000315412 | 299 |
| 131 | 3300005535 | Ga0070684_100013351 | Ga0070684_1000133514 | 299 |
| 132 | 3300005535 | Ga0070684_100033293 | Ga0070684_1000332932 | 299 |
| 133 | 3300005539 | Ga0068853_100087760 | Ga0068853_1000877602 | 299 |
| 134 | 3300005548 | Ga0070665_100000022 | Ga0070665_10000002278 | 299 |
| 135 | 3300005614 | Ga0068856_100013340 | Ga0068856_1000133409 | 299 |
| 136 | 3300005718 | Ga0068866_10000005 | Ga0068866_1000000567 | 299 |
| 137 | 3300005840 | Ga0068870_10243870 | Ga0068870_102438701 | 299 |
| 138 | 3300005842 | Ga0068858_100001657 | Ga0068858_1000016576 | 299 |
| 139 | 3300006163 | Ga0070715_10000008 | Ga0070715_10000008102 | 299 |
| 140 | 3300009147 | Ga0114129_10028895 | Ga0114129_100288956 | 299 |
| 141 | 3300009176 | Ga0105242_10048190 | Ga0105242_100481905 | 299 |
| 142 | 3300009545 | Ga0105237_10082040 | Ga0105237_100820403 | 299 |
| 143 | 3300009551 | Ga0105238_10034900 | Ga0105238_100349004 | 299 |
| 144 | 3300009553 | Ga0105249_10000368 | Ga0105249_100003686 | 299 |
| 145 | 3300013102 | Ga0157371_10123030 | Ga0157371_101230302 | 299 |
| 146 | 3300013104 | Ga0157370_10003060 | Ga0157370_100030602 | 299 |
| 147 | 3300013307 | Ga0157372_10032213 | Ga0157372_100322135 | 299 |
| 148 | 3300014326 | Ga0157380_10001737 | Ga0157380_1000173714 | 299 |
| 149 | 3300020078 | Ga0206352_10184859 | Ga0206352_101848591 | 299 |
| 150 | 3300020081 | Ga0206354_10367263 | Ga0206354_103672633 | 299 |
| 151 | 3300022467 | Ga0224712_10013711 | Ga0224712_100137114 | 299 |
| 152 | 3300025893 | Ga0207682_10000041 | Ga0207682_100000416 | 299 |
| 153 | 3300025899 | Ga0207642_10000005 | Ga0207642_10000005270 | 299 |
| 154 | 3300025905 | Ga0207685_10000012 | Ga0207685_10000012102 | 299 |
| 155 | 3300025912 | Ga0207707_10006269 | Ga0207707_100062694 | 299 |
| 156 | 3300025920 | Ga0207649_10029420 | Ga0207649_100294204 | 299 |
| 157 | 3300025921 | Ga0207652_10024377 | Ga0207652_100243774 | 299 |
| 158 | 3300025933 | Ga0207706_10000003 | Ga0207706_10000003185 | 299 |
| 159 | 3300025934 | Ga0207686_10068904 | Ga0207686_100689043 | 299 |
| 160 | 3300025937 | Ga0207669_10000140 | Ga0207669_1000014013 | 299 |
| 161 | 3300025944 | Ga0207661_10005294 | Ga0207661_100052946 | 299 |
| 162 | 3300025944 | Ga0207661_10014089 | Ga0207661_100140894 | 299 |
| 163 | 3300025944 | Ga0207661_10022934 | Ga0207661_100229346 | 299 |
| 164 | 3300025960 | Ga0207651_10002542 | Ga0207651_100025424 | 299 |
| 165 | 3300025961 | Ga0207712_10000027 | Ga0207712_10000027303 | 299 |
| 166 | 3300026035 | Ga0207703_10000020 | Ga0207703_10000020131 | 299 |
| 167 | 3300026041 | Ga0207639_10073801 | Ga0207639_100738013 | 299 |
| 168 | 3300026075 | Ga0207708_10079636 | Ga0207708_100796363 | 299 |
| 169 | 3300026078 | Ga0207702_10022825 | Ga0207702_100228257 | 299 |
| 170 | 3300026078 | Ga0207702_10293814 | Ga0207702_102938142 | 299 |
| 171 | 3300026089 | Ga0207648_10008953 | Ga0207648_100089537 | 299 |
| 172 | 3300026121 | Ga0207683_10191798 | Ga0207683_101917982 | 299 |
| 173 | 3300026142 | Ga0207698_10039926 | Ga0207698_100399266 | 299 |
| 174 | 3300028379 | Ga0268266_10000029 | Ga0268266_10000029372 | 299 |
| 175 | 3300028381 | Ga0268264_10000725 | Ga0268264_100007258 | 299 |
| 176 | 3300036401 | Ga0373937_0190830 | Ga0373937_0190830_678_1637 | 299 |
| 177 | 3300044694 | Ga0466963_0002882 | Ga0466963_0002882_4893_5852 | 299 |
| 178 | 3300044694 | Ga0466963_0047724 | Ga0466963_0047724_278_1243 | 299 |
| 179 | 3300044694 | Ga0466963_0177733 | Ga0466963_0177733_34_999 | 299 |
| 180 | 3300045976 | Ga0466967_0010925 | Ga0466967_0010925_5665_6630 | 299 |
| 181 | 3300045976 | Ga0466967_0128157 | Ga0466967_0128157_1033_1998 | 299 |
| 182 | 3300046455 | Ga0495603_0000194 | Ga0495603_0000194_18278_19237 | 299 |
| 183 | 3300046455 | Ga0495603_0008081 | Ga0495603_0008081_2049_3008 | 299 |
| 184 | 3300046461 | Ga0495641_0000004 | Ga0495641_0000004_135293_136252 | 299 |
| 185 | 3300046473 | Ga0495582_0000002 | Ga0495582_0000002_193242_194201 | 299 |
| 186 | 3300046517 | Ga0495630_0339366 | Ga0495630_0339366_111_1070 | 299 |
| 187 | 3300046539 | Ga0495621_0001476 | Ga0495621_0001476_1570_2529 | 299 |
| 188 | 3300046683 | Ga0495658_0000001 | Ga0495658_0000001_198067_199026 | 299 |
| 189 | 3300046809 | Ga0495600_0168896 | Ga0495600_0168896_17_976 | 299 |
| 190 | 3300047317 | Ga0495604_0000437 | Ga0495604_0000437_28581_29540 | 299 |
| 191 | 3300047321 | Ga0495676_0000320 | Ga0495676_0000320_25836_26795 | 299 |
| 192 | 3300047322 | Ga0495680_0000513 | Ga0495680_0000513_13841_14800 | 299 |
| 193 | 3300047446 | Ga0495679_015058 | Ga0495679_015058_1463_2422 | 299 |
| 194 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_186568_187527 | 299 |
| 195 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_186568_187527 | 299 |
| 196 | 3300048909 | Ga0496106_0000172 | Ga0496106_0000172_22404_23369 | 299 |
| 197 | 3300048913 | Ga0496110_0001335 | Ga0496110_0001335_8294_9253 | 299 |
| 198 | 3300049578 | Ga0501042_0120745 | Ga0501042_0120745_815_1774 | 299 |
| 199 | 3300049591 | Ga0501075_0001603 | Ga0501075_0001603_11607_12566 | 299 |
| 200 | 3300050492 | nmdc:mga0yw44_216496_c1 | nmdc:mga0yw44_216496_c1_283_1248 | 299 |
| 201 | 3300053077 | Ga0495601_0000444 | Ga0495601_0000444_16351_17310 | 299 |
| 202 | 3300053078 | Ga0495612_0001200 | Ga0495612_0001200_7833_8792 | 299 |
| 203 | 3300053123 | Ga0500614_000263 | Ga0500614_000263_5526_6485 | 299 |
| 204 | 3300003373 | JGI25407J50210_10021674 | JGI25407J50210_100216743 | 300 |
| 205 | 3300003659 | JGI25404J52841_10000538 | JGI25404J52841_100005382 | 300 |
| 206 | 3300005337 | Ga0070682_100000023 | Ga0070682_100000023223 | 300 |
| 207 | 3300005337 | Ga0070682_100000061 | Ga0070682_10000006184 | 300 |
| 208 | 3300005347 | Ga0070668_100457845 | Ga0070668_1004578451 | 300 |
| 209 | 3300005356 | Ga0070674_100033227 | Ga0070674_1000332276 | 300 |
| 210 | 3300005356 | Ga0070674_100219131 | Ga0070674_1002191311 | 300 |
| 211 | 3300005366 | Ga0070659_100008534 | Ga0070659_1000085346 | 300 |
| 212 | 3300005367 | Ga0070667_100000597 | Ga0070667_10000059710 | 300 |
| 213 | 3300005406 | Ga0070703_10080181 | Ga0070703_100801811 | 300 |
| 214 | 3300005434 | Ga0070709_10050251 | Ga0070709_100502512 | 300 |
| 215 | 3300005435 | Ga0070714_100107438 | Ga0070714_1001074382 | 300 |
| 216 | 3300005435 | Ga0070714_100121368 | Ga0070714_1001213683 | 300 |
| 217 | 3300005436 | Ga0070713_100067402 | Ga0070713_1000674023 | 300 |
| 218 | 3300005437 | Ga0070710_10100161 | Ga0070710_101001611 | 300 |
| 219 | 3300005437 | Ga0070710_10139697 | Ga0070710_101396972 | 300 |
| 220 | 3300005439 | Ga0070711_100064726 | Ga0070711_1000647261 | 300 |
| 221 | 3300005441 | Ga0070700_100151277 | Ga0070700_1001512772 | 300 |
| 222 | 3300005441 | Ga0070700_100213281 | Ga0070700_1002132811 | 300 |
| 223 | 3300005457 | Ga0070662_100088608 | Ga0070662_1000886082 | 300 |
| 224 | 3300005535 | Ga0070684_100120058 | Ga0070684_1001200582 | 300 |
| 225 | 3300005545 | Ga0070695_100120813 | Ga0070695_1001208131 | 300 |
| 226 | 3300005615 | Ga0070702_100004581 | Ga0070702_1000045819 | 300 |
| 227 | 3300005617 | Ga0068859_100132898 | Ga0068859_1001328982 | 300 |
| 228 | 3300005718 | Ga0068866_10100790 | Ga0068866_101007902 | 300 |
| 229 | 3300005719 | Ga0068861_100044604 | Ga0068861_1000446042 | 300 |
| 230 | 3300005834 | Ga0068851_10000741 | Ga0068851_100007415 | 300 |
| 231 | 3300005843 | Ga0068860_100270418 | Ga0068860_1002704182 | 300 |
| 232 | 3300005844 | Ga0068862_100001558 | Ga0068862_10000155826 | 300 |
| 233 | 3300005937 | Ga0081455_10004481 | Ga0081455_1000448111 | 300 |
| 234 | 3300005937 | Ga0081455_10110825 | Ga0081455_101108253 | 300 |
| 235 | 3300005981 | Ga0081538_10011162 | Ga0081538_100111622 | 300 |
| 236 | 3300005981 | Ga0081538_10023057 | Ga0081538_100230576 | 300 |
| 237 | 3300005983 | Ga0081540_1000697 | Ga0081540_100069712 | 300 |
| 238 | 3300005985 | Ga0081539_10014136 | Ga0081539_100141362 | 300 |
| 239 | 3300006038 | Ga0075365_10011703 | Ga0075365_100117034 | 300 |
| 240 | 3300006175 | Ga0070712_100049467 | Ga0070712_1000494675 | 300 |
| 241 | 3300006844 | Ga0075428_100087343 | Ga0075428_1000873432 | 300 |
| 242 | 3300006844 | Ga0075428_100424023 | Ga0075428_1004240232 | 300 |
| 243 | 3300006847 | Ga0075431_100010016 | Ga0075431_1000100168 | 300 |
| 244 | 3300006847 | Ga0075431_100059786 | Ga0075431_1000597863 | 300 |
| 245 | 3300006880 | Ga0075429_100396864 | Ga0075429_1003968641 | 300 |
| 246 | 3300006881 | Ga0068865_100000089 | Ga0068865_10000008925 | 300 |
| 247 | 3300006881 | Ga0068865_100140322 | Ga0068865_1001403222 | 300 |
| 248 | 3300006931 | Ga0097620_100132897 | Ga0097620_1001328973 | 300 |
| 249 | 3300009094 | Ga0111539_10028001 | Ga0111539_100280012 | 300 |
| 250 | 3300009094 | Ga0111539_10461760 | Ga0111539_104617601 | 300 |
| 251 | 3300009098 | Ga0105245_10000640 | Ga0105245_1000064025 | 300 |
| 252 | 3300009098 | Ga0105245_10002937 | Ga0105245_1000293721 | 300 |
| 253 | 3300009098 | Ga0105245_10006204 | Ga0105245_100062044 | 300 |
| 254 | 3300009147 | Ga0114129_10034389 | Ga0114129_100343897 | 300 |
| 255 | 3300009551 | Ga0105238_10000016 | Ga0105238_10000016222 | 300 |
| 256 | 3300009553 | Ga0105249_10001411 | Ga0105249_1000141117 | 300 |
| 257 | 3300009553 | Ga0105249_10392144 | Ga0105249_103921442 | 300 |
| 258 | 3300010375 | Ga0105239_10461707 | Ga0105239_104617071 | 300 |
| 259 | 3300013102 | Ga0157371_10007417 | Ga0157371_100074174 | 300 |
| 260 | 3300013104 | Ga0157370_10019536 | Ga0157370_100195367 | 300 |
| 261 | 3300013296 | Ga0157374_10000785 | Ga0157374_100007857 | 300 |
| 262 | 3300013307 | Ga0157372_10001649 | Ga0157372_1000164929 | 300 |
| 263 | 3300013308 | Ga0157375_10000717 | Ga0157375_100007176 | 300 |
| 264 | 3300013308 | Ga0157375_10005849 | Ga0157375_1000584913 | 300 |
| 265 | 3300020070 | Ga0206356_10907411 | Ga0206356_109074112 | 300 |
| 266 | 3300020081 | Ga0206354_11250835 | Ga0206354_112508351 | 300 |
| 267 | 3300020610 | Ga0154015_1384123 | Ga0154015_13841232 | 300 |
| 268 | 3300025302 | Ga0207426_1012827 | Ga0207426_10128276 | 300 |
| 269 | 3300025321 | Ga0207656_10001891 | Ga0207656_100018915 | 300 |
| 270 | 3300025901 | Ga0207688_10130382 | Ga0207688_101303822 | 300 |
| 271 | 3300025911 | Ga0207654_10076779 | Ga0207654_100767792 | 300 |
| 272 | 3300025924 | Ga0207694_10000012 | Ga0207694_10000012200 | 300 |
| 273 | 3300025927 | Ga0207687_10000331 | Ga0207687_100003316 | 300 |
| 274 | 3300025927 | Ga0207687_10001806 | Ga0207687_100018065 | 300 |
| 275 | 3300025928 | Ga0207700_10110794 | Ga0207700_101107942 | 300 |
| 276 | 3300025928 | Ga0207700_10377207 | Ga0207700_103772071 | 300 |
| 277 | 3300025929 | Ga0207664_10214760 | Ga0207664_102147601 | 300 |
| 278 | 3300025929 | Ga0207664_10386359 | Ga0207664_103863592 | 300 |
| 279 | 3300025932 | Ga0207690_10005455 | Ga0207690_100054556 | 300 |
| 280 | 3300025938 | Ga0207704_10000018 | Ga0207704_10000018122 | 300 |
| 281 | 3300025944 | Ga0207661_10220727 | Ga0207661_102207272 | 300 |
| 282 | 3300025961 | Ga0207712_10002082 | Ga0207712_100020828 | 300 |
| 283 | 3300025972 | Ga0207668_10019215 | Ga0207668_100192152 | 300 |
| 284 | 3300025981 | Ga0207640_10000205 | Ga0207640_100002058 | 300 |
| 285 | 3300025986 | Ga0207658_10000465 | Ga0207658_100004659 | 300 |
| 286 | 3300026035 | Ga0207703_10116317 | Ga0207703_101163171 | 300 |
| 287 | 3300026067 | Ga0207678_10234604 | Ga0207678_102346042 | 300 |
| 288 | 3300026075 | Ga0207708_10004102 | Ga0207708_100041022 | 300 |
| 289 | 3300026078 | Ga0207702_10000690 | Ga0207702_1000069023 | 300 |
| 290 | 3300026116 | Ga0207674_10289820 | Ga0207674_102898202 | 300 |
| 291 | 3300026118 | Ga0207675_100159493 | Ga0207675_1001594932 | 300 |
| 292 | 3300027907 | Ga0207428_10007595 | Ga0207428_100075952 | 300 |
| 293 | 3300027907 | Ga0207428_10080156 | Ga0207428_100801561 | 300 |
| 294 | 3300028380 | Ga0268265_10001048 | Ga0268265_1000104823 | 300 |
| 295 | 3300028381 | Ga0268264_10042318 | Ga0268264_100423182 | 300 |
| 296 | 3300028381 | Ga0268264_10217309 | Ga0268264_102173092 | 300 |
| 297 | 3300028381 | Ga0268264_10382828 | Ga0268264_103828282 | 300 |
| 298 | 3300028563 | Ga0265319_1000010 | Ga0265319_1000010114 | 300 |
| 299 | 3300028800 | Ga0265338_10000051 | Ga0265338_100000517 | 300 |
| 300 | 3300031241 | Ga0265325_10006156 | Ga0265325_100061567 | 300 |
| 301 | 3300031852 | Ga0307410_10023485 | Ga0307410_100234852 | 300 |
| 302 | 3300031901 | Ga0307406_10127295 | Ga0307406_101272953 | 300 |
| 303 | 3300031901 | Ga0307406_10235095 | Ga0307406_102350952 | 300 |
| 304 | 3300031903 | Ga0307407_10089927 | Ga0307407_100899272 | 300 |
| 305 | 3300031995 | Ga0307409_100029080 | Ga0307409_1000290807 | 300 |
| 306 | 3300031995 | Ga0307409_100029492 | Ga0307409_1000294922 | 300 |
| 307 | 3300031995 | Ga0307409_100092559 | Ga0307409_1000925595 | 300 |
| 308 | 3300031995 | Ga0307409_100675596 | Ga0307409_1006755961 | 300 |
| 309 | 3300032002 | Ga0307416_100025273 | Ga0307416_1000252732 | 300 |
| 310 | 3300032002 | Ga0307416_100105250 | Ga0307416_1001052501 | 300 |
| 311 | 3300032002 | Ga0307416_100141268 | Ga0307416_1001412681 | 300 |
| 312 | 3300032002 | Ga0307416_100314133 | Ga0307416_1003141332 | 300 |
| 313 | 3300032005 | Ga0307411_10028712 | Ga0307411_100287125 | 300 |
| 314 | 3300032126 | Ga0307415_100001546 | Ga0307415_1000015468 | 300 |
| 315 | 3300032126 | Ga0307415_100005858 | Ga0307415_1000058582 | 300 |
| 316 | 3300032126 | Ga0307415_100369356 | Ga0307415_1003693561 | 300 |
| 317 | 3300036401 | Ga0373937_0004436 | Ga0373937_0004436_2455_3423 | 300 |
| 318 | 3300037418 | Ga0395900_0008276 | Ga0395900_0008276_689_1657 | 300 |
| 319 | 3300037466 | Ga0395898_0002400 | Ga0395898_0002400_10692_11660 | 300 |
| 320 | 3300037466 | Ga0395898_0415425 | Ga0395898_0415425_83_1051 | 300 |
| 321 | 3300038443 | Ga0395901_0444783 | Ga0395901_0444783_219_1187 | 300 |
| 322 | 3300039450 | Ga0436363_1670627 | Ga0436363_1670627_111_1079 | 300 |
| 323 | 3300039453 | Ga0436362_0563621 | Ga0436362_0563621_18_986 | 300 |
| 324 | 3300044693 | Ga0466961_0003908 | Ga0466961_0003908_5122_6090 | 300 |
| 325 | 3300044693 | Ga0466961_0050408 | Ga0466961_0050408_240_1208 | 300 |
| 326 | 3300044694 | Ga0466963_0016311 | Ga0466963_0016311_2820_3788 | 300 |
| 327 | 3300044694 | Ga0466963_0020516 | Ga0466963_0020516_2053_3021 | 300 |
| 328 | 3300044694 | Ga0466963_0125338 | Ga0466963_0125338_648_1610 | 300 |
| 329 | 3300044706 | Ga0466964_0026274 | Ga0466964_0026274_134_1105 | 300 |
| 330 | 3300044719 | Ga0466971_0118538 | Ga0466971_0118538_24_989 | 300 |
| 331 | 3300044842 | Ga0466957_0205088 | Ga0466957_0205088_146_1114 | 300 |
| 332 | 3300045049 | Ga0466959_0066409 | Ga0466959_0066409_1232_2200 | 300 |
| 333 | 3300045049 | Ga0466959_0148771 | Ga0466959_0148771_104_1072 | 300 |
| 334 | 3300045836 | Ga0466958_0014181 | Ga0466958_0014181_2821_3789 | 300 |
| 335 | 3300045836 | Ga0466958_0038088 | Ga0466958_0038088_746_1708 | 300 |
| 336 | 3300045836 | Ga0466958_0108348 | Ga0466958_0108348_720_1688 | 300 |
| 337 | 3300045836 | Ga0466958_0126504 | Ga0466958_0126504_254_1222 | 300 |
| 338 | 3300045976 | Ga0466967_0041265 | Ga0466967_0041265_2744_3712 | 300 |
| 339 | 3300045976 | Ga0466967_0126554 | Ga0466967_0126554_119_1087 | 300 |
| 340 | 3300045976 | Ga0466967_0159296 | Ga0466967_0159296_206_1177 | 300 |
| 341 | 3300045976 | Ga0466967_0380437 | Ga0466967_0380437_203_1171 | 300 |
| 342 | 3300045976 | Ga0466967_0427957 | Ga0466967_0427957_247_1215 | 300 |
| 343 | 3300045976 | Ga0466967_0513348 | Ga0466967_0513348_87_1055 | 300 |
| 344 | 3300046457 | Ga0495590_0077347 | Ga0495590_0077347_119_1093 | 300 |
| 345 | 3300046459 | Ga0495629_0070965 | Ga0495629_0070965_845_1813 | 300 |
| 346 | 3300046462 | Ga0495651_0002656 | Ga0495651_0002656_8707_9675 | 300 |
| 347 | 3300046462 | Ga0495651_0037463 | Ga0495651_0037463_97_1059 | 300 |
| 348 | 3300046463 | Ga0495653_0007743 | Ga0495653_0007743_2570_3538 | 300 |
| 349 | 3300046476 | Ga0495662_0005718 | Ga0495662_0005718_400_1371 | 300 |
| 350 | 3300046499 | Ga0495594_0000012 | Ga0495594_0000012_76173_77135 | 300 |
| 351 | 3300046500 | Ga0495596_0024370 | Ga0495596_0024370_246_1220 | 300 |
| 352 | 3300046514 | Ga0495618_0022690 | Ga0495618_0022690_2366_3334 | 300 |
| 353 | 3300046515 | Ga0495620_0032803 | Ga0495620_0032803_32_997 | 300 |
| 354 | 3300046533 | Ga0495640_0016804 | Ga0495640_0016804_1368_2336 | 300 |
| 355 | 3300046535 | Ga0495586_0001742 | Ga0495586_0001742_9824_10789 | 300 |
| 356 | 3300046557 | Ga0495622_0000353 | Ga0495622_0000353_5798_6760 | 300 |
| 357 | 3300046559 | Ga0495667_0000265 | Ga0495667_0000265_17191_18153 | 300 |
| 358 | 3300046559 | Ga0495667_0000725 | Ga0495667_0000725_1667_2635 | 300 |
| 359 | 3300046663 | Ga0495635_0000709 | Ga0495635_0000709_27_995 | 300 |
| 360 | 3300046678 | Ga0495599_0132729 | Ga0495599_0132729_12_980 | 300 |
| 361 | 3300046681 | Ga0495647_0000005 | Ga0495647_0000005_37100_38065 | 300 |
| 362 | 3300046690 | Ga0495624_0000600 | Ga0495624_0000600_12472_13437 | 300 |
| 363 | 3300046809 | Ga0495600_0004809 | Ga0495600_0004809_5302_6270 | 300 |
| 364 | 3300046809 | Ga0495600_0007184 | Ga0495600_0007184_571_1533 | 300 |
| 365 | 3300047319 | Ga0495674_0000039 | Ga0495674_0000039_26080_27042 | 300 |
| 366 | 3300047319 | Ga0495674_0014499 | Ga0495674_0014499_3475_4443 | 300 |
| 367 | 3300047322 | Ga0495680_0001447 | Ga0495680_0001447_4240_5208 | 300 |
| 368 | 3300047322 | Ga0495680_0005366 | Ga0495680_0005366_5814_6776 | 300 |
| 369 | 3300047444 | Ga0495675_0176154 | Ga0495675_0176154_194_1156 | 300 |
| 370 | 3300047471 | Ga0495684_0041166 | Ga0495684_0041166_1788_2756 | 300 |
| 371 | 3300047472 | Ga0495686_0085784 | Ga0495686_0085784_693_1655 | 300 |
| 372 | 3300048088 | Ga0495602_0011907 | Ga0495602_0011907_3123_4091 | 300 |
| 373 | 3300048088 | Ga0495602_0080789 | Ga0495602_0080789_40_1020 | 300 |
| 374 | 3300048089 | Ga0495614_0078482 | Ga0495614_0078482_62_1030 | 300 |
| 375 | 3300048903 | Ga0496100_0000136 | Ga0496100_0000136_24387_25355 | 300 |
| 376 | 3300048904 | Ga0496101_0005625 | Ga0496101_0005625_3449_4417 | 300 |
| 377 | 3300048911 | Ga0496108_0000005 | Ga0496108_0000005_498902_499864 | 300 |
| 378 | 3300048911 | Ga0496108_0000721 | Ga0496108_0000721_20356_21318 | 300 |
| 379 | 3300048911 | Ga0496108_0197922 | Ga0496108_0197922_374_1342 | 300 |
| 380 | 3300048911 | Ga0496108_0502181 | Ga0496108_0502181_67_1035 | 300 |
| 381 | 3300048912 | Ga0496109_0000002 | Ga0496109_0000002_35228_36190 | 300 |
| 382 | 3300048912 | Ga0496109_0000389 | Ga0496109_0000389_1747_2709 | 300 |
| 383 | 3300048912 | Ga0496109_0066882 | Ga0496109_0066882_17_985 | 300 |
| 384 | 3300048913 | Ga0496110_0078101 | Ga0496110_0078101_301_1269 | 300 |
| 385 | 3300048913 | Ga0496110_0392354 | Ga0496110_0392354_119_1087 | 300 |
| 386 | 3300048914 | Ga0496111_0124566 | Ga0496111_0124566_599_1567 | 300 |
| 387 | 3300048915 | Ga0496112_0000661 | Ga0496112_0000661_10696_11658 | 300 |
| 388 | 3300048916 | Ga0496113_0000017 | Ga0496113_0000017_69462_70424 | 300 |
| 389 | 3300048916 | Ga0496113_0093778 | Ga0496113_0093778_433_1395 | 300 |
| 390 | 3300048924 | Ga0496121_0051254 | Ga0496121_0051254_2172_3143 | 300 |
| 391 | 3300049568 | Ga0501031_0010575 | Ga0501031_0010575_1063_2031 | 300 |
| 392 | 3300049575 | Ga0501039_0068905 | Ga0501039_0068905_104_1072 | 300 |
| 393 | 3300049577 | Ga0501041_0031944 | Ga0501041_0031944_1796_2764 | 300 |
| 394 | 3300049582 | Ga0501048_0051449 | Ga0501048_0051449_484_1452 | 300 |
| 395 | 3300049584 | Ga0501068_0089473 | Ga0501068_0089473_852_1814 | 300 |
| 396 | 3300049586 | Ga0501070_0442685 | Ga0501070_0442685_67_1035 | 300 |
| 397 | 3300049587 | Ga0501071_0030061 | Ga0501071_0030061_1851_2819 | 300 |
| 398 | 3300049588 | Ga0501072_0062732 | Ga0501072_0062732_1678_2646 | 300 |
| 399 | 3300049588 | Ga0501072_0192515 | Ga0501072_0192515_452_1420 | 300 |
| 400 | 3300049590 | Ga0501074_0129328 | Ga0501074_0129328_739_1707 | 300 |
| 401 | 3300049591 | Ga0501075_0049705 | Ga0501075_0049705_1672_2640 | 300 |
| 402 | 3300049593 | Ga0501077_0110823 | Ga0501077_0110823_368_1336 | 300 |
| 403 | 3300049741 | Ga0501079_0041556 | Ga0501079_0041556_2134_3102 | 300 |
| 404 | 3300049824 | Ga0501045_0220725 | Ga0501045_0220725_64_1032 | 300 |
| 405 | 3300050507 | nmdc:mga05p37_15634_c1 | nmdc:mga05p37_15634_c1_1637_2602 | 300 |
| 406 | 3300050510 | nmdc:mga06r32_118032_c1 | nmdc:mga06r32_118032_c1_128_1102 | 300 |
| 407 | 3300050511 | nmdc:mga08y16_10979_c1 | nmdc:mga08y16_10979_c1_3592_4560 | 300 |
| 408 | 3300050511 | nmdc:mga08y16_305620_c1 | nmdc:mga08y16_305620_c1_49_1014 | 300 |
| 409 | 3300053077 | Ga0495601_0159200 | Ga0495601_0159200_502_1464 | 300 |
| 410 | 3300053077 | Ga0495601_0207466 | Ga0495601_0207466_86_1054 | 300 |
| 411 | 3300053083 | Ga0495655_0005267 | Ga0495655_0005267_351_1313 | 300 |
| 412 | 3300053083 | Ga0495655_0019605 | Ga0495655_0019605_490_1464 | 300 |
| 413 | 3300053084 | Ga0495595_0000690 | Ga0495595_0000690_8605_9573 | 300 |
| 414 | 3300053085 | Ga0495619_0000067 | Ga0495619_0000067_46134_47096 | 300 |
| 415 | 3300053153 | Ga0500616_0048757 | Ga0500616_0048757_715_1683 | 300 |
| 416 | 3300059423 | Ga0590074_019718 | Ga0590074_019718_133_1101 | 300 |
| 417 | 3300059426 | Ga0590077_029049 | Ga0590077_029049_121_1089 | 300 |
| 418 | 3300060353 | Ga0501082_0070814 | Ga0501082_0070814_2009_2977 | 300 |
| 419 | 3300061719 | Ga0466962_0007808 | Ga0466962_0007808_629_1594 | 300 |
| 420 | 3300000546 | LJNas_1003365 | LJNas_10033651 | 301 |
| 421 | 3300001977 | JGI24746J21847_1000941 | JGI24746J21847_10009416 | 301 |
| 422 | 3300002074 | JGI24748J21848_1000576 | JGI24748J21848_10005762 | 301 |
| 423 | 3300002239 | JGI24034J26672_10000425 | JGI24034J26672_100004256 | 301 |
| 424 | 3300002244 | JGI24742J22300_10000739 | JGI24742J22300_100007395 | 301 |
| 425 | 3300003373 | JGI25407J50210_10000241 | JGI25407J50210_100002418 | 301 |
| 426 | 3300003373 | JGI25407J50210_10002334 | JGI25407J50210_100023345 | 301 |
| 427 | 3300003373 | JGI25407J50210_10007428 | JGI25407J50210_100074282 | 301 |
| 428 | 3300005327 | Ga0070658_10024325 | Ga0070658_100243256 | 301 |
| 429 | 3300005329 | Ga0070683_100001231 | Ga0070683_10000123117 | 301 |
| 430 | 3300005329 | Ga0070683_100017321 | Ga0070683_1000173216 | 301 |
| 431 | 3300005329 | Ga0070683_100198873 | Ga0070683_1001988731 | 301 |
| 432 | 3300005335 | Ga0070666_10018742 | Ga0070666_100187422 | 301 |
| 433 | 3300005337 | Ga0070682_100028676 | Ga0070682_1000286762 | 301 |
| 434 | 3300005338 | Ga0068868_100050568 | Ga0068868_1000505681 | 301 |
| 435 | 3300005338 | Ga0068868_100345810 | Ga0068868_1003458101 | 301 |
| 436 | 3300005340 | Ga0070689_100457795 | Ga0070689_1004577951 | 301 |
| 437 | 3300005341 | Ga0070691_10000004 | Ga0070691_1000000483 | 301 |
| 438 | 3300005343 | Ga0070687_100044085 | Ga0070687_1000440854 | 301 |
| 439 | 3300005344 | Ga0070661_100000110 | Ga0070661_10000011050 | 301 |
| 440 | 3300005344 | Ga0070661_100313458 | Ga0070661_1003134581 | 301 |
| 441 | 3300005345 | Ga0070692_10004822 | Ga0070692_100048221 | 301 |
| 442 | 3300005345 | Ga0070692_10055968 | Ga0070692_100559682 | 301 |
| 443 | 3300005347 | Ga0070668_100009891 | Ga0070668_1000098914 | 301 |
| 444 | 3300005353 | Ga0070669_100008089 | Ga0070669_1000080898 | 301 |
| 445 | 3300005354 | Ga0070675_100000091 | Ga0070675_10000009135 | 301 |
| 446 | 3300005354 | Ga0070675_100040732 | Ga0070675_1000407326 | 301 |
| 447 | 3300005365 | Ga0070688_100000077 | Ga0070688_10000007712 | 301 |
| 448 | 3300005365 | Ga0070688_100000937 | Ga0070688_1000009375 | 301 |
| 449 | 3300005365 | Ga0070688_100010454 | Ga0070688_1000104546 | 301 |
| 450 | 3300005365 | Ga0070688_100082357 | Ga0070688_1000823573 | 301 |
| 451 | 3300005365 | Ga0070688_100169927 | Ga0070688_1001699272 | 301 |
| 452 | 3300005366 | Ga0070659_100000026 | Ga0070659_100000026110 | 301 |
| 453 | 3300005366 | Ga0070659_100005636 | Ga0070659_1000056369 | 301 |
| 454 | 3300005367 | Ga0070667_100083799 | Ga0070667_1000837994 | 301 |
| 455 | 3300005434 | Ga0070709_10175990 | Ga0070709_101759902 | 301 |
| 456 | 3300005435 | Ga0070714_100000083 | Ga0070714_10000008327 | 301 |
| 457 | 3300005435 | Ga0070714_100047079 | Ga0070714_1000470793 | 301 |
| 458 | 3300005436 | Ga0070713_100000135 | Ga0070713_10000013539 | 301 |
| 459 | 3300005437 | Ga0070710_10000008 | Ga0070710_1000000888 | 301 |
| 460 | 3300005437 | Ga0070710_10047985 | Ga0070710_100479851 | 301 |
| 461 | 3300005437 | Ga0070710_10063380 | Ga0070710_100633802 | 301 |
| 462 | 3300005439 | Ga0070711_100001500 | Ga0070711_1000015004 | 301 |
| 463 | 3300005439 | Ga0070711_100049540 | Ga0070711_1000495403 | 301 |
| 464 | 3300005440 | Ga0070705_100000405 | Ga0070705_1000004055 | 301 |
| 465 | 3300005440 | Ga0070705_100082905 | Ga0070705_1000829051 | 301 |
| 466 | 3300005441 | Ga0070700_100000678 | Ga0070700_10000067821 | 301 |
| 467 | 3300005455 | Ga0070663_100002413 | Ga0070663_1000024131 | 301 |
| 468 | 3300005456 | Ga0070678_100044344 | Ga0070678_1000443446 | 301 |
| 469 | 3300005457 | Ga0070662_100216048 | Ga0070662_1002160482 | 301 |
| 470 | 3300005466 | Ga0070685_10000061 | Ga0070685_1000006116 | 301 |
| 471 | 3300005466 | Ga0070685_10000965 | Ga0070685_1000096517 | 301 |
| 472 | 3300005466 | Ga0070685_10186359 | Ga0070685_101863592 | 301 |
| 473 | 3300005466 | Ga0070685_10224276 | Ga0070685_102242761 | 301 |
| 474 | 3300005530 | Ga0070679_100027205 | Ga0070679_1000272051 | 301 |
| 475 | 3300005535 | Ga0070684_100012176 | Ga0070684_1000121766 | 301 |
| 476 | 3300005543 | Ga0070672_100000005 | Ga0070672_10000000588 | 301 |
| 477 | 3300005544 | Ga0070686_100028068 | Ga0070686_1000280682 | 301 |
| 478 | 3300005546 | Ga0070696_100420076 | Ga0070696_1004200761 | 301 |
| 479 | 3300005548 | Ga0070665_100006490 | Ga0070665_1000064907 | 301 |
| 480 | 3300005548 | Ga0070665_100114028 | Ga0070665_1001140282 | 301 |
| 481 | 3300005564 | Ga0070664_100105826 | Ga0070664_1001058262 | 301 |
| 482 | 3300005578 | Ga0068854_100244806 | Ga0068854_1002448062 | 301 |
| 483 | 3300005614 | Ga0068856_100005996 | Ga0068856_1000059968 | 301 |
| 484 | 3300005614 | Ga0068856_100171649 | Ga0068856_1001716494 | 301 |
| 485 | 3300005615 | Ga0070702_100005981 | Ga0070702_1000059814 | 301 |
| 486 | 3300005616 | Ga0068852_100000037 | Ga0068852_10000003741 | 301 |
| 487 | 3300005616 | Ga0068852_100008426 | Ga0068852_1000084266 | 301 |
| 488 | 3300005616 | Ga0068852_100009794 | Ga0068852_1000097947 | 301 |
| 489 | 3300005618 | Ga0068864_100000043 | Ga0068864_100000043124 | 301 |
| 490 | 3300005618 | Ga0068864_100144773 | Ga0068864_1001447732 | 301 |
| 491 | 3300005718 | Ga0068866_10000645 | Ga0068866_100006459 | 301 |
| 492 | 3300005834 | Ga0068851_10119137 | Ga0068851_101191372 | 301 |
| 493 | 3300005841 | Ga0068863_100004891 | Ga0068863_1000048915 | 301 |
| 494 | 3300005841 | Ga0068863_100022537 | Ga0068863_1000225376 | 301 |
| 495 | 3300005842 | Ga0068858_100000046 | Ga0068858_1000000466 | 301 |
| 496 | 3300005843 | Ga0068860_100002786 | Ga0068860_1000027862 | 301 |
| 497 | 3300005844 | Ga0068862_100320521 | Ga0068862_1003205212 | 301 |
| 498 | 3300005937 | Ga0081455_10005837 | Ga0081455_100058379 | 301 |
| 499 | 3300005937 | Ga0081455_10167081 | Ga0081455_101670813 | 301 |
| 500 | 3300005981 | Ga0081538_10000042 | Ga0081538_100000423 | 301 |
| 501 | 3300005981 | Ga0081538_10000270 | Ga0081538_1000027041 | 301 |
| 502 | 3300005981 | Ga0081538_10001012 | Ga0081538_1000101226 | 301 |
| 503 | 3300005981 | Ga0081538_10009117 | Ga0081538_100091172 | 301 |
| 504 | 3300005981 | Ga0081538_10032355 | Ga0081538_100323555 | 301 |
| 505 | 3300005981 | Ga0081538_10080216 | Ga0081538_100802163 | 301 |
| 506 | 3300005983 | Ga0081540_1000855 | Ga0081540_100085527 | 301 |
| 507 | 3300005983 | Ga0081540_1001971 | Ga0081540_100197110 | 301 |
| 508 | 3300005985 | Ga0081539_10002753 | Ga0081539_1000275332 | 301 |
| 509 | 3300005985 | Ga0081539_10006174 | Ga0081539_100061747 | 301 |
| 510 | 3300005985 | Ga0081539_10017623 | Ga0081539_100176237 | 301 |
| 511 | 3300006028 | Ga0070717_10000004 | Ga0070717_1000000492 | 301 |
| 512 | 3300006028 | Ga0070717_10023884 | Ga0070717_100238844 | 301 |
| 513 | 3300006028 | Ga0070717_10037727 | Ga0070717_100377275 | 301 |
| 514 | 3300006038 | Ga0075365_10046083 | Ga0075365_100460833 | 301 |
| 515 | 3300006038 | Ga0075365_10239732 | Ga0075365_102397322 | 301 |
| 516 | 3300006051 | Ga0075364_10129562 | Ga0075364_101295622 | 301 |
| 517 | 3300006058 | Ga0075432_10007258 | Ga0075432_100072585 | 301 |
| 518 | 3300006175 | Ga0070712_100000008 | Ga0070712_10000000862 | 301 |
| 519 | 3300006175 | Ga0070712_100005477 | Ga0070712_1000054776 | 301 |
| 520 | 3300006175 | Ga0070712_100011732 | Ga0070712_1000117322 | 301 |
| 521 | 3300006175 | Ga0070712_100025870 | Ga0070712_1000258706 | 301 |
| 522 | 3300006237 | Ga0097621_100124621 | Ga0097621_1001246211 | 301 |
| 523 | 3300006846 | Ga0075430_100000024 | Ga0075430_10000002462 | 301 |
| 524 | 3300006846 | Ga0075430_100014081 | Ga0075430_1000140817 | 301 |
| 525 | 3300006847 | Ga0075431_100016543 | Ga0075431_1000165435 | 301 |
| 526 | 3300006847 | Ga0075431_100025100 | Ga0075431_1000251004 | 301 |
| 527 | 3300006852 | Ga0075433_10063177 | Ga0075433_100631777 | 301 |
| 528 | 3300006871 | Ga0075434_100201644 | Ga0075434_1002016443 | 301 |
| 529 | 3300006880 | Ga0075429_100004701 | Ga0075429_10000470113 | 301 |
| 530 | 3300009011 | Ga0105251_10054195 | Ga0105251_100541953 | 301 |
| 531 | 3300009093 | Ga0105240_10046441 | Ga0105240_100464414 | 301 |
| 532 | 3300009094 | Ga0111539_10082333 | Ga0111539_100823331 | 301 |
| 533 | 3300009098 | Ga0105245_10001641 | Ga0105245_100016418 | 301 |
| 534 | 3300009098 | Ga0105245_10004571 | Ga0105245_100045712 | 301 |
| 535 | 3300009098 | Ga0105245_10468362 | Ga0105245_104683622 | 301 |
| 536 | 3300009101 | Ga0105247_10000591 | Ga0105247_100005917 | 301 |
| 537 | 3300009147 | Ga0114129_10003125 | Ga0114129_1000312528 | 301 |
| 538 | 3300009147 | Ga0114129_10317706 | Ga0114129_103177064 | 301 |
| 539 | 3300009147 | Ga0114129_10438886 | Ga0114129_104388862 | 301 |
| 540 | 3300009148 | Ga0105243_10028842 | Ga0105243_100288426 | 301 |
| 541 | 3300009174 | Ga0105241_10142534 | Ga0105241_101425342 | 301 |
| 542 | 3300009176 | Ga0105242_10000052 | Ga0105242_1000005263 | 301 |
| 543 | 3300009176 | Ga0105242_10008495 | Ga0105242_100084956 | 301 |
| 544 | 3300009176 | Ga0105242_10131466 | Ga0105242_101314662 | 301 |
| 545 | 3300009176 | Ga0105242_10137973 | Ga0105242_101379732 | 301 |
| 546 | 3300009176 | Ga0105242_10358114 | Ga0105242_103581141 | 301 |
| 547 | 3300009177 | Ga0105248_10000017 | Ga0105248_10000017264 | 301 |
| 548 | 3300009545 | Ga0105237_10005947 | Ga0105237_100059478 | 301 |
| 549 | 3300009545 | Ga0105237_10212784 | Ga0105237_102127843 | 301 |
| 550 | 3300009545 | Ga0105237_10373415 | Ga0105237_103734151 | 301 |
| 551 | 3300009551 | Ga0105238_10147044 | Ga0105238_101470443 | 301 |
| 552 | 3300009553 | Ga0105249_10043801 | Ga0105249_100438012 | 301 |
| 553 | 3300010375 | Ga0105239_10032590 | Ga0105239_100325908 | 301 |
| 554 | 3300010375 | Ga0105239_10195947 | Ga0105239_101959473 | 301 |
| 555 | 3300013102 | Ga0157371_10088324 | Ga0157371_100883243 | 301 |
| 556 | 3300013104 | Ga0157370_10032916 | Ga0157370_100329162 | 301 |
| 557 | 3300013105 | Ga0157369_10000105 | Ga0157369_1000010534 | 301 |
| 558 | 3300013105 | Ga0157369_10112813 | Ga0157369_101128133 | 301 |
| 559 | 3300013105 | Ga0157369_10400458 | Ga0157369_104004582 | 301 |
| 560 | 3300013296 | Ga0157374_10014025 | Ga0157374_100140259 | 301 |
| 561 | 3300013297 | Ga0157378_10016184 | Ga0157378_100161842 | 301 |
| 562 | 3300013306 | Ga0163162_10155764 | Ga0163162_101557641 | 301 |
| 563 | 3300013307 | Ga0157372_10047612 | Ga0157372_100476126 | 301 |
| 564 | 3300013308 | Ga0157375_10307641 | Ga0157375_103076411 | 301 |
| 565 | 3300014326 | Ga0157380_10269558 | Ga0157380_102695582 | 301 |
| 566 | 3300014497 | Ga0182008_10129764 | Ga0182008_101297642 | 301 |
| 567 | 3300014745 | Ga0157377_10003359 | Ga0157377_100033591 | 301 |
| 568 | 3300014745 | Ga0157377_10034398 | Ga0157377_100343982 | 301 |
| 569 | 3300014968 | Ga0157379_10005656 | Ga0157379_100056567 | 301 |
| 570 | 3300014968 | Ga0157379_10089872 | Ga0157379_100898724 | 301 |
| 571 | 3300014969 | Ga0157376_10006598 | Ga0157376_100065983 | 301 |
| 572 | 3300014969 | Ga0157376_10020347 | Ga0157376_100203473 | 301 |
| 573 | 3300017792 | Ga0163161_10000064 | Ga0163161_1000006449 | 301 |
| 574 | 3300017792 | Ga0163161_10077888 | Ga0163161_100778881 | 301 |
| 575 | 3300020076 | Ga0206355_1314388 | Ga0206355_13143883 | 301 |
| 576 | 3300020610 | Ga0154015_1473514 | Ga0154015_14735142 | 301 |
| 577 | 3300021358 | Ga0213873_10022808 | Ga0213873_100228082 | 301 |
| 578 | 3300021377 | Ga0213874_10000172 | Ga0213874_100001728 | 301 |
| 579 | 3300021377 | Ga0213874_10005393 | Ga0213874_100053932 | 301 |
| 580 | 3300021377 | Ga0213874_10014761 | Ga0213874_100147611 | 301 |
| 581 | 3300021384 | Ga0213876_10012939 | Ga0213876_100129395 | 301 |
| 582 | 3300021384 | Ga0213876_10016479 | Ga0213876_100164793 | 301 |
| 583 | 3300021384 | Ga0213876_10016638 | Ga0213876_100166384 | 301 |
| 584 | 3300021384 | Ga0213876_10049870 | Ga0213876_100498702 | 301 |
| 585 | 3300021384 | Ga0213876_10156666 | Ga0213876_101566661 | 301 |
| 586 | 3300021388 | Ga0213875_10000050 | Ga0213875_10000050134 | 301 |
| 587 | 3300021388 | Ga0213875_10009480 | Ga0213875_100094801 | 301 |
| 588 | 3300021388 | Ga0213875_10043490 | Ga0213875_100434901 | 301 |
| 589 | 3300025735 | Ga0207713_1068109 | Ga0207713_10681092 | 301 |
| 590 | 3300025898 | Ga0207692_10000006 | Ga0207692_10000006262 | 301 |
| 591 | 3300025898 | Ga0207692_10071283 | Ga0207692_100712832 | 301 |
| 592 | 3300025899 | Ga0207642_10015523 | Ga0207642_100155233 | 301 |
| 593 | 3300025900 | Ga0207710_10000684 | Ga0207710_100006849 | 301 |
| 594 | 3300025901 | Ga0207688_10002310 | Ga0207688_100023106 | 301 |
| 595 | 3300025903 | Ga0207680_10002263 | Ga0207680_100022639 | 301 |
| 596 | 3300025906 | Ga0207699_10063405 | Ga0207699_100634051 | 301 |
| 597 | 3300025913 | Ga0207695_10014458 | Ga0207695_100144584 | 301 |
| 598 | 3300025914 | Ga0207671_10004620 | Ga0207671_100046208 | 301 |
| 599 | 3300025914 | Ga0207671_10149884 | Ga0207671_101498843 | 301 |
| 600 | 3300025915 | Ga0207693_10000002 | Ga0207693_10000002279 | 301 |
| 601 | 3300025915 | Ga0207693_10001233 | Ga0207693_1000123324 | 301 |
| 602 | 3300025916 | Ga0207663_10001162 | Ga0207663_1000116215 | 301 |
| 603 | 3300025916 | Ga0207663_10033866 | Ga0207663_100338664 | 301 |
| 604 | 3300025918 | Ga0207662_10041964 | Ga0207662_100419643 | 301 |
| 605 | 3300025919 | Ga0207657_10047518 | Ga0207657_100475182 | 301 |
| 606 | 3300025920 | Ga0207649_10000015 | Ga0207649_10000015232 | 301 |
| 607 | 3300025920 | Ga0207649_10276310 | Ga0207649_102763102 | 301 |
| 608 | 3300025920 | Ga0207649_10282229 | Ga0207649_102822291 | 301 |
| 609 | 3300025921 | Ga0207652_10006391 | Ga0207652_100063919 | 301 |
| 610 | 3300025923 | Ga0207681_10006067 | Ga0207681_100060673 | 301 |
| 611 | 3300025923 | Ga0207681_10211717 | Ga0207681_102117172 | 301 |
| 612 | 3300025926 | Ga0207659_10000147 | Ga0207659_1000014728 | 301 |
| 613 | 3300025926 | Ga0207659_10303840 | Ga0207659_103038401 | 301 |
| 614 | 3300025927 | Ga0207687_10000040 | Ga0207687_1000004059 | 301 |
| 615 | 3300025927 | Ga0207687_10053372 | Ga0207687_100533721 | 301 |
| 616 | 3300025928 | Ga0207700_10000003 | Ga0207700_10000003116 | 301 |
| 617 | 3300025928 | Ga0207700_10062318 | Ga0207700_100623181 | 301 |
| 618 | 3300025929 | Ga0207664_10000006 | Ga0207664_10000006302 | 301 |
| 619 | 3300025929 | Ga0207664_10014457 | Ga0207664_100144571 | 301 |
| 620 | 3300025929 | Ga0207664_10051077 | Ga0207664_100510775 | 301 |
| 621 | 3300025929 | Ga0207664_10089505 | Ga0207664_100895054 | 301 |
| 622 | 3300025931 | Ga0207644_10372351 | Ga0207644_103723511 | 301 |
| 623 | 3300025932 | Ga0207690_10000017 | Ga0207690_100000179 | 301 |
| 624 | 3300025932 | Ga0207690_10004100 | Ga0207690_1000410010 | 301 |
| 625 | 3300025933 | Ga0207706_10029063 | Ga0207706_100290632 | 301 |
| 626 | 3300025934 | Ga0207686_10000119 | Ga0207686_1000011949 | 301 |
| 627 | 3300025934 | Ga0207686_10003997 | Ga0207686_100039975 | 301 |
| 628 | 3300025934 | Ga0207686_10024972 | Ga0207686_100249721 | 301 |
| 629 | 3300025935 | Ga0207709_10001985 | Ga0207709_1000198513 | 301 |
| 630 | 3300025937 | Ga0207669_10000029 | Ga0207669_1000002955 | 301 |
| 631 | 3300025939 | Ga0207665_10219133 | Ga0207665_102191332 | 301 |
| 632 | 3300025940 | Ga0207691_10000028 | Ga0207691_1000002842 | 301 |
| 633 | 3300025940 | Ga0207691_10194693 | Ga0207691_101946933 | 301 |
| 634 | 3300025941 | Ga0207711_10000011 | Ga0207711_10000011311 | 301 |
| 635 | 3300025941 | Ga0207711_10049898 | Ga0207711_100498982 | 301 |
| 636 | 3300025942 | Ga0207689_10134061 | Ga0207689_101340612 | 301 |
| 637 | 3300025944 | Ga0207661_10000714 | Ga0207661_1000071417 | 301 |
| 638 | 3300025944 | Ga0207661_10003496 | Ga0207661_1000349613 | 301 |
| 639 | 3300025944 | Ga0207661_10015312 | Ga0207661_100153125 | 301 |
| 640 | 3300025944 | Ga0207661_10486988 | Ga0207661_104869881 | 301 |
| 641 | 3300025945 | Ga0207679_10202261 | Ga0207679_102022612 | 301 |
| 642 | 3300025945 | Ga0207679_10360355 | Ga0207679_103603551 | 301 |
| 643 | 3300025949 | Ga0207667_10216613 | Ga0207667_102166132 | 301 |
| 644 | 3300025961 | Ga0207712_10085544 | Ga0207712_100855442 | 301 |
| 645 | 3300025961 | Ga0207712_10118328 | Ga0207712_101183282 | 301 |
| 646 | 3300026023 | Ga0207677_10009593 | Ga0207677_100095934 | 301 |
| 647 | 3300026067 | Ga0207678_10009775 | Ga0207678_100097754 | 301 |
| 648 | 3300026067 | Ga0207678_10033110 | Ga0207678_100331101 | 301 |
| 649 | 3300026067 | Ga0207678_10101339 | Ga0207678_101013392 | 301 |
| 650 | 3300026075 | Ga0207708_10009551 | Ga0207708_100095517 | 301 |
| 651 | 3300026075 | Ga0207708_10022857 | Ga0207708_100228572 | 301 |
| 652 | 3300026075 | Ga0207708_10061545 | Ga0207708_100615454 | 301 |
| 653 | 3300026078 | Ga0207702_10003502 | Ga0207702_1000350217 | 301 |
| 654 | 3300026078 | Ga0207702_10296520 | Ga0207702_102965202 | 301 |
| 655 | 3300026088 | Ga0207641_10001193 | Ga0207641_1000119316 | 301 |
| 656 | 3300026088 | Ga0207641_10002149 | Ga0207641_100021497 | 301 |
| 657 | 3300026089 | Ga0207648_10307674 | Ga0207648_103076742 | 301 |
| 658 | 3300026095 | Ga0207676_10000042 | Ga0207676_1000004246 | 301 |
| 659 | 3300026116 | Ga0207674_10173692 | Ga0207674_101736922 | 301 |
| 660 | 3300026116 | Ga0207674_10286741 | Ga0207674_102867412 | 301 |
| 661 | 3300026118 | Ga0207675_100014737 | Ga0207675_1000147376 | 301 |
| 662 | 3300026118 | Ga0207675_100217962 | Ga0207675_1002179623 | 301 |
| 663 | 3300026121 | Ga0207683_10003514 | Ga0207683_100035146 | 301 |
| 664 | 3300026121 | Ga0207683_10335749 | Ga0207683_103357492 | 301 |
| 665 | 3300026142 | Ga0207698_10000015 | Ga0207698_10000015163 | 301 |
| 666 | 3300026142 | Ga0207698_10018608 | Ga0207698_100186081 | 301 |
| 667 | 3300027907 | Ga0207428_10045873 | Ga0207428_100458735 | 301 |
| 668 | 3300028556 | Ga0265337_1000061 | Ga0265337_100006127 | 301 |
| 669 | 3300028556 | Ga0265337_1001815 | Ga0265337_10018155 | 301 |
| 670 | 3300028558 | Ga0265326_10000016 | Ga0265326_10000016120 | 301 |
| 671 | 3300028558 | Ga0265326_10000067 | Ga0265326_1000006716 | 301 |
| 672 | 3300028558 | Ga0265326_10001279 | Ga0265326_100012796 | 301 |
| 673 | 3300028563 | Ga0265319_1000796 | Ga0265319_10007967 | 301 |
| 674 | 3300028563 | Ga0265319_1000847 | Ga0265319_100084722 | 301 |
| 675 | 3300028563 | Ga0265319_1011920 | Ga0265319_10119204 | 301 |
| 676 | 3300028573 | Ga0265334_10000003 | Ga0265334_1000000310 | 301 |
| 677 | 3300028577 | Ga0265318_10000961 | Ga0265318_100009619 | 301 |
| 678 | 3300028577 | Ga0265318_10011281 | Ga0265318_100112812 | 301 |
| 679 | 3300028654 | Ga0265322_10000005 | Ga0265322_1000000593 | 301 |
| 680 | 3300028666 | Ga0265336_10000060 | Ga0265336_1000006094 | 301 |
| 681 | 3300028800 | Ga0265338_10000234 | Ga0265338_1000023495 | 301 |
| 682 | 3300028800 | Ga0265338_10005421 | Ga0265338_100054216 | 301 |
| 683 | 3300028800 | Ga0265338_10019449 | Ga0265338_100194495 | 301 |
| 684 | 3300029957 | Ga0265324_10000510 | Ga0265324_1000051019 | 301 |
| 685 | 3300029957 | Ga0265324_10007611 | Ga0265324_100076113 | 301 |
| 686 | 3300030521 | Ga0307511_10073950 | Ga0307511_100739502 | 301 |
| 687 | 3300031238 | Ga0265332_10023029 | Ga0265332_100230294 | 301 |
| 688 | 3300031239 | Ga0265328_10000563 | Ga0265328_100005636 | 301 |
| 689 | 3300031240 | Ga0265320_10000010 | Ga0265320_10000010139 | 301 |
| 690 | 3300031240 | Ga0265320_10001744 | Ga0265320_1000174414 | 301 |
| 691 | 3300031247 | Ga0265340_10000014 | Ga0265340_1000001419 | 301 |
| 692 | 3300031250 | Ga0265331_10003612 | Ga0265331_100036126 | 301 |
| 693 | 3300031251 | Ga0265327_10000040 | Ga0265327_10000040167 | 301 |
| 694 | 3300031251 | Ga0265327_10007890 | Ga0265327_100078905 | 301 |
| 695 | 3300031251 | Ga0265327_10014680 | Ga0265327_100146805 | 301 |
| 696 | 3300031251 | Ga0265327_10053485 | Ga0265327_100534852 | 301 |
| 697 | 3300031344 | Ga0265316_10301836 | Ga0265316_103018362 | 301 |
| 698 | 3300031711 | Ga0265314_10000208 | Ga0265314_1000020873 | 301 |
| 699 | 3300031711 | Ga0265314_10022037 | Ga0265314_100220375 | 301 |
| 700 | 3300031711 | Ga0265314_10063741 | Ga0265314_100637413 | 301 |
| 701 | 3300031852 | Ga0307410_10052995 | Ga0307410_100529954 | 301 |
| 702 | 3300031901 | Ga0307406_10051417 | Ga0307406_100514174 | 301 |
| 703 | 3300031995 | Ga0307409_100040412 | Ga0307409_1000404122 | 301 |
| 704 | 3300032002 | Ga0307416_100080230 | Ga0307416_1000802303 | 301 |
| 705 | 3300035172 | Ga0373955_0133634 | Ga0373955_0133634_81_1046 | 301 |
| 706 | 3300035241 | Ga0373961_0030544 | Ga0373961_0030544_502_1479 | 301 |
| 707 | 3300035691 | Ga0373931_0025368 | Ga0373931_0025368_37_1008 | 301 |
| 708 | 3300036401 | Ga0373937_0001667 | Ga0373937_0001667_17402_18367 | 301 |
| 709 | 3300036401 | Ga0373937_0508124 | Ga0373937_0508124_11_982 | 301 |
| 710 | 3300037418 | Ga0395900_0058250 | Ga0395900_0058250_2162_3136 | 301 |
| 711 | 3300037418 | Ga0395900_0268389 | Ga0395900_0268389_266_1240 | 301 |
| 712 | 3300037466 | Ga0395898_0049471 | Ga0395898_0049471_868_1842 | 301 |
| 713 | 3300037466 | Ga0395898_0151434 | Ga0395898_0151434_1122_2096 | 301 |
| 714 | 3300037466 | Ga0395898_0289935 | Ga0395898_0289935_565_1539 | 301 |
| 715 | 3300037471 | Ga0395905_0259976 | Ga0395905_0259976_319_1293 | 301 |
| 716 | 3300037853 | Ga0436364_0038128 | Ga0436364_0038128_30725_31696 | 301 |
| 717 | 3300037853 | Ga0436364_0216710 | Ga0436364_0216710_1860_2831 | 301 |
| 718 | 3300037853 | Ga0436364_0363596 | Ga0436364_0363596_3195_4166 | 301 |
| 719 | 3300037853 | Ga0436364_0378806 | Ga0436364_0378806_361_1332 | 301 |
| 720 | 3300037853 | Ga0436364_0532382 | Ga0436364_0532382_20846_21817 | 301 |
| 721 | 3300037853 | Ga0436364_0645424 | Ga0436364_0645424_7787_8758 | 301 |
| 722 | 3300037853 | Ga0436364_0857403 | Ga0436364_0857403_3681_4652 | 301 |
| 723 | 3300037853 | Ga0436364_1002783 | Ga0436364_1002783_794_1765 | 301 |
| 724 | 3300037853 | Ga0436364_1290040 | Ga0436364_1290040_3551_4522 | 301 |
| 725 | 3300037853 | Ga0436364_1552666 | Ga0436364_1552666_66_1037 | 301 |
| 726 | 3300039437 | Ga0436365_0235777 | Ga0436365_0235777_7118_8089 | 301 |
| 727 | 3300039437 | Ga0436365_0561226 | Ga0436365_0561226_97_1068 | 301 |
| 728 | 3300039437 | Ga0436365_0656722 | Ga0436365_0656722_6569_7540 | 301 |
| 729 | 3300039437 | Ga0436365_0725610 | Ga0436365_0725610_282_1253 | 301 |
| 730 | 3300039437 | Ga0436365_0730546 | Ga0436365_0730546_908_2020 | 301 |
| 731 | 3300039437 | Ga0436365_1012617 | Ga0436365_1012617_54_1025 | 301 |
| 732 | 3300039437 | Ga0436365_1022230 | Ga0436365_1022230_488_1459 | 301 |
| 733 | 3300039437 | Ga0436365_1104539 | Ga0436365_1104539_6574_7545 | 301 |
| 734 | 3300039437 | Ga0436365_1199460 | Ga0436365_1199460_1272_2243 | 301 |
| 735 | 3300039437 | Ga0436365_1704131 | Ga0436365_1704131_1976_2947 | 301 |
| 736 | 3300039450 | Ga0436363_0116001 | Ga0436363_0116001_33896_34867 | 301 |
| 737 | 3300039450 | Ga0436363_1208092 | Ga0436363_1208092_97_1068 | 301 |
| 738 | 3300039450 | Ga0436363_1218786 | Ga0436363_1218786_28_999 | 301 |
| 739 | 3300039450 | Ga0436363_1432146 | Ga0436363_1432146_3150_4121 | 301 |
| 740 | 3300039450 | Ga0436363_1478257 | Ga0436363_1478257_189_1160 | 301 |
| 741 | 3300039450 | Ga0436363_1499638 | Ga0436363_1499638_7998_8969 | 301 |
| 742 | 3300039453 | Ga0436362_0046940 | Ga0436362_0046940_94_1065 | 301 |
| 743 | 3300039453 | Ga0436362_0681159 | Ga0436362_0681159_77_1048 | 301 |
| 744 | 3300039453 | Ga0436362_0885374 | Ga0436362_0885374_674_1645 | 301 |
| 745 | 3300039453 | Ga0436362_0920455 | Ga0436362_0920455_206_1177 | 301 |
| 746 | 3300039453 | Ga0436362_0949373 | Ga0436362_0949373_1735_2706 | 301 |
| 747 | 3300041512 | Ga0451853_2799129 | Ga0451853_2799129_433_1398 | 301 |
| 748 | 3300044683 | Ga0466965_0046560 | Ga0466965_0046560_531_1502 | 301 |
| 749 | 3300044684 | Ga0466966_0054784 | Ga0466966_0054784_190_1161 | 301 |
| 750 | 3300044693 | Ga0466961_0019145 | Ga0466961_0019145_1421_2392 | 301 |
| 751 | 3300044694 | Ga0466963_0000415 | Ga0466963_0000415_8257_9228 | 301 |
| 752 | 3300044694 | Ga0466963_0019699 | Ga0466963_0019699_2861_3832 | 301 |
| 753 | 3300044694 | Ga0466963_0021672 | Ga0466963_0021672_1431_2402 | 301 |
| 754 | 3300044694 | Ga0466963_0025064 | Ga0466963_0025064_489_1460 | 301 |
| 755 | 3300044694 | Ga0466963_0037627 | Ga0466963_0037627_828_1799 | 301 |
| 756 | 3300044694 | Ga0466963_0060675 | Ga0466963_0060675_878_1849 | 301 |
| 757 | 3300044706 | Ga0466964_0016934 | Ga0466964_0016934_1605_2576 | 301 |
| 758 | 3300044719 | Ga0466971_0036989 | Ga0466971_0036989_753_1724 | 301 |
| 759 | 3300044719 | Ga0466971_0052608 | Ga0466971_0052608_188_1159 | 301 |
| 760 | 3300044719 | Ga0466971_0162134 | Ga0466971_0162134_32_1003 | 301 |
| 761 | 3300044735 | Ga0466968_0019494 | Ga0466968_0019494_156_1127 | 301 |
| 762 | 3300044735 | Ga0466968_0019833 | Ga0466968_0019833_380_1351 | 301 |
| 763 | 3300044735 | Ga0466968_0036147 | Ga0466968_0036147_765_1736 | 301 |
| 764 | 3300044765 | Ga0466970_0035604 | Ga0466970_0035604_43_1014 | 301 |
| 765 | 3300044842 | Ga0466957_0001280 | Ga0466957_0001280_10049_11020 | 301 |
| 766 | 3300044842 | Ga0466957_0065408 | Ga0466957_0065408_1200_2171 | 301 |
| 767 | 3300044842 | Ga0466957_0069438 | Ga0466957_0069438_498_1469 | 301 |
| 768 | 3300044842 | Ga0466957_0141908 | Ga0466957_0141908_549_1520 | 301 |
| 769 | 3300044901 | Ga0466960_0000004 | Ga0466960_0000004_13577_14551 | 301 |
| 770 | 3300044901 | Ga0466960_0009744 | Ga0466960_0009744_1300_2274 | 301 |
| 771 | 3300044901 | Ga0466960_0037582 | Ga0466960_0037582_316_1290 | 301 |
| 772 | 3300044901 | Ga0466960_0081124 | Ga0466960_0081124_314_1288 | 301 |
| 773 | 3300045049 | Ga0466959_0002714 | Ga0466959_0002714_5058_6029 | 301 |
| 774 | 3300045049 | Ga0466959_0049699 | Ga0466959_0049699_1887_2858 | 301 |
| 775 | 3300045049 | Ga0466959_0081306 | Ga0466959_0081306_316_1287 | 301 |
| 776 | 3300045049 | Ga0466959_0177297 | Ga0466959_0177297_466_1437 | 301 |
| 777 | 3300045836 | Ga0466958_0000711 | Ga0466958_0000711_9001_9972 | 301 |
| 778 | 3300045836 | Ga0466958_0009077 | Ga0466958_0009077_2669_3640 | 301 |
| 779 | 3300045836 | Ga0466958_0013426 | Ga0466958_0013426_2860_3831 | 301 |
| 780 | 3300045836 | Ga0466958_0015229 | Ga0466958_0015229_3264_4235 | 301 |
| 781 | 3300045836 | Ga0466958_0045373 | Ga0466958_0045373_1123_2094 | 301 |
| 782 | 3300045836 | Ga0466958_0097444 | Ga0466958_0097444_228_1199 | 301 |
| 783 | 3300045836 | Ga0466958_0156801 | Ga0466958_0156801_284_1255 | 301 |
| 784 | 3300045836 | Ga0466958_0158307 | Ga0466958_0158307_261_1232 | 301 |
| 785 | 3300045976 | Ga0466967_0061214 | Ga0466967_0061214_789_1760 | 301 |
| 786 | 3300045976 | Ga0466967_0074790 | Ga0466967_0074790_801_1778 | 301 |
| 787 | 3300045976 | Ga0466967_0168574 | Ga0466967_0168574_469_1443 | 301 |
| 788 | 3300045976 | Ga0466967_0196676 | Ga0466967_0196676_918_1889 | 301 |
| 789 | 3300046454 | Ga0495592_0000176 | Ga0495592_0000176_55241_56221 | 301 |
| 790 | 3300046459 | Ga0495629_0000806 | Ga0495629_0000806_19494_20459 | 301 |
| 791 | 3300046459 | Ga0495629_0003436 | Ga0495629_0003436_8403_9368 | 301 |
| 792 | 3300046459 | Ga0495629_0012055 | Ga0495629_0012055_3656_4624 | 301 |
| 793 | 3300046459 | Ga0495629_0041278 | Ga0495629_0041278_1472_2437 | 301 |
| 794 | 3300046460 | Ga0495638_0087005 | Ga0495638_0087005_458_1423 | 301 |
| 795 | 3300046462 | Ga0495651_0184032 | Ga0495651_0184032_340_1305 | 301 |
| 796 | 3300046463 | Ga0495653_0000231 | Ga0495653_0000231_32233_33204 | 301 |
| 797 | 3300046463 | Ga0495653_0052740 | Ga0495653_0052740_315_1295 | 301 |
| 798 | 3300046471 | Ga0495650_0000035 | Ga0495650_0000035_145498_146472 | 301 |
| 799 | 3300046476 | Ga0495662_0000051 | Ga0495662_0000051_5625_6605 | 301 |
| 800 | 3300046477 | Ga0495664_0000086 | Ga0495664_0000086_22897_23868 | 301 |
| 801 | 3300046491 | Ga0495584_0125085 | Ga0495584_0125085_168_1136 | 301 |
| 802 | 3300046507 | Ga0495606_0000895 | Ga0495606_0000895_36802_37767 | 301 |
| 803 | 3300046511 | Ga0495608_0000013 | Ga0495608_0000013_159642_160607 | 301 |
| 804 | 3300046511 | Ga0495608_0000092 | Ga0495608_0000092_15963_16943 | 301 |
| 805 | 3300046514 | Ga0495618_0000054 | Ga0495618_0000054_23909_24880 | 301 |
| 806 | 3300046514 | Ga0495618_0000094 | Ga0495618_0000094_45912_46892 | 301 |
| 807 | 3300046515 | Ga0495620_0084845 | Ga0495620_0084845_84_1049 | 301 |
| 808 | 3300046516 | Ga0495628_0002492 | Ga0495628_0002492_2087_3052 | 301 |
| 809 | 3300046516 | Ga0495628_0120326 | Ga0495628_0120326_381_1346 | 301 |
| 810 | 3300046517 | Ga0495630_0000032 | Ga0495630_0000032_15779_16744 | 301 |
| 811 | 3300046517 | Ga0495630_0000328 | Ga0495630_0000328_36679_37650 | 301 |
| 812 | 3300046517 | Ga0495630_0001088 | Ga0495630_0001088_14737_15702 | 301 |
| 813 | 3300046517 | Ga0495630_0005122 | Ga0495630_0005122_8045_9025 | 301 |
| 814 | 3300046517 | Ga0495630_0054464 | Ga0495630_0054464_390_1361 | 301 |
| 815 | 3300046520 | Ga0495637_0112337 | Ga0495637_0112337_36_1010 | 301 |
| 816 | 3300046523 | Ga0495644_0002998 | Ga0495644_0002998_3325_4305 | 301 |
| 817 | 3300046529 | Ga0495652_0000018 | Ga0495652_0000018_148247_149212 | 301 |
| 818 | 3300046529 | Ga0495652_0001501 | Ga0495652_0001501_12091_13056 | 301 |
| 819 | 3300046533 | Ga0495640_0006754 | Ga0495640_0006754_3603_4583 | 301 |
| 820 | 3300046536 | Ga0495587_0028299 | Ga0495587_0028299_1458_2423 | 301 |
| 821 | 3300046536 | Ga0495587_0075141 | Ga0495587_0075141_443_1408 | 301 |
| 822 | 3300046543 | Ga0495645_0000088 | Ga0495645_0000088_34630_35601 | 301 |
| 823 | 3300046543 | Ga0495645_0000535 | Ga0495645_0000535_22563_23534 | 301 |
| 824 | 3300046543 | Ga0495645_0055112 | Ga0495645_0055112_1638_2603 | 301 |
| 825 | 3300046559 | Ga0495667_0055519 | Ga0495667_0055519_1171_2136 | 301 |
| 826 | 3300046615 | Ga0495656_0001416 | Ga0495656_0001416_38_1003 | 301 |
| 827 | 3300046616 | Ga0495668_0160379 | Ga0495668_0160379_101_1081 | 301 |
| 828 | 3300046642 | Ga0495634_0000002 | Ga0495634_0000002_65391_66356 | 301 |
| 829 | 3300046642 | Ga0495634_0000191 | Ga0495634_0000191_12651_13616 | 301 |
| 830 | 3300046642 | Ga0495634_0016540 | Ga0495634_0016540_1322_2287 | 301 |
| 831 | 3300046642 | Ga0495634_0165686 | Ga0495634_0165686_107_1072 | 301 |
| 832 | 3300046663 | Ga0495635_0000182 | Ga0495635_0000182_6202_7182 | 301 |
| 833 | 3300046663 | Ga0495635_0097359 | Ga0495635_0097359_237_1202 | 301 |
| 834 | 3300046674 | Ga0495588_0000266 | Ga0495588_0000266_15744_16709 | 301 |
| 835 | 3300046675 | Ga0495657_0000003 | Ga0495657_0000003_210841_211806 | 301 |
| 836 | 3300046675 | Ga0495657_0000006 | Ga0495657_0000006_148554_149525 | 301 |
| 837 | 3300046678 | Ga0495599_0174331 | Ga0495599_0174331_27_1007 | 301 |
| 838 | 3300046680 | Ga0495646_0066231 | Ga0495646_0066231_360_1331 | 301 |
| 839 | 3300046681 | Ga0495647_0001427 | Ga0495647_0001427_1629_2609 | 301 |
| 840 | 3300046681 | Ga0495647_0011078 | Ga0495647_0011078_148_1113 | 301 |
| 841 | 3300046683 | Ga0495658_0112517 | Ga0495658_0112517_99_1079 | 301 |
| 842 | 3300046684 | Ga0495669_0000188 | Ga0495669_0000188_930_1910 | 301 |
| 843 | 3300046684 | Ga0495669_0013142 | Ga0495669_0013142_1770_2735 | 301 |
| 844 | 3300046689 | Ga0495613_0000173 | Ga0495613_0000173_47369_48349 | 301 |
| 845 | 3300046689 | Ga0495613_0000233 | Ga0495613_0000233_5146_6111 | 301 |
| 846 | 3300046690 | Ga0495624_0000563 | Ga0495624_0000563_11721_12686 | 301 |
| 847 | 3300046809 | Ga0495600_0002279 | Ga0495600_0002279_2069_3049 | 301 |
| 848 | 3300046809 | Ga0495600_0015795 | Ga0495600_0015795_1038_2009 | 301 |
| 849 | 3300046809 | Ga0495600_0105089 | Ga0495600_0105089_41_1021 | 301 |
| 850 | 3300047317 | Ga0495604_0000509 | Ga0495604_0000509_30188_31153 | 301 |
| 851 | 3300047317 | Ga0495604_0101081 | Ga0495604_0101081_1104_2069 | 301 |
| 852 | 3300047318 | Ga0495636_0127956 | Ga0495636_0127956_64_1038 | 301 |
| 853 | 3300047319 | Ga0495674_0194058 | Ga0495674_0194058_420_1391 | 301 |
| 854 | 3300047321 | Ga0495676_0009275 | Ga0495676_0009275_3973_4938 | 301 |
| 855 | 3300047321 | Ga0495676_0250948 | Ga0495676_0250948_69_1034 | 301 |
| 856 | 3300047322 | Ga0495680_0000113 | Ga0495680_0000113_50558_51538 | 301 |
| 857 | 3300047322 | Ga0495680_0074534 | Ga0495680_0074534_1116_2087 | 301 |
| 858 | 3300047444 | Ga0495675_0000002 | Ga0495675_0000002_210841_211806 | 301 |
| 859 | 3300047471 | Ga0495684_0002596 | Ga0495684_0002596_6367_7338 | 301 |
| 860 | 3300048088 | Ga0495602_0000034 | Ga0495602_0000034_23875_24840 | 301 |
| 861 | 3300048088 | Ga0495602_0000315 | Ga0495602_0000315_31748_32713 | 301 |
| 862 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_24911_25876 | 301 |
| 863 | 3300048903 | Ga0496100_0000234 | Ga0496100_0000234_3296_4276 | 301 |
| 864 | 3300048903 | Ga0496100_0008447 | Ga0496100_0008447_780_1751 | 301 |
| 865 | 3300048904 | Ga0496101_0000028 | Ga0496101_0000028_24900_25865 | 301 |
| 866 | 3300048904 | Ga0496101_0000382 | Ga0496101_0000382_3296_4276 | 301 |
| 867 | 3300048905 | Ga0496102_0000096 | Ga0496102_0000096_72282_73253 | 301 |
| 868 | 3300048905 | Ga0496102_0000129 | Ga0496102_0000129_63162_64127 | 301 |
| 869 | 3300048905 | Ga0496102_0047357 | Ga0496102_0047357_2493_3467 | 301 |
| 870 | 3300048906 | Ga0496103_0000035 | Ga0496103_0000035_72095_73066 | 301 |
| 871 | 3300048906 | Ga0496103_0000087 | Ga0496103_0000087_63160_64125 | 301 |
| 872 | 3300048906 | Ga0496103_0027889 | Ga0496103_0027889_455_1432 | 301 |
| 873 | 3300048907 | Ga0496104_0000010 | Ga0496104_0000010_278943_279908 | 301 |
| 874 | 3300048907 | Ga0496104_0000028 | Ga0496104_0000028_2794_3765 | 301 |
| 875 | 3300048907 | Ga0496104_0013374 | Ga0496104_0013374_2690_3664 | 301 |
| 876 | 3300048907 | Ga0496104_0043010 | Ga0496104_0043010_1691_2656 | 301 |
| 877 | 3300048907 | Ga0496104_0059462 | Ga0496104_0059462_2151_3125 | 301 |
| 878 | 3300048908 | Ga0496105_0000005 | Ga0496105_0000005_278943_279908 | 301 |
| 879 | 3300048908 | Ga0496105_0000051 | Ga0496105_0000051_11386_12351 | 301 |
| 880 | 3300048908 | Ga0496105_0010992 | Ga0496105_0010992_3143_4117 | 301 |
| 881 | 3300048908 | Ga0496105_0016037 | Ga0496105_0016037_2673_3647 | 301 |
| 882 | 3300048908 | Ga0496105_0066139 | Ga0496105_0066139_1694_2668 | 301 |
| 883 | 3300048908 | Ga0496105_0081709 | Ga0496105_0081709_359_1417 | 301 |
| 884 | 3300048908 | Ga0496105_0157387 | Ga0496105_0157387_591_1562 | 301 |
| 885 | 3300048909 | Ga0496106_0000134 | Ga0496106_0000134_41197_42162 | 301 |
| 886 | 3300048909 | Ga0496106_0000455 | Ga0496106_0000455_25033_26013 | 301 |
| 887 | 3300048909 | Ga0496106_0004709 | Ga0496106_0004709_4990_5964 | 301 |
| 888 | 3300048909 | Ga0496106_0021569 | Ga0496106_0021569_1966_2943 | 301 |
| 889 | 3300048910 | Ga0496107_0000002 | Ga0496107_0000002_222612_223577 | 301 |
| 890 | 3300048910 | Ga0496107_0000234 | Ga0496107_0000234_3284_4264 | 301 |
| 891 | 3300048911 | Ga0496108_0000004 | Ga0496108_0000004_404606_405586 | 301 |
| 892 | 3300048911 | Ga0496108_0005715 | Ga0496108_0005715_5098_6063 | 301 |
| 893 | 3300048911 | Ga0496108_0006524 | Ga0496108_0006524_4333_5307 | 301 |
| 894 | 3300048911 | Ga0496108_0016000 | Ga0496108_0016000_3638_4603 | 301 |
| 895 | 3300048911 | Ga0496108_0091865 | Ga0496108_0091865_43_1017 | 301 |
| 896 | 3300048911 | Ga0496108_0207400 | Ga0496108_0207400_94_1062 | 301 |
| 897 | 3300048911 | Ga0496108_0216683 | Ga0496108_0216683_35_1012 | 301 |
| 898 | 3300048912 | Ga0496109_0000011 | Ga0496109_0000011_15182_16147 | 301 |
| 899 | 3300048912 | Ga0496109_0000013 | Ga0496109_0000013_87047_88027 | 301 |
| 900 | 3300048912 | Ga0496109_0001749 | Ga0496109_0001749_5409_6386 | 301 |
| 901 | 3300048912 | Ga0496109_0016118 | Ga0496109_0016118_4659_5633 | 301 |
| 902 | 3300048912 | Ga0496109_0234550 | Ga0496109_0234550_745_1710 | 301 |
| 903 | 3300048913 | Ga0496110_0000185 | Ga0496110_0000185_4311_5276 | 301 |
| 904 | 3300048913 | Ga0496110_0001995 | Ga0496110_0001995_849_1820 | 301 |
| 905 | 3300048913 | Ga0496110_0037267 | Ga0496110_0037267_2438_3412 | 301 |
| 906 | 3300048913 | Ga0496110_0054802 | Ga0496110_0054802_304_1278 | 301 |
| 907 | 3300048913 | Ga0496110_0061760 | Ga0496110_0061760_844_1809 | 301 |
| 908 | 3300048913 | Ga0496110_0077077 | Ga0496110_0077077_1561_2538 | 301 |
| 909 | 3300048914 | Ga0496111_0000103 | Ga0496111_0000103_12966_13931 | 301 |
| 910 | 3300048914 | Ga0496111_0001859 | Ga0496111_0001859_8790_9761 | 301 |
| 911 | 3300048914 | Ga0496111_0006437 | Ga0496111_0006437_5891_6856 | 301 |
| 912 | 3300048914 | Ga0496111_0010556 | Ga0496111_0010556_1333_2307 | 301 |
| 913 | 3300048914 | Ga0496111_0024177 | Ga0496111_0024177_21_986 | 301 |
| 914 | 3300048914 | Ga0496111_0071374 | Ga0496111_0071374_1247_2224 | 301 |
| 915 | 3300048914 | Ga0496111_0227613 | Ga0496111_0227613_271_1239 | 301 |
| 916 | 3300048915 | Ga0496112_0001233 | Ga0496112_0001233_6314_7285 | 301 |
| 917 | 3300048915 | Ga0496112_0001703 | Ga0496112_0001703_2380_3354 | 301 |
| 918 | 3300048915 | Ga0496112_0040212 | Ga0496112_0040212_679_1653 | 301 |
| 919 | 3300048915 | Ga0496112_0399898 | Ga0496112_0399898_139_1116 | 301 |
| 920 | 3300048916 | Ga0496113_0007454 | Ga0496113_0007454_2835_3800 | 301 |
| 921 | 3300048916 | Ga0496113_0009718 | Ga0496113_0009718_3295_4260 | 301 |
| 922 | 3300048916 | Ga0496113_0017673 | Ga0496113_0017673_3960_4934 | 301 |
| 923 | 3300048916 | Ga0496113_0023407 | Ga0496113_0023407_2374_3348 | 301 |
| 924 | 3300048916 | Ga0496113_0056331 | Ga0496113_0056331_889_1860 | 301 |
| 925 | 3300048916 | Ga0496113_0103177 | Ga0496113_0103177_954_1925 | 301 |
| 926 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_433710_434675 | 301 |
| 927 | 3300048918 | Ga0496115_0000022 | Ga0496115_0000022_124862_125827 | 301 |
| 928 | 3300048918 | Ga0496115_0000408 | Ga0496115_0000408_20328_21293 | 301 |
| 929 | 3300048918 | Ga0496115_0015665 | Ga0496115_0015665_3583_4563 | 301 |
| 930 | 3300048918 | Ga0496115_0027710 | Ga0496115_0027710_1869_2840 | 301 |
| 931 | 3300048918 | Ga0496115_0028807 | Ga0496115_0028807_1534_2505 | 301 |
| 932 | 3300048918 | Ga0496115_0036332 | Ga0496115_0036332_2432_3406 | 301 |
| 933 | 3300048922 | Ga0496119_0009861 | Ga0496119_0009861_4336_5301 | 301 |
| 934 | 3300048922 | Ga0496119_0015154 | Ga0496119_0015154_4807_5772 | 301 |
| 935 | 3300048922 | Ga0496119_0098951 | Ga0496119_0098951_332_1297 | 301 |
| 936 | 3300048923 | Ga0496120_0002756 | Ga0496120_0002756_7642_8607 | 301 |
| 937 | 3300048923 | Ga0496120_0031163 | Ga0496120_0031163_780_1745 | 301 |
| 938 | 3300048924 | Ga0496121_0002900 | Ga0496121_0002900_1371_2345 | 301 |
| 939 | 3300048924 | Ga0496121_0005349 | Ga0496121_0005349_11032_11997 | 301 |
| 940 | 3300048927 | Ga0496124_0267006 | Ga0496124_0267006_145_1110 | 301 |
| 941 | 3300048929 | Ga0496126_0015537 | Ga0496126_0015537_1014_1979 | 301 |
| 942 | 3300048929 | Ga0496126_0057903 | Ga0496126_0057903_1280_2245 | 301 |
| 943 | 3300049569 | Ga0501032_0015713 | Ga0501032_0015713_1825_2799 | 301 |
| 944 | 3300049570 | Ga0501033_0003448 | Ga0501033_0003448_6190_7164 | 301 |
| 945 | 3300049571 | Ga0501034_0002876 | Ga0501034_0002876_6408_7376 | 301 |
| 946 | 3300049571 | Ga0501034_0035223 | Ga0501034_0035223_2217_3185 | 301 |
| 947 | 3300049571 | Ga0501034_0108701 | Ga0501034_0108701_484_1458 | 301 |
| 948 | 3300049571 | Ga0501034_0176227 | Ga0501034_0176227_433_1401 | 301 |
| 949 | 3300049571 | Ga0501034_0310807 | Ga0501034_0310807_508_1482 | 301 |
| 950 | 3300049572 | Ga0501036_0018894 | Ga0501036_0018894_954_1928 | 301 |
| 951 | 3300049572 | Ga0501036_0247634 | Ga0501036_0247634_246_1214 | 301 |
| 952 | 3300049573 | Ga0501037_0003467 | Ga0501037_0003467_10261_11235 | 301 |
| 953 | 3300049574 | Ga0501038_0347821 | Ga0501038_0347821_67_1035 | 301 |
| 954 | 3300049575 | Ga0501039_0021888 | Ga0501039_0021888_507_1481 | 301 |
| 955 | 3300049578 | Ga0501042_0010066 | Ga0501042_0010066_615_1589 | 301 |
| 956 | 3300049578 | Ga0501042_0086233 | Ga0501042_0086233_397_1362 | 301 |
| 957 | 3300049578 | Ga0501042_0179788 | Ga0501042_0179788_209_1174 | 301 |
| 958 | 3300049579 | Ga0501043_0032176 | Ga0501043_0032176_979_1953 | 301 |
| 959 | 3300049580 | Ga0501046_0004261 | Ga0501046_0004261_6573_7547 | 301 |
| 960 | 3300049581 | Ga0501047_0051756 | Ga0501047_0051756_891_1859 | 301 |
| 961 | 3300049581 | Ga0501047_0186161 | Ga0501047_0186161_870_1844 | 301 |
| 962 | 3300049582 | Ga0501048_0005946 | Ga0501048_0005946_338_1312 | 301 |
| 963 | 3300049583 | Ga0501067_0000864 | Ga0501067_0000864_963_1937 | 301 |
| 964 | 3300049583 | Ga0501067_0011384 | Ga0501067_0011384_2225_3193 | 301 |
| 965 | 3300049583 | Ga0501067_0156469 | Ga0501067_0156469_74_1045 | 301 |
| 966 | 3300049584 | Ga0501068_0065620 | Ga0501068_0065620_28_1002 | 301 |
| 967 | 3300049585 | Ga0501069_0013053 | Ga0501069_0013053_1504_2478 | 301 |
| 968 | 3300049586 | Ga0501070_0007617 | Ga0501070_0007617_29_1003 | 301 |
| 969 | 3300049589 | Ga0501073_0005549 | Ga0501073_0005549_7781_8755 | 301 |
| 970 | 3300049590 | Ga0501074_0026308 | Ga0501074_0026308_2381_3355 | 301 |
| 971 | 3300049742 | Ga0501080_0003769 | Ga0501080_0003769_4243_5217 | 301 |
| 972 | 3300049822 | Ga0501035_0064276 | Ga0501035_0064276_988_1962 | 301 |
| 973 | 3300049823 | Ga0501044_0036180 | Ga0501044_0036180_2932_3897 | 301 |
| 974 | 3300049823 | Ga0501044_0050761 | Ga0501044_0050761_2364_3338 | 301 |
| 975 | 3300049824 | Ga0501045_0085562 | Ga0501045_0085562_1157_2131 | 301 |
| 976 | 3300049851 | Ga0501212_010641 | Ga0501212_010641_323_1300 | 301 |
| 977 | 3300050491 | nmdc:mga00v17_46073_c1 | nmdc:mga00v17_46073_c1_1629_2597 | 301 |
| 978 | 3300050492 | nmdc:mga0yw44_15653_c1 | nmdc:mga0yw44_15653_c1_1943_2911 | 301 |
| 979 | 3300050492 | nmdc:mga0yw44_8680_c1 | nmdc:mga0yw44_8680_c1_3850_4818 | 301 |
| 980 | 3300050507 | nmdc:mga05p37_1685_c1 | nmdc:mga05p37_1685_c1_17857_18834 | 301 |
| 981 | 3300050507 | nmdc:mga05p37_224323_c1 | nmdc:mga05p37_224323_c1_877_1851 | 301 |
| 982 | 3300050507 | nmdc:mga05p37_240704_c1 | nmdc:mga05p37_240704_c1_351_1328 | 301 |
| 983 | 3300050508 | nmdc:mga09592_791_c1 | nmdc:mga09592_791_c1_154_1125 | 301 |
| 984 | 3300050509 | nmdc:mga0qj67_11680_c1 | nmdc:mga0qj67_11680_c1_2883_3860 | 301 |
| 985 | 3300050509 | nmdc:mga0qj67_20491_c1 | nmdc:mga0qj67_20491_c1_1634_2599 | 301 |
| 986 | 3300050509 | nmdc:mga0qj67_908_c1 | nmdc:mga0qj67_908_c1_17905_18882 | 301 |
| 987 | 3300050511 | nmdc:mga08y16_327363_c1 | nmdc:mga08y16_327363_c1_569_1543 | 301 |
| 988 | 3300050512 | nmdc:mga0n895_29896_c1 | nmdc:mga0n895_29896_c1_1416_2390 | 301 |
| 989 | 3300050512 | nmdc:mga0n895_82535_c1 | nmdc:mga0n895_82535_c1_676_1641 | 301 |
| 990 | 3300050515 | nmdc:mga0a205_120886_c1 | nmdc:mga0a205_120886_c1_1294_2271 | 301 |
| 991 | 3300050515 | nmdc:mga0a205_281_c1 | nmdc:mga0a205_281_c1_33467_34432 | 301 |
| 992 | 3300053077 | Ga0495601_0000029 | Ga0495601_0000029_63623_64588 | 301 |
| 993 | 3300053077 | Ga0495601_0000673 | Ga0495601_0000673_13069_14040 | 301 |
| 994 | 3300053077 | Ga0495601_0008993 | Ga0495601_0008993_1223_2188 | 301 |
| 995 | 3300053077 | Ga0495601_0009993 | Ga0495601_0009993_4414_5379 | 301 |
| 996 | 3300053077 | Ga0495601_0047138 | Ga0495601_0047138_900_1871 | 301 |
| 997 | 3300053078 | Ga0495612_0000049 | Ga0495612_0000049_47843_48814 | 301 |
| 998 | 3300053078 | Ga0495612_0004444 | Ga0495612_0004444_4504_5469 | 301 |
| 999 | 3300053083 | Ga0495655_0000010 | Ga0495655_0000010_84468_85433 | 301 |
| 1000 | 3300053084 | Ga0495595_0000007 | Ga0495595_0000007_159665_160630 | 301 |
| 1001 | 3300053084 | Ga0495595_0000547 | Ga0495595_0000547_9424_10404 | 301 |
| 1002 | 3300053085 | Ga0495619_0000001 | Ga0495619_0000001_384004_384987 | 301 |
| 1003 | 3300053085 | Ga0495619_0000026 | Ga0495619_0000026_11934_12899 | 301 |
| 1004 | 3300053085 | Ga0495619_0000205 | Ga0495619_0000205_21943_22908 | 301 |
| 1005 | 3300053085 | Ga0495619_0001750 | Ga0495619_0001750_2991_3977 | 301 |
| 1006 | 3300053085 | Ga0495619_0002447 | Ga0495619_0002447_8010_8975 | 301 |
| 1007 | 3300053085 | Ga0495619_0002937 | Ga0495619_0002937_6826_7791 | 301 |
| 1008 | 3300053085 | Ga0495619_0015207 | Ga0495619_0015207_2967_3932 | 301 |
| 1009 | 3300053094 | Ga0500566_0001360 | Ga0500566_0001360_974_1942 | 301 |
| 1010 | 3300053096 | Ga0500641_0003315 | Ga0500641_0003315_1403_2368 | 301 |
| 1011 | 3300053104 | Ga0500556_0001310 | Ga0500556_0001310_7537_8514 | 301 |
| 1012 | 3300053129 | Ga0500628_000024 | Ga0500628_000024_23972_24937 | 301 |
| 1013 | 3300053153 | Ga0500616_0003202 | Ga0500616_0003202_3861_4835 | 301 |
| 1014 | 3300053153 | Ga0500616_0005227 | Ga0500616_0005227_5211_6188 | 301 |
| 1015 | 3300053736 | Ga0500599_002557 | Ga0500599_002557_298_1275 | 301 |
| 1016 | 3300054114 | Ga0501084_0091029 | Ga0501084_0091029_591_1565 | 301 |
| 1017 | 3300054114 | Ga0501084_0100705 | Ga0501084_0100705_463_1428 | 301 |
| 1018 | 3300060353 | Ga0501082_0104093 | Ga0501082_0104093_1078_2052 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jc3-assembly3.cif.gz_F | structure of o-acetylserine sulfhydrylase b from salmonella typhimurium | 0.936 | 15 | 265 |
| 4i1y-assembly2.cif.gz_B | the structure of cysteine synthase from mycobacterium ulcerans agy99 | 0.9304 | 14 | 266 |
| 2v03-assembly1.cif.gz_A-2 | high resolution structure and catalysis of an o-acetylserine sulfhydrylase | 0.9248 | 15 | 265 |
| 4aec-assembly1.cif.gz_B | crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyase c | 0.923 | 14 | 265 |
| 4i1y-assembly1.cif.gz_A | the structure of cysteine synthase from mycobacterium ulcerans agy99 | 0.9212 | 14 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0WXY8_178_256_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9611 | 157 | 210 | 3.40.50.1100 |
| 3rr2A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9412 | 57 | 154 | 3.40.50.1100 |
| af_Q2G0V4_40_140_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9391 | 57 | 154 | 3.40.50.1100 |
| 5b1iC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9327 | 56 | 155 | 3.40.50.1100 |
| 3vc3B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.931 | 50 | 152 | 3.40.50.1100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2USF3-F1-model_v4 | Cysteine synthase | 0.9643 | 16 | 210 |
GO:0006535
GO:0016765 |
| AF-A0A356CU36-F1-model_v4 | Cysteine synthase B | 0.9633 | 72 | 208 |
GO:0004124
|
| AF-X1SBY9-F1-model_v4 | Tryptophan synthase beta chain-like PALP domain-containing protein | 0.9618 | 14 | 176 |
GO:0019344
|
| AF-X1NKG5-F1-model_v4 | Tryptophan synthase beta chain-like PALP domain-containing protein | 0.9595 | 18 | 144 |
GO:0006535
|
| AF-X1DN62-F1-model_v4 | Tryptophan synthase beta chain-like PALP domain-containing protein | 0.9563 | 14 | 216 |
GO:0006535
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar