F488335

General Info

Members Datasets Scaffolds Average Seq Length
1018 273 2036 133

Family's Representative Sequence

Representative Sequence 3300059509|Ga0587089_021695|Ga0587089_021695_308_883
Length 155
Sequence VPPVEAAGGEASRSHSDRKGLGIMKSFLVRASVGAAVAGLLPVAAVAQPWTPGSEVVGQPIQVTTNGVTNTVYLDPGGQLRILTPGGSTIPGTWTAANGQLCLAAGGPQECVPYAAPFQAGAPVTVTSSCGASESWLAQSTNAPXXXAAKSERGL

Samples

Sample ID Description Type Environment
1 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
199 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
212 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
217 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059602 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 15R_AD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89
Metatranscriptomes 11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.77
Rhizosphere 98.04
Stem 0
Stem Tuber 0
Unclassified 18.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587089_021695 3300059509 Bacteria 893
2 JGI24740J21852_10017128 3300001979 Bacteria 2598
3 JGI24739J22299_10005147 3300001989 Bacteria 4980
4 JGI24737J22298_10001371 3300001990 Bacteria 8641
5 JGI24737J22298_10001739 3300001990 Bacteria 7775
6 JGI24737J22298_10010090 3300001990 Bacteria 3128
7 JGI24737J22298_10115525 3300001990 Unclassified 793
8 JGI24743J22301_10013607 3300001991 Bacteria 1492
9 JGI24743J22301_10061766 3300001991 Bacteria 773
10 JGI24743J22301_10083134 3300001991 Bacteria 677
11 JGI24735J21928_10003163 3300002067 Bacteria 5635
12 JGI24735J21928_10004503 3300002067 Bacteria 4686
13 JGI24735J21928_10133570 3300002067 Unclassified 716
14 JGI24735J21928_10139576 3300002067 Unclassified 699
15 JGI24735J21928_10140301 3300002067 Unclassified 697
16 JGI24738J21930_10000372 3300002075 Bacteria 12499
17 JGI24738J21930_10001979 3300002075 Bacteria 5510
18 JGI24744J21845_10008807 3300002077 Bacteria 2074
19 Ga0058863_11670502 3300004799 Bacteria 655
20 Ga0058863_11870082 3300004799 Unclassified 797
21 Ga0058861_11885830 3300004800 Unclassified 705
22 Ga0058861_12010952 3300004800 Bacteria 588
23 Ga0058862_12414424 3300004803 Unclassified 531
24 Ga0065712_10247602 3300005290 Bacteria 939
25 Ga0065715_10524477 3300005293 Bacteria 761
26 Ga0070658_10000477 3300005327 Bacteria 34731
27 Ga0070658_10017337 3300005327 Bacteria 5763
28 Ga0070658_10020280 3300005327 Bacteria 5326
29 Ga0070658_10046871 3300005327 Bacteria 3497
30 Ga0070658_10060437 3300005327 Bacteria 3086
31 Ga0070658_10133965 3300005327 Bacteria 2066
32 Ga0070658_10203782 3300005327 Bacteria 1670
33 Ga0070658_10290916 3300005327 Bacteria 1392
34 Ga0070658_10527296 3300005327 Unclassified 1021
35 Ga0070658_10682718 3300005327 Unclassified 891
36 Ga0070676_10001347 3300005328 Bacteria 12342
37 Ga0070676_10003695 3300005328 Bacteria 8018
38 Ga0070676_10068888 3300005328 Bacteria 2119
39 Ga0070676_10120809 3300005328 Bacteria 1644
40 Ga0070676_11095783 3300005328 Bacteria 601
41 Ga0070683_100000747 3300005329 Bacteria 23810
42 Ga0070683_100005454 3300005329 Bacteria 10628
43 Ga0070683_100010424 3300005329 Bacteria 7992
44 Ga0070683_100174143 3300005329 Bacteria 2043
45 Ga0070683_100268394 3300005329 Bacteria 1623
46 Ga0070683_100480230 3300005329 Bacteria 1187
47 Ga0070683_100749937 3300005329 Bacteria 935
48 Ga0070683_100988990 3300005329 Bacteria 807
49 Ga0070690_100020500 3300005330 Bacteria 4028
50 Ga0070690_100062783 3300005330 Bacteria 2396
51 Ga0070670_100039466 3300005331 Bacteria 4060
52 Ga0070670_100379339 3300005331 Bacteria 1245
53 Ga0070670_100498666 3300005331 Unclassified 1082
54 Ga0070670_100564450 3300005331 Bacteria 1016
55 Ga0070670_100980266 3300005331 Bacteria 768
56 Ga0070677_10041571 3300005333 Bacteria 1816
57 Ga0068869_100006276 3300005334 Bacteria 7526
58 Ga0068869_100095563 3300005334 Bacteria 2242
59 Ga0068869_101175150 3300005334 Unclassified 673
60 Ga0070666_10002947 3300005335 Bacteria 10304
61 Ga0070666_10052734 3300005335 Bacteria 2742
62 Ga0070666_10070029 3300005335 Bacteria 2386
63 Ga0070666_10135878 3300005335 Bacteria 1711
64 Ga0070680_100147453 3300005336 Bacteria 1974
65 Ga0070680_100214594 3300005336 Bacteria 1624
66 Ga0070680_100739970 3300005336 Bacteria 846
67 Ga0070680_101013615 3300005336 Bacteria 717
68 Ga0070682_100001753 3300005337 Bacteria 12079
69 Ga0070682_100043356 3300005337 Bacteria 2781
70 Ga0070682_100072790 3300005337 Bacteria 2203
71 Ga0070682_101568571 3300005337 Bacteria 568
72 Ga0068868_100044049 3300005338 Bacteria 3488
73 Ga0068868_100196288 3300005338 Unclassified 1680
74 Ga0068868_100463282 3300005338 Unclassified 1104
75 Ga0068868_100537440 3300005338 Bacteria 1028
76 Ga0068868_101062679 3300005338 Unclassified 743
77 Ga0070660_100000425 3300005339 Bacteria 27941
78 Ga0070660_100003141 3300005339 Bacteria 11350
79 Ga0070660_100240795 3300005339 Bacteria 1474
80 Ga0070660_100303797 3300005339 Bacteria 1308
81 Ga0070660_100470796 3300005339 Bacteria 1043
82 Ga0070660_100474837 3300005339 Bacteria 1039
83 Ga0070660_101008537 3300005339 Unclassified 703
84 Ga0070660_101219972 3300005339 Unclassified 638
85 Ga0070689_100004740 3300005340 Bacteria 9229
86 Ga0070691_10035664 3300005341 Bacteria 2342
87 Ga0070687_100212620 3300005343 Unclassified 1179
88 Ga0070687_100391664 3300005343 Bacteria 908
89 Ga0070661_100000552 3300005344 Bacteria 28745
90 Ga0070661_100001960 3300005344 Bacteria 14220
91 Ga0070661_100002092 3300005344 Bacteria 13736
92 Ga0070661_100008264 3300005344 Bacteria 7185
93 Ga0070661_100036793 3300005344 Bacteria 3557
94 Ga0070661_100044834 3300005344 Bacteria 3232
95 Ga0070661_100133827 3300005344 Bacteria 1864
96 Ga0070661_100182595 3300005344 Bacteria 1597
97 Ga0070661_100584815 3300005344 Bacteria 901
98 Ga0070661_101227442 3300005344 Bacteria 627
99 Ga0070661_101458345 3300005344 Unclassified 576
100 Ga0070692_10034895 3300005345 Bacteria 2544
101 Ga0070692_10119051 3300005345 Bacteria 1470
102 Ga0070668_100001719 3300005347 Bacteria 15902
103 Ga0070668_100022957 3300005347 Bacteria 4717
104 Ga0070669_100021055 3300005353 Bacteria 4659
105 Ga0070669_100614306 3300005353 Bacteria 912
106 Ga0070669_100666619 3300005353 Bacteria 876
107 Ga0070675_100301932 3300005354 Bacteria 1411
108 Ga0070671_100012445 3300005355 Bacteria 6851
109 Ga0070671_100033760 3300005355 Bacteria 4234
110 Ga0070671_100034275 3300005355 Bacteria 4202
111 Ga0070671_100054845 3300005355 Bacteria 3315
112 Ga0070671_100121365 3300005355 Bacteria 2199
113 Ga0070671_100126515 3300005355 Bacteria 2151
114 Ga0070674_100036573 3300005356 Bacteria 3297
115 Ga0070674_100057775 3300005356 Bacteria 2694
116 Ga0070673_100001046 3300005364 Bacteria 15704
117 Ga0070673_100001556 3300005364 Bacteria 13518
118 Ga0070673_100133524 3300005364 Bacteria 2086
119 Ga0070673_100178351 3300005364 Bacteria 1817
120 Ga0070673_100543444 3300005364 Bacteria 1055
121 Ga0070673_100996216 3300005364 Unclassified 780
122 Ga0070659_100000065 3300005366 Bacteria 82919
123 Ga0070659_100011551 3300005366 Bacteria 6534
124 Ga0070659_100013967 3300005366 Bacteria 5994
125 Ga0070659_100016237 3300005366 Bacteria 5587
126 Ga0070659_100040228 3300005366 Bacteria 3652
127 Ga0070659_100041644 3300005366 Bacteria 3591
128 Ga0070659_100068005 3300005366 Bacteria 2825
129 Ga0070659_100089596 3300005366 Bacteria 2464
130 Ga0070659_100140975 3300005366 Bacteria 1963
131 Ga0070659_100257942 3300005366 Bacteria 1446
132 Ga0070659_100603853 3300005366 Bacteria 943
133 Ga0070659_101099487 3300005366 Bacteria 701
134 Ga0070659_101117178 3300005366 Bacteria 695
135 Ga0070659_101982550 3300005366 Unclassified 523
136 Ga0070667_100008194 3300005367 Bacteria 8662
137 Ga0070667_100011257 3300005367 Bacteria 7399
138 Ga0070667_100020823 3300005367 Bacteria 5446
139 Ga0070667_100024205 3300005367 Bacteria 5043
140 Ga0070667_100032912 3300005367 Bacteria 4327
141 Ga0070667_100086776 3300005367 Bacteria 2685
142 Ga0070667_100228041 3300005367 Bacteria 1660
143 Ga0070667_100263961 3300005367 Bacteria 1542
144 Ga0070667_100383781 3300005367 Bacteria 1276
145 Ga0070667_100385592 3300005367 Bacteria 1273
146 Ga0070709_10770043 3300005434 Unclassified 753
147 Ga0070714_100089684 3300005435 Bacteria 2692
148 Ga0070714_100956649 3300005435 Bacteria 833
149 Ga0070713_100347612 3300005436 Bacteria 1375
150 Ga0070713_102240953 3300005436 Bacteria 529
151 Ga0070663_100000647 3300005455 Bacteria 18662
152 Ga0070663_100001839 3300005455 Bacteria 11825
153 Ga0070663_100027782 3300005455 Bacteria 3845
154 Ga0070663_100126737 3300005455 Unclassified 1935
155 Ga0070663_100131939 3300005455 Bacteria 1898
156 Ga0070663_100161020 3300005455 Bacteria 1727
157 Ga0070663_100225129 3300005455 Bacteria 1474
158 Ga0070663_100242476 3300005455 Unclassified 1423
159 Ga0070663_100905861 3300005455 Bacteria 762
160 Ga0070663_101033811 3300005455 Bacteria 716
161 Ga0070663_101141897 3300005455 Unclassified 683
162 Ga0070678_100074997 3300005456 Bacteria 2544
163 Ga0070678_100098389 3300005456 Bacteria 2262
164 Ga0070678_100724892 3300005456 Unclassified 897
165 Ga0070662_100000010 3300005457 Bacteria 142717
166 Ga0070662_100000323 3300005457 Bacteria 28556
167 Ga0070662_100034343 3300005457 Bacteria 3575
168 Ga0070662_100103504 3300005457 Bacteria 2159
169 Ga0070662_100168055 3300005457 Bacteria 1720
170 Ga0070662_100180546 3300005457 Bacteria 1663
171 Ga0070662_100211513 3300005457 Bacteria 1543
172 Ga0070662_100287009 3300005457 Bacteria 1333
173 Ga0070662_100543773 3300005457 Bacteria 973
174 Ga0070662_101383194 3300005457 Bacteria 606
175 Ga0070681_10013516 3300005458 Bacteria 8117
176 Ga0070681_10152303 3300005458 Bacteria 2239
177 Ga0070681_10257261 3300005458 Bacteria 1658
178 Ga0068867_100004677 3300005459 Bacteria 9632
179 Ga0068867_100013102 3300005459 Bacteria 5870
180 Ga0068867_100278207 3300005459 Bacteria 1371
181 Ga0068867_100301265 3300005459 Unclassified 1321
182 Ga0068867_100520616 3300005459 Bacteria 1025
183 Ga0068867_101441810 3300005459 Bacteria 639
184 Ga0070685_10239772 3300005466 Bacteria 1196
185 Ga0070679_100014856 3300005530 Bacteria 7480
186 Ga0070679_100128950 3300005530 Bacteria 2511
187 Ga0070679_100181220 3300005530 Bacteria 2079
188 Ga0070679_100398756 3300005530 Bacteria 1322
189 Ga0070679_100526550 3300005530 Unclassified 1126
190 Ga0070679_100946217 3300005530 Bacteria 805
191 Ga0070679_101329082 3300005530 Unclassified 665
192 Ga0070679_101519181 3300005530 Unclassified 617
193 Ga0070679_102074640 3300005530 Unclassified 518
194 Ga0070684_100029987 3300005535 Bacteria 4617
195 Ga0070684_100094566 3300005535 Bacteria 2662
196 Ga0070684_100121740 3300005535 Bacteria 2347
197 Ga0070684_100541159 3300005535 Bacteria 1080
198 Ga0070684_102071085 3300005535 Unclassified 537
199 Ga0068853_100000067 3300005539 Bacteria 73891
200 Ga0068853_100011651 3300005539 Bacteria 7145
201 Ga0068853_100025346 3300005539 Bacteria 4976
202 Ga0068853_100030531 3300005539 Bacteria 4553
203 Ga0068853_100178754 3300005539 Bacteria 1923
204 Ga0068853_100195932 3300005539 Bacteria 1837
205 Ga0068853_100409380 3300005539 Bacteria 1270
206 Ga0070672_100023632 3300005543 Bacteria 4534
207 Ga0070672_100048432 3300005543 Bacteria 3302
208 Ga0070672_100095965 3300005543 Bacteria 2398
209 Ga0070686_100805827 3300005544 Unclassified 757
210 Ga0070696_100089379 3300005546 Bacteria 2190
211 Ga0070696_100619486 3300005546 Bacteria 874
212 Ga0070696_100815875 3300005546 Bacteria 769
213 Ga0070693_100000343 3300005547 Bacteria 21190
214 Ga0070693_100012856 3300005547 Bacteria 4249
215 Ga0070693_100015026 3300005547 Bacteria 3981
216 Ga0070693_100034700 3300005547 Bacteria 2793
217 Ga0070693_100068659 3300005547 Bacteria 2081
218 Ga0070693_100076941 3300005547 Bacteria 1979
219 Ga0070665_100013969 3300005548 Bacteria 8076
220 Ga0070665_100100909 3300005548 Bacteria 2890
221 Ga0070665_100119667 3300005548 Bacteria 2635
222 Ga0070665_100453511 3300005548 Bacteria 1292
223 Ga0070665_100516987 3300005548 Bacteria 1205
224 Ga0068855_100017249 3300005563 Bacteria 8690
225 Ga0068855_100018104 3300005563 Bacteria 8465
226 Ga0068855_100066116 3300005563 Bacteria 4215
227 Ga0068855_100079415 3300005563 Bacteria 3805
228 Ga0068855_100109434 3300005563 Bacteria 3173
229 Ga0068855_100295644 3300005563 Bacteria 1794
230 Ga0068855_100558573 3300005563 Unclassified 1238
231 Ga0068855_100751142 3300005563 Bacteria 1040
232 Ga0068855_101023477 3300005563 Unclassified 867
233 Ga0070664_100000228 3300005564 Bacteria 40132
234 Ga0070664_100002696 3300005564 Bacteria 14326
235 Ga0070664_100006881 3300005564 Bacteria 9167
236 Ga0070664_100009565 3300005564 Bacteria 7860
237 Ga0070664_100059968 3300005564 Bacteria 3238
238 Ga0070664_100071624 3300005564 Bacteria 2971
239 Ga0070664_100088394 3300005564 Bacteria 2679
240 Ga0070664_100276125 3300005564 Bacteria 1515
241 Ga0070664_100529306 3300005564 Bacteria 1088
242 Ga0070664_100578245 3300005564 Bacteria 1040
243 Ga0070664_100681133 3300005564 Unclassified 957
244 Ga0070664_100862659 3300005564 Bacteria 848
245 Ga0070664_100962590 3300005564 Bacteria 801
246 Ga0070664_100977906 3300005564 Bacteria 795
247 Ga0070664_102183787 3300005564 Unclassified 525
248 Ga0068857_100005960 3300005577 Bacteria 10414
249 Ga0068857_100018518 3300005577 Bacteria 6108
250 Ga0068857_100026322 3300005577 Bacteria 5126
251 Ga0068857_100208346 3300005577 Bacteria 1783
252 Ga0068857_100354085 3300005577 Bacteria 1360
253 Ga0068857_100380990 3300005577 Bacteria 1310
254 Ga0068857_100413628 3300005577 Bacteria 1256
255 Ga0068857_100561577 3300005577 Bacteria 1076
256 Ga0068857_100773393 3300005577 Bacteria 916
257 Ga0068857_102154810 3300005577 Bacteria 547
258 Ga0068854_100001913 3300005578 Bacteria 12684
259 Ga0068854_100006418 3300005578 Bacteria 7481
260 Ga0068854_100011321 3300005578 Bacteria 5802
261 Ga0068854_100025191 3300005578 Bacteria 4081
262 Ga0068854_100083818 3300005578 Bacteria 2357
263 Ga0068854_100411489 3300005578 Bacteria 1121
264 Ga0068856_100000101 3300005614 Bacteria 82391
265 Ga0068856_100023316 3300005614 Bacteria 6017
266 Ga0068856_100061342 3300005614 Bacteria 3714
267 Ga0068856_100079964 3300005614 Bacteria 3242
268 Ga0068856_100153835 3300005614 Bacteria 2310
269 Ga0068856_100334692 3300005614 Unclassified 1532
270 Ga0068856_100391785 3300005614 Bacteria 1409
271 Ga0068856_100689227 3300005614 Unclassified 1042
272 Ga0070702_100377282 3300005615 Bacteria 1007
273 Ga0068852_100000846 3300005616 Bacteria 20324
274 Ga0068852_100001433 3300005616 Bacteria 16088
275 Ga0068852_100003781 3300005616 Bacteria 10612
276 Ga0068852_100013090 3300005616 Bacteria 6335
277 Ga0068852_100023726 3300005616 Bacteria 4943
278 Ga0068852_100087984 3300005616 Bacteria 2773
279 Ga0068852_100093334 3300005616 Bacteria 2697
280 Ga0068852_100094713 3300005616 Bacteria 2680
281 Ga0068852_100437703 3300005616 Bacteria 1292
282 Ga0068852_102470375 3300005616 Unclassified 540
283 Ga0068859_100048611 3300005617 Unclassified 4260
284 Ga0068859_100054434 3300005617 Bacteria 4024
285 Ga0068859_100092224 3300005617 Bacteria 3080
286 Ga0068859_100379073 3300005617 Bacteria 1510
287 Ga0068859_100904590 3300005617 Bacteria 967
288 Ga0068864_100000222 3300005618 Bacteria 51430
289 Ga0068864_100007380 3300005618 Bacteria 9049
290 Ga0068864_100089427 3300005618 Bacteria 2713
291 Ga0068864_100180268 3300005618 Bacteria 1931
292 Ga0068861_100169755 3300005719 Bacteria 1807
293 Ga0068861_100329298 3300005719 Bacteria 1333
294 Ga0068861_100430982 3300005719 Bacteria 1177
295 Ga0068861_100485890 3300005719 Bacteria 1113
296 Ga0068851_10032858 3300005834 Bacteria 2582
297 Ga0068851_10047700 3300005834 Bacteria 2170
298 Ga0068851_10051292 3300005834 Unclassified 2096
299 Ga0068851_10154026 3300005834 Bacteria 1258
300 Ga0068851_10167365 3300005834 Bacteria 1211
301 Ga0068870_10103315 3300005840 Bacteria 1614
302 Ga0068863_100002567 3300005841 Bacteria 18003
303 Ga0068863_100034901 3300005841 Bacteria 4791
304 Ga0068863_100116639 3300005841 Bacteria 2544
305 Ga0068863_100360451 3300005841 Unclassified 1417
306 Ga0068863_100770831 3300005841 Unclassified 958
307 Ga0068858_100003320 3300005842 Bacteria 16021
308 Ga0068858_100007141 3300005842 Bacteria 10844
309 Ga0068860_100006803 3300005843 Bacteria 11459
310 Ga0068860_100061591 3300005843 Bacteria 3565
311 Ga0068860_100073377 3300005843 Bacteria 3253
312 Ga0068860_100245076 3300005843 Bacteria 1744
313 Ga0068862_100091796 3300005844 Bacteria 2646
314 Ga0068862_100253229 3300005844 Bacteria 1605
315 Ga0097621_100051529 3300006237 Bacteria 3350
316 Ga0097621_100357207 3300006237 Bacteria 1301
317 Ga0097621_100493047 3300006237 Bacteria 1109
318 Ga0097621_100561732 3300006237 Unclassified 1040
319 Ga0097621_101019463 3300006237 Bacteria 775
320 Ga0097621_101092693 3300006237 Bacteria 748
321 Ga0068871_100011090 3300006358 Bacteria 6604
322 Ga0068871_100379801 3300006358 Bacteria 1255
323 Ga0068871_100623150 3300006358 Unclassified 983
324 Ga0068871_100662228 3300006358 Bacteria 954
325 Ga0068871_101378884 3300006358 Bacteria 664
326 Ga0068865_100006056 3300006881 Bacteria 7375
327 Ga0068865_100034925 3300006881 Bacteria 3377
328 Ga0097620_100048612 3300006931 Unclassified 4260
329 Ga0097620_100054439 3300006931 Bacteria 4024
330 Ga0097620_100092228 3300006931 Bacteria 3080
331 Ga0097620_100379074 3300006931 Bacteria 1510
332 Ga0097620_100904739 3300006931 Bacteria 967
333 Ga0075435_100734814 3300007076 Bacteria 858
334 Ga0105240_10087961 3300009093 Bacteria 3803
335 Ga0105245_10006125 3300009098 Bacteria 10580
336 Ga0105241_10032907 3300009174 Bacteria 3889
337 Ga0105241_10130207 3300009174 Bacteria 2036
338 Ga0105241_10157917 3300009174 Bacteria 1861
339 Ga0105241_10342051 3300009174 Bacteria 1296
340 Ga0105241_10702355 3300009174 Unclassified 923
341 Ga0105242_10185671 3300009176 Bacteria 1837
342 Ga0105248_10001119 3300009177 Bacteria 29831
343 Ga0105248_10054729 3300009177 Bacteria 4475
344 Ga0105248_10228619 3300009177 Bacteria 2094
345 Ga0105248_10463115 3300009177 Bacteria 1429
346 Ga0105248_10829284 3300009177 Bacteria 1044
347 Ga0105248_11767199 3300009177 Unclassified 701
348 Ga0105248_12304511 3300009177 Bacteria 613
349 Ga0105237_10006758 3300009545 Bacteria 12663
350 Ga0105238_10004367 3300009551 Bacteria 14023
351 Ga0105238_10051275 3300009551 Bacteria 4151
352 Ga0105238_10063618 3300009551 Bacteria 3690
353 Ga0105238_10111637 3300009551 Bacteria 2714
354 Ga0105238_10327601 3300009551 Bacteria 1518
355 Ga0105238_12295790 3300009551 Unclassified 575
356 Ga0105249_10320235 3300009553 Bacteria 1562
357 Ga0105249_10935063 3300009553 Bacteria 934
358 Ga0105239_10054356 3300010375 Bacteria 4392
359 Ga0105239_10261369 3300010375 Unclassified 1945
360 Ga0105246_10008301 3300011119 Bacteria 6378
361 Ga0105246_10278750 3300011119 Bacteria 1340
362 Ga0157373_10009790 3300013100 Bacteria 7070
363 Ga0157373_10031339 3300013100 Bacteria 3828
364 Ga0157373_10059487 3300013100 Bacteria 2708
365 Ga0157373_10090355 3300013100 Bacteria 2157
366 Ga0157373_10092027 3300013100 Bacteria 2136
367 Ga0157373_10092672 3300013100 Bacteria 2128
368 Ga0157373_10102375 3300013100 Bacteria 2015
369 Ga0157373_10193781 3300013100 Bacteria 1432
370 Ga0157373_10272822 3300013100 Unclassified 1198
371 Ga0157373_10301096 3300013100 Bacteria 1138
372 Ga0157373_10463145 3300013100 Bacteria 913
373 Ga0157371_10003821 3300013102 Bacteria 13450
374 Ga0157371_10025025 3300013102 Bacteria 4356
375 Ga0157371_10026453 3300013102 Bacteria 4217
376 Ga0157371_10075155 3300013102 Bacteria 2393
377 Ga0157371_10092512 3300013102 Bacteria 2142
378 Ga0157371_10128560 3300013102 Bacteria 1802
379 Ga0157371_10870781 3300013102 Unclassified 682
380 Ga0157371_10939038 3300013102 Unclassified 657
381 Ga0157371_11244993 3300013102 Unclassified 574
382 Ga0157370_10059532 3300013104 Bacteria 3629
383 Ga0157370_10741220 3300013104 Unclassified 895
384 Ga0157370_10929875 3300013104 Unclassified 789
385 Ga0157369_10003181 3300013105 Bacteria 19593
386 Ga0157369_10032210 3300013105 Bacteria 5767
387 Ga0157369_10202481 3300013105 Bacteria 2083
388 Ga0157369_10259977 3300013105 Bacteria 1810
389 Ga0157369_10733218 3300013105 Unclassified 1017
390 Ga0157369_10922308 3300013105 Unclassified 895
391 Ga0157374_10303006 3300013296 Bacteria 1581
392 Ga0157374_10480692 3300013296 Unclassified 1245
393 Ga0157374_10519081 3300013296 Unclassified 1197
394 Ga0157378_10006532 3300013297 Bacteria 10192
395 Ga0157378_10007074 3300013297 Bacteria 9797
396 Ga0157378_10344935 3300013297 Bacteria 1453
397 Ga0163162_10032625 3300013306 Bacteria 5173
398 Ga0163162_10438663 3300013306 Unclassified 1438
399 Ga0157372_10011784 3300013307 Bacteria 9314
400 Ga0157372_10035809 3300013307 Bacteria 5466
401 Ga0157372_10045014 3300013307 Bacteria 4893
402 Ga0157372_10046828 3300013307 Bacteria 4802
403 Ga0157372_10359554 3300013307 Bacteria 1696
404 Ga0157372_11666553 3300013307 Unclassified 734
405 Ga0157372_12909297 3300013307 Bacteria 548
406 Ga0157375_10007221 3300013308 Bacteria 9716
407 Ga0157375_10024264 3300013308 Bacteria 5610
408 Ga0157375_10271200 3300013308 Bacteria 1859
409 Ga0163163_10019125 3300014325 Bacteria 6427
410 Ga0157377_10204425 3300014745 Bacteria 1256
411 Ga0157379_10165064 3300014968 Bacteria 1999
412 Ga0157379_10182441 3300014968 Unclassified 1896
413 Ga0157379_11204648 3300014968 Bacteria 728
414 Ga0157376_10684688 3300014969 Bacteria 1029
415 Ga0163161_10485228 3300017792 Bacteria 1004
416 Ga0197907_10034936 3300020069 Unclassified 667
417 Ga0197907_11002332 3300020069 Bacteria 910
418 Ga0206356_10307274 3300020070 Bacteria 1016
419 Ga0206356_11292785 3300020070 Bacteria 909
420 Ga0206356_11311979 3300020070 Unclassified 949
421 Ga0206356_11638823 3300020070 Bacteria 1524
422 Ga0206352_10699940 3300020078 Unclassified 901
423 Ga0206354_10948750 3300020081 Bacteria 990
424 Ga0206353_10732796 3300020082 Bacteria 619
425 Ga0224712_10171006 3300022467 Bacteria 974
426 Ga0224712_10205286 3300022467 Unclassified 897
427 Ga0207673_1020061 3300025290 Bacteria 900
428 Ga0207697_10000158 3300025315 Bacteria 33821
429 Ga0207697_10022280 3300025315 Bacteria 2595
430 Ga0207697_10028059 3300025315 Bacteria 2301
431 Ga0207697_10112020 3300025315 Bacteria 1169
432 Ga0207656_10003880 3300025321 Bacteria 5185
433 Ga0207656_10042249 3300025321 Bacteria 1939
434 Ga0207656_10061879 3300025321 Bacteria 1644
435 Ga0207656_10461209 3300025321 Bacteria 643
436 Ga0207713_1039137 3300025735 Bacteria 2003
437 Ga0207682_10035101 3300025893 Bacteria 2024
438 Ga0207642_10364144 3300025899 Unclassified 856
439 Ga0207688_10007071 3300025901 Bacteria 6102
440 Ga0207688_10126968 3300025901 Bacteria 1492
441 Ga0207680_10517167 3300025903 Bacteria 851
442 Ga0207647_10000832 3300025904 Bacteria 23993
443 Ga0207647_10004000 3300025904 Bacteria 10992
444 Ga0207647_10008390 3300025904 Bacteria 7410
445 Ga0207647_10061274 3300025904 Bacteria 2297
446 Ga0207647_10064373 3300025904 Bacteria 2228
447 Ga0207647_10079630 3300025904 Bacteria 1966
448 Ga0207647_10464687 3300025904 Bacteria 708
449 Ga0207645_10003931 3300025907 Bacteria 11101
450 Ga0207645_10004831 3300025907 Bacteria 9899
451 Ga0207645_10008901 3300025907 Bacteria 6973
452 Ga0207645_10063906 3300025907 Unclassified 2352
453 Ga0207645_10112926 3300025907 Bacteria 1760
454 Ga0207643_10054699 3300025908 Bacteria 2269
455 Ga0207643_10173377 3300025908 Bacteria 1303
456 Ga0207643_10254530 3300025908 Bacteria 1082
457 Ga0207705_10000113 3300025909 Bacteria 90567
458 Ga0207705_10010345 3300025909 Bacteria 6787
459 Ga0207705_10038951 3300025909 Bacteria 3406
460 Ga0207705_10059966 3300025909 Bacteria 2747
461 Ga0207705_10060833 3300025909 Bacteria 2728
462 Ga0207705_10065521 3300025909 Bacteria 2626
463 Ga0207705_10065899 3300025909 Bacteria 2619
464 Ga0207705_10077431 3300025909 Bacteria 2419
465 Ga0207705_10186859 3300025909 Bacteria 1566
466 Ga0207705_10261160 3300025909 Bacteria 1322
467 Ga0207705_11141639 3300025909 Unclassified 599
468 Ga0207654_10106813 3300025911 Bacteria 1734
469 Ga0207654_10178036 3300025911 Unclassified 1385
470 Ga0207707_10008907 3300025912 Bacteria 8714
471 Ga0207707_10453823 3300025912 Unclassified 1097
472 Ga0207707_10495635 3300025912 Bacteria 1042
473 Ga0207695_10622836 3300025913 Unclassified 960
474 Ga0207671_10017531 3300025914 Bacteria 5516
475 Ga0207693_10016003 3300025915 Bacteria 6004
476 Ga0207660_10007589 3300025917 Bacteria 7020
477 Ga0207660_10034958 3300025917 Bacteria 3486
478 Ga0207660_10440534 3300025917 Bacteria 1053
479 Ga0207660_10535163 3300025917 Bacteria 952
480 Ga0207660_10665417 3300025917 Bacteria 849
481 Ga0207660_10682176 3300025917 Bacteria 838
482 Ga0207660_11701896 3300025917 Bacteria 507
483 Ga0207662_10030474 3300025918 Bacteria 3130
484 Ga0207662_10077107 3300025918 Bacteria 2027
485 Ga0207662_10170760 3300025918 Bacteria 1394
486 Ga0207657_10000026 3300025919 Bacteria 143118
487 Ga0207657_10002103 3300025919 Bacteria 21540
488 Ga0207657_10005900 3300025919 Bacteria 12750
489 Ga0207657_10007800 3300025919 Bacteria 10926
490 Ga0207657_10038093 3300025919 Bacteria 4285
491 Ga0207657_10050216 3300025919 Bacteria 3630
492 Ga0207657_10093297 3300025919 Bacteria 2507
493 Ga0207657_10167001 3300025919 Bacteria 1784
494 Ga0207657_10281976 3300025919 Bacteria 1319
495 Ga0207657_10862110 3300025919 Bacteria 698
496 Ga0207649_10000516 3300025920 Bacteria 27112
497 Ga0207649_10002740 3300025920 Bacteria 9764
498 Ga0207649_10032422 3300025920 Bacteria 3114
499 Ga0207649_10038842 3300025920 Bacteria 2884
500 Ga0207649_10070046 3300025920 Bacteria 2235
501 Ga0207649_10085352 3300025920 Bacteria 2054
502 Ga0207649_10183527 3300025920 Bacteria 1466
503 Ga0207649_10517552 3300025920 Bacteria 909
504 Ga0207652_10026485 3300025921 Bacteria 4830
505 Ga0207652_10095828 3300025921 Bacteria 2614
506 Ga0207652_10220094 3300025921 Bacteria 1711
507 Ga0207652_10298249 3300025921 Bacteria 1455
508 Ga0207652_10338914 3300025921 Bacteria 1357
509 Ga0207652_10437556 3300025921 Unclassified 1179
510 Ga0207652_10487035 3300025921 Unclassified 1111
511 Ga0207652_10825776 3300025921 Bacteria 822
512 Ga0207652_11286989 3300025921 Unclassified 634
513 Ga0207681_10047787 3300025923 Bacteria 2885
514 Ga0207681_10056834 3300025923 Bacteria 2670
515 Ga0207681_10277952 3300025923 Unclassified 1317
516 Ga0207694_10000776 3300025924 Bacteria 28653
517 Ga0207694_10005699 3300025924 Bacteria 9549
518 Ga0207694_10185516 3300025924 Unclassified 1688
519 Ga0207694_10334497 3300025924 Bacteria 1251
520 Ga0207694_10921080 3300025924 Bacteria 739
521 Ga0207694_11500997 3300025924 Unclassified 569
522 Ga0207650_10028115 3300025925 Bacteria 4030
523 Ga0207650_10142089 3300025925 Bacteria 1888
524 Ga0207659_10835872 3300025926 Bacteria 791
525 Ga0207687_10048079 3300025927 Bacteria 2960
526 Ga0207687_10062974 3300025927 Bacteria 2625
527 Ga0207664_10146782 3300025929 Bacteria 2001
528 Ga0207664_10161196 3300025929 Bacteria 1913
529 Ga0207664_10251689 3300025929 Bacteria 1542
530 Ga0207664_10374847 3300025929 Bacteria 1262
531 Ga0207664_10801546 3300025929 Unclassified 847
532 Ga0207644_10022380 3300025931 Bacteria 4319
533 Ga0207644_10033303 3300025931 Bacteria 3599
534 Ga0207644_10033934 3300025931 Bacteria 3570
535 Ga0207644_10209882 3300025931 Bacteria 1539
536 Ga0207644_10227290 3300025931 Bacteria 1481
537 Ga0207690_10000649 3300025932 Bacteria 22307
538 Ga0207690_10002369 3300025932 Bacteria 11421
539 Ga0207690_10002565 3300025932 Bacteria 10974
540 Ga0207690_10012713 3300025932 Bacteria 5046
541 Ga0207690_10017432 3300025932 Bacteria 4383
542 Ga0207690_10050183 3300025932 Bacteria 2784
543 Ga0207690_10201848 3300025932 Unclassified 1511
544 Ga0207690_10219429 3300025932 Bacteria 1454
545 Ga0207690_10238263 3300025932 Bacteria 1400
546 Ga0207690_10369349 3300025932 Unclassified 1138
547 Ga0207690_10413049 3300025932 Bacteria 1078
548 Ga0207690_10429139 3300025932 Bacteria 1059
549 Ga0207690_10640821 3300025932 Bacteria 870
550 Ga0207690_11098335 3300025932 Unclassified 663
551 Ga0207706_10000031 3300025933 Bacteria 143109
552 Ga0207706_10000829 3300025933 Bacteria 32031
553 Ga0207706_10002893 3300025933 Bacteria 16604
554 Ga0207706_10008630 3300025933 Bacteria 9389
555 Ga0207706_10024282 3300025933 Bacteria 5434
556 Ga0207706_10038293 3300025933 Bacteria 4254
557 Ga0207706_10055308 3300025933 Bacteria 3500
558 Ga0207706_10081488 3300025933 Bacteria 2843
559 Ga0207706_10101934 3300025933 Bacteria 2526
560 Ga0207706_10158840 3300025933 Bacteria 1988
561 Ga0207706_10216949 3300025933 Bacteria 1676
562 Ga0207706_10260604 3300025933 Bacteria 1514
563 Ga0207706_10676408 3300025933 Unclassified 883
564 Ga0207706_10963687 3300025933 Unclassified 718
565 Ga0207686_10362636 3300025934 Bacteria 1094
566 Ga0207709_10681923 3300025935 Bacteria 821
567 Ga0207670_10044294 3300025936 Bacteria 2943
568 Ga0207669_10108579 3300025937 Bacteria 1853
569 Ga0207669_10828103 3300025937 Bacteria 769
570 Ga0207704_10060374 3300025938 Bacteria 2346
571 Ga0207704_11009349 3300025938 Bacteria 704
572 Ga0207704_11083528 3300025938 Unclassified 680
573 Ga0207691_10003632 3300025940 Bacteria 14973
574 Ga0207691_10061499 3300025940 Bacteria 3411
575 Ga0207691_10134809 3300025940 Bacteria 2179
576 Ga0207691_10144668 3300025940 Bacteria 2093
577 Ga0207711_10000446 3300025941 Bacteria 43126
578 Ga0207711_10002065 3300025941 Bacteria 18165
579 Ga0207711_10007845 3300025941 Bacteria 8923
580 Ga0207711_10117724 3300025941 Bacteria 2369
581 Ga0207711_10226883 3300025941 Bacteria 1710
582 Ga0207711_10287123 3300025941 Unclassified 1516
583 Ga0207711_10733378 3300025941 Bacteria 921
584 Ga0207711_11023149 3300025941 Unclassified 766
585 Ga0207689_10000017 3300025942 Bacteria 117159
586 Ga0207689_10025109 3300025942 Bacteria 4995
587 Ga0207689_10037964 3300025942 Bacteria 3991
588 Ga0207689_10066588 3300025942 Bacteria 2961
589 Ga0207689_10426773 3300025942 Bacteria 1107
590 Ga0207661_10013965 3300025944 Bacteria 5873
591 Ga0207661_10030599 3300025944 Bacteria 4149
592 Ga0207661_10031712 3300025944 Bacteria 4087
593 Ga0207661_10235922 3300025944 Bacteria 1621
594 Ga0207661_10783699 3300025944 Unclassified 878
595 Ga0207661_11073666 3300025944 Unclassified 741
596 Ga0207679_10000236 3300025945 Bacteria 42583
597 Ga0207679_10008515 3300025945 Bacteria 6534
598 Ga0207679_10032946 3300025945 Bacteria 3643
599 Ga0207679_10088718 3300025945 Bacteria 2385
600 Ga0207679_10100327 3300025945 Bacteria 2262
601 Ga0207679_10118558 3300025945 Bacteria 2102
602 Ga0207679_10134912 3300025945 Bacteria 1986
603 Ga0207679_10175160 3300025945 Bacteria 1770
604 Ga0207679_10201523 3300025945 Bacteria 1662
605 Ga0207679_10354516 3300025945 Bacteria 1280
606 Ga0207679_10531731 3300025945 Bacteria 1053
607 Ga0207679_11442595 3300025945 Bacteria 631
608 Ga0207679_12014802 3300025945 Unclassified 525
609 Ga0207667_10001718 3300025949 Bacteria 27571
610 Ga0207667_10081840 3300025949 Bacteria 3345
611 Ga0207667_10132858 3300025949 Bacteria 2563
612 Ga0207667_10720816 3300025949 Bacteria 999
613 Ga0207667_11750098 3300025949 Unclassified 587
614 Ga0207651_10029701 3300025960 Bacteria 3468
615 Ga0207651_10116028 3300025960 Bacteria 2020
616 Ga0207651_10432706 3300025960 Unclassified 1125
617 Ga0207651_10538401 3300025960 Unclassified 1014
618 Ga0207651_11127555 3300025960 Unclassified 703
619 Ga0207651_11547410 3300025960 Unclassified 597
620 Ga0207651_12017645 3300025960 Bacteria 518
621 Ga0207712_10079041 3300025961 Bacteria 2388
622 Ga0207668_10002157 3300025972 Bacteria 11474
623 Ga0207668_10073156 3300025972 Bacteria 2455
624 Ga0207640_10007503 3300025981 Bacteria 6024
625 Ga0207640_10010090 3300025981 Bacteria 5309
626 Ga0207640_10032101 3300025981 Bacteria 3253
627 Ga0207640_10034294 3300025981 Bacteria 3166
628 Ga0207640_10107025 3300025981 Bacteria 1974
629 Ga0207640_10114939 3300025981 Unclassified 1916
630 Ga0207640_10128956 3300025981 Bacteria 1825
631 Ga0207640_11504686 3300025981 Unclassified 605
632 Ga0207658_10017651 3300025986 Bacteria 4920
633 Ga0207658_10018455 3300025986 Bacteria 4817
634 Ga0207658_10027437 3300025986 Bacteria 4001
635 Ga0207658_10036587 3300025986 Bacteria 3520
636 Ga0207658_10072042 3300025986 Bacteria 2618
637 Ga0207658_10078804 3300025986 Bacteria 2518
638 Ga0207658_10080766 3300025986 Bacteria 2491
639 Ga0207658_10094610 3300025986 Bacteria 2326
640 Ga0207677_10102695 3300026023 Bacteria 2109
641 Ga0207677_10298705 3300026023 Bacteria 1329
642 Ga0207677_10765304 3300026023 Unclassified 862
643 Ga0207677_10815524 3300026023 Unclassified 836
644 Ga0207703_10025106 3300026035 Bacteria 4687
645 Ga0207703_10065655 3300026035 Bacteria 2983
646 Ga0207703_10088896 3300026035 Bacteria 2594
647 Ga0207703_10135939 3300026035 Bacteria 2128
648 Ga0207639_10005817 3300026041 Bacteria 8356
649 Ga0207639_10070955 3300026041 Bacteria 2723
650 Ga0207639_10095747 3300026041 Bacteria 2387
651 Ga0207639_10108892 3300026041 Bacteria 2253
652 Ga0207639_10205373 3300026041 Bacteria 1692
653 Ga0207639_10385639 3300026041 Unclassified 1259
654 Ga0207639_10770962 3300026041 Unclassified 895
655 Ga0207678_10002668 3300026067 Bacteria 16192
656 Ga0207678_10010119 3300026067 Bacteria 8274
657 Ga0207678_10010859 3300026067 Bacteria 8003
658 Ga0207678_10012250 3300026067 Bacteria 7530
659 Ga0207678_10023738 3300026067 Bacteria 5363
660 Ga0207678_10138368 3300026067 Bacteria 2078
661 Ga0207678_10154857 3300026067 Bacteria 1957
662 Ga0207678_10176738 3300026067 Unclassified 1823
663 Ga0207678_10209384 3300026067 Bacteria 1668
664 Ga0207678_10300599 3300026067 Unclassified 1379
665 Ga0207678_10502746 3300026067 Bacteria 1057
666 Ga0207678_10586127 3300026067 Bacteria 977
667 Ga0207708_10326846 3300026075 Bacteria 1253
668 Ga0207708_10327175 3300026075 Bacteria 1252
669 Ga0207702_10010631 3300026078 Bacteria 7690
670 Ga0207702_10015012 3300026078 Bacteria 6423
671 Ga0207702_10067734 3300026078 Bacteria 3064
672 Ga0207702_10095158 3300026078 Bacteria 2616
673 Ga0207702_10164850 3300026078 Bacteria 2026
674 Ga0207702_10208008 3300026078 Bacteria 1818
675 Ga0207702_10600741 3300026078 Bacteria 1080
676 Ga0207702_10839137 3300026078 Bacteria 909
677 Ga0207641_10011385 3300026088 Bacteria 7299
678 Ga0207641_10019349 3300026088 Bacteria 5588
679 Ga0207641_10033916 3300026088 Bacteria 4243
680 Ga0207641_10337044 3300026088 Bacteria 1434
681 Ga0207641_10433036 3300026088 Unclassified 1268
682 Ga0207641_11196227 3300026088 Bacteria 760
683 Ga0207648_10002318 3300026089 Bacteria 20543
684 Ga0207648_10003142 3300026089 Bacteria 17423
685 Ga0207648_10006581 3300026089 Bacteria 11535
686 Ga0207648_10116265 3300026089 Bacteria 2351
687 Ga0207676_10002072 3300026095 Bacteria 14553
688 Ga0207676_10008483 3300026095 Bacteria 7307
689 Ga0207676_10009522 3300026095 Bacteria 6915
690 Ga0207676_10031676 3300026095 Bacteria 3978
691 Ga0207676_10389840 3300026095 Bacteria 1299
692 Ga0207674_10000527 3300026116 Bacteria 50282
693 Ga0207674_10002277 3300026116 Bacteria 24338
694 Ga0207674_10003088 3300026116 Bacteria 20583
695 Ga0207674_10011531 3300026116 Bacteria 9928
696 Ga0207674_10024167 3300026116 Bacteria 6497
697 Ga0207674_10030316 3300026116 Bacteria 5688
698 Ga0207674_10036857 3300026116 Bacteria 5090
699 Ga0207674_10049289 3300026116 Bacteria 4308
700 Ga0207674_10111820 3300026116 Bacteria 2705
701 Ga0207674_10205136 3300026116 Unclassified 1921
702 Ga0207674_10539760 3300026116 Bacteria 1127
703 Ga0207675_100165697 3300026118 Bacteria 2110
704 Ga0207675_100242894 3300026118 Bacteria 1740
705 Ga0207675_100296014 3300026118 Bacteria 1575
706 Ga0207675_100578154 3300026118 Unclassified 1125
707 Ga0207675_100678760 3300026118 Bacteria 1038
708 Ga0207683_10014943 3300026121 Bacteria 6608
709 Ga0207683_10625691 3300026121 Bacteria 997
710 Ga0207698_10000618 3300026142 Bacteria 20690
711 Ga0207698_10001533 3300026142 Bacteria 13466
712 Ga0207698_10007701 3300026142 Bacteria 6757
713 Ga0207698_10009367 3300026142 Bacteria 6242
714 Ga0207698_10046260 3300026142 Bacteria 3285
715 Ga0207698_10280976 3300026142 Bacteria 1540
716 Ga0207698_10361244 3300026142 Unclassified 1375
717 Ga0207698_10379957 3300026142 Bacteria 1343
718 Ga0207698_10397596 3300026142 Bacteria 1316
719 Ga0207698_10727625 3300026142 Bacteria 989
720 Ga0268266_10005677 3300028379 Bacteria 11570
721 Ga0268266_10022882 3300028379 Bacteria 5318
722 Ga0268266_10422373 3300028379 Bacteria 1263
723 Ga0268265_10003245 3300028380 Bacteria 11805
724 Ga0268265_10059407 3300028380 Bacteria 2925
725 Ga0268265_10199537 3300028380 Bacteria 1734
726 Ga0268265_11013896 3300028380 Archaea 820
727 Ga0268264_10002543 3300028381 Bacteria 16012
728 Ga0268264_10035529 3300028381 Bacteria 4104
729 Ga0268264_10073947 3300028381 Unclassified 2894
730 Ga0268264_10157795 3300028381 Bacteria 2040
731 Ga0268264_10573422 3300028381 Unclassified 1109
732 Ga0307513_10390646 3300031456 Unclassified 1128
733 Ga0307408_100021556 3300031548 Bacteria 4362
734 Ga0307408_101050659 3300031548 Unclassified 753
735 Ga0307408_101720449 3300031548 Unclassified 598
736 Ga0307405_10457021 3300031731 Unclassified 1014
737 Ga0307405_10586539 3300031731 Bacteria 907
738 Ga0307405_10881887 3300031731 Unclassified 755
739 Ga0307413_10267439 3300031824 Bacteria 1278
740 Ga0307413_10487033 3300031824 Bacteria 987
741 Ga0307410_10107788 3300031852 Bacteria 2010
742 Ga0307410_10135140 3300031852 Unclassified 1817
743 Ga0307410_10342574 3300031852 Unclassified 1192
744 Ga0307410_10408551 3300031852 Bacteria 1098
745 Ga0307410_11529900 3300031852 Unclassified 588
746 Ga0307406_10006893 3300031901 Bacteria 6292
747 Ga0307406_10094729 3300031901 Bacteria 2019
748 Ga0307406_10183254 3300031901 Bacteria 1526
749 Ga0307406_10304271 3300031901 Bacteria 1226
750 Ga0307406_11360434 3300031901 Unclassified 621
751 Ga0307407_10007704 3300031903 Bacteria 4891
752 Ga0307407_10520960 3300031903 Bacteria 874
753 Ga0307412_10050121 3300031911 Bacteria 2754
754 Ga0307412_10125807 3300031911 Bacteria 1854
755 Ga0307412_10129002 3300031911 Bacteria 1834
756 Ga0307409_100018684 3300031995 Bacteria 4670
757 Ga0307409_100391047 3300031995 Bacteria 1325
758 Ga0307409_100415965 3300031995 Bacteria 1288
759 Ga0307409_101495403 3300031995 Bacteria 703
760 Ga0307416_100034296 3300032002 Bacteria 3860
761 Ga0307416_100186537 3300032002 Bacteria 1950
762 Ga0307416_100798430 3300032002 Bacteria 1039
763 Ga0307416_101024117 3300032002 Unclassified 929
764 Ga0307416_101170537 3300032002 Bacteria 874
765 Ga0307416_101697613 3300032002 Unclassified 736
766 Ga0307414_12034875 3300032004 Bacteria 536
767 Ga0307411_10208232 3300032005 Bacteria 1508
768 Ga0307411_10308733 3300032005 Bacteria 1272
769 Ga0307411_11720663 3300032005 Bacteria 581
770 Ga0307415_100019849 3300032126 Bacteria 4089
771 Ga0307415_100022433 3300032126 Bacteria 3896
772 Ga0307415_100027339 3300032126 Bacteria 3613
773 Ga0307415_100494859 3300032126 Bacteria 1067
774 Ga0307415_100808616 3300032126 Bacteria 856
775 Ga0373930_0092002 3300034816 Unclassified 712
776 Ga0373938_0099370 3300034957 Unclassified 729
777 Ga0373949_0066931 3300035090 Unclassified 934
778 Ga0373951_0066124 3300035091 Unclassified 913
779 Ga0373923_0002141 3300035111 Bacteria 5983
780 Ga0373955_0006945 3300035172 Bacteria 5179
781 Ga0373961_0010280 3300035241 Bacteria 2303
782 Ga0373962_0085039 3300035242 Unclassified 966
783 Ga0373933_0003124 3300035724 Bacteria 9231
784 Ga0373937_0000641 3300036401 Bacteria 30684
785 Ga0395899_0006584 3300037312 Bacteria 8999
786 Ga0395899_0030400 3300037312 Bacteria 4062
787 Ga0395899_0038361 3300037312 Bacteria 3588
788 Ga0395899_0098825 3300037312 Bacteria 2109
789 Ga0395899_0105236 3300037312 Bacteria 2033
790 Ga0395899_0191082 3300037312 Unclassified 1433
791 Ga0395899_0289732 3300037312 Bacteria 1111
792 Ga0395899_0893212 3300037312 Unclassified 542
793 Ga0395900_0106528 3300037418 Bacteria 2879
794 Ga0395900_0107348 3300037418 Bacteria 2868
795 Ga0395900_0176876 3300037418 Bacteria 2170
796 Ga0395900_0177213 3300037418 Bacteria 2168
797 Ga0395900_0245885 3300037418 Bacteria 1792
798 Ga0395900_0254630 3300037418 Unclassified 1755
799 Ga0395900_0262855 3300037418 Bacteria 1723
800 Ga0395900_0355503 3300037418 Bacteria 1437
801 Ga0395900_0442792 3300037418 Bacteria 1256
802 Ga0395900_0480745 3300037418 Bacteria 1194
803 Ga0395900_0582697 3300037418 Bacteria 1060
804 Ga0395900_0591238 3300037418 Unclassified 1051
805 Ga0395900_0607838 3300037418 Bacteria 1033
806 Ga0395900_0880782 3300037418 Bacteria 819
807 Ga0395900_1415124 3300037418 Unclassified 608
808 Ga0395900_1515835 3300037418 Unclassified 582
809 Ga0395900_1551262 3300037418 Bacteria 574
810 Ga0395898_0018087 3300037466 Bacteria 7191
811 Ga0395898_0197787 3300037466 Bacteria 1920
812 Ga0395898_0242749 3300037466 Bacteria 1718
813 Ga0395898_0253928 3300037466 Bacteria 1676
814 Ga0395898_0263788 3300037466 Unclassified 1643
815 Ga0395905_0000092 3300037471 Bacteria 149300
816 Ga0395905_0008699 3300037471 Bacteria 9994
817 Ga0395905_0017027 3300037471 Bacteria 6900
818 Ga0395905_0021465 3300037471 Bacteria 6105
819 Ga0395905_0033987 3300037471 Bacteria 4789
820 Ga0395905_0070313 3300037471 Bacteria 3279
821 Ga0395905_0088340 3300037471 Bacteria 2905
822 Ga0395905_0141907 3300037471 Bacteria 2259
823 Ga0395905_0179826 3300037471 Bacteria 1985
824 Ga0395905_0200560 3300037471 Bacteria 1871
825 Ga0395905_0226216 3300037471 Unclassified 1750
826 Ga0395905_0306016 3300037471 Bacteria 1477
827 Ga0395905_0552801 3300037471 Bacteria 1052
828 Ga0395905_0560942 3300037471 Bacteria 1043
829 Ga0395905_0645510 3300037471 Unclassified 960
830 Ga0395905_0683408 3300037471 Bacteria 929
831 Ga0395905_0727473 3300037471 Bacteria 895
832 Ga0395905_1114477 3300037471 Bacteria 692
833 Ga0395905_1438209 3300037471 Unclassified 594
834 Ga0395905_1553021 3300037471 Unclassified 566
835 Ga0395905_1568637 3300037471 Unclassified 563
836 Ga0395901_0000268 3300038443 Bacteria 64837
837 Ga0395901_0037677 3300038443 Bacteria 5000
838 Ga0395901_0109048 3300038443 Bacteria 2906
839 Ga0395901_0117722 3300038443 Bacteria 2791
840 Ga0395901_0157477 3300038443 Bacteria 2385
841 Ga0395901_0201949 3300038443 Bacteria 2083
842 Ga0395901_0211352 3300038443 Bacteria 2030
843 Ga0395901_0229427 3300038443 Bacteria 1939
844 Ga0395901_0323654 3300038443 Bacteria 1595
845 Ga0395901_0590479 3300038443 Bacteria 1121
846 Ga0395901_0755119 3300038443 Unclassified 965
847 Ga0395901_1876385 3300038443 Unclassified 547
848 Ga0451855_1685400 3300041511 Bacteria 650
849 Ga0439464_0000674 3300042439 Bacteria 7353
850 Ga0466965_0306418 3300044683 Unclassified 863
851 Ga0466961_0577514 3300044693 Bacteria 676
852 Ga0466963_0002161 3300044694 Bacteria 10866
853 Ga0466963_0002953 3300044694 Bacteria 9608
854 Ga0466963_0078078 3300044694 Bacteria 2238
855 Ga0466963_0144024 3300044694 Bacteria 1652
856 Ga0466963_0180407 3300044694 Bacteria 1474
857 Ga0466963_0245265 3300044694 Unclassified 1257
858 Ga0466963_0308765 3300044694 Bacteria 1112
859 Ga0466963_0438438 3300044694 Bacteria 921
860 Ga0466963_0536849 3300044694 Bacteria 826
861 Ga0466964_0871166 3300044706 Unclassified 513
862 Ga0466971_0111804 3300044719 Bacteria 1261
863 Ga0466970_0049888 3300044765 Bacteria 2232
864 Ga0466957_0019839 3300044842 Bacteria 3957
865 Ga0466957_0035844 3300044842 Bacteria 2978
866 Ga0466957_0489150 3300044842 Unclassified 852
867 Ga0466957_0519122 3300044842 Unclassified 827
868 Ga0466957_1261126 3300044842 Unclassified 536
869 Ga0466960_0435484 3300044901 Unclassified 760
870 Ga0466959_0052591 3300045049 Bacteria 2982
871 Ga0466959_0324334 3300045049 Unclassified 1052
872 Ga0466958_0141356 3300045836 Unclassified 1515
873 Ga0466967_0020400 3300045976 Bacteria 5356
874 Ga0466967_0029143 3300045976 Bacteria 4616
875 Ga0466967_0037978 3300045976 Bacteria 4127
876 Ga0466967_0045428 3300045976 Bacteria 3816
877 Ga0466967_0050943 3300045976 Bacteria 3626
878 Ga0466967_0076801 3300045976 Bacteria 3005
879 Ga0466967_0099774 3300045976 Bacteria 2652
880 Ga0466967_0139429 3300045976 Bacteria 2257
881 Ga0466967_0283333 3300045976 Bacteria 1590
882 Ga0466967_0368833 3300045976 Bacteria 1392
883 Ga0466967_0519627 3300045976 Bacteria 1170
884 Ga0466967_0625859 3300045976 Bacteria 1063
885 Ga0466967_0737680 3300045976 Bacteria 976
886 Ga0466967_0796071 3300045976 Bacteria 938
887 Ga0466967_0944532 3300045976 Unclassified 858
888 Ga0466967_0947702 3300045976 Bacteria 856
889 Ga0495598_0011985 3300046537 Bacteria 2114
890 Ga0495621_0000006 3300046539 Bacteria 44306
891 Ga0495633_0091937 3300046558 Bacteria 1410
892 Ga0495669_0022152 3300046684 Bacteria 2760
893 Ga0495669_0215423 3300046684 Bacteria 920
894 Ga0495669_0243948 3300046684 Bacteria 862
895 Ga0495670_0000238 3300046691 Bacteria 25286
896 Ga0495677_0368719 3300047445 Bacteria 567
897 Ga0495602_0057394 3300048088 Bacteria 3415
898 Ga0496100_0867835 3300048903 Unclassified 708
899 Ga0496102_0520496 3300048905 Bacteria 1112
900 Ga0496102_0806018 3300048905 Bacteria 861
901 Ga0496103_0066322 3300048906 Bacteria 2253
902 Ga0496103_0067421 3300048906 Bacteria 2235
903 Ga0496105_0256588 3300048908 Bacteria 1415
904 Ga0496106_0266612 3300048909 Unclassified 1371
905 Ga0496107_0032199 3300048910 Bacteria 3746
906 Ga0496107_0168768 3300048910 Bacteria 1623
907 Ga0496108_0004323 3300048911 Bacteria 11421
908 Ga0496109_0148582 3300048912 Unclassified 2193
909 Ga0496110_0018857 3300048913 Bacteria 5795
910 Ga0496110_1124815 3300048913 Unclassified 694
911 Ga0496111_0460234 3300048914 Unclassified 938
912 Ga0496112_0016189 3300048915 Bacteria 6977
913 Ga0496112_0309916 3300048915 Bacteria 1524
914 Ga0496112_0797084 3300048915 Unclassified 870
915 Ga0496113_1339998 3300048916 Unclassified 556
916 Ga0501070_0737083 3300049586 Bacteria 777
917 Ga0501071_0668488 3300049587 Bacteria 799
918 Ga0501074_0115947 3300049590 Bacteria 1916
919 Ga0501079_1330750 3300049741 Unclassified 565
920 Ga0501080_0023202 3300049742 Bacteria 5754
921 Ga0501080_0112494 3300049742 Bacteria 2524
922 nmdc:mga0rr50_286977_c1 3300050513 Unclassified 1374
923 Ga0587084_014175 3300059477 Unclassified 1107
924 Ga0587084_017887 3300059477 Unclassified 1028
925 Ga0587084_019545 3300059477 Bacteria 999
926 Ga0587084_043786 3300059477 Bacteria 770
927 Ga0587066_023228 3300059490 Bacteria 1045
928 Ga0587066_027294 3300059490 Bacteria 992
929 Ga0587066_034196 3300059490 Bacteria 924
930 Ga0587066_139051 3300059490 Unclassified 591
931 Ga0587070_018388 3300059491 Unclassified 1145
932 Ga0587073_0029922 3300059492 Unclassified 1117
933 Ga0587073_0041186 3300059492 Bacteria 1007
934 Ga0587073_0248447 3300059492 Unclassified 557
935 Ga0587077_034230 3300059493 Bacteria 986
936 Ga0587077_045904 3300059493 Bacteria 896
937 Ga0587080_021155 3300059503 Bacteria 1068
938 Ga0587080_027021 3300059503 Bacteria 978
939 Ga0587080_034007 3300059503 Bacteria 901
940 Ga0587082_034001 3300059504 Bacteria 903
941 Ga0587082_035086 3300059504 Bacteria 894
942 Ga0587082_036180 3300059504 Unclassified 884
943 Ga0587082_139513 3300059504 Unclassified 564
944 Ga0587083_0029666 3300059505 Bacteria 1079
945 Ga0587083_0050676 3300059505 Bacteria 904
946 Ga0587083_0053251 3300059505 Bacteria 889
947 Ga0587085_006090 3300059506 Bacteria 1452
948 Ga0587085_024211 3300059506 Bacteria 950
949 Ga0587086_014946 3300059507 Bacteria 996
950 Ga0587086_020521 3300059507 Bacteria 898
951 Ga0587088_005461 3300059508 Bacteria 1673
952 Ga0587088_028967 3300059508 Bacteria 978
953 Ga0587088_033577 3300059508 Bacteria 931
954 Ga0587089_020133 3300059509 Unclassified 917
955 Ga0587089_051640 3300059509 Unclassified 661
956 Ga0587090_015200 3300059510 Unclassified 1135
957 Ga0587090_018489 3300059510 Bacteria 1065
958 Ga0587090_030190 3300059510 Bacteria 902
959 Ga0587090_037292 3300059510 Bacteria 841
960 Ga0587091_017818 3300059511 Unclassified 1201
961 Ga0587091_024021 3300059511 Bacteria 1090
962 Ga0587091_042426 3300059511 Bacteria 903
963 Ga0587094_014432 3300059513 Unclassified 1079
964 Ga0587094_018969 3300059513 Bacteria 983
965 Ga0587095_005087 3300059514 Bacteria 984
966 Ga0587095_006724 3300059514 Bacteria 899
967 Ga0587074_03528 3300059602 Unclassified 555
968 Ga0587106_015710 3300059605 Bacteria 1061
969 Ga0587106_026336 3300059605 Bacteria 903
970 Ga0587106_110278 3300059605 Unclassified 572
971 Ga0587099_010211 3300059622 Unclassified 934
972 Ga0587101_016965 3300059623 Bacteria 1004
973 Ga0587101_019836 3300059623 Bacteria 957
974 Ga0587109_038372 3300059624 Unclassified 940
975 Ga0587113_009418 3300059625 Bacteria 885
976 Ga0587128_020109 3300059630 Bacteria 1017
977 Ga0587128_022297 3300059630 Bacteria 984
978 Ga0587128_027758 3300059630 Unclassified 917
979 Ga0587130_009408 3300059631 Bacteria 941
980 Ga0587062_022745 3300059639 Bacteria 903
981 Ga0587067_024876 3300059640 Unclassified 1061
982 Ga0587067_038826 3300059640 Bacteria 916
983 Ga0587068_031180 3300059641 Bacteria 925
984 Ga0587068_033680 3300059641 Bacteria 900
985 Ga0587069_019882 3300059642 Bacteria 997
986 Ga0587069_030174 3300059642 Bacteria 872
987 Ga0587069_124508 3300059642 Unclassified 550
988 Ga0587072_031365 3300059643 Bacteria 994
989 Ga0587072_038769 3300059643 Bacteria 918
990 Ga0587075_012011 3300059644 Bacteria 1170
991 Ga0587075_013438 3300059644 Unclassified 1126
992 Ga0587075_016342 3300059644 Bacteria 1054
993 Ga0587075_026979 3300059644 Bacteria 892
994 Ga0587075_027629 3300059644 Bacteria 885
995 Ga0587076_021445 3300059645 Bacteria 1070
996 Ga0587076_035552 3300059645 Bacteria 906
997 Ga0587076_036615 3300059645 Bacteria 898
998 Ga0587078_001873 3300059646 Bacteria 1964
999 Ga0587078_011898 3300059646 Bacteria 1016
1000 Ga0587078_012899 3300059646 Bacteria 984
1001 Ga0587079_026649 3300059647 Unclassified 1082
1002 Ga0587079_032180 3300059647 Bacteria 1014
1003 Ga0587079_063490 3300059647 Unclassified 806
1004 Ga0587079_065604 3300059647 Unclassified 797
1005 Ga0587102_007703 3300059649 Bacteria 1008
1006 Ga0587102_023221 3300059649 Bacteria 715
1007 Ga0587107_008996 3300059652 Unclassified 1168
1008 Ga0587107_017830 3300059652 Bacteria 955
1009 Ga0587107_017898 3300059652 Bacteria 953
1010 Ga0587119_011274 3300059658 Bacteria 1027
1011 Ga0587119_015410 3300059658 Bacteria 926
1012 Ga0587071_027880 3300060344 Unclassified 1072
1013 Ga0587071_028594 3300060344 Unclassified 1062
1014 Ga0587071_030866 3300060344 Bacteria 1031
1015 Ga0587071_040026 3300060344 Bacteria 936
1016 Ga0587111_0052710 3300060346 Bacteria 903
1017 Ga0587111_0088722 3300060346 Unclassified 751
1018 Ga0466962_0115600 3300061719 Unclassified 1293
1019 Ga0587089_021695
1020 JGI24740J21852_10017128
1021 JGI24739J22299_10005147
1022 JGI24737J22298_10001371
1023 JGI24737J22298_10001739
1024 JGI24737J22298_10010090
1025 JGI24737J22298_10115525
1026 JGI24743J22301_10013607
1027 JGI24743J22301_10061766
1028 JGI24743J22301_10083134
1029 JGI24735J21928_10003163
1030 JGI24735J21928_10004503
1031 JGI24735J21928_10133570
1032 JGI24735J21928_10139576
1033 JGI24735J21928_10140301
1034 JGI24738J21930_10000372
1035 JGI24738J21930_10001979
1036 JGI24744J21845_10008807
1037 Ga0058863_11670502
1038 Ga0058863_11870082
1039 Ga0058861_11885830
1040 Ga0058861_12010952
1041 Ga0058862_12414424
1042 Ga0065712_10247602
1043 Ga0065715_10524477
1044 Ga0070658_10000477
1045 Ga0070658_10017337
1046 Ga0070658_10020280
1047 Ga0070658_10046871
1048 Ga0070658_10060437
1049 Ga0070658_10133965
1050 Ga0070658_10203782
1051 Ga0070658_10290916
1052 Ga0070658_10527296
1053 Ga0070658_10682718
1054 Ga0070676_10001347
1055 Ga0070676_10003695
1056 Ga0070676_10068888
1057 Ga0070676_10120809
1058 Ga0070676_11095783
1059 Ga0070683_100000747
1060 Ga0070683_100005454
1061 Ga0070683_100010424
1062 Ga0070683_100174143
1063 Ga0070683_100268394
1064 Ga0070683_100480230
1065 Ga0070683_100749937
1066 Ga0070683_100988990
1067 Ga0070690_100020500
1068 Ga0070690_100062783
1069 Ga0070670_100039466
1070 Ga0070670_100379339
1071 Ga0070670_100498666
1072 Ga0070670_100564450
1073 Ga0070670_100980266
1074 Ga0070677_10041571
1075 Ga0068869_100006276
1076 Ga0068869_100095563
1077 Ga0068869_101175150
1078 Ga0070666_10002947
1079 Ga0070666_10052734
1080 Ga0070666_10070029
1081 Ga0070666_10135878
1082 Ga0070680_100147453
1083 Ga0070680_100214594
1084 Ga0070680_100739970
1085 Ga0070680_101013615
1086 Ga0070682_100001753
1087 Ga0070682_100043356
1088 Ga0070682_100072790
1089 Ga0070682_101568571
1090 Ga0068868_100044049
1091 Ga0068868_100196288
1092 Ga0068868_100463282
1093 Ga0068868_100537440
1094 Ga0068868_101062679
1095 Ga0070660_100000425
1096 Ga0070660_100003141
1097 Ga0070660_100240795
1098 Ga0070660_100303797
1099 Ga0070660_100470796
1100 Ga0070660_100474837
1101 Ga0070660_101008537
1102 Ga0070660_101219972
1103 Ga0070689_100004740
1104 Ga0070691_10035664
1105 Ga0070687_100212620
1106 Ga0070687_100391664
1107 Ga0070661_100000552
1108 Ga0070661_100001960
1109 Ga0070661_100002092
1110 Ga0070661_100008264
1111 Ga0070661_100036793
1112 Ga0070661_100044834
1113 Ga0070661_100133827
1114 Ga0070661_100182595
1115 Ga0070661_100584815
1116 Ga0070661_101227442
1117 Ga0070661_101458345
1118 Ga0070692_10034895
1119 Ga0070692_10119051
1120 Ga0070668_100001719
1121 Ga0070668_100022957
1122 Ga0070669_100021055
1123 Ga0070669_100614306
1124 Ga0070669_100666619
1125 Ga0070675_100301932
1126 Ga0070671_100012445
1127 Ga0070671_100033760
1128 Ga0070671_100034275
1129 Ga0070671_100054845
1130 Ga0070671_100121365
1131 Ga0070671_100126515
1132 Ga0070674_100036573
1133 Ga0070674_100057775
1134 Ga0070673_100001046
1135 Ga0070673_100001556
1136 Ga0070673_100133524
1137 Ga0070673_100178351
1138 Ga0070673_100543444
1139 Ga0070673_100996216
1140 Ga0070659_100000065
1141 Ga0070659_100011551
1142 Ga0070659_100013967
1143 Ga0070659_100016237
1144 Ga0070659_100040228
1145 Ga0070659_100041644
1146 Ga0070659_100068005
1147 Ga0070659_100089596
1148 Ga0070659_100140975
1149 Ga0070659_100257942
1150 Ga0070659_100603853
1151 Ga0070659_101099487
1152 Ga0070659_101117178
1153 Ga0070659_101982550
1154 Ga0070667_100008194
1155 Ga0070667_100011257
1156 Ga0070667_100020823
1157 Ga0070667_100024205
1158 Ga0070667_100032912
1159 Ga0070667_100086776
1160 Ga0070667_100228041
1161 Ga0070667_100263961
1162 Ga0070667_100383781
1163 Ga0070667_100385592
1164 Ga0070709_10770043
1165 Ga0070714_100089684
1166 Ga0070714_100956649
1167 Ga0070713_100347612
1168 Ga0070713_102240953
1169 Ga0070663_100000647
1170 Ga0070663_100001839
1171 Ga0070663_100027782
1172 Ga0070663_100126737
1173 Ga0070663_100131939
1174 Ga0070663_100161020
1175 Ga0070663_100225129
1176 Ga0070663_100242476
1177 Ga0070663_100905861
1178 Ga0070663_101033811
1179 Ga0070663_101141897
1180 Ga0070678_100074997
1181 Ga0070678_100098389
1182 Ga0070678_100724892
1183 Ga0070662_100000010
1184 Ga0070662_100000323
1185 Ga0070662_100034343
1186 Ga0070662_100103504
1187 Ga0070662_100168055
1188 Ga0070662_100180546
1189 Ga0070662_100211513
1190 Ga0070662_100287009
1191 Ga0070662_100543773
1192 Ga0070662_101383194
1193 Ga0070681_10013516
1194 Ga0070681_10152303
1195 Ga0070681_10257261
1196 Ga0068867_100004677
1197 Ga0068867_100013102
1198 Ga0068867_100278207
1199 Ga0068867_100301265
1200 Ga0068867_100520616
1201 Ga0068867_101441810
1202 Ga0070685_10239772
1203 Ga0070679_100014856
1204 Ga0070679_100128950
1205 Ga0070679_100181220
1206 Ga0070679_100398756
1207 Ga0070679_100526550
1208 Ga0070679_100946217
1209 Ga0070679_101329082
1210 Ga0070679_101519181
1211 Ga0070679_102074640
1212 Ga0070684_100029987
1213 Ga0070684_100094566
1214 Ga0070684_100121740
1215 Ga0070684_100541159
1216 Ga0070684_102071085
1217 Ga0068853_100000067
1218 Ga0068853_100011651
1219 Ga0068853_100025346
1220 Ga0068853_100030531
1221 Ga0068853_100178754
1222 Ga0068853_100195932
1223 Ga0068853_100409380
1224 Ga0070672_100023632
1225 Ga0070672_100048432
1226 Ga0070672_100095965
1227 Ga0070686_100805827
1228 Ga0070696_100089379
1229 Ga0070696_100619486
1230 Ga0070696_100815875
1231 Ga0070693_100000343
1232 Ga0070693_100012856
1233 Ga0070693_100015026
1234 Ga0070693_100034700
1235 Ga0070693_100068659
1236 Ga0070693_100076941
1237 Ga0070665_100013969
1238 Ga0070665_100100909
1239 Ga0070665_100119667
1240 Ga0070665_100453511
1241 Ga0070665_100516987
1242 Ga0068855_100017249
1243 Ga0068855_100018104
1244 Ga0068855_100066116
1245 Ga0068855_100079415
1246 Ga0068855_100109434
1247 Ga0068855_100295644
1248 Ga0068855_100558573
1249 Ga0068855_100751142
1250 Ga0068855_101023477
1251 Ga0070664_100000228
1252 Ga0070664_100002696
1253 Ga0070664_100006881
1254 Ga0070664_100009565
1255 Ga0070664_100059968
1256 Ga0070664_100071624
1257 Ga0070664_100088394
1258 Ga0070664_100276125
1259 Ga0070664_100529306
1260 Ga0070664_100578245
1261 Ga0070664_100681133
1262 Ga0070664_100862659
1263 Ga0070664_100962590
1264 Ga0070664_100977906
1265 Ga0070664_102183787
1266 Ga0068857_100005960
1267 Ga0068857_100018518
1268 Ga0068857_100026322
1269 Ga0068857_100208346
1270 Ga0068857_100354085
1271 Ga0068857_100380990
1272 Ga0068857_100413628
1273 Ga0068857_100561577
1274 Ga0068857_100773393
1275 Ga0068857_102154810
1276 Ga0068854_100001913
1277 Ga0068854_100006418
1278 Ga0068854_100011321
1279 Ga0068854_100025191
1280 Ga0068854_100083818
1281 Ga0068854_100411489
1282 Ga0068856_100000101
1283 Ga0068856_100023316
1284 Ga0068856_100061342
1285 Ga0068856_100079964
1286 Ga0068856_100153835
1287 Ga0068856_100334692
1288 Ga0068856_100391785
1289 Ga0068856_100689227
1290 Ga0070702_100377282
1291 Ga0068852_100000846
1292 Ga0068852_100001433
1293 Ga0068852_100003781
1294 Ga0068852_100013090
1295 Ga0068852_100023726
1296 Ga0068852_100087984
1297 Ga0068852_100093334
1298 Ga0068852_100094713
1299 Ga0068852_100437703
1300 Ga0068852_102470375
1301 Ga0068859_100048611
1302 Ga0068859_100054434
1303 Ga0068859_100092224
1304 Ga0068859_100379073
1305 Ga0068859_100904590
1306 Ga0068864_100000222
1307 Ga0068864_100007380
1308 Ga0068864_100089427
1309 Ga0068864_100180268
1310 Ga0068861_100169755
1311 Ga0068861_100329298
1312 Ga0068861_100430982
1313 Ga0068861_100485890
1314 Ga0068851_10032858
1315 Ga0068851_10047700
1316 Ga0068851_10051292
1317 Ga0068851_10154026
1318 Ga0068851_10167365
1319 Ga0068870_10103315
1320 Ga0068863_100002567
1321 Ga0068863_100034901
1322 Ga0068863_100116639
1323 Ga0068863_100360451
1324 Ga0068863_100770831
1325 Ga0068858_100003320
1326 Ga0068858_100007141
1327 Ga0068860_100006803
1328 Ga0068860_100061591
1329 Ga0068860_100073377
1330 Ga0068860_100245076
1331 Ga0068862_100091796
1332 Ga0068862_100253229
1333 Ga0097621_100051529
1334 Ga0097621_100357207
1335 Ga0097621_100493047
1336 Ga0097621_100561732
1337 Ga0097621_101019463
1338 Ga0097621_101092693
1339 Ga0068871_100011090
1340 Ga0068871_100379801
1341 Ga0068871_100623150
1342 Ga0068871_100662228
1343 Ga0068871_101378884
1344 Ga0068865_100006056
1345 Ga0068865_100034925
1346 Ga0097620_100048612
1347 Ga0097620_100054439
1348 Ga0097620_100092228
1349 Ga0097620_100379074
1350 Ga0097620_100904739
1351 Ga0075435_100734814
1352 Ga0105240_10087961
1353 Ga0105245_10006125
1354 Ga0105241_10032907
1355 Ga0105241_10130207
1356 Ga0105241_10157917
1357 Ga0105241_10342051
1358 Ga0105241_10702355
1359 Ga0105242_10185671
1360 Ga0105248_10001119
1361 Ga0105248_10054729
1362 Ga0105248_10228619
1363 Ga0105248_10463115
1364 Ga0105248_10829284
1365 Ga0105248_11767199
1366 Ga0105248_12304511
1367 Ga0105237_10006758
1368 Ga0105238_10004367
1369 Ga0105238_10051275
1370 Ga0105238_10063618
1371 Ga0105238_10111637
1372 Ga0105238_10327601
1373 Ga0105238_12295790
1374 Ga0105249_10320235
1375 Ga0105249_10935063
1376 Ga0105239_10054356
1377 Ga0105239_10261369
1378 Ga0105246_10008301
1379 Ga0105246_10278750
1380 Ga0157373_10009790
1381 Ga0157373_10031339
1382 Ga0157373_10059487
1383 Ga0157373_10090355
1384 Ga0157373_10092027
1385 Ga0157373_10092672
1386 Ga0157373_10102375
1387 Ga0157373_10193781
1388 Ga0157373_10272822
1389 Ga0157373_10301096
1390 Ga0157373_10463145
1391 Ga0157371_10003821
1392 Ga0157371_10025025
1393 Ga0157371_10026453
1394 Ga0157371_10075155
1395 Ga0157371_10092512
1396 Ga0157371_10128560
1397 Ga0157371_10870781
1398 Ga0157371_10939038
1399 Ga0157371_11244993
1400 Ga0157370_10059532
1401 Ga0157370_10741220
1402 Ga0157370_10929875
1403 Ga0157369_10003181
1404 Ga0157369_10032210
1405 Ga0157369_10202481
1406 Ga0157369_10259977
1407 Ga0157369_10733218
1408 Ga0157369_10922308
1409 Ga0157374_10303006
1410 Ga0157374_10480692
1411 Ga0157374_10519081
1412 Ga0157378_10006532
1413 Ga0157378_10007074
1414 Ga0157378_10344935
1415 Ga0163162_10032625
1416 Ga0163162_10438663
1417 Ga0157372_10011784
1418 Ga0157372_10035809
1419 Ga0157372_10045014
1420 Ga0157372_10046828
1421 Ga0157372_10359554
1422 Ga0157372_11666553
1423 Ga0157372_12909297
1424 Ga0157375_10007221
1425 Ga0157375_10024264
1426 Ga0157375_10271200
1427 Ga0163163_10019125
1428 Ga0157377_10204425
1429 Ga0157379_10165064
1430 Ga0157379_10182441
1431 Ga0157379_11204648
1432 Ga0157376_10684688
1433 Ga0163161_10485228
1434 Ga0197907_10034936
1435 Ga0197907_11002332
1436 Ga0206356_10307274
1437 Ga0206356_11292785
1438 Ga0206356_11311979
1439 Ga0206356_11638823
1440 Ga0206352_10699940
1441 Ga0206354_10948750
1442 Ga0206353_10732796
1443 Ga0224712_10171006
1444 Ga0224712_10205286
1445 Ga0207673_1020061
1446 Ga0207697_10000158
1447 Ga0207697_10022280
1448 Ga0207697_10028059
1449 Ga0207697_10112020
1450 Ga0207656_10003880
1451 Ga0207656_10042249
1452 Ga0207656_10061879
1453 Ga0207656_10461209
1454 Ga0207713_1039137
1455 Ga0207682_10035101
1456 Ga0207642_10364144
1457 Ga0207688_10007071
1458 Ga0207688_10126968
1459 Ga0207680_10517167
1460 Ga0207647_10000832
1461 Ga0207647_10004000
1462 Ga0207647_10008390
1463 Ga0207647_10061274
1464 Ga0207647_10064373
1465 Ga0207647_10079630
1466 Ga0207647_10464687
1467 Ga0207645_10003931
1468 Ga0207645_10004831
1469 Ga0207645_10008901
1470 Ga0207645_10063906
1471 Ga0207645_10112926
1472 Ga0207643_10054699
1473 Ga0207643_10173377
1474 Ga0207643_10254530
1475 Ga0207705_10000113
1476 Ga0207705_10010345
1477 Ga0207705_10038951
1478 Ga0207705_10059966
1479 Ga0207705_10060833
1480 Ga0207705_10065521
1481 Ga0207705_10065899
1482 Ga0207705_10077431
1483 Ga0207705_10186859
1484 Ga0207705_10261160
1485 Ga0207705_11141639
1486 Ga0207654_10106813
1487 Ga0207654_10178036
1488 Ga0207707_10008907
1489 Ga0207707_10453823
1490 Ga0207707_10495635
1491 Ga0207695_10622836
1492 Ga0207671_10017531
1493 Ga0207693_10016003
1494 Ga0207660_10007589
1495 Ga0207660_10034958
1496 Ga0207660_10440534
1497 Ga0207660_10535163
1498 Ga0207660_10665417
1499 Ga0207660_10682176
1500 Ga0207660_11701896
1501 Ga0207662_10030474
1502 Ga0207662_10077107
1503 Ga0207662_10170760
1504 Ga0207657_10000026
1505 Ga0207657_10002103
1506 Ga0207657_10005900
1507 Ga0207657_10007800
1508 Ga0207657_10038093
1509 Ga0207657_10050216
1510 Ga0207657_10093297
1511 Ga0207657_10167001
1512 Ga0207657_10281976
1513 Ga0207657_10862110
1514 Ga0207649_10000516
1515 Ga0207649_10002740
1516 Ga0207649_10032422
1517 Ga0207649_10038842
1518 Ga0207649_10070046
1519 Ga0207649_10085352
1520 Ga0207649_10183527
1521 Ga0207649_10517552
1522 Ga0207652_10026485
1523 Ga0207652_10095828
1524 Ga0207652_10220094
1525 Ga0207652_10298249
1526 Ga0207652_10338914
1527 Ga0207652_10437556
1528 Ga0207652_10487035
1529 Ga0207652_10825776
1530 Ga0207652_11286989
1531 Ga0207681_10047787
1532 Ga0207681_10056834
1533 Ga0207681_10277952
1534 Ga0207694_10000776
1535 Ga0207694_10005699
1536 Ga0207694_10185516
1537 Ga0207694_10334497
1538 Ga0207694_10921080
1539 Ga0207694_11500997
1540 Ga0207650_10028115
1541 Ga0207650_10142089
1542 Ga0207659_10835872
1543 Ga0207687_10048079
1544 Ga0207687_10062974
1545 Ga0207664_10146782
1546 Ga0207664_10161196
1547 Ga0207664_10251689
1548 Ga0207664_10374847
1549 Ga0207664_10801546
1550 Ga0207644_10022380
1551 Ga0207644_10033303
1552 Ga0207644_10033934
1553 Ga0207644_10209882
1554 Ga0207644_10227290
1555 Ga0207690_10000649
1556 Ga0207690_10002369
1557 Ga0207690_10002565
1558 Ga0207690_10012713
1559 Ga0207690_10017432
1560 Ga0207690_10050183
1561 Ga0207690_10201848
1562 Ga0207690_10219429
1563 Ga0207690_10238263
1564 Ga0207690_10369349
1565 Ga0207690_10413049
1566 Ga0207690_10429139
1567 Ga0207690_10640821
1568 Ga0207690_11098335
1569 Ga0207706_10000031
1570 Ga0207706_10000829
1571 Ga0207706_10002893
1572 Ga0207706_10008630
1573 Ga0207706_10024282
1574 Ga0207706_10038293
1575 Ga0207706_10055308
1576 Ga0207706_10081488
1577 Ga0207706_10101934
1578 Ga0207706_10158840
1579 Ga0207706_10216949
1580 Ga0207706_10260604
1581 Ga0207706_10676408
1582 Ga0207706_10963687
1583 Ga0207686_10362636
1584 Ga0207709_10681923
1585 Ga0207670_10044294
1586 Ga0207669_10108579
1587 Ga0207669_10828103
1588 Ga0207704_10060374
1589 Ga0207704_11009349
1590 Ga0207704_11083528
1591 Ga0207691_10003632
1592 Ga0207691_10061499
1593 Ga0207691_10134809
1594 Ga0207691_10144668
1595 Ga0207711_10000446
1596 Ga0207711_10002065
1597 Ga0207711_10007845
1598 Ga0207711_10117724
1599 Ga0207711_10226883
1600 Ga0207711_10287123
1601 Ga0207711_10733378
1602 Ga0207711_11023149
1603 Ga0207689_10000017
1604 Ga0207689_10025109
1605 Ga0207689_10037964
1606 Ga0207689_10066588
1607 Ga0207689_10426773
1608 Ga0207661_10013965
1609 Ga0207661_10030599
1610 Ga0207661_10031712
1611 Ga0207661_10235922
1612 Ga0207661_10783699
1613 Ga0207661_11073666
1614 Ga0207679_10000236
1615 Ga0207679_10008515
1616 Ga0207679_10032946
1617 Ga0207679_10088718
1618 Ga0207679_10100327
1619 Ga0207679_10118558
1620 Ga0207679_10134912
1621 Ga0207679_10175160
1622 Ga0207679_10201523
1623 Ga0207679_10354516
1624 Ga0207679_10531731
1625 Ga0207679_11442595
1626 Ga0207679_12014802
1627 Ga0207667_10001718
1628 Ga0207667_10081840
1629 Ga0207667_10132858
1630 Ga0207667_10720816
1631 Ga0207667_11750098
1632 Ga0207651_10029701
1633 Ga0207651_10116028
1634 Ga0207651_10432706
1635 Ga0207651_10538401
1636 Ga0207651_11127555
1637 Ga0207651_11547410
1638 Ga0207651_12017645
1639 Ga0207712_10079041
1640 Ga0207668_10002157
1641 Ga0207668_10073156
1642 Ga0207640_10007503
1643 Ga0207640_10010090
1644 Ga0207640_10032101
1645 Ga0207640_10034294
1646 Ga0207640_10107025
1647 Ga0207640_10114939
1648 Ga0207640_10128956
1649 Ga0207640_11504686
1650 Ga0207658_10017651
1651 Ga0207658_10018455
1652 Ga0207658_10027437
1653 Ga0207658_10036587
1654 Ga0207658_10072042
1655 Ga0207658_10078804
1656 Ga0207658_10080766
1657 Ga0207658_10094610
1658 Ga0207677_10102695
1659 Ga0207677_10298705
1660 Ga0207677_10765304
1661 Ga0207677_10815524
1662 Ga0207703_10025106
1663 Ga0207703_10065655
1664 Ga0207703_10088896
1665 Ga0207703_10135939
1666 Ga0207639_10005817
1667 Ga0207639_10070955
1668 Ga0207639_10095747
1669 Ga0207639_10108892
1670 Ga0207639_10205373
1671 Ga0207639_10385639
1672 Ga0207639_10770962
1673 Ga0207678_10002668
1674 Ga0207678_10010119
1675 Ga0207678_10010859
1676 Ga0207678_10012250
1677 Ga0207678_10023738
1678 Ga0207678_10138368
1679 Ga0207678_10154857
1680 Ga0207678_10176738
1681 Ga0207678_10209384
1682 Ga0207678_10300599
1683 Ga0207678_10502746
1684 Ga0207678_10586127
1685 Ga0207708_10326846
1686 Ga0207708_10327175
1687 Ga0207702_10010631
1688 Ga0207702_10015012
1689 Ga0207702_10067734
1690 Ga0207702_10095158
1691 Ga0207702_10164850
1692 Ga0207702_10208008
1693 Ga0207702_10600741
1694 Ga0207702_10839137
1695 Ga0207641_10011385
1696 Ga0207641_10019349
1697 Ga0207641_10033916
1698 Ga0207641_10337044
1699 Ga0207641_10433036
1700 Ga0207641_11196227
1701 Ga0207648_10002318
1702 Ga0207648_10003142
1703 Ga0207648_10006581
1704 Ga0207648_10116265
1705 Ga0207676_10002072
1706 Ga0207676_10008483
1707 Ga0207676_10009522
1708 Ga0207676_10031676
1709 Ga0207676_10389840
1710 Ga0207674_10000527
1711 Ga0207674_10002277
1712 Ga0207674_10003088
1713 Ga0207674_10011531
1714 Ga0207674_10024167
1715 Ga0207674_10030316
1716 Ga0207674_10036857
1717 Ga0207674_10049289
1718 Ga0207674_10111820
1719 Ga0207674_10205136
1720 Ga0207674_10539760
1721 Ga0207675_100165697
1722 Ga0207675_100242894
1723 Ga0207675_100296014
1724 Ga0207675_100578154
1725 Ga0207675_100678760
1726 Ga0207683_10014943
1727 Ga0207683_10625691
1728 Ga0207698_10000618
1729 Ga0207698_10001533
1730 Ga0207698_10007701
1731 Ga0207698_10009367
1732 Ga0207698_10046260
1733 Ga0207698_10280976
1734 Ga0207698_10361244
1735 Ga0207698_10379957
1736 Ga0207698_10397596
1737 Ga0207698_10727625
1738 Ga0268266_10005677
1739 Ga0268266_10022882
1740 Ga0268266_10422373
1741 Ga0268265_10003245
1742 Ga0268265_10059407
1743 Ga0268265_10199537
1744 Ga0268265_11013896
1745 Ga0268264_10002543
1746 Ga0268264_10035529
1747 Ga0268264_10073947
1748 Ga0268264_10157795
1749 Ga0268264_10573422
1750 Ga0307513_10390646
1751 Ga0307408_100021556
1752 Ga0307408_101050659
1753 Ga0307408_101720449
1754 Ga0307405_10457021
1755 Ga0307405_10586539
1756 Ga0307405_10881887
1757 Ga0307413_10267439
1758 Ga0307413_10487033
1759 Ga0307410_10107788
1760 Ga0307410_10135140
1761 Ga0307410_10342574
1762 Ga0307410_10408551
1763 Ga0307410_11529900
1764 Ga0307406_10006893
1765 Ga0307406_10094729
1766 Ga0307406_10183254
1767 Ga0307406_10304271
1768 Ga0307406_11360434
1769 Ga0307407_10007704
1770 Ga0307407_10520960
1771 Ga0307412_10050121
1772 Ga0307412_10125807
1773 Ga0307412_10129002
1774 Ga0307409_100018684
1775 Ga0307409_100391047
1776 Ga0307409_100415965
1777 Ga0307409_101495403
1778 Ga0307416_100034296
1779 Ga0307416_100186537
1780 Ga0307416_100798430
1781 Ga0307416_101024117
1782 Ga0307416_101170537
1783 Ga0307416_101697613
1784 Ga0307414_12034875
1785 Ga0307411_10208232
1786 Ga0307411_10308733
1787 Ga0307411_11720663
1788 Ga0307415_100019849
1789 Ga0307415_100022433
1790 Ga0307415_100027339
1791 Ga0307415_100494859
1792 Ga0307415_100808616
1793 Ga0373930_0092002
1794 Ga0373938_0099370
1795 Ga0373949_0066931
1796 Ga0373951_0066124
1797 Ga0373923_0002141
1798 Ga0373955_0006945
1799 Ga0373961_0010280
1800 Ga0373962_0085039
1801 Ga0373933_0003124
1802 Ga0373937_0000641
1803 Ga0395899_0006584
1804 Ga0395899_0030400
1805 Ga0395899_0038361
1806 Ga0395899_0098825
1807 Ga0395899_0105236
1808 Ga0395899_0191082
1809 Ga0395899_0289732
1810 Ga0395899_0893212
1811 Ga0395900_0106528
1812 Ga0395900_0107348
1813 Ga0395900_0176876
1814 Ga0395900_0177213
1815 Ga0395900_0245885
1816 Ga0395900_0254630
1817 Ga0395900_0262855
1818 Ga0395900_0355503
1819 Ga0395900_0442792
1820 Ga0395900_0480745
1821 Ga0395900_0582697
1822 Ga0395900_0591238
1823 Ga0395900_0607838
1824 Ga0395900_0880782
1825 Ga0395900_1415124
1826 Ga0395900_1515835
1827 Ga0395900_1551262
1828 Ga0395898_0018087
1829 Ga0395898_0197787
1830 Ga0395898_0242749
1831 Ga0395898_0253928
1832 Ga0395898_0263788
1833 Ga0395905_0000092
1834 Ga0395905_0008699
1835 Ga0395905_0017027
1836 Ga0395905_0021465
1837 Ga0395905_0033987
1838 Ga0395905_0070313
1839 Ga0395905_0088340
1840 Ga0395905_0141907
1841 Ga0395905_0179826
1842 Ga0395905_0200560
1843 Ga0395905_0226216
1844 Ga0395905_0306016
1845 Ga0395905_0552801
1846 Ga0395905_0560942
1847 Ga0395905_0645510
1848 Ga0395905_0683408
1849 Ga0395905_0727473
1850 Ga0395905_1114477
1851 Ga0395905_1438209
1852 Ga0395905_1553021
1853 Ga0395905_1568637
1854 Ga0395901_0000268
1855 Ga0395901_0037677
1856 Ga0395901_0109048
1857 Ga0395901_0117722
1858 Ga0395901_0157477
1859 Ga0395901_0201949
1860 Ga0395901_0211352
1861 Ga0395901_0229427
1862 Ga0395901_0323654
1863 Ga0395901_0590479
1864 Ga0395901_0755119
1865 Ga0395901_1876385
1866 Ga0451855_1685400
1867 Ga0439464_0000674
1868 Ga0466965_0306418
1869 Ga0466961_0577514
1870 Ga0466963_0002161
1871 Ga0466963_0002953
1872 Ga0466963_0078078
1873 Ga0466963_0144024
1874 Ga0466963_0180407
1875 Ga0466963_0245265
1876 Ga0466963_0308765
1877 Ga0466963_0438438
1878 Ga0466963_0536849
1879 Ga0466964_0871166
1880 Ga0466971_0111804
1881 Ga0466970_0049888
1882 Ga0466957_0019839
1883 Ga0466957_0035844
1884 Ga0466957_0489150
1885 Ga0466957_0519122
1886 Ga0466957_1261126
1887 Ga0466960_0435484
1888 Ga0466959_0052591
1889 Ga0466959_0324334
1890 Ga0466958_0141356
1891 Ga0466967_0020400
1892 Ga0466967_0029143
1893 Ga0466967_0037978
1894 Ga0466967_0045428
1895 Ga0466967_0050943
1896 Ga0466967_0076801
1897 Ga0466967_0099774
1898 Ga0466967_0139429
1899 Ga0466967_0283333
1900 Ga0466967_0368833
1901 Ga0466967_0519627
1902 Ga0466967_0625859
1903 Ga0466967_0737680
1904 Ga0466967_0796071
1905 Ga0466967_0944532
1906 Ga0466967_0947702
1907 Ga0495598_0011985
1908 Ga0495621_0000006
1909 Ga0495633_0091937
1910 Ga0495669_0022152
1911 Ga0495669_0215423
1912 Ga0495669_0243948
1913 Ga0495670_0000238
1914 Ga0495677_0368719
1915 Ga0495602_0057394
1916 Ga0496100_0867835
1917 Ga0496102_0520496
1918 Ga0496102_0806018
1919 Ga0496103_0066322
1920 Ga0496103_0067421
1921 Ga0496105_0256588
1922 Ga0496106_0266612
1923 Ga0496107_0032199
1924 Ga0496107_0168768
1925 Ga0496108_0004323
1926 Ga0496109_0148582
1927 Ga0496110_0018857
1928 Ga0496110_1124815
1929 Ga0496111_0460234
1930 Ga0496112_0016189
1931 Ga0496112_0309916
1932 Ga0496112_0797084
1933 Ga0496113_1339998
1934 Ga0501070_0737083
1935 Ga0501071_0668488
1936 Ga0501074_0115947
1937 Ga0501079_1330750
1938 Ga0501080_0023202
1939 Ga0501080_0112494
1940 nmdc:mga0rr50_286977_c1
1941 Ga0587084_014175
1942 Ga0587084_017887
1943 Ga0587084_019545
1944 Ga0587084_043786
1945 Ga0587066_023228
1946 Ga0587066_027294
1947 Ga0587066_034196
1948 Ga0587066_139051
1949 Ga0587070_018388
1950 Ga0587073_0029922
1951 Ga0587073_0041186
1952 Ga0587073_0248447
1953 Ga0587077_034230
1954 Ga0587077_045904
1955 Ga0587080_021155
1956 Ga0587080_027021
1957 Ga0587080_034007
1958 Ga0587082_034001
1959 Ga0587082_035086
1960 Ga0587082_036180
1961 Ga0587082_139513
1962 Ga0587083_0029666
1963 Ga0587083_0050676
1964 Ga0587083_0053251
1965 Ga0587085_006090
1966 Ga0587085_024211
1967 Ga0587086_014946
1968 Ga0587086_020521
1969 Ga0587088_005461
1970 Ga0587088_028967
1971 Ga0587088_033577
1972 Ga0587089_020133
1973 Ga0587089_051640
1974 Ga0587090_015200
1975 Ga0587090_018489
1976 Ga0587090_030190
1977 Ga0587090_037292
1978 Ga0587091_017818
1979 Ga0587091_024021
1980 Ga0587091_042426
1981 Ga0587094_014432
1982 Ga0587094_018969
1983 Ga0587095_005087
1984 Ga0587095_006724
1985 Ga0587074_03528
1986 Ga0587106_015710
1987 Ga0587106_026336
1988 Ga0587106_110278
1989 Ga0587099_010211
1990 Ga0587101_016965
1991 Ga0587101_019836
1992 Ga0587109_038372
1993 Ga0587113_009418
1994 Ga0587128_020109
1995 Ga0587128_022297
1996 Ga0587128_027758
1997 Ga0587130_009408
1998 Ga0587062_022745
1999 Ga0587067_024876
2000 Ga0587067_038826
2001 Ga0587068_031180
2002 Ga0587068_033680
2003 Ga0587069_019882
2004 Ga0587069_030174
2005 Ga0587069_124508
2006 Ga0587072_031365
2007 Ga0587072_038769
2008 Ga0587075_012011
2009 Ga0587075_013438
2010 Ga0587075_016342
2011 Ga0587075_026979
2012 Ga0587075_027629
2013 Ga0587076_021445
2014 Ga0587076_035552
2015 Ga0587076_036615
2016 Ga0587078_001873
2017 Ga0587078_011898
2018 Ga0587078_012899
2019 Ga0587079_026649
2020 Ga0587079_032180
2021 Ga0587079_063490
2022 Ga0587079_065604
2023 Ga0587102_007703
2024 Ga0587102_023221
2025 Ga0587107_008996
2026 Ga0587107_017830
2027 Ga0587107_017898
2028 Ga0587119_011274
2029 Ga0587119_015410
2030 Ga0587071_027880
2031 Ga0587071_028594
2032 Ga0587071_030866
2033 Ga0587071_040026
2034 Ga0587111_0052710
2035 Ga0587111_0088722
2036 Ga0466962_0115600

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8adc-assembly1.cif.gz_B viral tegument-like dubs 0.7687 34 61
8adc-assembly2.cif.gz_A viral tegument-like dubs 0.7541 34 62
8adb-assembly1.cif.gz_A viral tegument-like dubs 0.7535 34 67
4u3q-assembly1.cif.gz_B crystal structure of recombinant tp0435 from treponema pallidum 0.6771 34 101
6c9n-assembly1.cif.gz_A mycobacterium tuberculosis adenosine kinase bound to sangivamycin 0.6679 44 73
ID Description Score Start End Superfamily
af_A4HYS3_91_210_3.10.330.10 Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; 0.7542 92 116 3.10.330.10
af_O45110_151_229_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.6776 41 65 2.30.30.30
af_A0A2R8QJQ6_302_523_3.90.70.120 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A; 0.6615 34 65 3.90.70.120
af_A0A0R0ELK1_770_819_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.6557 35 67 2.30.30.60
af_Q2FWM2_2_319_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.6554 44 73 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A7T2GKA4-F1-model_v4 Uncharacterized protein 0.8998 30 111
AF-A0A519Q9Y9-F1-model_v4 DUF3313 domain-containing protein 0.8746 21 112
AF-A0A7H0G918-F1-model_v4 deleted 0.8704 66 130
AF-A0A158S7G9-F1-model_v4 Uncharacterized protein 0.8638 25 116
AF-A0A1H7XGQ5-F1-model_v4 Tetratricopeptide repeat-containing protein 0.8287 38 87

Map