F488335
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1018 | 273 | 2036 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300059509|Ga0587089_021695|Ga0587089_021695_308_883 |
| Length | 155 |
| Sequence | VPPVEAAGGEASRSHSDRKGLGIMKSFLVRASVGAAVAGLLPVAAVAQPWTPGSEVVGQPIQVTTNGVTNTVYLDPGGQLRILTPGGSTIPGTWTAANGQLCLAAGGPQECVPYAAPFQAGAPVTVTSSCGASESWLAQSTNAPXXXAAKSERGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 177 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 185 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 199 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 200 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 205 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 224 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 229 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300059602 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 15R_AD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89 |
| Metatranscriptomes | 11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.77 |
| Rhizosphere | 98.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0587089_021695 | 3300059509 | Bacteria | 893 |
| 2 | JGI24740J21852_10017128 | 3300001979 | Bacteria | 2598 |
| 3 | JGI24739J22299_10005147 | 3300001989 | Bacteria | 4980 |
| 4 | JGI24737J22298_10001371 | 3300001990 | Bacteria | 8641 |
| 5 | JGI24737J22298_10001739 | 3300001990 | Bacteria | 7775 |
| 6 | JGI24737J22298_10010090 | 3300001990 | Bacteria | 3128 |
| 7 | JGI24737J22298_10115525 | 3300001990 | Unclassified | 793 |
| 8 | JGI24743J22301_10013607 | 3300001991 | Bacteria | 1492 |
| 9 | JGI24743J22301_10061766 | 3300001991 | Bacteria | 773 |
| 10 | JGI24743J22301_10083134 | 3300001991 | Bacteria | 677 |
| 11 | JGI24735J21928_10003163 | 3300002067 | Bacteria | 5635 |
| 12 | JGI24735J21928_10004503 | 3300002067 | Bacteria | 4686 |
| 13 | JGI24735J21928_10133570 | 3300002067 | Unclassified | 716 |
| 14 | JGI24735J21928_10139576 | 3300002067 | Unclassified | 699 |
| 15 | JGI24735J21928_10140301 | 3300002067 | Unclassified | 697 |
| 16 | JGI24738J21930_10000372 | 3300002075 | Bacteria | 12499 |
| 17 | JGI24738J21930_10001979 | 3300002075 | Bacteria | 5510 |
| 18 | JGI24744J21845_10008807 | 3300002077 | Bacteria | 2074 |
| 19 | Ga0058863_11670502 | 3300004799 | Bacteria | 655 |
| 20 | Ga0058863_11870082 | 3300004799 | Unclassified | 797 |
| 21 | Ga0058861_11885830 | 3300004800 | Unclassified | 705 |
| 22 | Ga0058861_12010952 | 3300004800 | Bacteria | 588 |
| 23 | Ga0058862_12414424 | 3300004803 | Unclassified | 531 |
| 24 | Ga0065712_10247602 | 3300005290 | Bacteria | 939 |
| 25 | Ga0065715_10524477 | 3300005293 | Bacteria | 761 |
| 26 | Ga0070658_10000477 | 3300005327 | Bacteria | 34731 |
| 27 | Ga0070658_10017337 | 3300005327 | Bacteria | 5763 |
| 28 | Ga0070658_10020280 | 3300005327 | Bacteria | 5326 |
| 29 | Ga0070658_10046871 | 3300005327 | Bacteria | 3497 |
| 30 | Ga0070658_10060437 | 3300005327 | Bacteria | 3086 |
| 31 | Ga0070658_10133965 | 3300005327 | Bacteria | 2066 |
| 32 | Ga0070658_10203782 | 3300005327 | Bacteria | 1670 |
| 33 | Ga0070658_10290916 | 3300005327 | Bacteria | 1392 |
| 34 | Ga0070658_10527296 | 3300005327 | Unclassified | 1021 |
| 35 | Ga0070658_10682718 | 3300005327 | Unclassified | 891 |
| 36 | Ga0070676_10001347 | 3300005328 | Bacteria | 12342 |
| 37 | Ga0070676_10003695 | 3300005328 | Bacteria | 8018 |
| 38 | Ga0070676_10068888 | 3300005328 | Bacteria | 2119 |
| 39 | Ga0070676_10120809 | 3300005328 | Bacteria | 1644 |
| 40 | Ga0070676_11095783 | 3300005328 | Bacteria | 601 |
| 41 | Ga0070683_100000747 | 3300005329 | Bacteria | 23810 |
| 42 | Ga0070683_100005454 | 3300005329 | Bacteria | 10628 |
| 43 | Ga0070683_100010424 | 3300005329 | Bacteria | 7992 |
| 44 | Ga0070683_100174143 | 3300005329 | Bacteria | 2043 |
| 45 | Ga0070683_100268394 | 3300005329 | Bacteria | 1623 |
| 46 | Ga0070683_100480230 | 3300005329 | Bacteria | 1187 |
| 47 | Ga0070683_100749937 | 3300005329 | Bacteria | 935 |
| 48 | Ga0070683_100988990 | 3300005329 | Bacteria | 807 |
| 49 | Ga0070690_100020500 | 3300005330 | Bacteria | 4028 |
| 50 | Ga0070690_100062783 | 3300005330 | Bacteria | 2396 |
| 51 | Ga0070670_100039466 | 3300005331 | Bacteria | 4060 |
| 52 | Ga0070670_100379339 | 3300005331 | Bacteria | 1245 |
| 53 | Ga0070670_100498666 | 3300005331 | Unclassified | 1082 |
| 54 | Ga0070670_100564450 | 3300005331 | Bacteria | 1016 |
| 55 | Ga0070670_100980266 | 3300005331 | Bacteria | 768 |
| 56 | Ga0070677_10041571 | 3300005333 | Bacteria | 1816 |
| 57 | Ga0068869_100006276 | 3300005334 | Bacteria | 7526 |
| 58 | Ga0068869_100095563 | 3300005334 | Bacteria | 2242 |
| 59 | Ga0068869_101175150 | 3300005334 | Unclassified | 673 |
| 60 | Ga0070666_10002947 | 3300005335 | Bacteria | 10304 |
| 61 | Ga0070666_10052734 | 3300005335 | Bacteria | 2742 |
| 62 | Ga0070666_10070029 | 3300005335 | Bacteria | 2386 |
| 63 | Ga0070666_10135878 | 3300005335 | Bacteria | 1711 |
| 64 | Ga0070680_100147453 | 3300005336 | Bacteria | 1974 |
| 65 | Ga0070680_100214594 | 3300005336 | Bacteria | 1624 |
| 66 | Ga0070680_100739970 | 3300005336 | Bacteria | 846 |
| 67 | Ga0070680_101013615 | 3300005336 | Bacteria | 717 |
| 68 | Ga0070682_100001753 | 3300005337 | Bacteria | 12079 |
| 69 | Ga0070682_100043356 | 3300005337 | Bacteria | 2781 |
| 70 | Ga0070682_100072790 | 3300005337 | Bacteria | 2203 |
| 71 | Ga0070682_101568571 | 3300005337 | Bacteria | 568 |
| 72 | Ga0068868_100044049 | 3300005338 | Bacteria | 3488 |
| 73 | Ga0068868_100196288 | 3300005338 | Unclassified | 1680 |
| 74 | Ga0068868_100463282 | 3300005338 | Unclassified | 1104 |
| 75 | Ga0068868_100537440 | 3300005338 | Bacteria | 1028 |
| 76 | Ga0068868_101062679 | 3300005338 | Unclassified | 743 |
| 77 | Ga0070660_100000425 | 3300005339 | Bacteria | 27941 |
| 78 | Ga0070660_100003141 | 3300005339 | Bacteria | 11350 |
| 79 | Ga0070660_100240795 | 3300005339 | Bacteria | 1474 |
| 80 | Ga0070660_100303797 | 3300005339 | Bacteria | 1308 |
| 81 | Ga0070660_100470796 | 3300005339 | Bacteria | 1043 |
| 82 | Ga0070660_100474837 | 3300005339 | Bacteria | 1039 |
| 83 | Ga0070660_101008537 | 3300005339 | Unclassified | 703 |
| 84 | Ga0070660_101219972 | 3300005339 | Unclassified | 638 |
| 85 | Ga0070689_100004740 | 3300005340 | Bacteria | 9229 |
| 86 | Ga0070691_10035664 | 3300005341 | Bacteria | 2342 |
| 87 | Ga0070687_100212620 | 3300005343 | Unclassified | 1179 |
| 88 | Ga0070687_100391664 | 3300005343 | Bacteria | 908 |
| 89 | Ga0070661_100000552 | 3300005344 | Bacteria | 28745 |
| 90 | Ga0070661_100001960 | 3300005344 | Bacteria | 14220 |
| 91 | Ga0070661_100002092 | 3300005344 | Bacteria | 13736 |
| 92 | Ga0070661_100008264 | 3300005344 | Bacteria | 7185 |
| 93 | Ga0070661_100036793 | 3300005344 | Bacteria | 3557 |
| 94 | Ga0070661_100044834 | 3300005344 | Bacteria | 3232 |
| 95 | Ga0070661_100133827 | 3300005344 | Bacteria | 1864 |
| 96 | Ga0070661_100182595 | 3300005344 | Bacteria | 1597 |
| 97 | Ga0070661_100584815 | 3300005344 | Bacteria | 901 |
| 98 | Ga0070661_101227442 | 3300005344 | Bacteria | 627 |
| 99 | Ga0070661_101458345 | 3300005344 | Unclassified | 576 |
| 100 | Ga0070692_10034895 | 3300005345 | Bacteria | 2544 |
| 101 | Ga0070692_10119051 | 3300005345 | Bacteria | 1470 |
| 102 | Ga0070668_100001719 | 3300005347 | Bacteria | 15902 |
| 103 | Ga0070668_100022957 | 3300005347 | Bacteria | 4717 |
| 104 | Ga0070669_100021055 | 3300005353 | Bacteria | 4659 |
| 105 | Ga0070669_100614306 | 3300005353 | Bacteria | 912 |
| 106 | Ga0070669_100666619 | 3300005353 | Bacteria | 876 |
| 107 | Ga0070675_100301932 | 3300005354 | Bacteria | 1411 |
| 108 | Ga0070671_100012445 | 3300005355 | Bacteria | 6851 |
| 109 | Ga0070671_100033760 | 3300005355 | Bacteria | 4234 |
| 110 | Ga0070671_100034275 | 3300005355 | Bacteria | 4202 |
| 111 | Ga0070671_100054845 | 3300005355 | Bacteria | 3315 |
| 112 | Ga0070671_100121365 | 3300005355 | Bacteria | 2199 |
| 113 | Ga0070671_100126515 | 3300005355 | Bacteria | 2151 |
| 114 | Ga0070674_100036573 | 3300005356 | Bacteria | 3297 |
| 115 | Ga0070674_100057775 | 3300005356 | Bacteria | 2694 |
| 116 | Ga0070673_100001046 | 3300005364 | Bacteria | 15704 |
| 117 | Ga0070673_100001556 | 3300005364 | Bacteria | 13518 |
| 118 | Ga0070673_100133524 | 3300005364 | Bacteria | 2086 |
| 119 | Ga0070673_100178351 | 3300005364 | Bacteria | 1817 |
| 120 | Ga0070673_100543444 | 3300005364 | Bacteria | 1055 |
| 121 | Ga0070673_100996216 | 3300005364 | Unclassified | 780 |
| 122 | Ga0070659_100000065 | 3300005366 | Bacteria | 82919 |
| 123 | Ga0070659_100011551 | 3300005366 | Bacteria | 6534 |
| 124 | Ga0070659_100013967 | 3300005366 | Bacteria | 5994 |
| 125 | Ga0070659_100016237 | 3300005366 | Bacteria | 5587 |
| 126 | Ga0070659_100040228 | 3300005366 | Bacteria | 3652 |
| 127 | Ga0070659_100041644 | 3300005366 | Bacteria | 3591 |
| 128 | Ga0070659_100068005 | 3300005366 | Bacteria | 2825 |
| 129 | Ga0070659_100089596 | 3300005366 | Bacteria | 2464 |
| 130 | Ga0070659_100140975 | 3300005366 | Bacteria | 1963 |
| 131 | Ga0070659_100257942 | 3300005366 | Bacteria | 1446 |
| 132 | Ga0070659_100603853 | 3300005366 | Bacteria | 943 |
| 133 | Ga0070659_101099487 | 3300005366 | Bacteria | 701 |
| 134 | Ga0070659_101117178 | 3300005366 | Bacteria | 695 |
| 135 | Ga0070659_101982550 | 3300005366 | Unclassified | 523 |
| 136 | Ga0070667_100008194 | 3300005367 | Bacteria | 8662 |
| 137 | Ga0070667_100011257 | 3300005367 | Bacteria | 7399 |
| 138 | Ga0070667_100020823 | 3300005367 | Bacteria | 5446 |
| 139 | Ga0070667_100024205 | 3300005367 | Bacteria | 5043 |
| 140 | Ga0070667_100032912 | 3300005367 | Bacteria | 4327 |
| 141 | Ga0070667_100086776 | 3300005367 | Bacteria | 2685 |
| 142 | Ga0070667_100228041 | 3300005367 | Bacteria | 1660 |
| 143 | Ga0070667_100263961 | 3300005367 | Bacteria | 1542 |
| 144 | Ga0070667_100383781 | 3300005367 | Bacteria | 1276 |
| 145 | Ga0070667_100385592 | 3300005367 | Bacteria | 1273 |
| 146 | Ga0070709_10770043 | 3300005434 | Unclassified | 753 |
| 147 | Ga0070714_100089684 | 3300005435 | Bacteria | 2692 |
| 148 | Ga0070714_100956649 | 3300005435 | Bacteria | 833 |
| 149 | Ga0070713_100347612 | 3300005436 | Bacteria | 1375 |
| 150 | Ga0070713_102240953 | 3300005436 | Bacteria | 529 |
| 151 | Ga0070663_100000647 | 3300005455 | Bacteria | 18662 |
| 152 | Ga0070663_100001839 | 3300005455 | Bacteria | 11825 |
| 153 | Ga0070663_100027782 | 3300005455 | Bacteria | 3845 |
| 154 | Ga0070663_100126737 | 3300005455 | Unclassified | 1935 |
| 155 | Ga0070663_100131939 | 3300005455 | Bacteria | 1898 |
| 156 | Ga0070663_100161020 | 3300005455 | Bacteria | 1727 |
| 157 | Ga0070663_100225129 | 3300005455 | Bacteria | 1474 |
| 158 | Ga0070663_100242476 | 3300005455 | Unclassified | 1423 |
| 159 | Ga0070663_100905861 | 3300005455 | Bacteria | 762 |
| 160 | Ga0070663_101033811 | 3300005455 | Bacteria | 716 |
| 161 | Ga0070663_101141897 | 3300005455 | Unclassified | 683 |
| 162 | Ga0070678_100074997 | 3300005456 | Bacteria | 2544 |
| 163 | Ga0070678_100098389 | 3300005456 | Bacteria | 2262 |
| 164 | Ga0070678_100724892 | 3300005456 | Unclassified | 897 |
| 165 | Ga0070662_100000010 | 3300005457 | Bacteria | 142717 |
| 166 | Ga0070662_100000323 | 3300005457 | Bacteria | 28556 |
| 167 | Ga0070662_100034343 | 3300005457 | Bacteria | 3575 |
| 168 | Ga0070662_100103504 | 3300005457 | Bacteria | 2159 |
| 169 | Ga0070662_100168055 | 3300005457 | Bacteria | 1720 |
| 170 | Ga0070662_100180546 | 3300005457 | Bacteria | 1663 |
| 171 | Ga0070662_100211513 | 3300005457 | Bacteria | 1543 |
| 172 | Ga0070662_100287009 | 3300005457 | Bacteria | 1333 |
| 173 | Ga0070662_100543773 | 3300005457 | Bacteria | 973 |
| 174 | Ga0070662_101383194 | 3300005457 | Bacteria | 606 |
| 175 | Ga0070681_10013516 | 3300005458 | Bacteria | 8117 |
| 176 | Ga0070681_10152303 | 3300005458 | Bacteria | 2239 |
| 177 | Ga0070681_10257261 | 3300005458 | Bacteria | 1658 |
| 178 | Ga0068867_100004677 | 3300005459 | Bacteria | 9632 |
| 179 | Ga0068867_100013102 | 3300005459 | Bacteria | 5870 |
| 180 | Ga0068867_100278207 | 3300005459 | Bacteria | 1371 |
| 181 | Ga0068867_100301265 | 3300005459 | Unclassified | 1321 |
| 182 | Ga0068867_100520616 | 3300005459 | Bacteria | 1025 |
| 183 | Ga0068867_101441810 | 3300005459 | Bacteria | 639 |
| 184 | Ga0070685_10239772 | 3300005466 | Bacteria | 1196 |
| 185 | Ga0070679_100014856 | 3300005530 | Bacteria | 7480 |
| 186 | Ga0070679_100128950 | 3300005530 | Bacteria | 2511 |
| 187 | Ga0070679_100181220 | 3300005530 | Bacteria | 2079 |
| 188 | Ga0070679_100398756 | 3300005530 | Bacteria | 1322 |
| 189 | Ga0070679_100526550 | 3300005530 | Unclassified | 1126 |
| 190 | Ga0070679_100946217 | 3300005530 | Bacteria | 805 |
| 191 | Ga0070679_101329082 | 3300005530 | Unclassified | 665 |
| 192 | Ga0070679_101519181 | 3300005530 | Unclassified | 617 |
| 193 | Ga0070679_102074640 | 3300005530 | Unclassified | 518 |
| 194 | Ga0070684_100029987 | 3300005535 | Bacteria | 4617 |
| 195 | Ga0070684_100094566 | 3300005535 | Bacteria | 2662 |
| 196 | Ga0070684_100121740 | 3300005535 | Bacteria | 2347 |
| 197 | Ga0070684_100541159 | 3300005535 | Bacteria | 1080 |
| 198 | Ga0070684_102071085 | 3300005535 | Unclassified | 537 |
| 199 | Ga0068853_100000067 | 3300005539 | Bacteria | 73891 |
| 200 | Ga0068853_100011651 | 3300005539 | Bacteria | 7145 |
| 201 | Ga0068853_100025346 | 3300005539 | Bacteria | 4976 |
| 202 | Ga0068853_100030531 | 3300005539 | Bacteria | 4553 |
| 203 | Ga0068853_100178754 | 3300005539 | Bacteria | 1923 |
| 204 | Ga0068853_100195932 | 3300005539 | Bacteria | 1837 |
| 205 | Ga0068853_100409380 | 3300005539 | Bacteria | 1270 |
| 206 | Ga0070672_100023632 | 3300005543 | Bacteria | 4534 |
| 207 | Ga0070672_100048432 | 3300005543 | Bacteria | 3302 |
| 208 | Ga0070672_100095965 | 3300005543 | Bacteria | 2398 |
| 209 | Ga0070686_100805827 | 3300005544 | Unclassified | 757 |
| 210 | Ga0070696_100089379 | 3300005546 | Bacteria | 2190 |
| 211 | Ga0070696_100619486 | 3300005546 | Bacteria | 874 |
| 212 | Ga0070696_100815875 | 3300005546 | Bacteria | 769 |
| 213 | Ga0070693_100000343 | 3300005547 | Bacteria | 21190 |
| 214 | Ga0070693_100012856 | 3300005547 | Bacteria | 4249 |
| 215 | Ga0070693_100015026 | 3300005547 | Bacteria | 3981 |
| 216 | Ga0070693_100034700 | 3300005547 | Bacteria | 2793 |
| 217 | Ga0070693_100068659 | 3300005547 | Bacteria | 2081 |
| 218 | Ga0070693_100076941 | 3300005547 | Bacteria | 1979 |
| 219 | Ga0070665_100013969 | 3300005548 | Bacteria | 8076 |
| 220 | Ga0070665_100100909 | 3300005548 | Bacteria | 2890 |
| 221 | Ga0070665_100119667 | 3300005548 | Bacteria | 2635 |
| 222 | Ga0070665_100453511 | 3300005548 | Bacteria | 1292 |
| 223 | Ga0070665_100516987 | 3300005548 | Bacteria | 1205 |
| 224 | Ga0068855_100017249 | 3300005563 | Bacteria | 8690 |
| 225 | Ga0068855_100018104 | 3300005563 | Bacteria | 8465 |
| 226 | Ga0068855_100066116 | 3300005563 | Bacteria | 4215 |
| 227 | Ga0068855_100079415 | 3300005563 | Bacteria | 3805 |
| 228 | Ga0068855_100109434 | 3300005563 | Bacteria | 3173 |
| 229 | Ga0068855_100295644 | 3300005563 | Bacteria | 1794 |
| 230 | Ga0068855_100558573 | 3300005563 | Unclassified | 1238 |
| 231 | Ga0068855_100751142 | 3300005563 | Bacteria | 1040 |
| 232 | Ga0068855_101023477 | 3300005563 | Unclassified | 867 |
| 233 | Ga0070664_100000228 | 3300005564 | Bacteria | 40132 |
| 234 | Ga0070664_100002696 | 3300005564 | Bacteria | 14326 |
| 235 | Ga0070664_100006881 | 3300005564 | Bacteria | 9167 |
| 236 | Ga0070664_100009565 | 3300005564 | Bacteria | 7860 |
| 237 | Ga0070664_100059968 | 3300005564 | Bacteria | 3238 |
| 238 | Ga0070664_100071624 | 3300005564 | Bacteria | 2971 |
| 239 | Ga0070664_100088394 | 3300005564 | Bacteria | 2679 |
| 240 | Ga0070664_100276125 | 3300005564 | Bacteria | 1515 |
| 241 | Ga0070664_100529306 | 3300005564 | Bacteria | 1088 |
| 242 | Ga0070664_100578245 | 3300005564 | Bacteria | 1040 |
| 243 | Ga0070664_100681133 | 3300005564 | Unclassified | 957 |
| 244 | Ga0070664_100862659 | 3300005564 | Bacteria | 848 |
| 245 | Ga0070664_100962590 | 3300005564 | Bacteria | 801 |
| 246 | Ga0070664_100977906 | 3300005564 | Bacteria | 795 |
| 247 | Ga0070664_102183787 | 3300005564 | Unclassified | 525 |
| 248 | Ga0068857_100005960 | 3300005577 | Bacteria | 10414 |
| 249 | Ga0068857_100018518 | 3300005577 | Bacteria | 6108 |
| 250 | Ga0068857_100026322 | 3300005577 | Bacteria | 5126 |
| 251 | Ga0068857_100208346 | 3300005577 | Bacteria | 1783 |
| 252 | Ga0068857_100354085 | 3300005577 | Bacteria | 1360 |
| 253 | Ga0068857_100380990 | 3300005577 | Bacteria | 1310 |
| 254 | Ga0068857_100413628 | 3300005577 | Bacteria | 1256 |
| 255 | Ga0068857_100561577 | 3300005577 | Bacteria | 1076 |
| 256 | Ga0068857_100773393 | 3300005577 | Bacteria | 916 |
| 257 | Ga0068857_102154810 | 3300005577 | Bacteria | 547 |
| 258 | Ga0068854_100001913 | 3300005578 | Bacteria | 12684 |
| 259 | Ga0068854_100006418 | 3300005578 | Bacteria | 7481 |
| 260 | Ga0068854_100011321 | 3300005578 | Bacteria | 5802 |
| 261 | Ga0068854_100025191 | 3300005578 | Bacteria | 4081 |
| 262 | Ga0068854_100083818 | 3300005578 | Bacteria | 2357 |
| 263 | Ga0068854_100411489 | 3300005578 | Bacteria | 1121 |
| 264 | Ga0068856_100000101 | 3300005614 | Bacteria | 82391 |
| 265 | Ga0068856_100023316 | 3300005614 | Bacteria | 6017 |
| 266 | Ga0068856_100061342 | 3300005614 | Bacteria | 3714 |
| 267 | Ga0068856_100079964 | 3300005614 | Bacteria | 3242 |
| 268 | Ga0068856_100153835 | 3300005614 | Bacteria | 2310 |
| 269 | Ga0068856_100334692 | 3300005614 | Unclassified | 1532 |
| 270 | Ga0068856_100391785 | 3300005614 | Bacteria | 1409 |
| 271 | Ga0068856_100689227 | 3300005614 | Unclassified | 1042 |
| 272 | Ga0070702_100377282 | 3300005615 | Bacteria | 1007 |
| 273 | Ga0068852_100000846 | 3300005616 | Bacteria | 20324 |
| 274 | Ga0068852_100001433 | 3300005616 | Bacteria | 16088 |
| 275 | Ga0068852_100003781 | 3300005616 | Bacteria | 10612 |
| 276 | Ga0068852_100013090 | 3300005616 | Bacteria | 6335 |
| 277 | Ga0068852_100023726 | 3300005616 | Bacteria | 4943 |
| 278 | Ga0068852_100087984 | 3300005616 | Bacteria | 2773 |
| 279 | Ga0068852_100093334 | 3300005616 | Bacteria | 2697 |
| 280 | Ga0068852_100094713 | 3300005616 | Bacteria | 2680 |
| 281 | Ga0068852_100437703 | 3300005616 | Bacteria | 1292 |
| 282 | Ga0068852_102470375 | 3300005616 | Unclassified | 540 |
| 283 | Ga0068859_100048611 | 3300005617 | Unclassified | 4260 |
| 284 | Ga0068859_100054434 | 3300005617 | Bacteria | 4024 |
| 285 | Ga0068859_100092224 | 3300005617 | Bacteria | 3080 |
| 286 | Ga0068859_100379073 | 3300005617 | Bacteria | 1510 |
| 287 | Ga0068859_100904590 | 3300005617 | Bacteria | 967 |
| 288 | Ga0068864_100000222 | 3300005618 | Bacteria | 51430 |
| 289 | Ga0068864_100007380 | 3300005618 | Bacteria | 9049 |
| 290 | Ga0068864_100089427 | 3300005618 | Bacteria | 2713 |
| 291 | Ga0068864_100180268 | 3300005618 | Bacteria | 1931 |
| 292 | Ga0068861_100169755 | 3300005719 | Bacteria | 1807 |
| 293 | Ga0068861_100329298 | 3300005719 | Bacteria | 1333 |
| 294 | Ga0068861_100430982 | 3300005719 | Bacteria | 1177 |
| 295 | Ga0068861_100485890 | 3300005719 | Bacteria | 1113 |
| 296 | Ga0068851_10032858 | 3300005834 | Bacteria | 2582 |
| 297 | Ga0068851_10047700 | 3300005834 | Bacteria | 2170 |
| 298 | Ga0068851_10051292 | 3300005834 | Unclassified | 2096 |
| 299 | Ga0068851_10154026 | 3300005834 | Bacteria | 1258 |
| 300 | Ga0068851_10167365 | 3300005834 | Bacteria | 1211 |
| 301 | Ga0068870_10103315 | 3300005840 | Bacteria | 1614 |
| 302 | Ga0068863_100002567 | 3300005841 | Bacteria | 18003 |
| 303 | Ga0068863_100034901 | 3300005841 | Bacteria | 4791 |
| 304 | Ga0068863_100116639 | 3300005841 | Bacteria | 2544 |
| 305 | Ga0068863_100360451 | 3300005841 | Unclassified | 1417 |
| 306 | Ga0068863_100770831 | 3300005841 | Unclassified | 958 |
| 307 | Ga0068858_100003320 | 3300005842 | Bacteria | 16021 |
| 308 | Ga0068858_100007141 | 3300005842 | Bacteria | 10844 |
| 309 | Ga0068860_100006803 | 3300005843 | Bacteria | 11459 |
| 310 | Ga0068860_100061591 | 3300005843 | Bacteria | 3565 |
| 311 | Ga0068860_100073377 | 3300005843 | Bacteria | 3253 |
| 312 | Ga0068860_100245076 | 3300005843 | Bacteria | 1744 |
| 313 | Ga0068862_100091796 | 3300005844 | Bacteria | 2646 |
| 314 | Ga0068862_100253229 | 3300005844 | Bacteria | 1605 |
| 315 | Ga0097621_100051529 | 3300006237 | Bacteria | 3350 |
| 316 | Ga0097621_100357207 | 3300006237 | Bacteria | 1301 |
| 317 | Ga0097621_100493047 | 3300006237 | Bacteria | 1109 |
| 318 | Ga0097621_100561732 | 3300006237 | Unclassified | 1040 |
| 319 | Ga0097621_101019463 | 3300006237 | Bacteria | 775 |
| 320 | Ga0097621_101092693 | 3300006237 | Bacteria | 748 |
| 321 | Ga0068871_100011090 | 3300006358 | Bacteria | 6604 |
| 322 | Ga0068871_100379801 | 3300006358 | Bacteria | 1255 |
| 323 | Ga0068871_100623150 | 3300006358 | Unclassified | 983 |
| 324 | Ga0068871_100662228 | 3300006358 | Bacteria | 954 |
| 325 | Ga0068871_101378884 | 3300006358 | Bacteria | 664 |
| 326 | Ga0068865_100006056 | 3300006881 | Bacteria | 7375 |
| 327 | Ga0068865_100034925 | 3300006881 | Bacteria | 3377 |
| 328 | Ga0097620_100048612 | 3300006931 | Unclassified | 4260 |
| 329 | Ga0097620_100054439 | 3300006931 | Bacteria | 4024 |
| 330 | Ga0097620_100092228 | 3300006931 | Bacteria | 3080 |
| 331 | Ga0097620_100379074 | 3300006931 | Bacteria | 1510 |
| 332 | Ga0097620_100904739 | 3300006931 | Bacteria | 967 |
| 333 | Ga0075435_100734814 | 3300007076 | Bacteria | 858 |
| 334 | Ga0105240_10087961 | 3300009093 | Bacteria | 3803 |
| 335 | Ga0105245_10006125 | 3300009098 | Bacteria | 10580 |
| 336 | Ga0105241_10032907 | 3300009174 | Bacteria | 3889 |
| 337 | Ga0105241_10130207 | 3300009174 | Bacteria | 2036 |
| 338 | Ga0105241_10157917 | 3300009174 | Bacteria | 1861 |
| 339 | Ga0105241_10342051 | 3300009174 | Bacteria | 1296 |
| 340 | Ga0105241_10702355 | 3300009174 | Unclassified | 923 |
| 341 | Ga0105242_10185671 | 3300009176 | Bacteria | 1837 |
| 342 | Ga0105248_10001119 | 3300009177 | Bacteria | 29831 |
| 343 | Ga0105248_10054729 | 3300009177 | Bacteria | 4475 |
| 344 | Ga0105248_10228619 | 3300009177 | Bacteria | 2094 |
| 345 | Ga0105248_10463115 | 3300009177 | Bacteria | 1429 |
| 346 | Ga0105248_10829284 | 3300009177 | Bacteria | 1044 |
| 347 | Ga0105248_11767199 | 3300009177 | Unclassified | 701 |
| 348 | Ga0105248_12304511 | 3300009177 | Bacteria | 613 |
| 349 | Ga0105237_10006758 | 3300009545 | Bacteria | 12663 |
| 350 | Ga0105238_10004367 | 3300009551 | Bacteria | 14023 |
| 351 | Ga0105238_10051275 | 3300009551 | Bacteria | 4151 |
| 352 | Ga0105238_10063618 | 3300009551 | Bacteria | 3690 |
| 353 | Ga0105238_10111637 | 3300009551 | Bacteria | 2714 |
| 354 | Ga0105238_10327601 | 3300009551 | Bacteria | 1518 |
| 355 | Ga0105238_12295790 | 3300009551 | Unclassified | 575 |
| 356 | Ga0105249_10320235 | 3300009553 | Bacteria | 1562 |
| 357 | Ga0105249_10935063 | 3300009553 | Bacteria | 934 |
| 358 | Ga0105239_10054356 | 3300010375 | Bacteria | 4392 |
| 359 | Ga0105239_10261369 | 3300010375 | Unclassified | 1945 |
| 360 | Ga0105246_10008301 | 3300011119 | Bacteria | 6378 |
| 361 | Ga0105246_10278750 | 3300011119 | Bacteria | 1340 |
| 362 | Ga0157373_10009790 | 3300013100 | Bacteria | 7070 |
| 363 | Ga0157373_10031339 | 3300013100 | Bacteria | 3828 |
| 364 | Ga0157373_10059487 | 3300013100 | Bacteria | 2708 |
| 365 | Ga0157373_10090355 | 3300013100 | Bacteria | 2157 |
| 366 | Ga0157373_10092027 | 3300013100 | Bacteria | 2136 |
| 367 | Ga0157373_10092672 | 3300013100 | Bacteria | 2128 |
| 368 | Ga0157373_10102375 | 3300013100 | Bacteria | 2015 |
| 369 | Ga0157373_10193781 | 3300013100 | Bacteria | 1432 |
| 370 | Ga0157373_10272822 | 3300013100 | Unclassified | 1198 |
| 371 | Ga0157373_10301096 | 3300013100 | Bacteria | 1138 |
| 372 | Ga0157373_10463145 | 3300013100 | Bacteria | 913 |
| 373 | Ga0157371_10003821 | 3300013102 | Bacteria | 13450 |
| 374 | Ga0157371_10025025 | 3300013102 | Bacteria | 4356 |
| 375 | Ga0157371_10026453 | 3300013102 | Bacteria | 4217 |
| 376 | Ga0157371_10075155 | 3300013102 | Bacteria | 2393 |
| 377 | Ga0157371_10092512 | 3300013102 | Bacteria | 2142 |
| 378 | Ga0157371_10128560 | 3300013102 | Bacteria | 1802 |
| 379 | Ga0157371_10870781 | 3300013102 | Unclassified | 682 |
| 380 | Ga0157371_10939038 | 3300013102 | Unclassified | 657 |
| 381 | Ga0157371_11244993 | 3300013102 | Unclassified | 574 |
| 382 | Ga0157370_10059532 | 3300013104 | Bacteria | 3629 |
| 383 | Ga0157370_10741220 | 3300013104 | Unclassified | 895 |
| 384 | Ga0157370_10929875 | 3300013104 | Unclassified | 789 |
| 385 | Ga0157369_10003181 | 3300013105 | Bacteria | 19593 |
| 386 | Ga0157369_10032210 | 3300013105 | Bacteria | 5767 |
| 387 | Ga0157369_10202481 | 3300013105 | Bacteria | 2083 |
| 388 | Ga0157369_10259977 | 3300013105 | Bacteria | 1810 |
| 389 | Ga0157369_10733218 | 3300013105 | Unclassified | 1017 |
| 390 | Ga0157369_10922308 | 3300013105 | Unclassified | 895 |
| 391 | Ga0157374_10303006 | 3300013296 | Bacteria | 1581 |
| 392 | Ga0157374_10480692 | 3300013296 | Unclassified | 1245 |
| 393 | Ga0157374_10519081 | 3300013296 | Unclassified | 1197 |
| 394 | Ga0157378_10006532 | 3300013297 | Bacteria | 10192 |
| 395 | Ga0157378_10007074 | 3300013297 | Bacteria | 9797 |
| 396 | Ga0157378_10344935 | 3300013297 | Bacteria | 1453 |
| 397 | Ga0163162_10032625 | 3300013306 | Bacteria | 5173 |
| 398 | Ga0163162_10438663 | 3300013306 | Unclassified | 1438 |
| 399 | Ga0157372_10011784 | 3300013307 | Bacteria | 9314 |
| 400 | Ga0157372_10035809 | 3300013307 | Bacteria | 5466 |
| 401 | Ga0157372_10045014 | 3300013307 | Bacteria | 4893 |
| 402 | Ga0157372_10046828 | 3300013307 | Bacteria | 4802 |
| 403 | Ga0157372_10359554 | 3300013307 | Bacteria | 1696 |
| 404 | Ga0157372_11666553 | 3300013307 | Unclassified | 734 |
| 405 | Ga0157372_12909297 | 3300013307 | Bacteria | 548 |
| 406 | Ga0157375_10007221 | 3300013308 | Bacteria | 9716 |
| 407 | Ga0157375_10024264 | 3300013308 | Bacteria | 5610 |
| 408 | Ga0157375_10271200 | 3300013308 | Bacteria | 1859 |
| 409 | Ga0163163_10019125 | 3300014325 | Bacteria | 6427 |
| 410 | Ga0157377_10204425 | 3300014745 | Bacteria | 1256 |
| 411 | Ga0157379_10165064 | 3300014968 | Bacteria | 1999 |
| 412 | Ga0157379_10182441 | 3300014968 | Unclassified | 1896 |
| 413 | Ga0157379_11204648 | 3300014968 | Bacteria | 728 |
| 414 | Ga0157376_10684688 | 3300014969 | Bacteria | 1029 |
| 415 | Ga0163161_10485228 | 3300017792 | Bacteria | 1004 |
| 416 | Ga0197907_10034936 | 3300020069 | Unclassified | 667 |
| 417 | Ga0197907_11002332 | 3300020069 | Bacteria | 910 |
| 418 | Ga0206356_10307274 | 3300020070 | Bacteria | 1016 |
| 419 | Ga0206356_11292785 | 3300020070 | Bacteria | 909 |
| 420 | Ga0206356_11311979 | 3300020070 | Unclassified | 949 |
| 421 | Ga0206356_11638823 | 3300020070 | Bacteria | 1524 |
| 422 | Ga0206352_10699940 | 3300020078 | Unclassified | 901 |
| 423 | Ga0206354_10948750 | 3300020081 | Bacteria | 990 |
| 424 | Ga0206353_10732796 | 3300020082 | Bacteria | 619 |
| 425 | Ga0224712_10171006 | 3300022467 | Bacteria | 974 |
| 426 | Ga0224712_10205286 | 3300022467 | Unclassified | 897 |
| 427 | Ga0207673_1020061 | 3300025290 | Bacteria | 900 |
| 428 | Ga0207697_10000158 | 3300025315 | Bacteria | 33821 |
| 429 | Ga0207697_10022280 | 3300025315 | Bacteria | 2595 |
| 430 | Ga0207697_10028059 | 3300025315 | Bacteria | 2301 |
| 431 | Ga0207697_10112020 | 3300025315 | Bacteria | 1169 |
| 432 | Ga0207656_10003880 | 3300025321 | Bacteria | 5185 |
| 433 | Ga0207656_10042249 | 3300025321 | Bacteria | 1939 |
| 434 | Ga0207656_10061879 | 3300025321 | Bacteria | 1644 |
| 435 | Ga0207656_10461209 | 3300025321 | Bacteria | 643 |
| 436 | Ga0207713_1039137 | 3300025735 | Bacteria | 2003 |
| 437 | Ga0207682_10035101 | 3300025893 | Bacteria | 2024 |
| 438 | Ga0207642_10364144 | 3300025899 | Unclassified | 856 |
| 439 | Ga0207688_10007071 | 3300025901 | Bacteria | 6102 |
| 440 | Ga0207688_10126968 | 3300025901 | Bacteria | 1492 |
| 441 | Ga0207680_10517167 | 3300025903 | Bacteria | 851 |
| 442 | Ga0207647_10000832 | 3300025904 | Bacteria | 23993 |
| 443 | Ga0207647_10004000 | 3300025904 | Bacteria | 10992 |
| 444 | Ga0207647_10008390 | 3300025904 | Bacteria | 7410 |
| 445 | Ga0207647_10061274 | 3300025904 | Bacteria | 2297 |
| 446 | Ga0207647_10064373 | 3300025904 | Bacteria | 2228 |
| 447 | Ga0207647_10079630 | 3300025904 | Bacteria | 1966 |
| 448 | Ga0207647_10464687 | 3300025904 | Bacteria | 708 |
| 449 | Ga0207645_10003931 | 3300025907 | Bacteria | 11101 |
| 450 | Ga0207645_10004831 | 3300025907 | Bacteria | 9899 |
| 451 | Ga0207645_10008901 | 3300025907 | Bacteria | 6973 |
| 452 | Ga0207645_10063906 | 3300025907 | Unclassified | 2352 |
| 453 | Ga0207645_10112926 | 3300025907 | Bacteria | 1760 |
| 454 | Ga0207643_10054699 | 3300025908 | Bacteria | 2269 |
| 455 | Ga0207643_10173377 | 3300025908 | Bacteria | 1303 |
| 456 | Ga0207643_10254530 | 3300025908 | Bacteria | 1082 |
| 457 | Ga0207705_10000113 | 3300025909 | Bacteria | 90567 |
| 458 | Ga0207705_10010345 | 3300025909 | Bacteria | 6787 |
| 459 | Ga0207705_10038951 | 3300025909 | Bacteria | 3406 |
| 460 | Ga0207705_10059966 | 3300025909 | Bacteria | 2747 |
| 461 | Ga0207705_10060833 | 3300025909 | Bacteria | 2728 |
| 462 | Ga0207705_10065521 | 3300025909 | Bacteria | 2626 |
| 463 | Ga0207705_10065899 | 3300025909 | Bacteria | 2619 |
| 464 | Ga0207705_10077431 | 3300025909 | Bacteria | 2419 |
| 465 | Ga0207705_10186859 | 3300025909 | Bacteria | 1566 |
| 466 | Ga0207705_10261160 | 3300025909 | Bacteria | 1322 |
| 467 | Ga0207705_11141639 | 3300025909 | Unclassified | 599 |
| 468 | Ga0207654_10106813 | 3300025911 | Bacteria | 1734 |
| 469 | Ga0207654_10178036 | 3300025911 | Unclassified | 1385 |
| 470 | Ga0207707_10008907 | 3300025912 | Bacteria | 8714 |
| 471 | Ga0207707_10453823 | 3300025912 | Unclassified | 1097 |
| 472 | Ga0207707_10495635 | 3300025912 | Bacteria | 1042 |
| 473 | Ga0207695_10622836 | 3300025913 | Unclassified | 960 |
| 474 | Ga0207671_10017531 | 3300025914 | Bacteria | 5516 |
| 475 | Ga0207693_10016003 | 3300025915 | Bacteria | 6004 |
| 476 | Ga0207660_10007589 | 3300025917 | Bacteria | 7020 |
| 477 | Ga0207660_10034958 | 3300025917 | Bacteria | 3486 |
| 478 | Ga0207660_10440534 | 3300025917 | Bacteria | 1053 |
| 479 | Ga0207660_10535163 | 3300025917 | Bacteria | 952 |
| 480 | Ga0207660_10665417 | 3300025917 | Bacteria | 849 |
| 481 | Ga0207660_10682176 | 3300025917 | Bacteria | 838 |
| 482 | Ga0207660_11701896 | 3300025917 | Bacteria | 507 |
| 483 | Ga0207662_10030474 | 3300025918 | Bacteria | 3130 |
| 484 | Ga0207662_10077107 | 3300025918 | Bacteria | 2027 |
| 485 | Ga0207662_10170760 | 3300025918 | Bacteria | 1394 |
| 486 | Ga0207657_10000026 | 3300025919 | Bacteria | 143118 |
| 487 | Ga0207657_10002103 | 3300025919 | Bacteria | 21540 |
| 488 | Ga0207657_10005900 | 3300025919 | Bacteria | 12750 |
| 489 | Ga0207657_10007800 | 3300025919 | Bacteria | 10926 |
| 490 | Ga0207657_10038093 | 3300025919 | Bacteria | 4285 |
| 491 | Ga0207657_10050216 | 3300025919 | Bacteria | 3630 |
| 492 | Ga0207657_10093297 | 3300025919 | Bacteria | 2507 |
| 493 | Ga0207657_10167001 | 3300025919 | Bacteria | 1784 |
| 494 | Ga0207657_10281976 | 3300025919 | Bacteria | 1319 |
| 495 | Ga0207657_10862110 | 3300025919 | Bacteria | 698 |
| 496 | Ga0207649_10000516 | 3300025920 | Bacteria | 27112 |
| 497 | Ga0207649_10002740 | 3300025920 | Bacteria | 9764 |
| 498 | Ga0207649_10032422 | 3300025920 | Bacteria | 3114 |
| 499 | Ga0207649_10038842 | 3300025920 | Bacteria | 2884 |
| 500 | Ga0207649_10070046 | 3300025920 | Bacteria | 2235 |
| 501 | Ga0207649_10085352 | 3300025920 | Bacteria | 2054 |
| 502 | Ga0207649_10183527 | 3300025920 | Bacteria | 1466 |
| 503 | Ga0207649_10517552 | 3300025920 | Bacteria | 909 |
| 504 | Ga0207652_10026485 | 3300025921 | Bacteria | 4830 |
| 505 | Ga0207652_10095828 | 3300025921 | Bacteria | 2614 |
| 506 | Ga0207652_10220094 | 3300025921 | Bacteria | 1711 |
| 507 | Ga0207652_10298249 | 3300025921 | Bacteria | 1455 |
| 508 | Ga0207652_10338914 | 3300025921 | Bacteria | 1357 |
| 509 | Ga0207652_10437556 | 3300025921 | Unclassified | 1179 |
| 510 | Ga0207652_10487035 | 3300025921 | Unclassified | 1111 |
| 511 | Ga0207652_10825776 | 3300025921 | Bacteria | 822 |
| 512 | Ga0207652_11286989 | 3300025921 | Unclassified | 634 |
| 513 | Ga0207681_10047787 | 3300025923 | Bacteria | 2885 |
| 514 | Ga0207681_10056834 | 3300025923 | Bacteria | 2670 |
| 515 | Ga0207681_10277952 | 3300025923 | Unclassified | 1317 |
| 516 | Ga0207694_10000776 | 3300025924 | Bacteria | 28653 |
| 517 | Ga0207694_10005699 | 3300025924 | Bacteria | 9549 |
| 518 | Ga0207694_10185516 | 3300025924 | Unclassified | 1688 |
| 519 | Ga0207694_10334497 | 3300025924 | Bacteria | 1251 |
| 520 | Ga0207694_10921080 | 3300025924 | Bacteria | 739 |
| 521 | Ga0207694_11500997 | 3300025924 | Unclassified | 569 |
| 522 | Ga0207650_10028115 | 3300025925 | Bacteria | 4030 |
| 523 | Ga0207650_10142089 | 3300025925 | Bacteria | 1888 |
| 524 | Ga0207659_10835872 | 3300025926 | Bacteria | 791 |
| 525 | Ga0207687_10048079 | 3300025927 | Bacteria | 2960 |
| 526 | Ga0207687_10062974 | 3300025927 | Bacteria | 2625 |
| 527 | Ga0207664_10146782 | 3300025929 | Bacteria | 2001 |
| 528 | Ga0207664_10161196 | 3300025929 | Bacteria | 1913 |
| 529 | Ga0207664_10251689 | 3300025929 | Bacteria | 1542 |
| 530 | Ga0207664_10374847 | 3300025929 | Bacteria | 1262 |
| 531 | Ga0207664_10801546 | 3300025929 | Unclassified | 847 |
| 532 | Ga0207644_10022380 | 3300025931 | Bacteria | 4319 |
| 533 | Ga0207644_10033303 | 3300025931 | Bacteria | 3599 |
| 534 | Ga0207644_10033934 | 3300025931 | Bacteria | 3570 |
| 535 | Ga0207644_10209882 | 3300025931 | Bacteria | 1539 |
| 536 | Ga0207644_10227290 | 3300025931 | Bacteria | 1481 |
| 537 | Ga0207690_10000649 | 3300025932 | Bacteria | 22307 |
| 538 | Ga0207690_10002369 | 3300025932 | Bacteria | 11421 |
| 539 | Ga0207690_10002565 | 3300025932 | Bacteria | 10974 |
| 540 | Ga0207690_10012713 | 3300025932 | Bacteria | 5046 |
| 541 | Ga0207690_10017432 | 3300025932 | Bacteria | 4383 |
| 542 | Ga0207690_10050183 | 3300025932 | Bacteria | 2784 |
| 543 | Ga0207690_10201848 | 3300025932 | Unclassified | 1511 |
| 544 | Ga0207690_10219429 | 3300025932 | Bacteria | 1454 |
| 545 | Ga0207690_10238263 | 3300025932 | Bacteria | 1400 |
| 546 | Ga0207690_10369349 | 3300025932 | Unclassified | 1138 |
| 547 | Ga0207690_10413049 | 3300025932 | Bacteria | 1078 |
| 548 | Ga0207690_10429139 | 3300025932 | Bacteria | 1059 |
| 549 | Ga0207690_10640821 | 3300025932 | Bacteria | 870 |
| 550 | Ga0207690_11098335 | 3300025932 | Unclassified | 663 |
| 551 | Ga0207706_10000031 | 3300025933 | Bacteria | 143109 |
| 552 | Ga0207706_10000829 | 3300025933 | Bacteria | 32031 |
| 553 | Ga0207706_10002893 | 3300025933 | Bacteria | 16604 |
| 554 | Ga0207706_10008630 | 3300025933 | Bacteria | 9389 |
| 555 | Ga0207706_10024282 | 3300025933 | Bacteria | 5434 |
| 556 | Ga0207706_10038293 | 3300025933 | Bacteria | 4254 |
| 557 | Ga0207706_10055308 | 3300025933 | Bacteria | 3500 |
| 558 | Ga0207706_10081488 | 3300025933 | Bacteria | 2843 |
| 559 | Ga0207706_10101934 | 3300025933 | Bacteria | 2526 |
| 560 | Ga0207706_10158840 | 3300025933 | Bacteria | 1988 |
| 561 | Ga0207706_10216949 | 3300025933 | Bacteria | 1676 |
| 562 | Ga0207706_10260604 | 3300025933 | Bacteria | 1514 |
| 563 | Ga0207706_10676408 | 3300025933 | Unclassified | 883 |
| 564 | Ga0207706_10963687 | 3300025933 | Unclassified | 718 |
| 565 | Ga0207686_10362636 | 3300025934 | Bacteria | 1094 |
| 566 | Ga0207709_10681923 | 3300025935 | Bacteria | 821 |
| 567 | Ga0207670_10044294 | 3300025936 | Bacteria | 2943 |
| 568 | Ga0207669_10108579 | 3300025937 | Bacteria | 1853 |
| 569 | Ga0207669_10828103 | 3300025937 | Bacteria | 769 |
| 570 | Ga0207704_10060374 | 3300025938 | Bacteria | 2346 |
| 571 | Ga0207704_11009349 | 3300025938 | Bacteria | 704 |
| 572 | Ga0207704_11083528 | 3300025938 | Unclassified | 680 |
| 573 | Ga0207691_10003632 | 3300025940 | Bacteria | 14973 |
| 574 | Ga0207691_10061499 | 3300025940 | Bacteria | 3411 |
| 575 | Ga0207691_10134809 | 3300025940 | Bacteria | 2179 |
| 576 | Ga0207691_10144668 | 3300025940 | Bacteria | 2093 |
| 577 | Ga0207711_10000446 | 3300025941 | Bacteria | 43126 |
| 578 | Ga0207711_10002065 | 3300025941 | Bacteria | 18165 |
| 579 | Ga0207711_10007845 | 3300025941 | Bacteria | 8923 |
| 580 | Ga0207711_10117724 | 3300025941 | Bacteria | 2369 |
| 581 | Ga0207711_10226883 | 3300025941 | Bacteria | 1710 |
| 582 | Ga0207711_10287123 | 3300025941 | Unclassified | 1516 |
| 583 | Ga0207711_10733378 | 3300025941 | Bacteria | 921 |
| 584 | Ga0207711_11023149 | 3300025941 | Unclassified | 766 |
| 585 | Ga0207689_10000017 | 3300025942 | Bacteria | 117159 |
| 586 | Ga0207689_10025109 | 3300025942 | Bacteria | 4995 |
| 587 | Ga0207689_10037964 | 3300025942 | Bacteria | 3991 |
| 588 | Ga0207689_10066588 | 3300025942 | Bacteria | 2961 |
| 589 | Ga0207689_10426773 | 3300025942 | Bacteria | 1107 |
| 590 | Ga0207661_10013965 | 3300025944 | Bacteria | 5873 |
| 591 | Ga0207661_10030599 | 3300025944 | Bacteria | 4149 |
| 592 | Ga0207661_10031712 | 3300025944 | Bacteria | 4087 |
| 593 | Ga0207661_10235922 | 3300025944 | Bacteria | 1621 |
| 594 | Ga0207661_10783699 | 3300025944 | Unclassified | 878 |
| 595 | Ga0207661_11073666 | 3300025944 | Unclassified | 741 |
| 596 | Ga0207679_10000236 | 3300025945 | Bacteria | 42583 |
| 597 | Ga0207679_10008515 | 3300025945 | Bacteria | 6534 |
| 598 | Ga0207679_10032946 | 3300025945 | Bacteria | 3643 |
| 599 | Ga0207679_10088718 | 3300025945 | Bacteria | 2385 |
| 600 | Ga0207679_10100327 | 3300025945 | Bacteria | 2262 |
| 601 | Ga0207679_10118558 | 3300025945 | Bacteria | 2102 |
| 602 | Ga0207679_10134912 | 3300025945 | Bacteria | 1986 |
| 603 | Ga0207679_10175160 | 3300025945 | Bacteria | 1770 |
| 604 | Ga0207679_10201523 | 3300025945 | Bacteria | 1662 |
| 605 | Ga0207679_10354516 | 3300025945 | Bacteria | 1280 |
| 606 | Ga0207679_10531731 | 3300025945 | Bacteria | 1053 |
| 607 | Ga0207679_11442595 | 3300025945 | Bacteria | 631 |
| 608 | Ga0207679_12014802 | 3300025945 | Unclassified | 525 |
| 609 | Ga0207667_10001718 | 3300025949 | Bacteria | 27571 |
| 610 | Ga0207667_10081840 | 3300025949 | Bacteria | 3345 |
| 611 | Ga0207667_10132858 | 3300025949 | Bacteria | 2563 |
| 612 | Ga0207667_10720816 | 3300025949 | Bacteria | 999 |
| 613 | Ga0207667_11750098 | 3300025949 | Unclassified | 587 |
| 614 | Ga0207651_10029701 | 3300025960 | Bacteria | 3468 |
| 615 | Ga0207651_10116028 | 3300025960 | Bacteria | 2020 |
| 616 | Ga0207651_10432706 | 3300025960 | Unclassified | 1125 |
| 617 | Ga0207651_10538401 | 3300025960 | Unclassified | 1014 |
| 618 | Ga0207651_11127555 | 3300025960 | Unclassified | 703 |
| 619 | Ga0207651_11547410 | 3300025960 | Unclassified | 597 |
| 620 | Ga0207651_12017645 | 3300025960 | Bacteria | 518 |
| 621 | Ga0207712_10079041 | 3300025961 | Bacteria | 2388 |
| 622 | Ga0207668_10002157 | 3300025972 | Bacteria | 11474 |
| 623 | Ga0207668_10073156 | 3300025972 | Bacteria | 2455 |
| 624 | Ga0207640_10007503 | 3300025981 | Bacteria | 6024 |
| 625 | Ga0207640_10010090 | 3300025981 | Bacteria | 5309 |
| 626 | Ga0207640_10032101 | 3300025981 | Bacteria | 3253 |
| 627 | Ga0207640_10034294 | 3300025981 | Bacteria | 3166 |
| 628 | Ga0207640_10107025 | 3300025981 | Bacteria | 1974 |
| 629 | Ga0207640_10114939 | 3300025981 | Unclassified | 1916 |
| 630 | Ga0207640_10128956 | 3300025981 | Bacteria | 1825 |
| 631 | Ga0207640_11504686 | 3300025981 | Unclassified | 605 |
| 632 | Ga0207658_10017651 | 3300025986 | Bacteria | 4920 |
| 633 | Ga0207658_10018455 | 3300025986 | Bacteria | 4817 |
| 634 | Ga0207658_10027437 | 3300025986 | Bacteria | 4001 |
| 635 | Ga0207658_10036587 | 3300025986 | Bacteria | 3520 |
| 636 | Ga0207658_10072042 | 3300025986 | Bacteria | 2618 |
| 637 | Ga0207658_10078804 | 3300025986 | Bacteria | 2518 |
| 638 | Ga0207658_10080766 | 3300025986 | Bacteria | 2491 |
| 639 | Ga0207658_10094610 | 3300025986 | Bacteria | 2326 |
| 640 | Ga0207677_10102695 | 3300026023 | Bacteria | 2109 |
| 641 | Ga0207677_10298705 | 3300026023 | Bacteria | 1329 |
| 642 | Ga0207677_10765304 | 3300026023 | Unclassified | 862 |
| 643 | Ga0207677_10815524 | 3300026023 | Unclassified | 836 |
| 644 | Ga0207703_10025106 | 3300026035 | Bacteria | 4687 |
| 645 | Ga0207703_10065655 | 3300026035 | Bacteria | 2983 |
| 646 | Ga0207703_10088896 | 3300026035 | Bacteria | 2594 |
| 647 | Ga0207703_10135939 | 3300026035 | Bacteria | 2128 |
| 648 | Ga0207639_10005817 | 3300026041 | Bacteria | 8356 |
| 649 | Ga0207639_10070955 | 3300026041 | Bacteria | 2723 |
| 650 | Ga0207639_10095747 | 3300026041 | Bacteria | 2387 |
| 651 | Ga0207639_10108892 | 3300026041 | Bacteria | 2253 |
| 652 | Ga0207639_10205373 | 3300026041 | Bacteria | 1692 |
| 653 | Ga0207639_10385639 | 3300026041 | Unclassified | 1259 |
| 654 | Ga0207639_10770962 | 3300026041 | Unclassified | 895 |
| 655 | Ga0207678_10002668 | 3300026067 | Bacteria | 16192 |
| 656 | Ga0207678_10010119 | 3300026067 | Bacteria | 8274 |
| 657 | Ga0207678_10010859 | 3300026067 | Bacteria | 8003 |
| 658 | Ga0207678_10012250 | 3300026067 | Bacteria | 7530 |
| 659 | Ga0207678_10023738 | 3300026067 | Bacteria | 5363 |
| 660 | Ga0207678_10138368 | 3300026067 | Bacteria | 2078 |
| 661 | Ga0207678_10154857 | 3300026067 | Bacteria | 1957 |
| 662 | Ga0207678_10176738 | 3300026067 | Unclassified | 1823 |
| 663 | Ga0207678_10209384 | 3300026067 | Bacteria | 1668 |
| 664 | Ga0207678_10300599 | 3300026067 | Unclassified | 1379 |
| 665 | Ga0207678_10502746 | 3300026067 | Bacteria | 1057 |
| 666 | Ga0207678_10586127 | 3300026067 | Bacteria | 977 |
| 667 | Ga0207708_10326846 | 3300026075 | Bacteria | 1253 |
| 668 | Ga0207708_10327175 | 3300026075 | Bacteria | 1252 |
| 669 | Ga0207702_10010631 | 3300026078 | Bacteria | 7690 |
| 670 | Ga0207702_10015012 | 3300026078 | Bacteria | 6423 |
| 671 | Ga0207702_10067734 | 3300026078 | Bacteria | 3064 |
| 672 | Ga0207702_10095158 | 3300026078 | Bacteria | 2616 |
| 673 | Ga0207702_10164850 | 3300026078 | Bacteria | 2026 |
| 674 | Ga0207702_10208008 | 3300026078 | Bacteria | 1818 |
| 675 | Ga0207702_10600741 | 3300026078 | Bacteria | 1080 |
| 676 | Ga0207702_10839137 | 3300026078 | Bacteria | 909 |
| 677 | Ga0207641_10011385 | 3300026088 | Bacteria | 7299 |
| 678 | Ga0207641_10019349 | 3300026088 | Bacteria | 5588 |
| 679 | Ga0207641_10033916 | 3300026088 | Bacteria | 4243 |
| 680 | Ga0207641_10337044 | 3300026088 | Bacteria | 1434 |
| 681 | Ga0207641_10433036 | 3300026088 | Unclassified | 1268 |
| 682 | Ga0207641_11196227 | 3300026088 | Bacteria | 760 |
| 683 | Ga0207648_10002318 | 3300026089 | Bacteria | 20543 |
| 684 | Ga0207648_10003142 | 3300026089 | Bacteria | 17423 |
| 685 | Ga0207648_10006581 | 3300026089 | Bacteria | 11535 |
| 686 | Ga0207648_10116265 | 3300026089 | Bacteria | 2351 |
| 687 | Ga0207676_10002072 | 3300026095 | Bacteria | 14553 |
| 688 | Ga0207676_10008483 | 3300026095 | Bacteria | 7307 |
| 689 | Ga0207676_10009522 | 3300026095 | Bacteria | 6915 |
| 690 | Ga0207676_10031676 | 3300026095 | Bacteria | 3978 |
| 691 | Ga0207676_10389840 | 3300026095 | Bacteria | 1299 |
| 692 | Ga0207674_10000527 | 3300026116 | Bacteria | 50282 |
| 693 | Ga0207674_10002277 | 3300026116 | Bacteria | 24338 |
| 694 | Ga0207674_10003088 | 3300026116 | Bacteria | 20583 |
| 695 | Ga0207674_10011531 | 3300026116 | Bacteria | 9928 |
| 696 | Ga0207674_10024167 | 3300026116 | Bacteria | 6497 |
| 697 | Ga0207674_10030316 | 3300026116 | Bacteria | 5688 |
| 698 | Ga0207674_10036857 | 3300026116 | Bacteria | 5090 |
| 699 | Ga0207674_10049289 | 3300026116 | Bacteria | 4308 |
| 700 | Ga0207674_10111820 | 3300026116 | Bacteria | 2705 |
| 701 | Ga0207674_10205136 | 3300026116 | Unclassified | 1921 |
| 702 | Ga0207674_10539760 | 3300026116 | Bacteria | 1127 |
| 703 | Ga0207675_100165697 | 3300026118 | Bacteria | 2110 |
| 704 | Ga0207675_100242894 | 3300026118 | Bacteria | 1740 |
| 705 | Ga0207675_100296014 | 3300026118 | Bacteria | 1575 |
| 706 | Ga0207675_100578154 | 3300026118 | Unclassified | 1125 |
| 707 | Ga0207675_100678760 | 3300026118 | Bacteria | 1038 |
| 708 | Ga0207683_10014943 | 3300026121 | Bacteria | 6608 |
| 709 | Ga0207683_10625691 | 3300026121 | Bacteria | 997 |
| 710 | Ga0207698_10000618 | 3300026142 | Bacteria | 20690 |
| 711 | Ga0207698_10001533 | 3300026142 | Bacteria | 13466 |
| 712 | Ga0207698_10007701 | 3300026142 | Bacteria | 6757 |
| 713 | Ga0207698_10009367 | 3300026142 | Bacteria | 6242 |
| 714 | Ga0207698_10046260 | 3300026142 | Bacteria | 3285 |
| 715 | Ga0207698_10280976 | 3300026142 | Bacteria | 1540 |
| 716 | Ga0207698_10361244 | 3300026142 | Unclassified | 1375 |
| 717 | Ga0207698_10379957 | 3300026142 | Bacteria | 1343 |
| 718 | Ga0207698_10397596 | 3300026142 | Bacteria | 1316 |
| 719 | Ga0207698_10727625 | 3300026142 | Bacteria | 989 |
| 720 | Ga0268266_10005677 | 3300028379 | Bacteria | 11570 |
| 721 | Ga0268266_10022882 | 3300028379 | Bacteria | 5318 |
| 722 | Ga0268266_10422373 | 3300028379 | Bacteria | 1263 |
| 723 | Ga0268265_10003245 | 3300028380 | Bacteria | 11805 |
| 724 | Ga0268265_10059407 | 3300028380 | Bacteria | 2925 |
| 725 | Ga0268265_10199537 | 3300028380 | Bacteria | 1734 |
| 726 | Ga0268265_11013896 | 3300028380 | Archaea | 820 |
| 727 | Ga0268264_10002543 | 3300028381 | Bacteria | 16012 |
| 728 | Ga0268264_10035529 | 3300028381 | Bacteria | 4104 |
| 729 | Ga0268264_10073947 | 3300028381 | Unclassified | 2894 |
| 730 | Ga0268264_10157795 | 3300028381 | Bacteria | 2040 |
| 731 | Ga0268264_10573422 | 3300028381 | Unclassified | 1109 |
| 732 | Ga0307513_10390646 | 3300031456 | Unclassified | 1128 |
| 733 | Ga0307408_100021556 | 3300031548 | Bacteria | 4362 |
| 734 | Ga0307408_101050659 | 3300031548 | Unclassified | 753 |
| 735 | Ga0307408_101720449 | 3300031548 | Unclassified | 598 |
| 736 | Ga0307405_10457021 | 3300031731 | Unclassified | 1014 |
| 737 | Ga0307405_10586539 | 3300031731 | Bacteria | 907 |
| 738 | Ga0307405_10881887 | 3300031731 | Unclassified | 755 |
| 739 | Ga0307413_10267439 | 3300031824 | Bacteria | 1278 |
| 740 | Ga0307413_10487033 | 3300031824 | Bacteria | 987 |
| 741 | Ga0307410_10107788 | 3300031852 | Bacteria | 2010 |
| 742 | Ga0307410_10135140 | 3300031852 | Unclassified | 1817 |
| 743 | Ga0307410_10342574 | 3300031852 | Unclassified | 1192 |
| 744 | Ga0307410_10408551 | 3300031852 | Bacteria | 1098 |
| 745 | Ga0307410_11529900 | 3300031852 | Unclassified | 588 |
| 746 | Ga0307406_10006893 | 3300031901 | Bacteria | 6292 |
| 747 | Ga0307406_10094729 | 3300031901 | Bacteria | 2019 |
| 748 | Ga0307406_10183254 | 3300031901 | Bacteria | 1526 |
| 749 | Ga0307406_10304271 | 3300031901 | Bacteria | 1226 |
| 750 | Ga0307406_11360434 | 3300031901 | Unclassified | 621 |
| 751 | Ga0307407_10007704 | 3300031903 | Bacteria | 4891 |
| 752 | Ga0307407_10520960 | 3300031903 | Bacteria | 874 |
| 753 | Ga0307412_10050121 | 3300031911 | Bacteria | 2754 |
| 754 | Ga0307412_10125807 | 3300031911 | Bacteria | 1854 |
| 755 | Ga0307412_10129002 | 3300031911 | Bacteria | 1834 |
| 756 | Ga0307409_100018684 | 3300031995 | Bacteria | 4670 |
| 757 | Ga0307409_100391047 | 3300031995 | Bacteria | 1325 |
| 758 | Ga0307409_100415965 | 3300031995 | Bacteria | 1288 |
| 759 | Ga0307409_101495403 | 3300031995 | Bacteria | 703 |
| 760 | Ga0307416_100034296 | 3300032002 | Bacteria | 3860 |
| 761 | Ga0307416_100186537 | 3300032002 | Bacteria | 1950 |
| 762 | Ga0307416_100798430 | 3300032002 | Bacteria | 1039 |
| 763 | Ga0307416_101024117 | 3300032002 | Unclassified | 929 |
| 764 | Ga0307416_101170537 | 3300032002 | Bacteria | 874 |
| 765 | Ga0307416_101697613 | 3300032002 | Unclassified | 736 |
| 766 | Ga0307414_12034875 | 3300032004 | Bacteria | 536 |
| 767 | Ga0307411_10208232 | 3300032005 | Bacteria | 1508 |
| 768 | Ga0307411_10308733 | 3300032005 | Bacteria | 1272 |
| 769 | Ga0307411_11720663 | 3300032005 | Bacteria | 581 |
| 770 | Ga0307415_100019849 | 3300032126 | Bacteria | 4089 |
| 771 | Ga0307415_100022433 | 3300032126 | Bacteria | 3896 |
| 772 | Ga0307415_100027339 | 3300032126 | Bacteria | 3613 |
| 773 | Ga0307415_100494859 | 3300032126 | Bacteria | 1067 |
| 774 | Ga0307415_100808616 | 3300032126 | Bacteria | 856 |
| 775 | Ga0373930_0092002 | 3300034816 | Unclassified | 712 |
| 776 | Ga0373938_0099370 | 3300034957 | Unclassified | 729 |
| 777 | Ga0373949_0066931 | 3300035090 | Unclassified | 934 |
| 778 | Ga0373951_0066124 | 3300035091 | Unclassified | 913 |
| 779 | Ga0373923_0002141 | 3300035111 | Bacteria | 5983 |
| 780 | Ga0373955_0006945 | 3300035172 | Bacteria | 5179 |
| 781 | Ga0373961_0010280 | 3300035241 | Bacteria | 2303 |
| 782 | Ga0373962_0085039 | 3300035242 | Unclassified | 966 |
| 783 | Ga0373933_0003124 | 3300035724 | Bacteria | 9231 |
| 784 | Ga0373937_0000641 | 3300036401 | Bacteria | 30684 |
| 785 | Ga0395899_0006584 | 3300037312 | Bacteria | 8999 |
| 786 | Ga0395899_0030400 | 3300037312 | Bacteria | 4062 |
| 787 | Ga0395899_0038361 | 3300037312 | Bacteria | 3588 |
| 788 | Ga0395899_0098825 | 3300037312 | Bacteria | 2109 |
| 789 | Ga0395899_0105236 | 3300037312 | Bacteria | 2033 |
| 790 | Ga0395899_0191082 | 3300037312 | Unclassified | 1433 |
| 791 | Ga0395899_0289732 | 3300037312 | Bacteria | 1111 |
| 792 | Ga0395899_0893212 | 3300037312 | Unclassified | 542 |
| 793 | Ga0395900_0106528 | 3300037418 | Bacteria | 2879 |
| 794 | Ga0395900_0107348 | 3300037418 | Bacteria | 2868 |
| 795 | Ga0395900_0176876 | 3300037418 | Bacteria | 2170 |
| 796 | Ga0395900_0177213 | 3300037418 | Bacteria | 2168 |
| 797 | Ga0395900_0245885 | 3300037418 | Bacteria | 1792 |
| 798 | Ga0395900_0254630 | 3300037418 | Unclassified | 1755 |
| 799 | Ga0395900_0262855 | 3300037418 | Bacteria | 1723 |
| 800 | Ga0395900_0355503 | 3300037418 | Bacteria | 1437 |
| 801 | Ga0395900_0442792 | 3300037418 | Bacteria | 1256 |
| 802 | Ga0395900_0480745 | 3300037418 | Bacteria | 1194 |
| 803 | Ga0395900_0582697 | 3300037418 | Bacteria | 1060 |
| 804 | Ga0395900_0591238 | 3300037418 | Unclassified | 1051 |
| 805 | Ga0395900_0607838 | 3300037418 | Bacteria | 1033 |
| 806 | Ga0395900_0880782 | 3300037418 | Bacteria | 819 |
| 807 | Ga0395900_1415124 | 3300037418 | Unclassified | 608 |
| 808 | Ga0395900_1515835 | 3300037418 | Unclassified | 582 |
| 809 | Ga0395900_1551262 | 3300037418 | Bacteria | 574 |
| 810 | Ga0395898_0018087 | 3300037466 | Bacteria | 7191 |
| 811 | Ga0395898_0197787 | 3300037466 | Bacteria | 1920 |
| 812 | Ga0395898_0242749 | 3300037466 | Bacteria | 1718 |
| 813 | Ga0395898_0253928 | 3300037466 | Bacteria | 1676 |
| 814 | Ga0395898_0263788 | 3300037466 | Unclassified | 1643 |
| 815 | Ga0395905_0000092 | 3300037471 | Bacteria | 149300 |
| 816 | Ga0395905_0008699 | 3300037471 | Bacteria | 9994 |
| 817 | Ga0395905_0017027 | 3300037471 | Bacteria | 6900 |
| 818 | Ga0395905_0021465 | 3300037471 | Bacteria | 6105 |
| 819 | Ga0395905_0033987 | 3300037471 | Bacteria | 4789 |
| 820 | Ga0395905_0070313 | 3300037471 | Bacteria | 3279 |
| 821 | Ga0395905_0088340 | 3300037471 | Bacteria | 2905 |
| 822 | Ga0395905_0141907 | 3300037471 | Bacteria | 2259 |
| 823 | Ga0395905_0179826 | 3300037471 | Bacteria | 1985 |
| 824 | Ga0395905_0200560 | 3300037471 | Bacteria | 1871 |
| 825 | Ga0395905_0226216 | 3300037471 | Unclassified | 1750 |
| 826 | Ga0395905_0306016 | 3300037471 | Bacteria | 1477 |
| 827 | Ga0395905_0552801 | 3300037471 | Bacteria | 1052 |
| 828 | Ga0395905_0560942 | 3300037471 | Bacteria | 1043 |
| 829 | Ga0395905_0645510 | 3300037471 | Unclassified | 960 |
| 830 | Ga0395905_0683408 | 3300037471 | Bacteria | 929 |
| 831 | Ga0395905_0727473 | 3300037471 | Bacteria | 895 |
| 832 | Ga0395905_1114477 | 3300037471 | Bacteria | 692 |
| 833 | Ga0395905_1438209 | 3300037471 | Unclassified | 594 |
| 834 | Ga0395905_1553021 | 3300037471 | Unclassified | 566 |
| 835 | Ga0395905_1568637 | 3300037471 | Unclassified | 563 |
| 836 | Ga0395901_0000268 | 3300038443 | Bacteria | 64837 |
| 837 | Ga0395901_0037677 | 3300038443 | Bacteria | 5000 |
| 838 | Ga0395901_0109048 | 3300038443 | Bacteria | 2906 |
| 839 | Ga0395901_0117722 | 3300038443 | Bacteria | 2791 |
| 840 | Ga0395901_0157477 | 3300038443 | Bacteria | 2385 |
| 841 | Ga0395901_0201949 | 3300038443 | Bacteria | 2083 |
| 842 | Ga0395901_0211352 | 3300038443 | Bacteria | 2030 |
| 843 | Ga0395901_0229427 | 3300038443 | Bacteria | 1939 |
| 844 | Ga0395901_0323654 | 3300038443 | Bacteria | 1595 |
| 845 | Ga0395901_0590479 | 3300038443 | Bacteria | 1121 |
| 846 | Ga0395901_0755119 | 3300038443 | Unclassified | 965 |
| 847 | Ga0395901_1876385 | 3300038443 | Unclassified | 547 |
| 848 | Ga0451855_1685400 | 3300041511 | Bacteria | 650 |
| 849 | Ga0439464_0000674 | 3300042439 | Bacteria | 7353 |
| 850 | Ga0466965_0306418 | 3300044683 | Unclassified | 863 |
| 851 | Ga0466961_0577514 | 3300044693 | Bacteria | 676 |
| 852 | Ga0466963_0002161 | 3300044694 | Bacteria | 10866 |
| 853 | Ga0466963_0002953 | 3300044694 | Bacteria | 9608 |
| 854 | Ga0466963_0078078 | 3300044694 | Bacteria | 2238 |
| 855 | Ga0466963_0144024 | 3300044694 | Bacteria | 1652 |
| 856 | Ga0466963_0180407 | 3300044694 | Bacteria | 1474 |
| 857 | Ga0466963_0245265 | 3300044694 | Unclassified | 1257 |
| 858 | Ga0466963_0308765 | 3300044694 | Bacteria | 1112 |
| 859 | Ga0466963_0438438 | 3300044694 | Bacteria | 921 |
| 860 | Ga0466963_0536849 | 3300044694 | Bacteria | 826 |
| 861 | Ga0466964_0871166 | 3300044706 | Unclassified | 513 |
| 862 | Ga0466971_0111804 | 3300044719 | Bacteria | 1261 |
| 863 | Ga0466970_0049888 | 3300044765 | Bacteria | 2232 |
| 864 | Ga0466957_0019839 | 3300044842 | Bacteria | 3957 |
| 865 | Ga0466957_0035844 | 3300044842 | Bacteria | 2978 |
| 866 | Ga0466957_0489150 | 3300044842 | Unclassified | 852 |
| 867 | Ga0466957_0519122 | 3300044842 | Unclassified | 827 |
| 868 | Ga0466957_1261126 | 3300044842 | Unclassified | 536 |
| 869 | Ga0466960_0435484 | 3300044901 | Unclassified | 760 |
| 870 | Ga0466959_0052591 | 3300045049 | Bacteria | 2982 |
| 871 | Ga0466959_0324334 | 3300045049 | Unclassified | 1052 |
| 872 | Ga0466958_0141356 | 3300045836 | Unclassified | 1515 |
| 873 | Ga0466967_0020400 | 3300045976 | Bacteria | 5356 |
| 874 | Ga0466967_0029143 | 3300045976 | Bacteria | 4616 |
| 875 | Ga0466967_0037978 | 3300045976 | Bacteria | 4127 |
| 876 | Ga0466967_0045428 | 3300045976 | Bacteria | 3816 |
| 877 | Ga0466967_0050943 | 3300045976 | Bacteria | 3626 |
| 878 | Ga0466967_0076801 | 3300045976 | Bacteria | 3005 |
| 879 | Ga0466967_0099774 | 3300045976 | Bacteria | 2652 |
| 880 | Ga0466967_0139429 | 3300045976 | Bacteria | 2257 |
| 881 | Ga0466967_0283333 | 3300045976 | Bacteria | 1590 |
| 882 | Ga0466967_0368833 | 3300045976 | Bacteria | 1392 |
| 883 | Ga0466967_0519627 | 3300045976 | Bacteria | 1170 |
| 884 | Ga0466967_0625859 | 3300045976 | Bacteria | 1063 |
| 885 | Ga0466967_0737680 | 3300045976 | Bacteria | 976 |
| 886 | Ga0466967_0796071 | 3300045976 | Bacteria | 938 |
| 887 | Ga0466967_0944532 | 3300045976 | Unclassified | 858 |
| 888 | Ga0466967_0947702 | 3300045976 | Bacteria | 856 |
| 889 | Ga0495598_0011985 | 3300046537 | Bacteria | 2114 |
| 890 | Ga0495621_0000006 | 3300046539 | Bacteria | 44306 |
| 891 | Ga0495633_0091937 | 3300046558 | Bacteria | 1410 |
| 892 | Ga0495669_0022152 | 3300046684 | Bacteria | 2760 |
| 893 | Ga0495669_0215423 | 3300046684 | Bacteria | 920 |
| 894 | Ga0495669_0243948 | 3300046684 | Bacteria | 862 |
| 895 | Ga0495670_0000238 | 3300046691 | Bacteria | 25286 |
| 896 | Ga0495677_0368719 | 3300047445 | Bacteria | 567 |
| 897 | Ga0495602_0057394 | 3300048088 | Bacteria | 3415 |
| 898 | Ga0496100_0867835 | 3300048903 | Unclassified | 708 |
| 899 | Ga0496102_0520496 | 3300048905 | Bacteria | 1112 |
| 900 | Ga0496102_0806018 | 3300048905 | Bacteria | 861 |
| 901 | Ga0496103_0066322 | 3300048906 | Bacteria | 2253 |
| 902 | Ga0496103_0067421 | 3300048906 | Bacteria | 2235 |
| 903 | Ga0496105_0256588 | 3300048908 | Bacteria | 1415 |
| 904 | Ga0496106_0266612 | 3300048909 | Unclassified | 1371 |
| 905 | Ga0496107_0032199 | 3300048910 | Bacteria | 3746 |
| 906 | Ga0496107_0168768 | 3300048910 | Bacteria | 1623 |
| 907 | Ga0496108_0004323 | 3300048911 | Bacteria | 11421 |
| 908 | Ga0496109_0148582 | 3300048912 | Unclassified | 2193 |
| 909 | Ga0496110_0018857 | 3300048913 | Bacteria | 5795 |
| 910 | Ga0496110_1124815 | 3300048913 | Unclassified | 694 |
| 911 | Ga0496111_0460234 | 3300048914 | Unclassified | 938 |
| 912 | Ga0496112_0016189 | 3300048915 | Bacteria | 6977 |
| 913 | Ga0496112_0309916 | 3300048915 | Bacteria | 1524 |
| 914 | Ga0496112_0797084 | 3300048915 | Unclassified | 870 |
| 915 | Ga0496113_1339998 | 3300048916 | Unclassified | 556 |
| 916 | Ga0501070_0737083 | 3300049586 | Bacteria | 777 |
| 917 | Ga0501071_0668488 | 3300049587 | Bacteria | 799 |
| 918 | Ga0501074_0115947 | 3300049590 | Bacteria | 1916 |
| 919 | Ga0501079_1330750 | 3300049741 | Unclassified | 565 |
| 920 | Ga0501080_0023202 | 3300049742 | Bacteria | 5754 |
| 921 | Ga0501080_0112494 | 3300049742 | Bacteria | 2524 |
| 922 | nmdc:mga0rr50_286977_c1 | 3300050513 | Unclassified | 1374 |
| 923 | Ga0587084_014175 | 3300059477 | Unclassified | 1107 |
| 924 | Ga0587084_017887 | 3300059477 | Unclassified | 1028 |
| 925 | Ga0587084_019545 | 3300059477 | Bacteria | 999 |
| 926 | Ga0587084_043786 | 3300059477 | Bacteria | 770 |
| 927 | Ga0587066_023228 | 3300059490 | Bacteria | 1045 |
| 928 | Ga0587066_027294 | 3300059490 | Bacteria | 992 |
| 929 | Ga0587066_034196 | 3300059490 | Bacteria | 924 |
| 930 | Ga0587066_139051 | 3300059490 | Unclassified | 591 |
| 931 | Ga0587070_018388 | 3300059491 | Unclassified | 1145 |
| 932 | Ga0587073_0029922 | 3300059492 | Unclassified | 1117 |
| 933 | Ga0587073_0041186 | 3300059492 | Bacteria | 1007 |
| 934 | Ga0587073_0248447 | 3300059492 | Unclassified | 557 |
| 935 | Ga0587077_034230 | 3300059493 | Bacteria | 986 |
| 936 | Ga0587077_045904 | 3300059493 | Bacteria | 896 |
| 937 | Ga0587080_021155 | 3300059503 | Bacteria | 1068 |
| 938 | Ga0587080_027021 | 3300059503 | Bacteria | 978 |
| 939 | Ga0587080_034007 | 3300059503 | Bacteria | 901 |
| 940 | Ga0587082_034001 | 3300059504 | Bacteria | 903 |
| 941 | Ga0587082_035086 | 3300059504 | Bacteria | 894 |
| 942 | Ga0587082_036180 | 3300059504 | Unclassified | 884 |
| 943 | Ga0587082_139513 | 3300059504 | Unclassified | 564 |
| 944 | Ga0587083_0029666 | 3300059505 | Bacteria | 1079 |
| 945 | Ga0587083_0050676 | 3300059505 | Bacteria | 904 |
| 946 | Ga0587083_0053251 | 3300059505 | Bacteria | 889 |
| 947 | Ga0587085_006090 | 3300059506 | Bacteria | 1452 |
| 948 | Ga0587085_024211 | 3300059506 | Bacteria | 950 |
| 949 | Ga0587086_014946 | 3300059507 | Bacteria | 996 |
| 950 | Ga0587086_020521 | 3300059507 | Bacteria | 898 |
| 951 | Ga0587088_005461 | 3300059508 | Bacteria | 1673 |
| 952 | Ga0587088_028967 | 3300059508 | Bacteria | 978 |
| 953 | Ga0587088_033577 | 3300059508 | Bacteria | 931 |
| 954 | Ga0587089_020133 | 3300059509 | Unclassified | 917 |
| 955 | Ga0587089_051640 | 3300059509 | Unclassified | 661 |
| 956 | Ga0587090_015200 | 3300059510 | Unclassified | 1135 |
| 957 | Ga0587090_018489 | 3300059510 | Bacteria | 1065 |
| 958 | Ga0587090_030190 | 3300059510 | Bacteria | 902 |
| 959 | Ga0587090_037292 | 3300059510 | Bacteria | 841 |
| 960 | Ga0587091_017818 | 3300059511 | Unclassified | 1201 |
| 961 | Ga0587091_024021 | 3300059511 | Bacteria | 1090 |
| 962 | Ga0587091_042426 | 3300059511 | Bacteria | 903 |
| 963 | Ga0587094_014432 | 3300059513 | Unclassified | 1079 |
| 964 | Ga0587094_018969 | 3300059513 | Bacteria | 983 |
| 965 | Ga0587095_005087 | 3300059514 | Bacteria | 984 |
| 966 | Ga0587095_006724 | 3300059514 | Bacteria | 899 |
| 967 | Ga0587074_03528 | 3300059602 | Unclassified | 555 |
| 968 | Ga0587106_015710 | 3300059605 | Bacteria | 1061 |
| 969 | Ga0587106_026336 | 3300059605 | Bacteria | 903 |
| 970 | Ga0587106_110278 | 3300059605 | Unclassified | 572 |
| 971 | Ga0587099_010211 | 3300059622 | Unclassified | 934 |
| 972 | Ga0587101_016965 | 3300059623 | Bacteria | 1004 |
| 973 | Ga0587101_019836 | 3300059623 | Bacteria | 957 |
| 974 | Ga0587109_038372 | 3300059624 | Unclassified | 940 |
| 975 | Ga0587113_009418 | 3300059625 | Bacteria | 885 |
| 976 | Ga0587128_020109 | 3300059630 | Bacteria | 1017 |
| 977 | Ga0587128_022297 | 3300059630 | Bacteria | 984 |
| 978 | Ga0587128_027758 | 3300059630 | Unclassified | 917 |
| 979 | Ga0587130_009408 | 3300059631 | Bacteria | 941 |
| 980 | Ga0587062_022745 | 3300059639 | Bacteria | 903 |
| 981 | Ga0587067_024876 | 3300059640 | Unclassified | 1061 |
| 982 | Ga0587067_038826 | 3300059640 | Bacteria | 916 |
| 983 | Ga0587068_031180 | 3300059641 | Bacteria | 925 |
| 984 | Ga0587068_033680 | 3300059641 | Bacteria | 900 |
| 985 | Ga0587069_019882 | 3300059642 | Bacteria | 997 |
| 986 | Ga0587069_030174 | 3300059642 | Bacteria | 872 |
| 987 | Ga0587069_124508 | 3300059642 | Unclassified | 550 |
| 988 | Ga0587072_031365 | 3300059643 | Bacteria | 994 |
| 989 | Ga0587072_038769 | 3300059643 | Bacteria | 918 |
| 990 | Ga0587075_012011 | 3300059644 | Bacteria | 1170 |
| 991 | Ga0587075_013438 | 3300059644 | Unclassified | 1126 |
| 992 | Ga0587075_016342 | 3300059644 | Bacteria | 1054 |
| 993 | Ga0587075_026979 | 3300059644 | Bacteria | 892 |
| 994 | Ga0587075_027629 | 3300059644 | Bacteria | 885 |
| 995 | Ga0587076_021445 | 3300059645 | Bacteria | 1070 |
| 996 | Ga0587076_035552 | 3300059645 | Bacteria | 906 |
| 997 | Ga0587076_036615 | 3300059645 | Bacteria | 898 |
| 998 | Ga0587078_001873 | 3300059646 | Bacteria | 1964 |
| 999 | Ga0587078_011898 | 3300059646 | Bacteria | 1016 |
| 1000 | Ga0587078_012899 | 3300059646 | Bacteria | 984 |
| 1001 | Ga0587079_026649 | 3300059647 | Unclassified | 1082 |
| 1002 | Ga0587079_032180 | 3300059647 | Bacteria | 1014 |
| 1003 | Ga0587079_063490 | 3300059647 | Unclassified | 806 |
| 1004 | Ga0587079_065604 | 3300059647 | Unclassified | 797 |
| 1005 | Ga0587102_007703 | 3300059649 | Bacteria | 1008 |
| 1006 | Ga0587102_023221 | 3300059649 | Bacteria | 715 |
| 1007 | Ga0587107_008996 | 3300059652 | Unclassified | 1168 |
| 1008 | Ga0587107_017830 | 3300059652 | Bacteria | 955 |
| 1009 | Ga0587107_017898 | 3300059652 | Bacteria | 953 |
| 1010 | Ga0587119_011274 | 3300059658 | Bacteria | 1027 |
| 1011 | Ga0587119_015410 | 3300059658 | Bacteria | 926 |
| 1012 | Ga0587071_027880 | 3300060344 | Unclassified | 1072 |
| 1013 | Ga0587071_028594 | 3300060344 | Unclassified | 1062 |
| 1014 | Ga0587071_030866 | 3300060344 | Bacteria | 1031 |
| 1015 | Ga0587071_040026 | 3300060344 | Bacteria | 936 |
| 1016 | Ga0587111_0052710 | 3300060346 | Bacteria | 903 |
| 1017 | Ga0587111_0088722 | 3300060346 | Unclassified | 751 |
| 1018 | Ga0466962_0115600 | 3300061719 | Unclassified | 1293 |
| 1019 | Ga0587089_021695 | |||
| 1020 | JGI24740J21852_10017128 | |||
| 1021 | JGI24739J22299_10005147 | |||
| 1022 | JGI24737J22298_10001371 | |||
| 1023 | JGI24737J22298_10001739 | |||
| 1024 | JGI24737J22298_10010090 | |||
| 1025 | JGI24737J22298_10115525 | |||
| 1026 | JGI24743J22301_10013607 | |||
| 1027 | JGI24743J22301_10061766 | |||
| 1028 | JGI24743J22301_10083134 | |||
| 1029 | JGI24735J21928_10003163 | |||
| 1030 | JGI24735J21928_10004503 | |||
| 1031 | JGI24735J21928_10133570 | |||
| 1032 | JGI24735J21928_10139576 | |||
| 1033 | JGI24735J21928_10140301 | |||
| 1034 | JGI24738J21930_10000372 | |||
| 1035 | JGI24738J21930_10001979 | |||
| 1036 | JGI24744J21845_10008807 | |||
| 1037 | Ga0058863_11670502 | |||
| 1038 | Ga0058863_11870082 | |||
| 1039 | Ga0058861_11885830 | |||
| 1040 | Ga0058861_12010952 | |||
| 1041 | Ga0058862_12414424 | |||
| 1042 | Ga0065712_10247602 | |||
| 1043 | Ga0065715_10524477 | |||
| 1044 | Ga0070658_10000477 | |||
| 1045 | Ga0070658_10017337 | |||
| 1046 | Ga0070658_10020280 | |||
| 1047 | Ga0070658_10046871 | |||
| 1048 | Ga0070658_10060437 | |||
| 1049 | Ga0070658_10133965 | |||
| 1050 | Ga0070658_10203782 | |||
| 1051 | Ga0070658_10290916 | |||
| 1052 | Ga0070658_10527296 | |||
| 1053 | Ga0070658_10682718 | |||
| 1054 | Ga0070676_10001347 | |||
| 1055 | Ga0070676_10003695 | |||
| 1056 | Ga0070676_10068888 | |||
| 1057 | Ga0070676_10120809 | |||
| 1058 | Ga0070676_11095783 | |||
| 1059 | Ga0070683_100000747 | |||
| 1060 | Ga0070683_100005454 | |||
| 1061 | Ga0070683_100010424 | |||
| 1062 | Ga0070683_100174143 | |||
| 1063 | Ga0070683_100268394 | |||
| 1064 | Ga0070683_100480230 | |||
| 1065 | Ga0070683_100749937 | |||
| 1066 | Ga0070683_100988990 | |||
| 1067 | Ga0070690_100020500 | |||
| 1068 | Ga0070690_100062783 | |||
| 1069 | Ga0070670_100039466 | |||
| 1070 | Ga0070670_100379339 | |||
| 1071 | Ga0070670_100498666 | |||
| 1072 | Ga0070670_100564450 | |||
| 1073 | Ga0070670_100980266 | |||
| 1074 | Ga0070677_10041571 | |||
| 1075 | Ga0068869_100006276 | |||
| 1076 | Ga0068869_100095563 | |||
| 1077 | Ga0068869_101175150 | |||
| 1078 | Ga0070666_10002947 | |||
| 1079 | Ga0070666_10052734 | |||
| 1080 | Ga0070666_10070029 | |||
| 1081 | Ga0070666_10135878 | |||
| 1082 | Ga0070680_100147453 | |||
| 1083 | Ga0070680_100214594 | |||
| 1084 | Ga0070680_100739970 | |||
| 1085 | Ga0070680_101013615 | |||
| 1086 | Ga0070682_100001753 | |||
| 1087 | Ga0070682_100043356 | |||
| 1088 | Ga0070682_100072790 | |||
| 1089 | Ga0070682_101568571 | |||
| 1090 | Ga0068868_100044049 | |||
| 1091 | Ga0068868_100196288 | |||
| 1092 | Ga0068868_100463282 | |||
| 1093 | Ga0068868_100537440 | |||
| 1094 | Ga0068868_101062679 | |||
| 1095 | Ga0070660_100000425 | |||
| 1096 | Ga0070660_100003141 | |||
| 1097 | Ga0070660_100240795 | |||
| 1098 | Ga0070660_100303797 | |||
| 1099 | Ga0070660_100470796 | |||
| 1100 | Ga0070660_100474837 | |||
| 1101 | Ga0070660_101008537 | |||
| 1102 | Ga0070660_101219972 | |||
| 1103 | Ga0070689_100004740 | |||
| 1104 | Ga0070691_10035664 | |||
| 1105 | Ga0070687_100212620 | |||
| 1106 | Ga0070687_100391664 | |||
| 1107 | Ga0070661_100000552 | |||
| 1108 | Ga0070661_100001960 | |||
| 1109 | Ga0070661_100002092 | |||
| 1110 | Ga0070661_100008264 | |||
| 1111 | Ga0070661_100036793 | |||
| 1112 | Ga0070661_100044834 | |||
| 1113 | Ga0070661_100133827 | |||
| 1114 | Ga0070661_100182595 | |||
| 1115 | Ga0070661_100584815 | |||
| 1116 | Ga0070661_101227442 | |||
| 1117 | Ga0070661_101458345 | |||
| 1118 | Ga0070692_10034895 | |||
| 1119 | Ga0070692_10119051 | |||
| 1120 | Ga0070668_100001719 | |||
| 1121 | Ga0070668_100022957 | |||
| 1122 | Ga0070669_100021055 | |||
| 1123 | Ga0070669_100614306 | |||
| 1124 | Ga0070669_100666619 | |||
| 1125 | Ga0070675_100301932 | |||
| 1126 | Ga0070671_100012445 | |||
| 1127 | Ga0070671_100033760 | |||
| 1128 | Ga0070671_100034275 | |||
| 1129 | Ga0070671_100054845 | |||
| 1130 | Ga0070671_100121365 | |||
| 1131 | Ga0070671_100126515 | |||
| 1132 | Ga0070674_100036573 | |||
| 1133 | Ga0070674_100057775 | |||
| 1134 | Ga0070673_100001046 | |||
| 1135 | Ga0070673_100001556 | |||
| 1136 | Ga0070673_100133524 | |||
| 1137 | Ga0070673_100178351 | |||
| 1138 | Ga0070673_100543444 | |||
| 1139 | Ga0070673_100996216 | |||
| 1140 | Ga0070659_100000065 | |||
| 1141 | Ga0070659_100011551 | |||
| 1142 | Ga0070659_100013967 | |||
| 1143 | Ga0070659_100016237 | |||
| 1144 | Ga0070659_100040228 | |||
| 1145 | Ga0070659_100041644 | |||
| 1146 | Ga0070659_100068005 | |||
| 1147 | Ga0070659_100089596 | |||
| 1148 | Ga0070659_100140975 | |||
| 1149 | Ga0070659_100257942 | |||
| 1150 | Ga0070659_100603853 | |||
| 1151 | Ga0070659_101099487 | |||
| 1152 | Ga0070659_101117178 | |||
| 1153 | Ga0070659_101982550 | |||
| 1154 | Ga0070667_100008194 | |||
| 1155 | Ga0070667_100011257 | |||
| 1156 | Ga0070667_100020823 | |||
| 1157 | Ga0070667_100024205 | |||
| 1158 | Ga0070667_100032912 | |||
| 1159 | Ga0070667_100086776 | |||
| 1160 | Ga0070667_100228041 | |||
| 1161 | Ga0070667_100263961 | |||
| 1162 | Ga0070667_100383781 | |||
| 1163 | Ga0070667_100385592 | |||
| 1164 | Ga0070709_10770043 | |||
| 1165 | Ga0070714_100089684 | |||
| 1166 | Ga0070714_100956649 | |||
| 1167 | Ga0070713_100347612 | |||
| 1168 | Ga0070713_102240953 | |||
| 1169 | Ga0070663_100000647 | |||
| 1170 | Ga0070663_100001839 | |||
| 1171 | Ga0070663_100027782 | |||
| 1172 | Ga0070663_100126737 | |||
| 1173 | Ga0070663_100131939 | |||
| 1174 | Ga0070663_100161020 | |||
| 1175 | Ga0070663_100225129 | |||
| 1176 | Ga0070663_100242476 | |||
| 1177 | Ga0070663_100905861 | |||
| 1178 | Ga0070663_101033811 | |||
| 1179 | Ga0070663_101141897 | |||
| 1180 | Ga0070678_100074997 | |||
| 1181 | Ga0070678_100098389 | |||
| 1182 | Ga0070678_100724892 | |||
| 1183 | Ga0070662_100000010 | |||
| 1184 | Ga0070662_100000323 | |||
| 1185 | Ga0070662_100034343 | |||
| 1186 | Ga0070662_100103504 | |||
| 1187 | Ga0070662_100168055 | |||
| 1188 | Ga0070662_100180546 | |||
| 1189 | Ga0070662_100211513 | |||
| 1190 | Ga0070662_100287009 | |||
| 1191 | Ga0070662_100543773 | |||
| 1192 | Ga0070662_101383194 | |||
| 1193 | Ga0070681_10013516 | |||
| 1194 | Ga0070681_10152303 | |||
| 1195 | Ga0070681_10257261 | |||
| 1196 | Ga0068867_100004677 | |||
| 1197 | Ga0068867_100013102 | |||
| 1198 | Ga0068867_100278207 | |||
| 1199 | Ga0068867_100301265 | |||
| 1200 | Ga0068867_100520616 | |||
| 1201 | Ga0068867_101441810 | |||
| 1202 | Ga0070685_10239772 | |||
| 1203 | Ga0070679_100014856 | |||
| 1204 | Ga0070679_100128950 | |||
| 1205 | Ga0070679_100181220 | |||
| 1206 | Ga0070679_100398756 | |||
| 1207 | Ga0070679_100526550 | |||
| 1208 | Ga0070679_100946217 | |||
| 1209 | Ga0070679_101329082 | |||
| 1210 | Ga0070679_101519181 | |||
| 1211 | Ga0070679_102074640 | |||
| 1212 | Ga0070684_100029987 | |||
| 1213 | Ga0070684_100094566 | |||
| 1214 | Ga0070684_100121740 | |||
| 1215 | Ga0070684_100541159 | |||
| 1216 | Ga0070684_102071085 | |||
| 1217 | Ga0068853_100000067 | |||
| 1218 | Ga0068853_100011651 | |||
| 1219 | Ga0068853_100025346 | |||
| 1220 | Ga0068853_100030531 | |||
| 1221 | Ga0068853_100178754 | |||
| 1222 | Ga0068853_100195932 | |||
| 1223 | Ga0068853_100409380 | |||
| 1224 | Ga0070672_100023632 | |||
| 1225 | Ga0070672_100048432 | |||
| 1226 | Ga0070672_100095965 | |||
| 1227 | Ga0070686_100805827 | |||
| 1228 | Ga0070696_100089379 | |||
| 1229 | Ga0070696_100619486 | |||
| 1230 | Ga0070696_100815875 | |||
| 1231 | Ga0070693_100000343 | |||
| 1232 | Ga0070693_100012856 | |||
| 1233 | Ga0070693_100015026 | |||
| 1234 | Ga0070693_100034700 | |||
| 1235 | Ga0070693_100068659 | |||
| 1236 | Ga0070693_100076941 | |||
| 1237 | Ga0070665_100013969 | |||
| 1238 | Ga0070665_100100909 | |||
| 1239 | Ga0070665_100119667 | |||
| 1240 | Ga0070665_100453511 | |||
| 1241 | Ga0070665_100516987 | |||
| 1242 | Ga0068855_100017249 | |||
| 1243 | Ga0068855_100018104 | |||
| 1244 | Ga0068855_100066116 | |||
| 1245 | Ga0068855_100079415 | |||
| 1246 | Ga0068855_100109434 | |||
| 1247 | Ga0068855_100295644 | |||
| 1248 | Ga0068855_100558573 | |||
| 1249 | Ga0068855_100751142 | |||
| 1250 | Ga0068855_101023477 | |||
| 1251 | Ga0070664_100000228 | |||
| 1252 | Ga0070664_100002696 | |||
| 1253 | Ga0070664_100006881 | |||
| 1254 | Ga0070664_100009565 | |||
| 1255 | Ga0070664_100059968 | |||
| 1256 | Ga0070664_100071624 | |||
| 1257 | Ga0070664_100088394 | |||
| 1258 | Ga0070664_100276125 | |||
| 1259 | Ga0070664_100529306 | |||
| 1260 | Ga0070664_100578245 | |||
| 1261 | Ga0070664_100681133 | |||
| 1262 | Ga0070664_100862659 | |||
| 1263 | Ga0070664_100962590 | |||
| 1264 | Ga0070664_100977906 | |||
| 1265 | Ga0070664_102183787 | |||
| 1266 | Ga0068857_100005960 | |||
| 1267 | Ga0068857_100018518 | |||
| 1268 | Ga0068857_100026322 | |||
| 1269 | Ga0068857_100208346 | |||
| 1270 | Ga0068857_100354085 | |||
| 1271 | Ga0068857_100380990 | |||
| 1272 | Ga0068857_100413628 | |||
| 1273 | Ga0068857_100561577 | |||
| 1274 | Ga0068857_100773393 | |||
| 1275 | Ga0068857_102154810 | |||
| 1276 | Ga0068854_100001913 | |||
| 1277 | Ga0068854_100006418 | |||
| 1278 | Ga0068854_100011321 | |||
| 1279 | Ga0068854_100025191 | |||
| 1280 | Ga0068854_100083818 | |||
| 1281 | Ga0068854_100411489 | |||
| 1282 | Ga0068856_100000101 | |||
| 1283 | Ga0068856_100023316 | |||
| 1284 | Ga0068856_100061342 | |||
| 1285 | Ga0068856_100079964 | |||
| 1286 | Ga0068856_100153835 | |||
| 1287 | Ga0068856_100334692 | |||
| 1288 | Ga0068856_100391785 | |||
| 1289 | Ga0068856_100689227 | |||
| 1290 | Ga0070702_100377282 | |||
| 1291 | Ga0068852_100000846 | |||
| 1292 | Ga0068852_100001433 | |||
| 1293 | Ga0068852_100003781 | |||
| 1294 | Ga0068852_100013090 | |||
| 1295 | Ga0068852_100023726 | |||
| 1296 | Ga0068852_100087984 | |||
| 1297 | Ga0068852_100093334 | |||
| 1298 | Ga0068852_100094713 | |||
| 1299 | Ga0068852_100437703 | |||
| 1300 | Ga0068852_102470375 | |||
| 1301 | Ga0068859_100048611 | |||
| 1302 | Ga0068859_100054434 | |||
| 1303 | Ga0068859_100092224 | |||
| 1304 | Ga0068859_100379073 | |||
| 1305 | Ga0068859_100904590 | |||
| 1306 | Ga0068864_100000222 | |||
| 1307 | Ga0068864_100007380 | |||
| 1308 | Ga0068864_100089427 | |||
| 1309 | Ga0068864_100180268 | |||
| 1310 | Ga0068861_100169755 | |||
| 1311 | Ga0068861_100329298 | |||
| 1312 | Ga0068861_100430982 | |||
| 1313 | Ga0068861_100485890 | |||
| 1314 | Ga0068851_10032858 | |||
| 1315 | Ga0068851_10047700 | |||
| 1316 | Ga0068851_10051292 | |||
| 1317 | Ga0068851_10154026 | |||
| 1318 | Ga0068851_10167365 | |||
| 1319 | Ga0068870_10103315 | |||
| 1320 | Ga0068863_100002567 | |||
| 1321 | Ga0068863_100034901 | |||
| 1322 | Ga0068863_100116639 | |||
| 1323 | Ga0068863_100360451 | |||
| 1324 | Ga0068863_100770831 | |||
| 1325 | Ga0068858_100003320 | |||
| 1326 | Ga0068858_100007141 | |||
| 1327 | Ga0068860_100006803 | |||
| 1328 | Ga0068860_100061591 | |||
| 1329 | Ga0068860_100073377 | |||
| 1330 | Ga0068860_100245076 | |||
| 1331 | Ga0068862_100091796 | |||
| 1332 | Ga0068862_100253229 | |||
| 1333 | Ga0097621_100051529 | |||
| 1334 | Ga0097621_100357207 | |||
| 1335 | Ga0097621_100493047 | |||
| 1336 | Ga0097621_100561732 | |||
| 1337 | Ga0097621_101019463 | |||
| 1338 | Ga0097621_101092693 | |||
| 1339 | Ga0068871_100011090 | |||
| 1340 | Ga0068871_100379801 | |||
| 1341 | Ga0068871_100623150 | |||
| 1342 | Ga0068871_100662228 | |||
| 1343 | Ga0068871_101378884 | |||
| 1344 | Ga0068865_100006056 | |||
| 1345 | Ga0068865_100034925 | |||
| 1346 | Ga0097620_100048612 | |||
| 1347 | Ga0097620_100054439 | |||
| 1348 | Ga0097620_100092228 | |||
| 1349 | Ga0097620_100379074 | |||
| 1350 | Ga0097620_100904739 | |||
| 1351 | Ga0075435_100734814 | |||
| 1352 | Ga0105240_10087961 | |||
| 1353 | Ga0105245_10006125 | |||
| 1354 | Ga0105241_10032907 | |||
| 1355 | Ga0105241_10130207 | |||
| 1356 | Ga0105241_10157917 | |||
| 1357 | Ga0105241_10342051 | |||
| 1358 | Ga0105241_10702355 | |||
| 1359 | Ga0105242_10185671 | |||
| 1360 | Ga0105248_10001119 | |||
| 1361 | Ga0105248_10054729 | |||
| 1362 | Ga0105248_10228619 | |||
| 1363 | Ga0105248_10463115 | |||
| 1364 | Ga0105248_10829284 | |||
| 1365 | Ga0105248_11767199 | |||
| 1366 | Ga0105248_12304511 | |||
| 1367 | Ga0105237_10006758 | |||
| 1368 | Ga0105238_10004367 | |||
| 1369 | Ga0105238_10051275 | |||
| 1370 | Ga0105238_10063618 | |||
| 1371 | Ga0105238_10111637 | |||
| 1372 | Ga0105238_10327601 | |||
| 1373 | Ga0105238_12295790 | |||
| 1374 | Ga0105249_10320235 | |||
| 1375 | Ga0105249_10935063 | |||
| 1376 | Ga0105239_10054356 | |||
| 1377 | Ga0105239_10261369 | |||
| 1378 | Ga0105246_10008301 | |||
| 1379 | Ga0105246_10278750 | |||
| 1380 | Ga0157373_10009790 | |||
| 1381 | Ga0157373_10031339 | |||
| 1382 | Ga0157373_10059487 | |||
| 1383 | Ga0157373_10090355 | |||
| 1384 | Ga0157373_10092027 | |||
| 1385 | Ga0157373_10092672 | |||
| 1386 | Ga0157373_10102375 | |||
| 1387 | Ga0157373_10193781 | |||
| 1388 | Ga0157373_10272822 | |||
| 1389 | Ga0157373_10301096 | |||
| 1390 | Ga0157373_10463145 | |||
| 1391 | Ga0157371_10003821 | |||
| 1392 | Ga0157371_10025025 | |||
| 1393 | Ga0157371_10026453 | |||
| 1394 | Ga0157371_10075155 | |||
| 1395 | Ga0157371_10092512 | |||
| 1396 | Ga0157371_10128560 | |||
| 1397 | Ga0157371_10870781 | |||
| 1398 | Ga0157371_10939038 | |||
| 1399 | Ga0157371_11244993 | |||
| 1400 | Ga0157370_10059532 | |||
| 1401 | Ga0157370_10741220 | |||
| 1402 | Ga0157370_10929875 | |||
| 1403 | Ga0157369_10003181 | |||
| 1404 | Ga0157369_10032210 | |||
| 1405 | Ga0157369_10202481 | |||
| 1406 | Ga0157369_10259977 | |||
| 1407 | Ga0157369_10733218 | |||
| 1408 | Ga0157369_10922308 | |||
| 1409 | Ga0157374_10303006 | |||
| 1410 | Ga0157374_10480692 | |||
| 1411 | Ga0157374_10519081 | |||
| 1412 | Ga0157378_10006532 | |||
| 1413 | Ga0157378_10007074 | |||
| 1414 | Ga0157378_10344935 | |||
| 1415 | Ga0163162_10032625 | |||
| 1416 | Ga0163162_10438663 | |||
| 1417 | Ga0157372_10011784 | |||
| 1418 | Ga0157372_10035809 | |||
| 1419 | Ga0157372_10045014 | |||
| 1420 | Ga0157372_10046828 | |||
| 1421 | Ga0157372_10359554 | |||
| 1422 | Ga0157372_11666553 | |||
| 1423 | Ga0157372_12909297 | |||
| 1424 | Ga0157375_10007221 | |||
| 1425 | Ga0157375_10024264 | |||
| 1426 | Ga0157375_10271200 | |||
| 1427 | Ga0163163_10019125 | |||
| 1428 | Ga0157377_10204425 | |||
| 1429 | Ga0157379_10165064 | |||
| 1430 | Ga0157379_10182441 | |||
| 1431 | Ga0157379_11204648 | |||
| 1432 | Ga0157376_10684688 | |||
| 1433 | Ga0163161_10485228 | |||
| 1434 | Ga0197907_10034936 | |||
| 1435 | Ga0197907_11002332 | |||
| 1436 | Ga0206356_10307274 | |||
| 1437 | Ga0206356_11292785 | |||
| 1438 | Ga0206356_11311979 | |||
| 1439 | Ga0206356_11638823 | |||
| 1440 | Ga0206352_10699940 | |||
| 1441 | Ga0206354_10948750 | |||
| 1442 | Ga0206353_10732796 | |||
| 1443 | Ga0224712_10171006 | |||
| 1444 | Ga0224712_10205286 | |||
| 1445 | Ga0207673_1020061 | |||
| 1446 | Ga0207697_10000158 | |||
| 1447 | Ga0207697_10022280 | |||
| 1448 | Ga0207697_10028059 | |||
| 1449 | Ga0207697_10112020 | |||
| 1450 | Ga0207656_10003880 | |||
| 1451 | Ga0207656_10042249 | |||
| 1452 | Ga0207656_10061879 | |||
| 1453 | Ga0207656_10461209 | |||
| 1454 | Ga0207713_1039137 | |||
| 1455 | Ga0207682_10035101 | |||
| 1456 | Ga0207642_10364144 | |||
| 1457 | Ga0207688_10007071 | |||
| 1458 | Ga0207688_10126968 | |||
| 1459 | Ga0207680_10517167 | |||
| 1460 | Ga0207647_10000832 | |||
| 1461 | Ga0207647_10004000 | |||
| 1462 | Ga0207647_10008390 | |||
| 1463 | Ga0207647_10061274 | |||
| 1464 | Ga0207647_10064373 | |||
| 1465 | Ga0207647_10079630 | |||
| 1466 | Ga0207647_10464687 | |||
| 1467 | Ga0207645_10003931 | |||
| 1468 | Ga0207645_10004831 | |||
| 1469 | Ga0207645_10008901 | |||
| 1470 | Ga0207645_10063906 | |||
| 1471 | Ga0207645_10112926 | |||
| 1472 | Ga0207643_10054699 | |||
| 1473 | Ga0207643_10173377 | |||
| 1474 | Ga0207643_10254530 | |||
| 1475 | Ga0207705_10000113 | |||
| 1476 | Ga0207705_10010345 | |||
| 1477 | Ga0207705_10038951 | |||
| 1478 | Ga0207705_10059966 | |||
| 1479 | Ga0207705_10060833 | |||
| 1480 | Ga0207705_10065521 | |||
| 1481 | Ga0207705_10065899 | |||
| 1482 | Ga0207705_10077431 | |||
| 1483 | Ga0207705_10186859 | |||
| 1484 | Ga0207705_10261160 | |||
| 1485 | Ga0207705_11141639 | |||
| 1486 | Ga0207654_10106813 | |||
| 1487 | Ga0207654_10178036 | |||
| 1488 | Ga0207707_10008907 | |||
| 1489 | Ga0207707_10453823 | |||
| 1490 | Ga0207707_10495635 | |||
| 1491 | Ga0207695_10622836 | |||
| 1492 | Ga0207671_10017531 | |||
| 1493 | Ga0207693_10016003 | |||
| 1494 | Ga0207660_10007589 | |||
| 1495 | Ga0207660_10034958 | |||
| 1496 | Ga0207660_10440534 | |||
| 1497 | Ga0207660_10535163 | |||
| 1498 | Ga0207660_10665417 | |||
| 1499 | Ga0207660_10682176 | |||
| 1500 | Ga0207660_11701896 | |||
| 1501 | Ga0207662_10030474 | |||
| 1502 | Ga0207662_10077107 | |||
| 1503 | Ga0207662_10170760 | |||
| 1504 | Ga0207657_10000026 | |||
| 1505 | Ga0207657_10002103 | |||
| 1506 | Ga0207657_10005900 | |||
| 1507 | Ga0207657_10007800 | |||
| 1508 | Ga0207657_10038093 | |||
| 1509 | Ga0207657_10050216 | |||
| 1510 | Ga0207657_10093297 | |||
| 1511 | Ga0207657_10167001 | |||
| 1512 | Ga0207657_10281976 | |||
| 1513 | Ga0207657_10862110 | |||
| 1514 | Ga0207649_10000516 | |||
| 1515 | Ga0207649_10002740 | |||
| 1516 | Ga0207649_10032422 | |||
| 1517 | Ga0207649_10038842 | |||
| 1518 | Ga0207649_10070046 | |||
| 1519 | Ga0207649_10085352 | |||
| 1520 | Ga0207649_10183527 | |||
| 1521 | Ga0207649_10517552 | |||
| 1522 | Ga0207652_10026485 | |||
| 1523 | Ga0207652_10095828 | |||
| 1524 | Ga0207652_10220094 | |||
| 1525 | Ga0207652_10298249 | |||
| 1526 | Ga0207652_10338914 | |||
| 1527 | Ga0207652_10437556 | |||
| 1528 | Ga0207652_10487035 | |||
| 1529 | Ga0207652_10825776 | |||
| 1530 | Ga0207652_11286989 | |||
| 1531 | Ga0207681_10047787 | |||
| 1532 | Ga0207681_10056834 | |||
| 1533 | Ga0207681_10277952 | |||
| 1534 | Ga0207694_10000776 | |||
| 1535 | Ga0207694_10005699 | |||
| 1536 | Ga0207694_10185516 | |||
| 1537 | Ga0207694_10334497 | |||
| 1538 | Ga0207694_10921080 | |||
| 1539 | Ga0207694_11500997 | |||
| 1540 | Ga0207650_10028115 | |||
| 1541 | Ga0207650_10142089 | |||
| 1542 | Ga0207659_10835872 | |||
| 1543 | Ga0207687_10048079 | |||
| 1544 | Ga0207687_10062974 | |||
| 1545 | Ga0207664_10146782 | |||
| 1546 | Ga0207664_10161196 | |||
| 1547 | Ga0207664_10251689 | |||
| 1548 | Ga0207664_10374847 | |||
| 1549 | Ga0207664_10801546 | |||
| 1550 | Ga0207644_10022380 | |||
| 1551 | Ga0207644_10033303 | |||
| 1552 | Ga0207644_10033934 | |||
| 1553 | Ga0207644_10209882 | |||
| 1554 | Ga0207644_10227290 | |||
| 1555 | Ga0207690_10000649 | |||
| 1556 | Ga0207690_10002369 | |||
| 1557 | Ga0207690_10002565 | |||
| 1558 | Ga0207690_10012713 | |||
| 1559 | Ga0207690_10017432 | |||
| 1560 | Ga0207690_10050183 | |||
| 1561 | Ga0207690_10201848 | |||
| 1562 | Ga0207690_10219429 | |||
| 1563 | Ga0207690_10238263 | |||
| 1564 | Ga0207690_10369349 | |||
| 1565 | Ga0207690_10413049 | |||
| 1566 | Ga0207690_10429139 | |||
| 1567 | Ga0207690_10640821 | |||
| 1568 | Ga0207690_11098335 | |||
| 1569 | Ga0207706_10000031 | |||
| 1570 | Ga0207706_10000829 | |||
| 1571 | Ga0207706_10002893 | |||
| 1572 | Ga0207706_10008630 | |||
| 1573 | Ga0207706_10024282 | |||
| 1574 | Ga0207706_10038293 | |||
| 1575 | Ga0207706_10055308 | |||
| 1576 | Ga0207706_10081488 | |||
| 1577 | Ga0207706_10101934 | |||
| 1578 | Ga0207706_10158840 | |||
| 1579 | Ga0207706_10216949 | |||
| 1580 | Ga0207706_10260604 | |||
| 1581 | Ga0207706_10676408 | |||
| 1582 | Ga0207706_10963687 | |||
| 1583 | Ga0207686_10362636 | |||
| 1584 | Ga0207709_10681923 | |||
| 1585 | Ga0207670_10044294 | |||
| 1586 | Ga0207669_10108579 | |||
| 1587 | Ga0207669_10828103 | |||
| 1588 | Ga0207704_10060374 | |||
| 1589 | Ga0207704_11009349 | |||
| 1590 | Ga0207704_11083528 | |||
| 1591 | Ga0207691_10003632 | |||
| 1592 | Ga0207691_10061499 | |||
| 1593 | Ga0207691_10134809 | |||
| 1594 | Ga0207691_10144668 | |||
| 1595 | Ga0207711_10000446 | |||
| 1596 | Ga0207711_10002065 | |||
| 1597 | Ga0207711_10007845 | |||
| 1598 | Ga0207711_10117724 | |||
| 1599 | Ga0207711_10226883 | |||
| 1600 | Ga0207711_10287123 | |||
| 1601 | Ga0207711_10733378 | |||
| 1602 | Ga0207711_11023149 | |||
| 1603 | Ga0207689_10000017 | |||
| 1604 | Ga0207689_10025109 | |||
| 1605 | Ga0207689_10037964 | |||
| 1606 | Ga0207689_10066588 | |||
| 1607 | Ga0207689_10426773 | |||
| 1608 | Ga0207661_10013965 | |||
| 1609 | Ga0207661_10030599 | |||
| 1610 | Ga0207661_10031712 | |||
| 1611 | Ga0207661_10235922 | |||
| 1612 | Ga0207661_10783699 | |||
| 1613 | Ga0207661_11073666 | |||
| 1614 | Ga0207679_10000236 | |||
| 1615 | Ga0207679_10008515 | |||
| 1616 | Ga0207679_10032946 | |||
| 1617 | Ga0207679_10088718 | |||
| 1618 | Ga0207679_10100327 | |||
| 1619 | Ga0207679_10118558 | |||
| 1620 | Ga0207679_10134912 | |||
| 1621 | Ga0207679_10175160 | |||
| 1622 | Ga0207679_10201523 | |||
| 1623 | Ga0207679_10354516 | |||
| 1624 | Ga0207679_10531731 | |||
| 1625 | Ga0207679_11442595 | |||
| 1626 | Ga0207679_12014802 | |||
| 1627 | Ga0207667_10001718 | |||
| 1628 | Ga0207667_10081840 | |||
| 1629 | Ga0207667_10132858 | |||
| 1630 | Ga0207667_10720816 | |||
| 1631 | Ga0207667_11750098 | |||
| 1632 | Ga0207651_10029701 | |||
| 1633 | Ga0207651_10116028 | |||
| 1634 | Ga0207651_10432706 | |||
| 1635 | Ga0207651_10538401 | |||
| 1636 | Ga0207651_11127555 | |||
| 1637 | Ga0207651_11547410 | |||
| 1638 | Ga0207651_12017645 | |||
| 1639 | Ga0207712_10079041 | |||
| 1640 | Ga0207668_10002157 | |||
| 1641 | Ga0207668_10073156 | |||
| 1642 | Ga0207640_10007503 | |||
| 1643 | Ga0207640_10010090 | |||
| 1644 | Ga0207640_10032101 | |||
| 1645 | Ga0207640_10034294 | |||
| 1646 | Ga0207640_10107025 | |||
| 1647 | Ga0207640_10114939 | |||
| 1648 | Ga0207640_10128956 | |||
| 1649 | Ga0207640_11504686 | |||
| 1650 | Ga0207658_10017651 | |||
| 1651 | Ga0207658_10018455 | |||
| 1652 | Ga0207658_10027437 | |||
| 1653 | Ga0207658_10036587 | |||
| 1654 | Ga0207658_10072042 | |||
| 1655 | Ga0207658_10078804 | |||
| 1656 | Ga0207658_10080766 | |||
| 1657 | Ga0207658_10094610 | |||
| 1658 | Ga0207677_10102695 | |||
| 1659 | Ga0207677_10298705 | |||
| 1660 | Ga0207677_10765304 | |||
| 1661 | Ga0207677_10815524 | |||
| 1662 | Ga0207703_10025106 | |||
| 1663 | Ga0207703_10065655 | |||
| 1664 | Ga0207703_10088896 | |||
| 1665 | Ga0207703_10135939 | |||
| 1666 | Ga0207639_10005817 | |||
| 1667 | Ga0207639_10070955 | |||
| 1668 | Ga0207639_10095747 | |||
| 1669 | Ga0207639_10108892 | |||
| 1670 | Ga0207639_10205373 | |||
| 1671 | Ga0207639_10385639 | |||
| 1672 | Ga0207639_10770962 | |||
| 1673 | Ga0207678_10002668 | |||
| 1674 | Ga0207678_10010119 | |||
| 1675 | Ga0207678_10010859 | |||
| 1676 | Ga0207678_10012250 | |||
| 1677 | Ga0207678_10023738 | |||
| 1678 | Ga0207678_10138368 | |||
| 1679 | Ga0207678_10154857 | |||
| 1680 | Ga0207678_10176738 | |||
| 1681 | Ga0207678_10209384 | |||
| 1682 | Ga0207678_10300599 | |||
| 1683 | Ga0207678_10502746 | |||
| 1684 | Ga0207678_10586127 | |||
| 1685 | Ga0207708_10326846 | |||
| 1686 | Ga0207708_10327175 | |||
| 1687 | Ga0207702_10010631 | |||
| 1688 | Ga0207702_10015012 | |||
| 1689 | Ga0207702_10067734 | |||
| 1690 | Ga0207702_10095158 | |||
| 1691 | Ga0207702_10164850 | |||
| 1692 | Ga0207702_10208008 | |||
| 1693 | Ga0207702_10600741 | |||
| 1694 | Ga0207702_10839137 | |||
| 1695 | Ga0207641_10011385 | |||
| 1696 | Ga0207641_10019349 | |||
| 1697 | Ga0207641_10033916 | |||
| 1698 | Ga0207641_10337044 | |||
| 1699 | Ga0207641_10433036 | |||
| 1700 | Ga0207641_11196227 | |||
| 1701 | Ga0207648_10002318 | |||
| 1702 | Ga0207648_10003142 | |||
| 1703 | Ga0207648_10006581 | |||
| 1704 | Ga0207648_10116265 | |||
| 1705 | Ga0207676_10002072 | |||
| 1706 | Ga0207676_10008483 | |||
| 1707 | Ga0207676_10009522 | |||
| 1708 | Ga0207676_10031676 | |||
| 1709 | Ga0207676_10389840 | |||
| 1710 | Ga0207674_10000527 | |||
| 1711 | Ga0207674_10002277 | |||
| 1712 | Ga0207674_10003088 | |||
| 1713 | Ga0207674_10011531 | |||
| 1714 | Ga0207674_10024167 | |||
| 1715 | Ga0207674_10030316 | |||
| 1716 | Ga0207674_10036857 | |||
| 1717 | Ga0207674_10049289 | |||
| 1718 | Ga0207674_10111820 | |||
| 1719 | Ga0207674_10205136 | |||
| 1720 | Ga0207674_10539760 | |||
| 1721 | Ga0207675_100165697 | |||
| 1722 | Ga0207675_100242894 | |||
| 1723 | Ga0207675_100296014 | |||
| 1724 | Ga0207675_100578154 | |||
| 1725 | Ga0207675_100678760 | |||
| 1726 | Ga0207683_10014943 | |||
| 1727 | Ga0207683_10625691 | |||
| 1728 | Ga0207698_10000618 | |||
| 1729 | Ga0207698_10001533 | |||
| 1730 | Ga0207698_10007701 | |||
| 1731 | Ga0207698_10009367 | |||
| 1732 | Ga0207698_10046260 | |||
| 1733 | Ga0207698_10280976 | |||
| 1734 | Ga0207698_10361244 | |||
| 1735 | Ga0207698_10379957 | |||
| 1736 | Ga0207698_10397596 | |||
| 1737 | Ga0207698_10727625 | |||
| 1738 | Ga0268266_10005677 | |||
| 1739 | Ga0268266_10022882 | |||
| 1740 | Ga0268266_10422373 | |||
| 1741 | Ga0268265_10003245 | |||
| 1742 | Ga0268265_10059407 | |||
| 1743 | Ga0268265_10199537 | |||
| 1744 | Ga0268265_11013896 | |||
| 1745 | Ga0268264_10002543 | |||
| 1746 | Ga0268264_10035529 | |||
| 1747 | Ga0268264_10073947 | |||
| 1748 | Ga0268264_10157795 | |||
| 1749 | Ga0268264_10573422 | |||
| 1750 | Ga0307513_10390646 | |||
| 1751 | Ga0307408_100021556 | |||
| 1752 | Ga0307408_101050659 | |||
| 1753 | Ga0307408_101720449 | |||
| 1754 | Ga0307405_10457021 | |||
| 1755 | Ga0307405_10586539 | |||
| 1756 | Ga0307405_10881887 | |||
| 1757 | Ga0307413_10267439 | |||
| 1758 | Ga0307413_10487033 | |||
| 1759 | Ga0307410_10107788 | |||
| 1760 | Ga0307410_10135140 | |||
| 1761 | Ga0307410_10342574 | |||
| 1762 | Ga0307410_10408551 | |||
| 1763 | Ga0307410_11529900 | |||
| 1764 | Ga0307406_10006893 | |||
| 1765 | Ga0307406_10094729 | |||
| 1766 | Ga0307406_10183254 | |||
| 1767 | Ga0307406_10304271 | |||
| 1768 | Ga0307406_11360434 | |||
| 1769 | Ga0307407_10007704 | |||
| 1770 | Ga0307407_10520960 | |||
| 1771 | Ga0307412_10050121 | |||
| 1772 | Ga0307412_10125807 | |||
| 1773 | Ga0307412_10129002 | |||
| 1774 | Ga0307409_100018684 | |||
| 1775 | Ga0307409_100391047 | |||
| 1776 | Ga0307409_100415965 | |||
| 1777 | Ga0307409_101495403 | |||
| 1778 | Ga0307416_100034296 | |||
| 1779 | Ga0307416_100186537 | |||
| 1780 | Ga0307416_100798430 | |||
| 1781 | Ga0307416_101024117 | |||
| 1782 | Ga0307416_101170537 | |||
| 1783 | Ga0307416_101697613 | |||
| 1784 | Ga0307414_12034875 | |||
| 1785 | Ga0307411_10208232 | |||
| 1786 | Ga0307411_10308733 | |||
| 1787 | Ga0307411_11720663 | |||
| 1788 | Ga0307415_100019849 | |||
| 1789 | Ga0307415_100022433 | |||
| 1790 | Ga0307415_100027339 | |||
| 1791 | Ga0307415_100494859 | |||
| 1792 | Ga0307415_100808616 | |||
| 1793 | Ga0373930_0092002 | |||
| 1794 | Ga0373938_0099370 | |||
| 1795 | Ga0373949_0066931 | |||
| 1796 | Ga0373951_0066124 | |||
| 1797 | Ga0373923_0002141 | |||
| 1798 | Ga0373955_0006945 | |||
| 1799 | Ga0373961_0010280 | |||
| 1800 | Ga0373962_0085039 | |||
| 1801 | Ga0373933_0003124 | |||
| 1802 | Ga0373937_0000641 | |||
| 1803 | Ga0395899_0006584 | |||
| 1804 | Ga0395899_0030400 | |||
| 1805 | Ga0395899_0038361 | |||
| 1806 | Ga0395899_0098825 | |||
| 1807 | Ga0395899_0105236 | |||
| 1808 | Ga0395899_0191082 | |||
| 1809 | Ga0395899_0289732 | |||
| 1810 | Ga0395899_0893212 | |||
| 1811 | Ga0395900_0106528 | |||
| 1812 | Ga0395900_0107348 | |||
| 1813 | Ga0395900_0176876 | |||
| 1814 | Ga0395900_0177213 | |||
| 1815 | Ga0395900_0245885 | |||
| 1816 | Ga0395900_0254630 | |||
| 1817 | Ga0395900_0262855 | |||
| 1818 | Ga0395900_0355503 | |||
| 1819 | Ga0395900_0442792 | |||
| 1820 | Ga0395900_0480745 | |||
| 1821 | Ga0395900_0582697 | |||
| 1822 | Ga0395900_0591238 | |||
| 1823 | Ga0395900_0607838 | |||
| 1824 | Ga0395900_0880782 | |||
| 1825 | Ga0395900_1415124 | |||
| 1826 | Ga0395900_1515835 | |||
| 1827 | Ga0395900_1551262 | |||
| 1828 | Ga0395898_0018087 | |||
| 1829 | Ga0395898_0197787 | |||
| 1830 | Ga0395898_0242749 | |||
| 1831 | Ga0395898_0253928 | |||
| 1832 | Ga0395898_0263788 | |||
| 1833 | Ga0395905_0000092 | |||
| 1834 | Ga0395905_0008699 | |||
| 1835 | Ga0395905_0017027 | |||
| 1836 | Ga0395905_0021465 | |||
| 1837 | Ga0395905_0033987 | |||
| 1838 | Ga0395905_0070313 | |||
| 1839 | Ga0395905_0088340 | |||
| 1840 | Ga0395905_0141907 | |||
| 1841 | Ga0395905_0179826 | |||
| 1842 | Ga0395905_0200560 | |||
| 1843 | Ga0395905_0226216 | |||
| 1844 | Ga0395905_0306016 | |||
| 1845 | Ga0395905_0552801 | |||
| 1846 | Ga0395905_0560942 | |||
| 1847 | Ga0395905_0645510 | |||
| 1848 | Ga0395905_0683408 | |||
| 1849 | Ga0395905_0727473 | |||
| 1850 | Ga0395905_1114477 | |||
| 1851 | Ga0395905_1438209 | |||
| 1852 | Ga0395905_1553021 | |||
| 1853 | Ga0395905_1568637 | |||
| 1854 | Ga0395901_0000268 | |||
| 1855 | Ga0395901_0037677 | |||
| 1856 | Ga0395901_0109048 | |||
| 1857 | Ga0395901_0117722 | |||
| 1858 | Ga0395901_0157477 | |||
| 1859 | Ga0395901_0201949 | |||
| 1860 | Ga0395901_0211352 | |||
| 1861 | Ga0395901_0229427 | |||
| 1862 | Ga0395901_0323654 | |||
| 1863 | Ga0395901_0590479 | |||
| 1864 | Ga0395901_0755119 | |||
| 1865 | Ga0395901_1876385 | |||
| 1866 | Ga0451855_1685400 | |||
| 1867 | Ga0439464_0000674 | |||
| 1868 | Ga0466965_0306418 | |||
| 1869 | Ga0466961_0577514 | |||
| 1870 | Ga0466963_0002161 | |||
| 1871 | Ga0466963_0002953 | |||
| 1872 | Ga0466963_0078078 | |||
| 1873 | Ga0466963_0144024 | |||
| 1874 | Ga0466963_0180407 | |||
| 1875 | Ga0466963_0245265 | |||
| 1876 | Ga0466963_0308765 | |||
| 1877 | Ga0466963_0438438 | |||
| 1878 | Ga0466963_0536849 | |||
| 1879 | Ga0466964_0871166 | |||
| 1880 | Ga0466971_0111804 | |||
| 1881 | Ga0466970_0049888 | |||
| 1882 | Ga0466957_0019839 | |||
| 1883 | Ga0466957_0035844 | |||
| 1884 | Ga0466957_0489150 | |||
| 1885 | Ga0466957_0519122 | |||
| 1886 | Ga0466957_1261126 | |||
| 1887 | Ga0466960_0435484 | |||
| 1888 | Ga0466959_0052591 | |||
| 1889 | Ga0466959_0324334 | |||
| 1890 | Ga0466958_0141356 | |||
| 1891 | Ga0466967_0020400 | |||
| 1892 | Ga0466967_0029143 | |||
| 1893 | Ga0466967_0037978 | |||
| 1894 | Ga0466967_0045428 | |||
| 1895 | Ga0466967_0050943 | |||
| 1896 | Ga0466967_0076801 | |||
| 1897 | Ga0466967_0099774 | |||
| 1898 | Ga0466967_0139429 | |||
| 1899 | Ga0466967_0283333 | |||
| 1900 | Ga0466967_0368833 | |||
| 1901 | Ga0466967_0519627 | |||
| 1902 | Ga0466967_0625859 | |||
| 1903 | Ga0466967_0737680 | |||
| 1904 | Ga0466967_0796071 | |||
| 1905 | Ga0466967_0944532 | |||
| 1906 | Ga0466967_0947702 | |||
| 1907 | Ga0495598_0011985 | |||
| 1908 | Ga0495621_0000006 | |||
| 1909 | Ga0495633_0091937 | |||
| 1910 | Ga0495669_0022152 | |||
| 1911 | Ga0495669_0215423 | |||
| 1912 | Ga0495669_0243948 | |||
| 1913 | Ga0495670_0000238 | |||
| 1914 | Ga0495677_0368719 | |||
| 1915 | Ga0495602_0057394 | |||
| 1916 | Ga0496100_0867835 | |||
| 1917 | Ga0496102_0520496 | |||
| 1918 | Ga0496102_0806018 | |||
| 1919 | Ga0496103_0066322 | |||
| 1920 | Ga0496103_0067421 | |||
| 1921 | Ga0496105_0256588 | |||
| 1922 | Ga0496106_0266612 | |||
| 1923 | Ga0496107_0032199 | |||
| 1924 | Ga0496107_0168768 | |||
| 1925 | Ga0496108_0004323 | |||
| 1926 | Ga0496109_0148582 | |||
| 1927 | Ga0496110_0018857 | |||
| 1928 | Ga0496110_1124815 | |||
| 1929 | Ga0496111_0460234 | |||
| 1930 | Ga0496112_0016189 | |||
| 1931 | Ga0496112_0309916 | |||
| 1932 | Ga0496112_0797084 | |||
| 1933 | Ga0496113_1339998 | |||
| 1934 | Ga0501070_0737083 | |||
| 1935 | Ga0501071_0668488 | |||
| 1936 | Ga0501074_0115947 | |||
| 1937 | Ga0501079_1330750 | |||
| 1938 | Ga0501080_0023202 | |||
| 1939 | Ga0501080_0112494 | |||
| 1940 | nmdc:mga0rr50_286977_c1 | |||
| 1941 | Ga0587084_014175 | |||
| 1942 | Ga0587084_017887 | |||
| 1943 | Ga0587084_019545 | |||
| 1944 | Ga0587084_043786 | |||
| 1945 | Ga0587066_023228 | |||
| 1946 | Ga0587066_027294 | |||
| 1947 | Ga0587066_034196 | |||
| 1948 | Ga0587066_139051 | |||
| 1949 | Ga0587070_018388 | |||
| 1950 | Ga0587073_0029922 | |||
| 1951 | Ga0587073_0041186 | |||
| 1952 | Ga0587073_0248447 | |||
| 1953 | Ga0587077_034230 | |||
| 1954 | Ga0587077_045904 | |||
| 1955 | Ga0587080_021155 | |||
| 1956 | Ga0587080_027021 | |||
| 1957 | Ga0587080_034007 | |||
| 1958 | Ga0587082_034001 | |||
| 1959 | Ga0587082_035086 | |||
| 1960 | Ga0587082_036180 | |||
| 1961 | Ga0587082_139513 | |||
| 1962 | Ga0587083_0029666 | |||
| 1963 | Ga0587083_0050676 | |||
| 1964 | Ga0587083_0053251 | |||
| 1965 | Ga0587085_006090 | |||
| 1966 | Ga0587085_024211 | |||
| 1967 | Ga0587086_014946 | |||
| 1968 | Ga0587086_020521 | |||
| 1969 | Ga0587088_005461 | |||
| 1970 | Ga0587088_028967 | |||
| 1971 | Ga0587088_033577 | |||
| 1972 | Ga0587089_020133 | |||
| 1973 | Ga0587089_051640 | |||
| 1974 | Ga0587090_015200 | |||
| 1975 | Ga0587090_018489 | |||
| 1976 | Ga0587090_030190 | |||
| 1977 | Ga0587090_037292 | |||
| 1978 | Ga0587091_017818 | |||
| 1979 | Ga0587091_024021 | |||
| 1980 | Ga0587091_042426 | |||
| 1981 | Ga0587094_014432 | |||
| 1982 | Ga0587094_018969 | |||
| 1983 | Ga0587095_005087 | |||
| 1984 | Ga0587095_006724 | |||
| 1985 | Ga0587074_03528 | |||
| 1986 | Ga0587106_015710 | |||
| 1987 | Ga0587106_026336 | |||
| 1988 | Ga0587106_110278 | |||
| 1989 | Ga0587099_010211 | |||
| 1990 | Ga0587101_016965 | |||
| 1991 | Ga0587101_019836 | |||
| 1992 | Ga0587109_038372 | |||
| 1993 | Ga0587113_009418 | |||
| 1994 | Ga0587128_020109 | |||
| 1995 | Ga0587128_022297 | |||
| 1996 | Ga0587128_027758 | |||
| 1997 | Ga0587130_009408 | |||
| 1998 | Ga0587062_022745 | |||
| 1999 | Ga0587067_024876 | |||
| 2000 | Ga0587067_038826 | |||
| 2001 | Ga0587068_031180 | |||
| 2002 | Ga0587068_033680 | |||
| 2003 | Ga0587069_019882 | |||
| 2004 | Ga0587069_030174 | |||
| 2005 | Ga0587069_124508 | |||
| 2006 | Ga0587072_031365 | |||
| 2007 | Ga0587072_038769 | |||
| 2008 | Ga0587075_012011 | |||
| 2009 | Ga0587075_013438 | |||
| 2010 | Ga0587075_016342 | |||
| 2011 | Ga0587075_026979 | |||
| 2012 | Ga0587075_027629 | |||
| 2013 | Ga0587076_021445 | |||
| 2014 | Ga0587076_035552 | |||
| 2015 | Ga0587076_036615 | |||
| 2016 | Ga0587078_001873 | |||
| 2017 | Ga0587078_011898 | |||
| 2018 | Ga0587078_012899 | |||
| 2019 | Ga0587079_026649 | |||
| 2020 | Ga0587079_032180 | |||
| 2021 | Ga0587079_063490 | |||
| 2022 | Ga0587079_065604 | |||
| 2023 | Ga0587102_007703 | |||
| 2024 | Ga0587102_023221 | |||
| 2025 | Ga0587107_008996 | |||
| 2026 | Ga0587107_017830 | |||
| 2027 | Ga0587107_017898 | |||
| 2028 | Ga0587119_011274 | |||
| 2029 | Ga0587119_015410 | |||
| 2030 | Ga0587071_027880 | |||
| 2031 | Ga0587071_028594 | |||
| 2032 | Ga0587071_030866 | |||
| 2033 | Ga0587071_040026 | |||
| 2034 | Ga0587111_0052710 | |||
| 2035 | Ga0587111_0088722 | |||
| 2036 | Ga0466962_0115600 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8adc-assembly1.cif.gz_B | viral tegument-like dubs | 0.7687 | 34 | 61 |
| 8adc-assembly2.cif.gz_A | viral tegument-like dubs | 0.7541 | 34 | 62 |
| 8adb-assembly1.cif.gz_A | viral tegument-like dubs | 0.7535 | 34 | 67 |
| 4u3q-assembly1.cif.gz_B | crystal structure of recombinant tp0435 from treponema pallidum | 0.6771 | 34 | 101 |
| 6c9n-assembly1.cif.gz_A | mycobacterium tuberculosis adenosine kinase bound to sangivamycin | 0.6679 | 44 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HYS3_91_210_3.10.330.10 | Alpha Beta;Roll;Vcp-like ATPase; Chain A, domain 2; | 0.7542 | 92 | 116 | 3.10.330.10 |
| af_O45110_151_229_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.6776 | 41 | 65 | 2.30.30.30 |
| af_A0A2R8QJQ6_302_523_3.90.70.120 | Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A; | 0.6615 | 34 | 65 | 3.90.70.120 |
| af_A0A0R0ELK1_770_819_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.6557 | 35 | 67 | 2.30.30.60 |
| af_Q2FWM2_2_319_3.40.1190.20 | Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase | 0.6554 | 44 | 73 | 3.40.1190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T2GKA4-F1-model_v4 | Uncharacterized protein | 0.8998 | 30 | 111 |
|
| AF-A0A519Q9Y9-F1-model_v4 | DUF3313 domain-containing protein | 0.8746 | 21 | 112 |
|
| AF-A0A7H0G918-F1-model_v4 | deleted | 0.8704 | 66 | 130 |
|
| AF-A0A158S7G9-F1-model_v4 | Uncharacterized protein | 0.8638 | 25 | 116 |
|
| AF-A0A1H7XGQ5-F1-model_v4 | Tetratricopeptide repeat-containing protein | 0.8287 | 38 | 87 |
|