F488341
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1019 | 313 | 1018 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300005367|Ga0070667_100331294|Ga0070667_1003312942 |
| Length | 105 |
| Sequence | MSKKNKPDNRGFVYSTDPEFKFLPAAQQKLKIRLDTKHRAGKAVTLIEGFTGKEEDLEDLGKKLKSFCGTGGSAKDGEIIVQGDQREKVLQWLIKNGYKNSRKTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 175 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 176 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 177 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 180 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 181 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 201 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 202 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 203 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 204 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 212 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 213 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 214 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 217 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 218 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 219 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 220 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 221 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 222 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 223 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 224 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 225 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 226 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 227 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 228 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 229 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 230 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 231 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 232 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 233 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 234 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 235 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 236 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 283 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 284 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 285 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 300 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 301 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 302 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 304 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 306 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 309 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 310 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 311 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 312 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0 |
| Isolates | 0.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.47 |
| Nodule | 0 |
| Rhizoplane | 1.47 |
| Rhizosphere | 95.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1580370 | 2162886007 | Bacteria | 910 |
| 2 | SwRhRL2b_contig_942247 | 2162886007 | Bacteria | 903 |
| 3 | ARcpr5yngRDRAFT_c011162 | 3300000043 | Bacteria | 760 |
| 4 | JGI24735J21928_10022974 | 3300002067 | Bacteria | 1893 |
| 5 | JGI24751J29686_10000360 | 3300002459 | Bacteria | 15823 |
| 6 | rootL2_10182482 | 3300003322 | Bacteria | 2480 |
| 7 | rootL2_10224766 | 3300003322 | Bacteria | 1719 |
| 8 | rootL2_10300896 | 3300003322 | Bacteria | 1227 |
| 9 | rootH1_10017808 | 3300003323 | Bacteria | 3962 |
| 10 | Ga0065714_10101230 | 3300005288 | Bacteria | 1648 |
| 11 | Ga0065704_10120433 | 3300005289 | Bacteria | 1768 |
| 12 | Ga0065704_10494583 | 3300005289 | Unclassified | 672 |
| 13 | Ga0065712_10001246 | 3300005290 | Bacteria | 8768 |
| 14 | Ga0065712_10010559 | 3300005290 | Bacteria | 2149 |
| 15 | Ga0065712_10160118 | 3300005290 | Bacteria | 1306 |
| 16 | Ga0065715_10004024 | 3300005293 | Bacteria | 4807 |
| 17 | Ga0065707_10126934 | 3300005295 | Bacteria | 1993 |
| 18 | Ga0065707_10898219 | 3300005295 | Bacteria | 567 |
| 19 | Ga0070658_10203888 | 3300005327 | Bacteria | 1669 |
| 20 | Ga0070658_10771285 | 3300005327 | Bacteria | 835 |
| 21 | Ga0070676_10005845 | 3300005328 | Bacteria | 6563 |
| 22 | Ga0070676_10063316 | 3300005328 | Bacteria | 2203 |
| 23 | Ga0070676_10584658 | 3300005328 | Bacteria | 803 |
| 24 | Ga0070676_10729671 | 3300005328 | Unclassified | 726 |
| 25 | Ga0070683_100004596 | 3300005329 | Bacteria | 11396 |
| 26 | Ga0070683_100080455 | 3300005329 | Bacteria | 3050 |
| 27 | Ga0070683_100113788 | 3300005329 | Bacteria | 2554 |
| 28 | Ga0070683_100160047 | 3300005329 | Bacteria | 2136 |
| 29 | Ga0070690_100004279 | 3300005330 | Bacteria | 7907 |
| 30 | Ga0070690_100142125 | 3300005330 | Bacteria | 1630 |
| 31 | Ga0070690_100424827 | 3300005330 | Bacteria | 980 |
| 32 | Ga0070690_100622132 | 3300005330 | Unclassified | 822 |
| 33 | Ga0070670_100005255 | 3300005331 | Bacteria | 10908 |
| 34 | Ga0070670_100015474 | 3300005331 | Bacteria | 6552 |
| 35 | Ga0070670_100169780 | 3300005331 | Bacteria | 1892 |
| 36 | Ga0070670_100285072 | 3300005331 | Bacteria | 1442 |
| 37 | Ga0070670_100385025 | 3300005331 | Bacteria | 1236 |
| 38 | Ga0070670_100549754 | 3300005331 | Bacteria | 1030 |
| 39 | Ga0070670_100951485 | 3300005331 | Bacteria | 780 |
| 40 | Ga0070677_10078448 | 3300005333 | Bacteria | 1407 |
| 41 | Ga0070677_10295193 | 3300005333 | Bacteria | 821 |
| 42 | Ga0070677_10352086 | 3300005333 | Bacteria | 763 |
| 43 | Ga0070677_10443069 | 3300005333 | Bacteria | 693 |
| 44 | Ga0068869_100036673 | 3300005334 | Bacteria | 3482 |
| 45 | Ga0068869_100058928 | 3300005334 | Bacteria | 2810 |
| 46 | Ga0068869_100086488 | 3300005334 | Bacteria | 2350 |
| 47 | Ga0068869_100106493 | 3300005334 | Bacteria | 2128 |
| 48 | Ga0068869_100163534 | 3300005334 | Bacteria | 1734 |
| 49 | Ga0068869_100231521 | 3300005334 | Bacteria | 1468 |
| 50 | Ga0068869_100324197 | 3300005334 | Bacteria | 1250 |
| 51 | Ga0068869_100553890 | 3300005334 | Bacteria | 966 |
| 52 | Ga0068869_101464314 | 3300005334 | Unclassified | 606 |
| 53 | Ga0070666_10013142 | 3300005335 | Bacteria | 5246 |
| 54 | Ga0070666_10073096 | 3300005335 | Bacteria | 2335 |
| 55 | Ga0070680_100030579 | 3300005336 | Bacteria | 4326 |
| 56 | Ga0070680_100346120 | 3300005336 | Bacteria | 1264 |
| 57 | Ga0070680_101119374 | 3300005336 | Bacteria | 681 |
| 58 | Ga0070682_100089216 | 3300005337 | Bacteria | 2014 |
| 59 | Ga0070682_100974016 | 3300005337 | Bacteria | 702 |
| 60 | Ga0070682_100978604 | 3300005337 | Bacteria | 701 |
| 61 | Ga0068868_100000543 | 3300005338 | Bacteria | 25349 |
| 62 | Ga0068868_100266290 | 3300005338 | Bacteria | 1447 |
| 63 | Ga0068868_100344639 | 3300005338 | Bacteria | 1275 |
| 64 | Ga0070660_100000647 | 3300005339 | Bacteria | 23049 |
| 65 | Ga0070660_100110890 | 3300005339 | Bacteria | 2182 |
| 66 | Ga0070660_100307379 | 3300005339 | Bacteria | 1301 |
| 67 | Ga0070660_100410270 | 3300005339 | Bacteria | 1121 |
| 68 | Ga0070660_101087677 | 3300005339 | Bacteria | 677 |
| 69 | Ga0070660_101362826 | 3300005339 | Bacteria | 602 |
| 70 | Ga0070689_100004881 | 3300005340 | Bacteria | 9104 |
| 71 | Ga0070689_100035973 | 3300005340 | Bacteria | 3786 |
| 72 | Ga0070689_100102142 | 3300005340 | Bacteria | 2271 |
| 73 | Ga0070689_100103588 | 3300005340 | Bacteria | 2255 |
| 74 | Ga0070689_100129781 | 3300005340 | Bacteria | 2020 |
| 75 | Ga0070689_100399922 | 3300005340 | Bacteria | 1161 |
| 76 | Ga0070689_100429290 | 3300005340 | Bacteria | 1121 |
| 77 | Ga0070689_100964328 | 3300005340 | Unclassified | 757 |
| 78 | Ga0070691_10343897 | 3300005341 | Bacteria | 826 |
| 79 | Ga0070687_100097851 | 3300005343 | Bacteria | 1637 |
| 80 | Ga0070687_100225299 | 3300005343 | Unclassified | 1151 |
| 81 | Ga0070687_100785099 | 3300005343 | Unclassified | 673 |
| 82 | Ga0070661_100000111 | 3300005344 | Bacteria | 68066 |
| 83 | Ga0070661_100184872 | 3300005344 | Bacteria | 1587 |
| 84 | Ga0070661_100633736 | 3300005344 | Unclassified | 866 |
| 85 | Ga0070661_101628530 | 3300005344 | Bacteria | 546 |
| 86 | Ga0070692_10026463 | 3300005345 | Bacteria | 2868 |
| 87 | Ga0070692_10307479 | 3300005345 | Bacteria | 970 |
| 88 | Ga0070692_11108538 | 3300005345 | Unclassified | 559 |
| 89 | Ga0070668_100072114 | 3300005347 | Bacteria | 2691 |
| 90 | Ga0070668_100101573 | 3300005347 | Unclassified | 2279 |
| 91 | Ga0070668_100162676 | 3300005347 | Bacteria | 1812 |
| 92 | Ga0070668_100167301 | 3300005347 | Bacteria | 1788 |
| 93 | Ga0070668_100224006 | 3300005347 | Bacteria | 1552 |
| 94 | Ga0070668_100257219 | 3300005347 | Bacteria | 1451 |
| 95 | Ga0070668_100876369 | 3300005347 | Unclassified | 801 |
| 96 | Ga0070668_100935392 | 3300005347 | Bacteria | 776 |
| 97 | Ga0070669_100002767 | 3300005353 | Bacteria | 12650 |
| 98 | Ga0070669_100145398 | 3300005353 | Bacteria | 1831 |
| 99 | Ga0070669_100395934 | 3300005353 | Unclassified | 1129 |
| 100 | Ga0070669_100423097 | 3300005353 | Unclassified | 1093 |
| 101 | Ga0070669_101074626 | 3300005353 | Bacteria | 692 |
| 102 | Ga0070669_101488746 | 3300005353 | Unclassified | 588 |
| 103 | Ga0070675_100001118 | 3300005354 | Bacteria | 19352 |
| 104 | Ga0070675_100018336 | 3300005354 | Bacteria | 5570 |
| 105 | Ga0070675_100177621 | 3300005354 | Unclassified | 1839 |
| 106 | Ga0070675_100228031 | 3300005354 | Bacteria | 1624 |
| 107 | Ga0070671_100074050 | 3300005355 | Bacteria | 2845 |
| 108 | Ga0070671_100494667 | 3300005355 | Unclassified | 1052 |
| 109 | Ga0070671_100639121 | 3300005355 | Bacteria | 921 |
| 110 | Ga0070674_100009989 | 3300005356 | Bacteria | 5715 |
| 111 | Ga0070674_100242382 | 3300005356 | Bacteria | 1412 |
| 112 | Ga0070674_100259112 | 3300005356 | Bacteria | 1369 |
| 113 | Ga0070674_100845386 | 3300005356 | Bacteria | 793 |
| 114 | Ga0070674_102160360 | 3300005356 | Unclassified | 508 |
| 115 | Ga0070673_100129777 | 3300005364 | Bacteria | 2113 |
| 116 | Ga0070673_100138920 | 3300005364 | Bacteria | 2048 |
| 117 | Ga0070673_100174884 | 3300005364 | Bacteria | 1834 |
| 118 | Ga0070673_100193532 | 3300005364 | Bacteria | 1748 |
| 119 | Ga0070673_100220071 | 3300005364 | Bacteria | 1643 |
| 120 | Ga0070673_100280754 | 3300005364 | Bacteria | 1461 |
| 121 | Ga0070673_100433804 | 3300005364 | Bacteria | 1180 |
| 122 | Ga0070673_101225394 | 3300005364 | Bacteria | 703 |
| 123 | Ga0070688_100017227 | 3300005365 | Bacteria | 4144 |
| 124 | Ga0070688_100027855 | 3300005365 | Bacteria | 3367 |
| 125 | Ga0070688_100031884 | 3300005365 | Bacteria | 3173 |
| 126 | Ga0070688_100320696 | 3300005365 | Bacteria | 1126 |
| 127 | Ga0070688_100416517 | 3300005365 | Bacteria | 998 |
| 128 | Ga0070688_101040424 | 3300005365 | Unclassified | 652 |
| 129 | Ga0070659_100006959 | 3300005366 | Bacteria | 8191 |
| 130 | Ga0070659_100042462 | 3300005366 | Bacteria | 3554 |
| 131 | Ga0070659_100065305 | 3300005366 | Bacteria | 2882 |
| 132 | Ga0070659_100134986 | 3300005366 | Bacteria | 2006 |
| 133 | Ga0070659_100155893 | 3300005366 | Bacteria | 1865 |
| 134 | Ga0070659_100197196 | 3300005366 | Bacteria | 1656 |
| 135 | Ga0070659_100241857 | 3300005366 | Bacteria | 1494 |
| 136 | Ga0070667_100005088 | 3300005367 | Bacteria | 11005 |
| 137 | Ga0070667_100089394 | 3300005367 | Bacteria | 2646 |
| 138 | Ga0070667_100240360 | 3300005367 | Bacteria | 1617 |
| 139 | Ga0070667_100323457 | 3300005367 | Bacteria | 1392 |
| 140 | Ga0070667_100331294 | 3300005367 | Unclassified | 1375 |
| 141 | Ga0070667_100372078 | 3300005367 | Unclassified | 1297 |
| 142 | Ga0070667_101377321 | 3300005367 | Bacteria | 661 |
| 143 | Ga0070667_101487820 | 3300005367 | Unclassified | 636 |
| 144 | Ga0070667_101978532 | 3300005367 | Bacteria | 549 |
| 145 | Ga0070701_10039194 | 3300005438 | Bacteria | 2402 |
| 146 | Ga0070701_10313150 | 3300005438 | Unclassified | 969 |
| 147 | Ga0070705_101309602 | 3300005440 | Unclassified | 601 |
| 148 | Ga0070700_100071081 | 3300005441 | Bacteria | 2221 |
| 149 | Ga0070700_100366148 | 3300005441 | Bacteria | 1073 |
| 150 | Ga0070663_100283988 | 3300005455 | Unclassified | 1320 |
| 151 | Ga0070663_100380496 | 3300005455 | Bacteria | 1149 |
| 152 | Ga0070663_100476845 | 3300005455 | Bacteria | 1032 |
| 153 | Ga0070678_100007620 | 3300005456 | Bacteria | 6431 |
| 154 | Ga0070678_100352482 | 3300005456 | Bacteria | 1266 |
| 155 | Ga0070678_100488904 | 3300005456 | Bacteria | 1084 |
| 156 | Ga0070678_101824856 | 3300005456 | Unclassified | 573 |
| 157 | Ga0070678_101826733 | 3300005456 | Bacteria | 573 |
| 158 | Ga0070678_101880785 | 3300005456 | Unclassified | 565 |
| 159 | Ga0070678_102082329 | 3300005456 | Unclassified | 537 |
| 160 | Ga0070662_100006327 | 3300005457 | Bacteria | 7627 |
| 161 | Ga0070662_100016061 | 3300005457 | Bacteria | 5022 |
| 162 | Ga0070662_100030265 | 3300005457 | Bacteria | 3786 |
| 163 | Ga0070681_10103549 | 3300005458 | Bacteria | 2790 |
| 164 | Ga0070681_10262077 | 3300005458 | Bacteria | 1640 |
| 165 | Ga0070681_10265667 | 3300005458 | Bacteria | 1627 |
| 166 | Ga0068867_100007969 | 3300005459 | Bacteria | 7483 |
| 167 | Ga0068867_100014817 | 3300005459 | Bacteria | 5528 |
| 168 | Ga0068867_100018800 | 3300005459 | Bacteria | 4916 |
| 169 | Ga0068867_100070063 | 3300005459 | Unclassified | 2620 |
| 170 | Ga0068867_100140807 | 3300005459 | Bacteria | 1885 |
| 171 | Ga0068867_100196427 | 3300005459 | Bacteria | 1613 |
| 172 | Ga0068867_101385560 | 3300005459 | Unclassified | 652 |
| 173 | Ga0070685_10011831 | 3300005466 | Bacteria | 4575 |
| 174 | Ga0070685_10013277 | 3300005466 | Bacteria | 4342 |
| 175 | Ga0070685_10043005 | 3300005466 | Bacteria | 2581 |
| 176 | Ga0070685_10044166 | 3300005466 | Unclassified | 2551 |
| 177 | Ga0070685_10094402 | 3300005466 | Bacteria | 1817 |
| 178 | Ga0070685_10193721 | 3300005466 | Bacteria | 1317 |
| 179 | Ga0070685_10375101 | 3300005466 | Bacteria | 979 |
| 180 | Ga0070706_101110149 | 3300005467 | Unclassified | 728 |
| 181 | Ga0070698_100001074 | 3300005471 | Bacteria | 30038 |
| 182 | Ga0070698_100009628 | 3300005471 | Bacteria | 10336 |
| 183 | Ga0070698_100015207 | 3300005471 | Bacteria | 8137 |
| 184 | Ga0070698_100182933 | 3300005471 | Bacteria | 2034 |
| 185 | Ga0070699_100068012 | 3300005518 | Bacteria | 3093 |
| 186 | Ga0070679_100001516 | 3300005530 | Bacteria | 20680 |
| 187 | Ga0070679_100125043 | 3300005530 | Bacteria | 2554 |
| 188 | Ga0070679_100244490 | 3300005530 | Bacteria | 1751 |
| 189 | Ga0070679_101145985 | 3300005530 | Bacteria | 722 |
| 190 | Ga0070679_101301507 | 3300005530 | Unclassified | 672 |
| 191 | Ga0070684_100012277 | 3300005535 | Bacteria | 6860 |
| 192 | Ga0070684_100119148 | 3300005535 | Bacteria | 2373 |
| 193 | Ga0070684_101110014 | 3300005535 | Unclassified | 743 |
| 194 | Ga0070697_100241043 | 3300005536 | Bacteria | 1544 |
| 195 | Ga0068853_100014798 | 3300005539 | Bacteria | 6403 |
| 196 | Ga0068853_100027463 | 3300005539 | Bacteria | 4781 |
| 197 | Ga0068853_100228322 | 3300005539 | Unclassified | 1702 |
| 198 | Ga0068853_100319566 | 3300005539 | Bacteria | 1439 |
| 199 | Ga0068853_100377403 | 3300005539 | Bacteria | 1323 |
| 200 | Ga0068853_100409159 | 3300005539 | Bacteria | 1271 |
| 201 | Ga0068853_100515092 | 3300005539 | Unclassified | 1130 |
| 202 | Ga0068853_100597028 | 3300005539 | Bacteria | 1048 |
| 203 | Ga0068853_101002797 | 3300005539 | Bacteria | 804 |
| 204 | Ga0068853_101069712 | 3300005539 | Bacteria | 778 |
| 205 | Ga0070672_100036130 | 3300005543 | Bacteria | 3762 |
| 206 | Ga0070672_100255414 | 3300005543 | Bacteria | 1477 |
| 207 | Ga0070672_101665980 | 3300005543 | Unclassified | 573 |
| 208 | Ga0070672_102131282 | 3300005543 | Bacteria | 505 |
| 209 | Ga0070686_100004001 | 3300005544 | Bacteria | 8104 |
| 210 | Ga0070686_100121073 | 3300005544 | Bacteria | 1797 |
| 211 | Ga0070686_100641040 | 3300005544 | Bacteria | 841 |
| 212 | Ga0070686_101911460 | 3300005544 | Bacteria | 507 |
| 213 | Ga0070695_100188470 | 3300005545 | Bacteria | 1466 |
| 214 | Ga0070695_101604237 | 3300005545 | Unclassified | 543 |
| 215 | Ga0070665_100958532 | 3300005548 | Bacteria | 868 |
| 216 | Ga0070704_100580009 | 3300005549 | Unclassified | 983 |
| 217 | Ga0070704_101042199 | 3300005549 | Unclassified | 741 |
| 218 | Ga0068855_100000145 | 3300005563 | Bacteria | 91452 |
| 219 | Ga0068855_100003314 | 3300005563 | Bacteria | 19707 |
| 220 | Ga0068855_100094911 | 3300005563 | Bacteria | 3439 |
| 221 | Ga0068855_100125794 | 3300005563 | Bacteria | 2931 |
| 222 | Ga0068855_100140061 | 3300005563 | Bacteria | 2758 |
| 223 | Ga0068855_100146818 | 3300005563 | Bacteria | 2684 |
| 224 | Ga0068855_100352365 | 3300005563 | Bacteria | 1621 |
| 225 | Ga0068855_100933037 | 3300005563 | Bacteria | 915 |
| 226 | Ga0068855_101231581 | 3300005563 | Unclassified | 777 |
| 227 | Ga0070664_100000243 | 3300005564 | Bacteria | 39166 |
| 228 | Ga0070664_100278400 | 3300005564 | Bacteria | 1508 |
| 229 | Ga0070664_100607112 | 3300005564 | Unclassified | 1015 |
| 230 | Ga0070664_101354238 | 3300005564 | Bacteria | 672 |
| 231 | Ga0068857_100001483 | 3300005577 | Bacteria | 18682 |
| 232 | Ga0068857_100002097 | 3300005577 | Bacteria | 16192 |
| 233 | Ga0068857_100017217 | 3300005577 | Bacteria | 6332 |
| 234 | Ga0068857_100097876 | 3300005577 | Bacteria | 2631 |
| 235 | Ga0068857_100220722 | 3300005577 | Bacteria | 1731 |
| 236 | Ga0068857_100295744 | 3300005577 | Bacteria | 1492 |
| 237 | Ga0068857_100343486 | 3300005577 | Bacteria | 1381 |
| 238 | Ga0068857_100355853 | 3300005577 | Bacteria | 1356 |
| 239 | Ga0068857_100365443 | 3300005577 | Bacteria | 1338 |
| 240 | Ga0068857_100667668 | 3300005577 | Unclassified | 986 |
| 241 | Ga0068857_100778807 | 3300005577 | Unclassified | 912 |
| 242 | Ga0068857_101203789 | 3300005577 | Unclassified | 733 |
| 243 | Ga0068857_101393431 | 3300005577 | Bacteria | 682 |
| 244 | Ga0068857_102091613 | 3300005577 | Unclassified | 555 |
| 245 | Ga0068857_102247341 | 3300005577 | Bacteria | 535 |
| 246 | Ga0068854_100031969 | 3300005578 | Bacteria | 3659 |
| 247 | Ga0068854_100074627 | 3300005578 | Bacteria | 2488 |
| 248 | Ga0068854_100114212 | 3300005578 | Bacteria | 2041 |
| 249 | Ga0068854_100317444 | 3300005578 | Bacteria | 1265 |
| 250 | Ga0068854_100340479 | 3300005578 | Bacteria | 1225 |
| 251 | Ga0068854_101780553 | 3300005578 | Bacteria | 564 |
| 252 | Ga0068856_100023593 | 3300005614 | Bacteria | 5982 |
| 253 | Ga0068856_100044165 | 3300005614 | Bacteria | 4384 |
| 254 | Ga0068856_100205533 | 3300005614 | Bacteria | 1984 |
| 255 | Ga0068856_100335347 | 3300005614 | Bacteria | 1530 |
| 256 | Ga0068856_101690405 | 3300005614 | Bacteria | 645 |
| 257 | Ga0068852_100002726 | 3300005616 | Bacteria | 12214 |
| 258 | Ga0068852_100026651 | 3300005616 | Bacteria | 4703 |
| 259 | Ga0068852_100235284 | 3300005616 | Bacteria | 1748 |
| 260 | Ga0068852_100382901 | 3300005616 | Bacteria | 1380 |
| 261 | Ga0068852_100653796 | 3300005616 | Bacteria | 1059 |
| 262 | Ga0068852_100677826 | 3300005616 | Unclassified | 1040 |
| 263 | Ga0068852_101185278 | 3300005616 | Bacteria | 785 |
| 264 | Ga0068852_102072628 | 3300005616 | Unclassified | 591 |
| 265 | Ga0068859_100016081 | 3300005617 | Bacteria | 7517 |
| 266 | Ga0068859_100059890 | 3300005617 | Bacteria | 3836 |
| 267 | Ga0068859_100166408 | 3300005617 | Bacteria | 2285 |
| 268 | Ga0068859_100186862 | 3300005617 | Bacteria | 2156 |
| 269 | Ga0068859_100200658 | 3300005617 | Bacteria | 2079 |
| 270 | Ga0068859_100339164 | 3300005617 | Bacteria | 1597 |
| 271 | Ga0068859_100531688 | 3300005617 | Bacteria | 1270 |
| 272 | Ga0068859_101431419 | 3300005617 | Bacteria | 762 |
| 273 | Ga0068859_101789151 | 3300005617 | Unclassified | 679 |
| 274 | Ga0068859_103052632 | 3300005617 | Bacteria | 511 |
| 275 | Ga0068864_100006400 | 3300005618 | Bacteria | 9651 |
| 276 | Ga0068864_100124308 | 3300005618 | Unclassified | 2310 |
| 277 | Ga0068864_100237825 | 3300005618 | Bacteria | 1686 |
| 278 | Ga0068864_100338587 | 3300005618 | Bacteria | 1417 |
| 279 | Ga0068864_100360431 | 3300005618 | Bacteria | 1374 |
| 280 | Ga0068864_100390057 | 3300005618 | Bacteria | 1321 |
| 281 | Ga0068866_10029543 | 3300005718 | Bacteria | 2623 |
| 282 | Ga0068866_10113877 | 3300005718 | Bacteria | 1513 |
| 283 | Ga0068866_10217925 | 3300005718 | Bacteria | 1150 |
| 284 | Ga0068861_100007430 | 3300005719 | Bacteria | 7511 |
| 285 | Ga0068861_100052573 | 3300005719 | Unclassified | 3096 |
| 286 | Ga0068861_100157247 | 3300005719 | Bacteria | 1871 |
| 287 | Ga0068861_100286841 | 3300005719 | Bacteria | 1420 |
| 288 | Ga0068861_100346859 | 3300005719 | Bacteria | 1301 |
| 289 | Ga0068861_100502652 | 3300005719 | Bacteria | 1096 |
| 290 | Ga0068861_101125681 | 3300005719 | Unclassified | 756 |
| 291 | Ga0068861_101249133 | 3300005719 | Bacteria | 720 |
| 292 | Ga0068851_10567664 | 3300005834 | Bacteria | 687 |
| 293 | Ga0068870_10009968 | 3300005840 | Bacteria | 4343 |
| 294 | Ga0068870_10211602 | 3300005840 | Unclassified | 1181 |
| 295 | Ga0068863_100014068 | 3300005841 | Bacteria | 7710 |
| 296 | Ga0068863_100020130 | 3300005841 | Bacteria | 6383 |
| 297 | Ga0068863_100063616 | 3300005841 | Bacteria | 3489 |
| 298 | Ga0068863_100311080 | 3300005841 | Bacteria | 1529 |
| 299 | Ga0068863_100473288 | 3300005841 | Bacteria | 1231 |
| 300 | Ga0068863_100986907 | 3300005841 | Bacteria | 845 |
| 301 | Ga0068863_101277784 | 3300005841 | Unclassified | 741 |
| 302 | Ga0068863_101457457 | 3300005841 | Unclassified | 693 |
| 303 | Ga0068863_101834240 | 3300005841 | Bacteria | 616 |
| 304 | Ga0068858_100056174 | 3300005842 | Bacteria | 3639 |
| 305 | Ga0068858_100261028 | 3300005842 | Bacteria | 1646 |
| 306 | Ga0068858_101039195 | 3300005842 | Bacteria | 803 |
| 307 | Ga0068858_102005184 | 3300005842 | Unclassified | 572 |
| 308 | Ga0068860_100038000 | 3300005843 | Bacteria | 4607 |
| 309 | Ga0068860_100364160 | 3300005843 | Bacteria | 1425 |
| 310 | Ga0068860_100364671 | 3300005843 | Bacteria | 1424 |
| 311 | Ga0068860_100580204 | 3300005843 | Unclassified | 1125 |
| 312 | Ga0068860_100593590 | 3300005843 | Bacteria | 1112 |
| 313 | Ga0068860_100655051 | 3300005843 | Bacteria | 1058 |
| 314 | Ga0068860_100838760 | 3300005843 | Unclassified | 933 |
| 315 | Ga0068860_100865714 | 3300005843 | Bacteria | 919 |
| 316 | Ga0068860_101150488 | 3300005843 | Bacteria | 796 |
| 317 | Ga0068860_101881403 | 3300005843 | Bacteria | 620 |
| 318 | Ga0068860_102824736 | 3300005843 | Bacteria | 503 |
| 319 | Ga0068862_100114924 | 3300005844 | Bacteria | 2366 |
| 320 | Ga0068862_100195821 | 3300005844 | Bacteria | 1820 |
| 321 | Ga0068862_100196777 | 3300005844 | Bacteria | 1816 |
| 322 | Ga0068862_100197710 | 3300005844 | Bacteria | 1811 |
| 323 | Ga0068862_100310651 | 3300005844 | Unclassified | 1453 |
| 324 | Ga0068862_100319909 | 3300005844 | Bacteria | 1432 |
| 325 | Ga0068862_101092915 | 3300005844 | Bacteria | 792 |
| 326 | Ga0068862_101368253 | 3300005844 | Unclassified | 710 |
| 327 | Ga0068862_101461805 | 3300005844 | Bacteria | 688 |
| 328 | Ga0068862_101519662 | 3300005844 | Bacteria | 675 |
| 329 | Ga0081539_10120430 | 3300005985 | Bacteria | 1304 |
| 330 | Ga0070715_10027365 | 3300006163 | Bacteria | 2278 |
| 331 | Ga0070715_10046476 | 3300006163 | Bacteria | 1846 |
| 332 | Ga0075366_10183517 | 3300006195 | Bacteria | 1271 |
| 333 | Ga0097621_100264271 | 3300006237 | Bacteria | 1510 |
| 334 | Ga0097621_100614270 | 3300006237 | Bacteria | 995 |
| 335 | Ga0097621_101616740 | 3300006237 | Unclassified | 616 |
| 336 | Ga0097621_102004036 | 3300006237 | Bacteria | 553 |
| 337 | Ga0068871_100014874 | 3300006358 | Bacteria | 5813 |
| 338 | Ga0068871_100105996 | 3300006358 | Bacteria | 2359 |
| 339 | Ga0068871_100285359 | 3300006358 | Bacteria | 1445 |
| 340 | Ga0068871_100909023 | 3300006358 | Unclassified | 816 |
| 341 | Ga0068871_100952134 | 3300006358 | Bacteria | 798 |
| 342 | Ga0075428_100012646 | 3300006844 | Bacteria | 9385 |
| 343 | Ga0075428_100416303 | 3300006844 | Unclassified | 1440 |
| 344 | Ga0075428_100452833 | 3300006844 | Bacteria | 1375 |
| 345 | Ga0075428_100604721 | 3300006844 | Bacteria | 1171 |
| 346 | Ga0075428_101884212 | 3300006844 | Unclassified | 621 |
| 347 | Ga0075430_100044970 | 3300006846 | Bacteria | 3732 |
| 348 | Ga0075431_100038737 | 3300006847 | Bacteria | 4910 |
| 349 | Ga0075433_11430664 | 3300006852 | Bacteria | 598 |
| 350 | Ga0075434_100250681 | 3300006871 | Bacteria | 1790 |
| 351 | Ga0075429_100035605 | 3300006880 | Bacteria | 4330 |
| 352 | Ga0075429_100086034 | 3300006880 | Bacteria | 2740 |
| 353 | Ga0068865_100267382 | 3300006881 | Bacteria | 1356 |
| 354 | Ga0068865_100456138 | 3300006881 | Bacteria | 1058 |
| 355 | Ga0068865_101624266 | 3300006881 | Bacteria | 581 |
| 356 | Ga0097620_100016082 | 3300006931 | Bacteria | 7517 |
| 357 | Ga0097620_100059889 | 3300006931 | Bacteria | 3836 |
| 358 | Ga0097620_100166414 | 3300006931 | Bacteria | 2285 |
| 359 | Ga0097620_100186869 | 3300006931 | Bacteria | 2156 |
| 360 | Ga0097620_100200656 | 3300006931 | Bacteria | 2079 |
| 361 | Ga0097620_100339163 | 3300006931 | Bacteria | 1597 |
| 362 | Ga0097620_100531691 | 3300006931 | Bacteria | 1270 |
| 363 | Ga0097620_101431425 | 3300006931 | Bacteria | 762 |
| 364 | Ga0097620_101789168 | 3300006931 | Unclassified | 679 |
| 365 | Ga0097620_103051072 | 3300006931 | Bacteria | 511 |
| 366 | Ga0105240_10008412 | 3300009093 | Bacteria | 14764 |
| 367 | Ga0105240_10013970 | 3300009093 | Bacteria | 10992 |
| 368 | Ga0105240_10048294 | 3300009093 | Bacteria | 5381 |
| 369 | Ga0105240_10158930 | 3300009093 | Bacteria | 2686 |
| 370 | Ga0111539_10140833 | 3300009094 | Bacteria | 2823 |
| 371 | Ga0111539_10161304 | 3300009094 | Bacteria | 2622 |
| 372 | Ga0111539_10478553 | 3300009094 | Bacteria | 1450 |
| 373 | Ga0111539_10926299 | 3300009094 | Bacteria | 1013 |
| 374 | Ga0111539_12108073 | 3300009094 | Bacteria | 654 |
| 375 | Ga0111539_12418412 | 3300009094 | Bacteria | 609 |
| 376 | Ga0105247_10005318 | 3300009101 | Bacteria | 8116 |
| 377 | Ga0105247_10257803 | 3300009101 | Unclassified | 1194 |
| 378 | Ga0105247_10273914 | 3300009101 | Bacteria | 1162 |
| 379 | Ga0105247_10497523 | 3300009101 | Unclassified | 888 |
| 380 | Ga0114129_10027834 | 3300009147 | Bacteria | 8005 |
| 381 | Ga0114129_10047706 | 3300009147 | Bacteria | 6017 |
| 382 | Ga0114129_13240719 | 3300009147 | Bacteria | 528 |
| 383 | Ga0105243_10369475 | 3300009148 | Bacteria | 1323 |
| 384 | Ga0105243_10507510 | 3300009148 | Bacteria | 1144 |
| 385 | Ga0105241_10000460 | 3300009174 | Bacteria | 30681 |
| 386 | Ga0105241_10416031 | 3300009174 | Unclassified | 1182 |
| 387 | Ga0105241_10456955 | 3300009174 | Bacteria | 1131 |
| 388 | Ga0105241_10471635 | 3300009174 | Bacteria | 1114 |
| 389 | Ga0105241_10521220 | 3300009174 | Unclassified | 1063 |
| 390 | Ga0105241_12507995 | 3300009174 | Bacteria | 516 |
| 391 | Ga0105242_10036767 | 3300009176 | Bacteria | 3930 |
| 392 | Ga0105242_10038912 | 3300009176 | Bacteria | 3827 |
| 393 | Ga0105242_10041913 | 3300009176 | Bacteria | 3695 |
| 394 | Ga0105242_10057460 | 3300009176 | Bacteria | 3187 |
| 395 | Ga0105242_10078592 | 3300009176 | Bacteria | 2754 |
| 396 | Ga0105242_10377044 | 3300009176 | Bacteria | 1317 |
| 397 | Ga0105242_10554226 | 3300009176 | Bacteria | 1103 |
| 398 | Ga0105242_11117850 | 3300009176 | Bacteria | 803 |
| 399 | Ga0105242_11272156 | 3300009176 | Bacteria | 758 |
| 400 | Ga0105242_13050904 | 3300009176 | Bacteria | 519 |
| 401 | Ga0105248_10337014 | 3300009177 | Bacteria | 1698 |
| 402 | Ga0105248_10405758 | 3300009177 | Unclassified | 1534 |
| 403 | Ga0105237_10009688 | 3300009545 | Bacteria | 10307 |
| 404 | Ga0105238_10000488 | 3300009551 | Bacteria | 41712 |
| 405 | Ga0105238_10019337 | 3300009551 | Bacteria | 6936 |
| 406 | Ga0105238_10021278 | 3300009551 | Bacteria | 6610 |
| 407 | Ga0105238_11060670 | 3300009551 | Bacteria | 832 |
| 408 | Ga0105249_10001044 | 3300009553 | Bacteria | 24495 |
| 409 | Ga0105249_10003251 | 3300009553 | Bacteria | 14076 |
| 410 | Ga0105249_10008489 | 3300009553 | Bacteria | 8951 |
| 411 | Ga0105249_10021033 | 3300009553 | Bacteria | 5840 |
| 412 | Ga0105249_10031881 | 3300009553 | Bacteria | 4768 |
| 413 | Ga0105249_10155331 | 3300009553 | Bacteria | 2206 |
| 414 | Ga0105249_10350109 | 3300009553 | Bacteria | 1496 |
| 415 | Ga0105249_10438787 | 3300009553 | Unclassified | 1343 |
| 416 | Ga0105249_10560999 | 3300009553 | Bacteria | 1194 |
| 417 | Ga0105249_10727350 | 3300009553 | Bacteria | 1054 |
| 418 | Ga0105249_10766227 | 3300009553 | Unclassified | 1028 |
| 419 | Ga0105249_11166446 | 3300009553 | Unclassified | 841 |
| 420 | Ga0105249_11556370 | 3300009553 | Unclassified | 733 |
| 421 | Ga0105239_10032094 | 3300010375 | Bacteria | 5771 |
| 422 | Ga0105239_10084716 | 3300010375 | Bacteria | 3492 |
| 423 | Ga0105246_10176787 | 3300011119 | Bacteria | 1640 |
| 424 | Ga0105246_10178053 | 3300011119 | Bacteria | 1635 |
| 425 | Ga0105246_10500332 | 3300011119 | Bacteria | 1032 |
| 426 | Ga0157373_10027634 | 3300013100 | Bacteria | 4093 |
| 427 | Ga0157373_10138537 | 3300013100 | Bacteria | 1711 |
| 428 | Ga0157373_10142570 | 3300013100 | Bacteria | 1685 |
| 429 | Ga0157373_10172867 | 3300013100 | Bacteria | 1520 |
| 430 | Ga0157373_10287471 | 3300013100 | Bacteria | 1166 |
| 431 | Ga0157373_10527391 | 3300013100 | Bacteria | 855 |
| 432 | Ga0157373_10904612 | 3300013100 | Unclassified | 655 |
| 433 | Ga0157373_11071155 | 3300013100 | Unclassified | 604 |
| 434 | Ga0157371_10000868 | 3300013102 | Bacteria | 34292 |
| 435 | Ga0157371_10005115 | 3300013102 | Bacteria | 11187 |
| 436 | Ga0157371_10039547 | 3300013102 | Bacteria | 3372 |
| 437 | Ga0157371_10162582 | 3300013102 | Bacteria | 1594 |
| 438 | Ga0157371_10183168 | 3300013102 | Bacteria | 1498 |
| 439 | Ga0157371_10433342 | 3300013102 | Bacteria | 965 |
| 440 | Ga0157371_10457951 | 3300013102 | Bacteria | 938 |
| 441 | Ga0157371_10651042 | 3300013102 | Unclassified | 786 |
| 442 | Ga0157371_10833826 | 3300013102 | Unclassified | 696 |
| 443 | Ga0157371_10907198 | 3300013102 | Bacteria | 668 |
| 444 | Ga0157370_10000313 | 3300013104 | Bacteria | 60838 |
| 445 | Ga0157370_10000628 | 3300013104 | Bacteria | 43950 |
| 446 | Ga0157370_10034855 | 3300013104 | Bacteria | 4897 |
| 447 | Ga0157370_10045234 | 3300013104 | Bacteria | 4224 |
| 448 | Ga0157370_10191488 | 3300013104 | Bacteria | 1898 |
| 449 | Ga0157370_10453106 | 3300013104 | Bacteria | 1179 |
| 450 | Ga0157370_10620036 | 3300013104 | Unclassified | 990 |
| 451 | Ga0157370_10700953 | 3300013104 | Bacteria | 924 |
| 452 | Ga0157369_10008510 | 3300013105 | Bacteria | 11765 |
| 453 | Ga0157369_10014518 | 3300013105 | Bacteria | 8888 |
| 454 | Ga0157369_10025886 | 3300013105 | Bacteria | 6509 |
| 455 | Ga0157369_10259455 | 3300013105 | Bacteria | 1812 |
| 456 | Ga0157374_10007342 | 3300013296 | Bacteria | 9400 |
| 457 | Ga0157374_10007442 | 3300013296 | Bacteria | 9340 |
| 458 | Ga0157374_10050953 | 3300013296 | Bacteria | 3851 |
| 459 | Ga0157374_10191600 | 3300013296 | Bacteria | 2000 |
| 460 | Ga0157374_10513022 | 3300013296 | Bacteria | 1204 |
| 461 | Ga0157374_10862023 | 3300013296 | Bacteria | 923 |
| 462 | Ga0157378_10177225 | 3300013297 | Bacteria | 2003 |
| 463 | Ga0157378_10403637 | 3300013297 | Bacteria | 1347 |
| 464 | Ga0157378_10483881 | 3300013297 | Bacteria | 1234 |
| 465 | Ga0157378_11368833 | 3300013297 | Bacteria | 750 |
| 466 | Ga0157378_12396900 | 3300013297 | Bacteria | 579 |
| 467 | Ga0157378_13170480 | 3300013297 | Unclassified | 511 |
| 468 | Ga0163162_10002193 | 3300013306 | Bacteria | 18320 |
| 469 | Ga0163162_10019306 | 3300013306 | Bacteria | 6684 |
| 470 | Ga0163162_10039481 | 3300013306 | Bacteria | 4718 |
| 471 | Ga0163162_10046225 | 3300013306 | Bacteria | 4363 |
| 472 | Ga0163162_10058280 | 3300013306 | Bacteria | 3891 |
| 473 | Ga0163162_10188340 | 3300013306 | Bacteria | 2191 |
| 474 | Ga0163162_10247492 | 3300013306 | Bacteria | 1914 |
| 475 | Ga0163162_10282674 | 3300013306 | Bacteria | 1791 |
| 476 | Ga0163162_10425596 | 3300013306 | Bacteria | 1460 |
| 477 | Ga0163162_10840113 | 3300013306 | Bacteria | 1034 |
| 478 | Ga0163162_11579920 | 3300013306 | Unclassified | 748 |
| 479 | Ga0163162_12223275 | 3300013306 | Bacteria | 630 |
| 480 | Ga0163162_12314021 | 3300013306 | Bacteria | 617 |
| 481 | Ga0157372_10001983 | 3300013307 | Bacteria | 22252 |
| 482 | Ga0157372_10010278 | 3300013307 | Bacteria | 9942 |
| 483 | Ga0157372_10017315 | 3300013307 | Bacteria | 7736 |
| 484 | Ga0157372_10094848 | 3300013307 | Bacteria | 3399 |
| 485 | Ga0157372_10101634 | 3300013307 | Bacteria | 3282 |
| 486 | Ga0157372_10126077 | 3300013307 | Unclassified | 2944 |
| 487 | Ga0157372_10214413 | 3300013307 | Bacteria | 2231 |
| 488 | Ga0157372_10470989 | 3300013307 | Bacteria | 1464 |
| 489 | Ga0157372_10479674 | 3300013307 | Bacteria | 1450 |
| 490 | Ga0157372_10505769 | 3300013307 | Bacteria | 1409 |
| 491 | Ga0157372_10666193 | 3300013307 | Bacteria | 1211 |
| 492 | Ga0157372_13483023 | 3300013307 | Bacteria | 500 |
| 493 | Ga0157375_10007261 | 3300013308 | Bacteria | 9694 |
| 494 | Ga0157375_10011768 | 3300013308 | Bacteria | 7737 |
| 495 | Ga0157375_10023657 | 3300013308 | Bacteria | 5673 |
| 496 | Ga0157375_10076285 | 3300013308 | Bacteria | 3378 |
| 497 | Ga0157375_10087559 | 3300013308 | Bacteria | 3167 |
| 498 | Ga0157375_10097502 | 3300013308 | Bacteria | 3014 |
| 499 | Ga0157375_10970445 | 3300013308 | Bacteria | 991 |
| 500 | Ga0157375_12224419 | 3300013308 | Unclassified | 653 |
| 501 | Ga0157375_12273375 | 3300013308 | Bacteria | 646 |
| 502 | Ga0157375_12829655 | 3300013308 | Unclassified | 580 |
| 503 | Ga0157375_13671857 | 3300013308 | Bacteria | 510 |
| 504 | Ga0163163_10005376 | 3300014325 | Bacteria | 11069 |
| 505 | Ga0163163_10042028 | 3300014325 | Bacteria | 4474 |
| 506 | Ga0163163_10061006 | 3300014325 | Bacteria | 3736 |
| 507 | Ga0163163_10139040 | 3300014325 | Bacteria | 2470 |
| 508 | Ga0163163_10185645 | 3300014325 | Bacteria | 2127 |
| 509 | Ga0163163_10188446 | 3300014325 | Bacteria | 2111 |
| 510 | Ga0163163_10302420 | 3300014325 | Bacteria | 1652 |
| 511 | Ga0163163_11429461 | 3300014325 | Bacteria | 753 |
| 512 | Ga0163163_12887016 | 3300014325 | Unclassified | 536 |
| 513 | Ga0157380_10018730 | 3300014326 | Bacteria | 5146 |
| 514 | Ga0157380_10027818 | 3300014326 | Bacteria | 4304 |
| 515 | Ga0157380_10266159 | 3300014326 | Bacteria | 1560 |
| 516 | Ga0157380_10414794 | 3300014326 | Unclassified | 1282 |
| 517 | Ga0157380_10594697 | 3300014326 | Unclassified | 1093 |
| 518 | Ga0157380_10739259 | 3300014326 | Bacteria | 994 |
| 519 | Ga0157380_11579148 | 3300014326 | Unclassified | 711 |
| 520 | Ga0157380_11894687 | 3300014326 | Unclassified | 657 |
| 521 | Ga0157380_12412174 | 3300014326 | Bacteria | 591 |
| 522 | Ga0157377_10000678 | 3300014745 | Bacteria | 14088 |
| 523 | Ga0157377_10008049 | 3300014745 | Bacteria | 5126 |
| 524 | Ga0157377_10010005 | 3300014745 | Bacteria | 4678 |
| 525 | Ga0157377_10238428 | 3300014745 | Unclassified | 1173 |
| 526 | Ga0157377_10264540 | 3300014745 | Bacteria | 1120 |
| 527 | Ga0157377_10365055 | 3300014745 | Bacteria | 973 |
| 528 | Ga0157377_10461175 | 3300014745 | Bacteria | 879 |
| 529 | Ga0157377_10484089 | 3300014745 | Bacteria | 861 |
| 530 | Ga0157377_10684990 | 3300014745 | Bacteria | 742 |
| 531 | Ga0157379_10085475 | 3300014968 | Bacteria | 2827 |
| 532 | Ga0157379_10246758 | 3300014968 | Bacteria | 1620 |
| 533 | Ga0157379_10605657 | 3300014968 | Bacteria | 1023 |
| 534 | Ga0157379_10667471 | 3300014968 | Bacteria | 974 |
| 535 | Ga0157379_10748182 | 3300014968 | Bacteria | 920 |
| 536 | Ga0157379_10833434 | 3300014968 | Bacteria | 872 |
| 537 | Ga0157376_10006599 | 3300014969 | Bacteria | 8210 |
| 538 | Ga0157376_10171063 | 3300014969 | Bacteria | 1979 |
| 539 | Ga0157376_10661862 | 3300014969 | Bacteria | 1046 |
| 540 | Ga0157376_11339872 | 3300014969 | Bacteria | 746 |
| 541 | Ga0163161_10006695 | 3300017792 | Bacteria | 7974 |
| 542 | Ga0163161_10160993 | 3300017792 | Bacteria | 1711 |
| 543 | Ga0163161_10241650 | 3300017792 | Bacteria | 1404 |
| 544 | Ga0163161_10303358 | 3300017792 | Bacteria | 1258 |
| 545 | Ga0163161_10630074 | 3300017792 | Unclassified | 887 |
| 546 | Ga0213876_10093846 | 3300021384 | Bacteria | 1590 |
| 547 | Ga0207697_10015840 | 3300025315 | Bacteria | 3110 |
| 548 | Ga0207697_10055750 | 3300025315 | Bacteria | 1639 |
| 549 | Ga0207642_10368139 | 3300025899 | Bacteria | 852 |
| 550 | Ga0207642_10997564 | 3300025899 | Unclassified | 539 |
| 551 | Ga0207710_10008757 | 3300025900 | Unclassified | 4263 |
| 552 | Ga0207680_10041487 | 3300025903 | Bacteria | 2685 |
| 553 | Ga0207680_10719785 | 3300025903 | Bacteria | 715 |
| 554 | Ga0207647_10013169 | 3300025904 | Bacteria | 5745 |
| 555 | Ga0207647_10057441 | 3300025904 | Bacteria | 2386 |
| 556 | Ga0207647_10062815 | 3300025904 | Bacteria | 2262 |
| 557 | Ga0207685_10088628 | 3300025905 | Bacteria | 1297 |
| 558 | Ga0207685_10375486 | 3300025905 | Bacteria | 723 |
| 559 | Ga0207645_10024141 | 3300025907 | Bacteria | 3945 |
| 560 | Ga0207645_10034576 | 3300025907 | Bacteria | 3247 |
| 561 | Ga0207645_10273779 | 3300025907 | Bacteria | 1120 |
| 562 | Ga0207643_10009087 | 3300025908 | Bacteria | 5337 |
| 563 | Ga0207643_10023317 | 3300025908 | Bacteria | 3412 |
| 564 | Ga0207643_10042085 | 3300025908 | Bacteria | 2575 |
| 565 | Ga0207705_10002807 | 3300025909 | Bacteria | 13316 |
| 566 | Ga0207705_10026743 | 3300025909 | Bacteria | 4112 |
| 567 | Ga0207705_10071547 | 3300025909 | Bacteria | 2514 |
| 568 | Ga0207705_10084511 | 3300025909 | Unclassified | 2317 |
| 569 | Ga0207705_11166062 | 3300025909 | Bacteria | 592 |
| 570 | Ga0207684_11653904 | 3300025910 | Unclassified | 517 |
| 571 | Ga0207654_10069535 | 3300025911 | Unclassified | 2087 |
| 572 | Ga0207654_10869588 | 3300025911 | Bacteria | 653 |
| 573 | Ga0207707_10059337 | 3300025912 | Bacteria | 3329 |
| 574 | Ga0207707_10194289 | 3300025912 | Bacteria | 1770 |
| 575 | Ga0207707_10370432 | 3300025912 | Bacteria | 1232 |
| 576 | Ga0207707_10795303 | 3300025912 | Bacteria | 788 |
| 577 | Ga0207695_10001387 | 3300025913 | Bacteria | 40927 |
| 578 | Ga0207695_10038130 | 3300025913 | Bacteria | 5178 |
| 579 | Ga0207695_10052655 | 3300025913 | Bacteria | 4262 |
| 580 | Ga0207695_11463290 | 3300025913 | Bacteria | 563 |
| 581 | Ga0207671_10007829 | 3300025914 | Bacteria | 9188 |
| 582 | Ga0207660_10011907 | 3300025917 | Bacteria | 5675 |
| 583 | Ga0207660_10119703 | 3300025917 | Bacteria | 1993 |
| 584 | Ga0207660_10309496 | 3300025917 | Bacteria | 1259 |
| 585 | Ga0207660_10491296 | 3300025917 | Bacteria | 995 |
| 586 | Ga0207662_10003292 | 3300025918 | Bacteria | 8290 |
| 587 | Ga0207662_10059491 | 3300025918 | Bacteria | 2290 |
| 588 | Ga0207662_10073654 | 3300025918 | Bacteria | 2072 |
| 589 | Ga0207657_10005023 | 3300025919 | Bacteria | 13884 |
| 590 | Ga0207657_10029703 | 3300025919 | Bacteria | 4971 |
| 591 | Ga0207657_10132123 | 3300025919 | Bacteria | 2045 |
| 592 | Ga0207657_10186480 | 3300025919 | Bacteria | 1675 |
| 593 | Ga0207657_10312403 | 3300025919 | Bacteria | 1244 |
| 594 | Ga0207657_10812087 | 3300025919 | Bacteria | 723 |
| 595 | Ga0207649_10019365 | 3300025920 | Bacteria | 3888 |
| 596 | Ga0207649_10264292 | 3300025920 | Bacteria | 1245 |
| 597 | Ga0207649_10337821 | 3300025920 | Unclassified | 1111 |
| 598 | Ga0207649_10428886 | 3300025920 | Bacteria | 994 |
| 599 | Ga0207652_10000187 | 3300025921 | Bacteria | 65282 |
| 600 | Ga0207652_10000198 | 3300025921 | Bacteria | 63388 |
| 601 | Ga0207652_10029289 | 3300025921 | Bacteria | 4602 |
| 602 | Ga0207652_10115311 | 3300025921 | Bacteria | 2386 |
| 603 | Ga0207652_11844939 | 3300025921 | Bacteria | 510 |
| 604 | Ga0207681_10002024 | 3300025923 | Bacteria | 13028 |
| 605 | Ga0207681_10165742 | 3300025923 | Bacteria | 1670 |
| 606 | Ga0207681_10187394 | 3300025923 | Bacteria | 1580 |
| 607 | Ga0207681_10448510 | 3300025923 | Bacteria | 1049 |
| 608 | Ga0207681_10767913 | 3300025923 | Bacteria | 804 |
| 609 | Ga0207681_11423202 | 3300025923 | Bacteria | 582 |
| 610 | Ga0207694_10002191 | 3300025924 | Bacteria | 16050 |
| 611 | Ga0207694_10028517 | 3300025924 | Bacteria | 4257 |
| 612 | Ga0207694_11570389 | 3300025924 | Unclassified | 555 |
| 613 | Ga0207650_10023273 | 3300025925 | Bacteria | 4391 |
| 614 | Ga0207650_10039444 | 3300025925 | Bacteria | 3451 |
| 615 | Ga0207650_10145425 | 3300025925 | Bacteria | 1867 |
| 616 | Ga0207650_10237979 | 3300025925 | Bacteria | 1471 |
| 617 | Ga0207659_10022937 | 3300025926 | Bacteria | 4162 |
| 618 | Ga0207659_10151721 | 3300025926 | Bacteria | 1810 |
| 619 | Ga0207659_10271986 | 3300025926 | Bacteria | 1382 |
| 620 | Ga0207659_10571682 | 3300025926 | Bacteria | 962 |
| 621 | Ga0207644_10093875 | 3300025931 | Unclassified | 2241 |
| 622 | Ga0207644_10227264 | 3300025931 | Bacteria | 1482 |
| 623 | Ga0207690_10003750 | 3300025932 | Bacteria | 9010 |
| 624 | Ga0207690_10030767 | 3300025932 | Bacteria | 3428 |
| 625 | Ga0207690_10048458 | 3300025932 | Bacteria | 2825 |
| 626 | Ga0207690_10089507 | 3300025932 | Bacteria | 2171 |
| 627 | Ga0207690_10143848 | 3300025932 | Bacteria | 1760 |
| 628 | Ga0207690_10604401 | 3300025932 | Bacteria | 895 |
| 629 | Ga0207706_10005261 | 3300025933 | Bacteria | 12070 |
| 630 | Ga0207706_10020449 | 3300025933 | Bacteria | 5951 |
| 631 | Ga0207706_10020556 | 3300025933 | Bacteria | 5933 |
| 632 | Ga0207706_10375299 | 3300025933 | Bacteria | 1235 |
| 633 | Ga0207706_11076955 | 3300025933 | Bacteria | 672 |
| 634 | Ga0207686_10001189 | 3300025934 | Bacteria | 15075 |
| 635 | Ga0207686_10012292 | 3300025934 | Bacteria | 4705 |
| 636 | Ga0207686_10018765 | 3300025934 | Bacteria | 3920 |
| 637 | Ga0207686_10040292 | 3300025934 | Bacteria | 2839 |
| 638 | Ga0207686_10357787 | 3300025934 | Unclassified | 1101 |
| 639 | Ga0207670_10004279 | 3300025936 | Bacteria | 7663 |
| 640 | Ga0207670_10042128 | 3300025936 | Bacteria | 3006 |
| 641 | Ga0207670_10080757 | 3300025936 | Bacteria | 2274 |
| 642 | Ga0207670_10094296 | 3300025936 | Unclassified | 2123 |
| 643 | Ga0207670_10137271 | 3300025936 | Bacteria | 1799 |
| 644 | Ga0207670_10426793 | 3300025936 | Bacteria | 1065 |
| 645 | Ga0207670_10501171 | 3300025936 | Unclassified | 986 |
| 646 | Ga0207670_11743416 | 3300025936 | Bacteria | 530 |
| 647 | Ga0207669_10019812 | 3300025937 | Bacteria | 3512 |
| 648 | Ga0207669_10535287 | 3300025937 | Bacteria | 943 |
| 649 | Ga0207691_10017962 | 3300025940 | Bacteria | 6700 |
| 650 | Ga0207691_10554754 | 3300025940 | Bacteria | 974 |
| 651 | Ga0207691_10774475 | 3300025940 | Bacteria | 807 |
| 652 | Ga0207711_10480404 | 3300025941 | Bacteria | 1158 |
| 653 | Ga0207711_10561142 | 3300025941 | Bacteria | 1065 |
| 654 | Ga0207689_10002851 | 3300025942 | Bacteria | 15954 |
| 655 | Ga0207689_10007932 | 3300025942 | Bacteria | 9273 |
| 656 | Ga0207689_10009313 | 3300025942 | Bacteria | 8492 |
| 657 | Ga0207689_10023684 | 3300025942 | Bacteria | 5149 |
| 658 | Ga0207689_10103461 | 3300025942 | Unclassified | 2340 |
| 659 | Ga0207689_10236602 | 3300025942 | Bacteria | 1509 |
| 660 | Ga0207689_10505107 | 3300025942 | Bacteria | 1013 |
| 661 | Ga0207689_11516867 | 3300025942 | Bacteria | 559 |
| 662 | Ga0207661_10005152 | 3300025944 | Bacteria | 9184 |
| 663 | Ga0207661_10034029 | 3300025944 | Bacteria | 3959 |
| 664 | Ga0207661_10144280 | 3300025944 | Bacteria | 2052 |
| 665 | Ga0207661_10169413 | 3300025944 | Bacteria | 1900 |
| 666 | Ga0207661_10190896 | 3300025944 | Bacteria | 1796 |
| 667 | Ga0207661_10286707 | 3300025944 | Bacteria | 1473 |
| 668 | Ga0207661_10707131 | 3300025944 | Bacteria | 927 |
| 669 | Ga0207679_10000091 | 3300025945 | Bacteria | 78725 |
| 670 | Ga0207679_10018927 | 3300025945 | Bacteria | 4621 |
| 671 | Ga0207679_10138763 | 3300025945 | Bacteria | 1962 |
| 672 | Ga0207679_10240570 | 3300025945 | Bacteria | 1533 |
| 673 | Ga0207679_10445790 | 3300025945 | Bacteria | 1147 |
| 674 | Ga0207679_11226232 | 3300025945 | Unclassified | 688 |
| 675 | Ga0207667_10000492 | 3300025949 | Bacteria | 52207 |
| 676 | Ga0207667_10001760 | 3300025949 | Bacteria | 27253 |
| 677 | Ga0207667_10027086 | 3300025949 | Bacteria | 6249 |
| 678 | Ga0207667_10098972 | 3300025949 | Bacteria | 3008 |
| 679 | Ga0207667_10424044 | 3300025949 | Bacteria | 1353 |
| 680 | Ga0207667_10597744 | 3300025949 | Unclassified | 1113 |
| 681 | Ga0207651_10111794 | 3300025960 | Bacteria | 2052 |
| 682 | Ga0207651_10182526 | 3300025960 | Unclassified | 1666 |
| 683 | Ga0207651_10184834 | 3300025960 | Bacteria | 1657 |
| 684 | Ga0207651_10399407 | 3300025960 | Bacteria | 1169 |
| 685 | Ga0207651_10405797 | 3300025960 | Bacteria | 1160 |
| 686 | Ga0207651_10762505 | 3300025960 | Bacteria | 856 |
| 687 | Ga0207651_10764818 | 3300025960 | Unclassified | 854 |
| 688 | Ga0207651_11391031 | 3300025960 | Bacteria | 631 |
| 689 | Ga0207712_10001457 | 3300025961 | Bacteria | 16141 |
| 690 | Ga0207712_10033161 | 3300025961 | Bacteria | 3490 |
| 691 | Ga0207712_10112787 | 3300025961 | Bacteria | 2042 |
| 692 | Ga0207712_10318529 | 3300025961 | Bacteria | 1282 |
| 693 | Ga0207712_10370752 | 3300025961 | Bacteria | 1195 |
| 694 | Ga0207712_10450586 | 3300025961 | Bacteria | 1091 |
| 695 | Ga0207712_11588561 | 3300025961 | Unclassified | 586 |
| 696 | Ga0207668_10094208 | 3300025972 | Bacteria | 2208 |
| 697 | Ga0207668_10098112 | 3300025972 | Unclassified | 2170 |
| 698 | Ga0207668_10141362 | 3300025972 | Bacteria | 1852 |
| 699 | Ga0207668_10171258 | 3300025972 | Bacteria | 1703 |
| 700 | Ga0207668_10234022 | 3300025972 | Bacteria | 1483 |
| 701 | Ga0207668_11869941 | 3300025972 | Unclassified | 541 |
| 702 | Ga0207640_10181913 | 3300025981 | Bacteria | 1577 |
| 703 | Ga0207640_10365833 | 3300025981 | Bacteria | 1164 |
| 704 | Ga0207640_10445036 | 3300025981 | Bacteria | 1066 |
| 705 | Ga0207640_10843356 | 3300025981 | Bacteria | 797 |
| 706 | Ga0207640_12067380 | 3300025981 | Bacteria | 516 |
| 707 | Ga0207658_10293330 | 3300025986 | Unclassified | 1398 |
| 708 | Ga0207658_10581807 | 3300025986 | Bacteria | 1004 |
| 709 | Ga0207658_10797309 | 3300025986 | Bacteria | 857 |
| 710 | Ga0207658_11803949 | 3300025986 | Bacteria | 558 |
| 711 | Ga0207658_11875546 | 3300025986 | Bacteria | 546 |
| 712 | Ga0207677_10043771 | 3300026023 | Bacteria | 2978 |
| 713 | Ga0207677_10091214 | 3300026023 | Bacteria | 2216 |
| 714 | Ga0207677_10142611 | 3300026023 | Bacteria | 1837 |
| 715 | Ga0207677_10608853 | 3300026023 | Bacteria | 959 |
| 716 | Ga0207677_10925223 | 3300026023 | Bacteria | 787 |
| 717 | Ga0207677_11197777 | 3300026023 | Bacteria | 695 |
| 718 | Ga0207703_10615323 | 3300026035 | Bacteria | 1028 |
| 719 | Ga0207703_10822432 | 3300026035 | Bacteria | 887 |
| 720 | Ga0207703_10872006 | 3300026035 | Bacteria | 861 |
| 721 | Ga0207703_11126320 | 3300026035 | Bacteria | 754 |
| 722 | Ga0207639_10019684 | 3300026041 | Bacteria | 4818 |
| 723 | Ga0207639_10073993 | 3300026041 | Bacteria | 2673 |
| 724 | Ga0207639_10092796 | 3300026041 | Bacteria | 2420 |
| 725 | Ga0207639_10115198 | 3300026041 | Bacteria | 2198 |
| 726 | Ga0207639_10330791 | 3300026041 | Unclassified | 1355 |
| 727 | Ga0207639_10458427 | 3300026041 | Bacteria | 1158 |
| 728 | Ga0207639_10536754 | 3300026041 | Bacteria | 1073 |
| 729 | Ga0207639_10553409 | 3300026041 | Bacteria | 1056 |
| 730 | Ga0207639_10900829 | 3300026041 | Bacteria | 827 |
| 731 | Ga0207639_11027077 | 3300026041 | Unclassified | 772 |
| 732 | Ga0207678_10018070 | 3300026067 | Bacteria | 6193 |
| 733 | Ga0207678_10025516 | 3300026067 | Bacteria | 5159 |
| 734 | Ga0207708_10017202 | 3300026075 | Bacteria | 5442 |
| 735 | Ga0207708_10147513 | 3300026075 | Bacteria | 1850 |
| 736 | Ga0207708_10190030 | 3300026075 | Bacteria | 1634 |
| 737 | Ga0207708_10514081 | 3300026075 | Bacteria | 1005 |
| 738 | Ga0207708_11256877 | 3300026075 | Unclassified | 648 |
| 739 | Ga0207702_10007374 | 3300026078 | Bacteria | 9391 |
| 740 | Ga0207641_10002685 | 3300026088 | Bacteria | 16230 |
| 741 | Ga0207641_10014674 | 3300026088 | Bacteria | 6424 |
| 742 | Ga0207641_10021780 | 3300026088 | Bacteria | 5268 |
| 743 | Ga0207641_10123766 | 3300026088 | Unclassified | 2312 |
| 744 | Ga0207641_10144518 | 3300026088 | Bacteria | 2150 |
| 745 | Ga0207641_10205387 | 3300026088 | Bacteria | 1819 |
| 746 | Ga0207641_10409238 | 3300026088 | Bacteria | 1304 |
| 747 | Ga0207641_11370123 | 3300026088 | Unclassified | 708 |
| 748 | Ga0207648_10008642 | 3300026089 | Bacteria | 9835 |
| 749 | Ga0207648_10043835 | 3300026089 | Bacteria | 3927 |
| 750 | Ga0207648_10063299 | 3300026089 | Bacteria | 3224 |
| 751 | Ga0207648_10176544 | 3300026089 | Unclassified | 1889 |
| 752 | Ga0207648_10215118 | 3300026089 | Bacteria | 1707 |
| 753 | Ga0207648_10829501 | 3300026089 | Unclassified | 862 |
| 754 | Ga0207648_11048313 | 3300026089 | Bacteria | 764 |
| 755 | Ga0207676_10012166 | 3300026095 | Bacteria | 6161 |
| 756 | Ga0207676_10027882 | 3300026095 | Bacteria | 4212 |
| 757 | Ga0207676_10054925 | 3300026095 | Bacteria | 3123 |
| 758 | Ga0207676_10086183 | 3300026095 | Bacteria | 2565 |
| 759 | Ga0207676_10147746 | 3300026095 | Bacteria | 2020 |
| 760 | Ga0207676_10474709 | 3300026095 | Bacteria | 1183 |
| 761 | Ga0207676_12096474 | 3300026095 | Unclassified | 564 |
| 762 | Ga0207674_10006694 | 3300026116 | Bacteria | 13532 |
| 763 | Ga0207674_10006896 | 3300026116 | Bacteria | 13314 |
| 764 | Ga0207674_10019038 | 3300026116 | Bacteria | 7440 |
| 765 | Ga0207674_10023357 | 3300026116 | Bacteria | 6626 |
| 766 | Ga0207674_10228855 | 3300026116 | Bacteria | 1807 |
| 767 | Ga0207674_10353433 | 3300026116 | Unclassified | 1421 |
| 768 | Ga0207674_10373297 | 3300026116 | Bacteria | 1379 |
| 769 | Ga0207674_10374571 | 3300026116 | Bacteria | 1376 |
| 770 | Ga0207674_11123978 | 3300026116 | Unclassified | 755 |
| 771 | Ga0207675_100000085 | 3300026118 | Bacteria | 73716 |
| 772 | Ga0207675_100011340 | 3300026118 | Bacteria | 8340 |
| 773 | Ga0207675_100142715 | 3300026118 | Bacteria | 2275 |
| 774 | Ga0207675_100160960 | 3300026118 | Bacteria | 2141 |
| 775 | Ga0207675_100187137 | 3300026118 | Bacteria | 1985 |
| 776 | Ga0207675_100294295 | 3300026118 | Bacteria | 1580 |
| 777 | Ga0207675_100335370 | 3300026118 | Bacteria | 1479 |
| 778 | Ga0207675_100728933 | 3300026118 | Bacteria | 1001 |
| 779 | Ga0207675_100895081 | 3300026118 | Bacteria | 904 |
| 780 | Ga0207675_101440331 | 3300026118 | Bacteria | 710 |
| 781 | Ga0207675_102562642 | 3300026118 | Unclassified | 520 |
| 782 | Ga0207683_10012383 | 3300026121 | Bacteria | 7279 |
| 783 | Ga0207683_10826837 | 3300026121 | Bacteria | 860 |
| 784 | Ga0207683_11002180 | 3300026121 | Bacteria | 775 |
| 785 | Ga0207683_11740019 | 3300026121 | Unclassified | 573 |
| 786 | Ga0207698_10000340 | 3300026142 | Bacteria | 27673 |
| 787 | Ga0207698_10026635 | 3300026142 | Bacteria | 4092 |
| 788 | Ga0207698_10033125 | 3300026142 | Bacteria | 3751 |
| 789 | Ga0207698_10065708 | 3300026142 | Bacteria | 2851 |
| 790 | Ga0207698_10159407 | 3300026142 | Bacteria | 1971 |
| 791 | Ga0207698_10281058 | 3300026142 | Bacteria | 1539 |
| 792 | Ga0207698_10867347 | 3300026142 | Bacteria | 908 |
| 793 | Ga0207698_10902057 | 3300026142 | Unclassified | 891 |
| 794 | Ga0207428_10050789 | 3300027907 | Bacteria | 3316 |
| 795 | Ga0207428_10315430 | 3300027907 | Bacteria | 1155 |
| 796 | Ga0268265_10004802 | 3300028380 | Bacteria | 9318 |
| 797 | Ga0268265_10066375 | 3300028380 | Bacteria | 2789 |
| 798 | Ga0268265_10321709 | 3300028380 | Bacteria | 1401 |
| 799 | Ga0268265_10392047 | 3300028380 | Bacteria | 1281 |
| 800 | Ga0268265_10473322 | 3300028380 | Bacteria | 1175 |
| 801 | Ga0268265_11300289 | 3300028380 | Bacteria | 727 |
| 802 | Ga0268265_11311065 | 3300028380 | Unclassified | 724 |
| 803 | Ga0268265_11355816 | 3300028380 | Unclassified | 712 |
| 804 | Ga0268264_10027341 | 3300028381 | Bacteria | 4659 |
| 805 | Ga0268264_10038894 | 3300028381 | Bacteria | 3928 |
| 806 | Ga0268264_10081403 | 3300028381 | Bacteria | 2767 |
| 807 | Ga0268264_10271614 | 3300028381 | Bacteria | 1584 |
| 808 | Ga0268264_10500232 | 3300028381 | Unclassified | 1185 |
| 809 | Ga0268264_10667574 | 3300028381 | Bacteria | 1030 |
| 810 | Ga0268264_10674043 | 3300028381 | Bacteria | 1025 |
| 811 | Ga0268264_10709910 | 3300028381 | Unclassified | 999 |
| 812 | Ga0268264_11033787 | 3300028381 | Bacteria | 829 |
| 813 | Ga0268264_11254784 | 3300028381 | Bacteria | 751 |
| 814 | Ga0268264_11602209 | 3300028381 | Bacteria | 662 |
| 815 | Ga0307517_10510855 | 3300028786 | Unclassified | 609 |
| 816 | Ga0307511_10002747 | 3300030521 | Bacteria | 18300 |
| 817 | Ga0316177_1121841 | 3300030731 | Bacteria | 897 |
| 818 | Ga0265328_10276544 | 3300031239 | Bacteria | 646 |
| 819 | Ga0265327_10009266 | 3300031251 | Bacteria | 7136 |
| 820 | Ga0307513_10219809 | 3300031456 | Bacteria | 1722 |
| 821 | Ga0307513_10550569 | 3300031456 | Bacteria | 866 |
| 822 | Ga0307513_11048326 | 3300031456 | Bacteria | 526 |
| 823 | Ga0307509_10106400 | 3300031507 | Bacteria | 2824 |
| 824 | Ga0265313_10098314 | 3300031595 | Bacteria | 1303 |
| 825 | Ga0307413_12012694 | 3300031824 | Bacteria | 521 |
| 826 | Ga0307416_101388975 | 3300032002 | Unclassified | 808 |
| 827 | Ga0307414_10247074 | 3300032004 | Bacteria | 1481 |
| 828 | Ga0307414_10290691 | 3300032004 | Bacteria | 1378 |
| 829 | Ga0307414_11228193 | 3300032004 | Unclassified | 694 |
| 830 | Ga0307414_11883152 | 3300032004 | Bacteria | 558 |
| 831 | Ga0307411_10307778 | 3300032005 | Bacteria | 1274 |
| 832 | Ga0373932_0396271 | 3300035112 | Bacteria | 533 |
| 833 | Ga0373936_0292345 | 3300035113 | Bacteria | 734 |
| 834 | Ga0373943_0813620 | 3300035170 | Bacteria | 556 |
| 835 | Ga0373955_0049638 | 3300035172 | Unclassified | 2279 |
| 836 | Ga0373924_0016787 | 3300035410 | Bacteria | 2800 |
| 837 | Ga0373931_0462994 | 3300035691 | Unclassified | 813 |
| 838 | Ga0373935_0135645 | 3300035692 | Unclassified | 1658 |
| 839 | Ga0373935_0466453 | 3300035692 | Bacteria | 914 |
| 840 | Ga0373947_0037890 | 3300035725 | Bacteria | 2862 |
| 841 | Ga0373937_0028695 | 3300036401 | Bacteria | 5036 |
| 842 | Ga0395899_0003604 | 3300037312 | Bacteria | 12245 |
| 843 | Ga0395899_0007612 | 3300037312 | Bacteria | 8353 |
| 844 | Ga0395899_0035542 | 3300037312 | Bacteria | 3739 |
| 845 | Ga0395899_0039093 | 3300037312 | Bacteria | 3553 |
| 846 | Ga0395899_0287047 | 3300037312 | Unclassified | 1117 |
| 847 | Ga0395899_0824244 | 3300037312 | Bacteria | 571 |
| 848 | Ga0395899_0835106 | 3300037312 | Bacteria | 567 |
| 849 | Ga0395900_0026756 | 3300037418 | Bacteria | 5903 |
| 850 | Ga0395900_0068173 | 3300037418 | Bacteria | 3655 |
| 851 | Ga0395900_0076792 | 3300037418 | Bacteria | 3432 |
| 852 | Ga0395900_0197612 | 3300037418 | Bacteria | 2036 |
| 853 | Ga0395900_0514622 | 3300037418 | Unclassified | 1145 |
| 854 | Ga0395900_0890876 | 3300037418 | Unclassified | 814 |
| 855 | Ga0395898_0003818 | 3300037466 | Bacteria | 16686 |
| 856 | Ga0395898_0041299 | 3300037466 | Bacteria | 4557 |
| 857 | Ga0395898_0055555 | 3300037466 | Bacteria | 3861 |
| 858 | Ga0395898_0063252 | 3300037466 | Bacteria | 3591 |
| 859 | Ga0395898_0276176 | 3300037466 | Bacteria | 1602 |
| 860 | Ga0395898_0516745 | 3300037466 | Bacteria | 1135 |
| 861 | Ga0395898_0865374 | 3300037466 | Bacteria | 843 |
| 862 | Ga0395905_0285293 | 3300037471 | Bacteria | 1538 |
| 863 | Ga0395905_0408526 | 3300037471 | Bacteria | 1253 |
| 864 | Ga0395901_0006287 | 3300038443 | Bacteria | 12032 |
| 865 | Ga0395901_0015165 | 3300038443 | Bacteria | 7837 |
| 866 | Ga0395901_0041546 | 3300038443 | Bacteria | 4766 |
| 867 | Ga0395901_0130611 | 3300038443 | Bacteria | 2639 |
| 868 | Ga0395901_0161314 | 3300038443 | Bacteria | 2355 |
| 869 | Ga0395901_0444758 | 3300038443 | Unclassified | 1326 |
| 870 | Ga0436365_1066023 | 3300039437 | Bacteria | 2519 |
| 871 | Ga0436365_1111130 | 3300039437 | Bacteria | 1896 |
| 872 | Ga0439436_0027239 | 3300041404 | Bacteria | 1672 |
| 873 | Ga0439439_0018325 | 3300041406 | Bacteria | 1729 |
| 874 | Ga0439439_0060288 | 3300041406 | Bacteria | 1007 |
| 875 | Ga0439465_0370875 | 3300041413 | Bacteria | 542 |
| 876 | Ga0451787_601744 | 3300041441 | Bacteria | 534 |
| 877 | Ga0451789_1085436 | 3300041443 | Bacteria | 599 |
| 878 | Ga0451791_0709903 | 3300041451 | Bacteria | 703 |
| 879 | Ga0451791_0976880 | 3300041451 | Bacteria | 1292 |
| 880 | Ga0451791_1417606 | 3300041451 | Unclassified | 515 |
| 881 | Ga0451797_0143917 | 3300041453 | Bacteria | 506 |
| 882 | Ga0451800_0573962 | 3300041459 | Bacteria | 759 |
| 883 | Ga0451802_0505948 | 3300041460 | Unclassified | 586 |
| 884 | Ga0451802_0744852 | 3300041460 | Bacteria | 988 |
| 885 | Ga0451807_1283653 | 3300041486 | Bacteria | 517 |
| 886 | Ga0451807_2598025 | 3300041486 | Bacteria | 673 |
| 887 | Ga0451833_0407819 | 3300041491 | Bacteria | 736 |
| 888 | Ga0451837_0560980 | 3300041494 | Bacteria | 1029 |
| 889 | Ga0451851_0639284 | 3300041507 | Bacteria | 789 |
| 890 | Ga0451843_0288465 | 3300041509 | Bacteria | 858 |
| 891 | Ga0451853_0925438 | 3300041512 | Bacteria | 942 |
| 892 | Ga0451853_1827383 | 3300041512 | Unclassified | 842 |
| 893 | Ga0439431_0109007 | 3300041997 | Bacteria | 766 |
| 894 | Ga0439433_0074625 | 3300041999 | Bacteria | 820 |
| 895 | Ga0439441_001674 | 3300042001 | Bacteria | 2971 |
| 896 | Ga0439445_0056666 | 3300042004 | Unclassified | 1066 |
| 897 | Ga0439449_0008946 | 3300042007 | Bacteria | 3797 |
| 898 | Ga0439449_0012910 | 3300042007 | Bacteria | 3141 |
| 899 | Ga0439454_013571 | 3300042011 | Bacteria | 1120 |
| 900 | Ga0439457_000874 | 3300042014 | Bacteria | 9102 |
| 901 | Ga0439462_0004114 | 3300042015 | Bacteria | 3533 |
| 902 | Ga0450922_022258 | 3300042124 | Bacteria | 659 |
| 903 | Ga0450897_022153 | 3300042128 | Unclassified | 686 |
| 904 | Ga0450894_025993 | 3300042131 | Bacteria | 803 |
| 905 | Ga0450896_044332 | 3300042133 | Bacteria | 698 |
| 906 | Ga0450898_020988 | 3300042134 | Bacteria | 1148 |
| 907 | Ga0450899_012799 | 3300042135 | Unclassified | 944 |
| 908 | Ga0439434_0261570 | 3300042435 | Bacteria | 593 |
| 909 | Ga0439435_0055381 | 3300042436 | Bacteria | 1144 |
| 910 | Ga0439444_0070272 | 3300042437 | Bacteria | 748 |
| 911 | Ga0439459_0142367 | 3300042438 | Bacteria | 621 |
| 912 | Ga0439464_0129699 | 3300042439 | Bacteria | 780 |
| 913 | Ga0439460_0010547 | 3300042461 | Bacteria | 2369 |
| 914 | Ga0451577_1644303 | 3300042876 | Bacteria | 566 |
| 915 | Ga0495592_0126013 | 3300046454 | Bacteria | 1797 |
| 916 | Ga0495638_0035545 | 3300046460 | Bacteria | 3176 |
| 917 | Ga0495584_0174665 | 3300046491 | Bacteria | 1092 |
| 918 | Ga0495608_0066795 | 3300046511 | Unclassified | 2354 |
| 919 | Ga0495618_0221260 | 3300046514 | Bacteria | 1194 |
| 920 | Ga0495630_0014167 | 3300046517 | Bacteria | 5804 |
| 921 | Ga0495632_0213052 | 3300046519 | Bacteria | 876 |
| 922 | Ga0495643_0007703 | 3300046522 | Bacteria | 6901 |
| 923 | Ga0495640_0081502 | 3300046533 | Bacteria | 2151 |
| 924 | Ga0495598_0037398 | 3300046537 | Bacteria | 1400 |
| 925 | Ga0495598_0251797 | 3300046537 | Bacteria | 654 |
| 926 | Ga0495621_0074477 | 3300046539 | Bacteria | 1256 |
| 927 | Ga0495667_0752181 | 3300046559 | Bacteria | 602 |
| 928 | Ga0495634_0099314 | 3300046642 | Bacteria | 1882 |
| 929 | Ga0495611_0129352 | 3300046648 | Bacteria | 1178 |
| 930 | Ga0495657_0108124 | 3300046675 | Bacteria | 1765 |
| 931 | Ga0495658_0128425 | 3300046683 | Bacteria | 1541 |
| 932 | Ga0495613_0110120 | 3300046689 | Unclassified | 1985 |
| 933 | Ga0495600_0736454 | 3300046809 | Bacteria | 591 |
| 934 | Ga0495581_0359628 | 3300047315 | Bacteria | 850 |
| 935 | Ga0495604_0227112 | 3300047317 | Unclassified | 1282 |
| 936 | Ga0495636_0690415 | 3300047318 | Bacteria | 503 |
| 937 | Ga0495672_0061725 | 3300047320 | Bacteria | 2159 |
| 938 | Ga0495672_0362970 | 3300047320 | Bacteria | 670 |
| 939 | Ga0495680_0507477 | 3300047322 | Unclassified | 818 |
| 940 | Ga0495680_0896578 | 3300047322 | Bacteria | 573 |
| 941 | Ga0495675_0204749 | 3300047444 | Bacteria | 1200 |
| 942 | Ga0495677_0461501 | 3300047445 | Bacteria | 503 |
| 943 | Ga0495684_0410038 | 3300047471 | Unclassified | 949 |
| 944 | Ga0496107_0710618 | 3300048910 | Bacteria | 739 |
| 945 | Ga0496110_0101779 | 3300048913 | Bacteria | 2576 |
| 946 | Ga0496112_0460695 | 3300048915 | Bacteria | 1209 |
| 947 | Ga0496112_0737494 | 3300048915 | Bacteria | 912 |
| 948 | Ga0495682_0133351 | 3300049460 | Unclassified | 888 |
| 949 | Ga0501032_0005001 | 3300049569 | Bacteria | 9914 |
| 950 | Ga0501032_0285675 | 3300049569 | Unclassified | 1068 |
| 951 | Ga0501033_0060506 | 3300049570 | Bacteria | 2794 |
| 952 | Ga0501033_0208755 | 3300049570 | Bacteria | 1393 |
| 953 | Ga0501034_0012357 | 3300049571 | Bacteria | 8821 |
| 954 | Ga0501034_0041785 | 3300049571 | Bacteria | 4639 |
| 955 | Ga0501034_0062096 | 3300049571 | Bacteria | 3751 |
| 956 | Ga0501036_0032651 | 3300049572 | Bacteria | 4400 |
| 957 | Ga0501037_0048748 | 3300049573 | Bacteria | 3102 |
| 958 | Ga0501037_0452002 | 3300049573 | Bacteria | 876 |
| 959 | Ga0501037_0701793 | 3300049573 | Bacteria | 673 |
| 960 | Ga0501038_0072836 | 3300049574 | Bacteria | 2910 |
| 961 | Ga0501038_0659550 | 3300049574 | Bacteria | 787 |
| 962 | Ga0501039_0072471 | 3300049575 | Bacteria | 2676 |
| 963 | Ga0501039_1276274 | 3300049575 | Bacteria | 567 |
| 964 | Ga0501043_0003493 | 3300049579 | Bacteria | 12916 |
| 965 | Ga0501043_0216530 | 3300049579 | Bacteria | 1483 |
| 966 | Ga0501047_0004866 | 3300049581 | Bacteria | 12612 |
| 967 | Ga0501047_0279843 | 3300049581 | Bacteria | 1513 |
| 968 | Ga0501048_0016937 | 3300049582 | Bacteria | 5372 |
| 969 | Ga0501069_0350827 | 3300049585 | Bacteria | 870 |
| 970 | Ga0501070_0020247 | 3300049586 | Bacteria | 5580 |
| 971 | Ga0501070_0425120 | 3300049586 | Bacteria | 1073 |
| 972 | Ga0501072_0312892 | 3300049588 | Bacteria | 1248 |
| 973 | Ga0501073_0753687 | 3300049589 | Bacteria | 671 |
| 974 | Ga0501074_0004850 | 3300049590 | Bacteria | 9645 |
| 975 | Ga0501216_149296 | 3300049660 | Unclassified | 554 |
| 976 | Ga0501243_039873 | 3300049675 | Bacteria | 823 |
| 977 | Ga0501221_149305 | 3300049704 | Bacteria | 618 |
| 978 | Ga0501225_0004750 | 3300049705 | Bacteria | 4027 |
| 979 | Ga0501225_0207819 | 3300049705 | Unclassified | 624 |
| 980 | Ga0501080_0082856 | 3300049742 | Bacteria | 2979 |
| 981 | Ga0501080_0130029 | 3300049742 | Bacteria | 2331 |
| 982 | Ga0501083_0178906 | 3300049744 | Bacteria | 1385 |
| 983 | Ga0501241_004041 | 3300049758 | Bacteria | 2760 |
| 984 | Ga0501035_0010218 | 3300049822 | Bacteria | 8711 |
| 985 | Ga0501035_0097171 | 3300049822 | Bacteria | 2587 |
| 986 | Ga0501035_0114632 | 3300049822 | Bacteria | 2360 |
| 987 | Ga0501044_0014761 | 3300049823 | Bacteria | 8421 |
| 988 | Ga0501044_0219155 | 3300049823 | Bacteria | 1854 |
| 989 | Ga0501045_0243704 | 3300049824 | Bacteria | 1338 |
| 990 | nmdc:mga05p37_118879_c1 | 3300050507 | Unclassified | 3247 |
| 991 | nmdc:mga05p37_25280_c1 | 3300050507 | Bacteria | 7221 |
| 992 | nmdc:mga09592_12569_c2 | 3300050508 | Bacteria | 4830 |
| 993 | nmdc:mga09592_363122_c1 | 3300050508 | Bacteria | 1253 |
| 994 | nmdc:mga0qj67_370556_c1 | 3300050509 | Unclassified | 1157 |
| 995 | nmdc:mga06r32_1364632_c1 | 3300050510 | Bacteria | 651 |
| 996 | nmdc:mga06r32_58047_c1 | 3300050510 | Bacteria | 3719 |
| 997 | nmdc:mga08y16_207810_c1 | 3300050511 | Bacteria | 2028 |
| 998 | nmdc:mga08y16_21376_c1 | 3300050511 | Bacteria | 6834 |
| 999 | nmdc:mga08y16_351456_c1 | 3300050511 | Bacteria | 1514 |
| 1000 | nmdc:mga08y16_86504_c1 | 3300050511 | Bacteria | 3266 |
| 1001 | nmdc:mga0n895_237077_c1 | 3300050512 | Bacteria | 1851 |
| 1002 | nmdc:mga0rr50_600577_c1 | 3300050513 | Bacteria | 938 |
| 1003 | Ga0500646_0034250 | 3300053090 | Bacteria | 1407 |
| 1004 | Ga0500583_0127636 | 3300053092 | Bacteria | 1260 |
| 1005 | Ga0500651_0225284 | 3300053093 | Bacteria | 1098 |
| 1006 | Ga0500556_0066129 | 3300053104 | Bacteria | 1342 |
| 1007 | Ga0500642_0109696 | 3300053130 | Bacteria | 1288 |
| 1008 | Ga0500658_0132059 | 3300053134 | Bacteria | 1115 |
| 1009 | Ga0500589_005991 | 3300053147 | Bacteria | 4808 |
| 1010 | Ga0500604_0112489 | 3300053151 | Bacteria | 905 |
| 1011 | Ga0500616_0134010 | 3300053153 | Bacteria | 1167 |
| 1012 | Ga0500622_0061690 | 3300053156 | Bacteria | 1911 |
| 1013 | Ga0500622_0201134 | 3300053156 | Bacteria | 906 |
| 1014 | Ga0500627_0174523 | 3300053158 | Unclassified | 968 |
| 1015 | Ga0500637_0045015 | 3300053178 | Bacteria | 2502 |
| 1016 | Ga0500611_000039 | 3300053727 | Bacteria | 68825 |
| 1017 | Ga0501084_0034594 | 3300054114 | Bacteria | 4224 |
| 1018 | Ga0501082_1425286 | 3300060353 | Unclassified | 605 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005367 | Ga0070667_100331294 | Ga0070667_1003312942 | 103 |
| 2 | 3300005841 | Ga0068863_100473288 | Ga0068863_1004732882 | 103 |
| 3 | 3300009553 | Ga0105249_10766227 | Ga0105249_107662271 | 103 |
| 4 | 3300025961 | Ga0207712_11588561 | Ga0207712_115885611 | 103 |
| 5 | 3300025986 | Ga0207658_10293330 | Ga0207658_102933302 | 103 |
| 6 | 3300005334 | Ga0068869_100058928 | Ga0068869_1000589284 | 106 |
| 7 | 3300005337 | Ga0070682_100089216 | Ga0070682_1000892162 | 106 |
| 8 | 3300005340 | Ga0070689_100103588 | Ga0070689_1001035885 | 106 |
| 9 | 3300005364 | Ga0070673_100433804 | Ga0070673_1004338042 | 106 |
| 10 | 3300005365 | Ga0070688_100017227 | Ga0070688_1000172273 | 106 |
| 11 | 3300005366 | Ga0070659_100241857 | Ga0070659_1002418572 | 106 |
| 12 | 3300005455 | Ga0070663_100283988 | Ga0070663_1002839882 | 106 |
| 13 | 3300005539 | Ga0068853_101069712 | Ga0068853_1010697121 | 106 |
| 14 | 3300005548 | Ga0070665_100958532 | Ga0070665_1009585322 | 106 |
| 15 | 3300005563 | Ga0068855_101231581 | Ga0068855_1012315812 | 106 |
| 16 | 3300005564 | Ga0070664_101354238 | Ga0070664_1013542382 | 106 |
| 17 | 3300005577 | Ga0068857_100355853 | Ga0068857_1003558531 | 106 |
| 18 | 3300005577 | Ga0068857_101203789 | Ga0068857_1012037892 | 106 |
| 19 | 3300005616 | Ga0068852_101185278 | Ga0068852_1011852782 | 106 |
| 20 | 3300005617 | Ga0068859_101431419 | Ga0068859_1014314192 | 106 |
| 21 | 3300005844 | Ga0068862_100196777 | Ga0068862_1001967773 | 106 |
| 22 | 3300006931 | Ga0097620_101431425 | Ga0097620_1014314252 | 106 |
| 23 | 3300013296 | Ga0157374_10007442 | Ga0157374_100074429 | 106 |
| 24 | 3300013306 | Ga0163162_10046225 | Ga0163162_100462253 | 106 |
| 25 | 3300013308 | Ga0157375_10023657 | Ga0157375_100236572 | 106 |
| 26 | 3300014325 | Ga0163163_10005376 | Ga0163163_100053764 | 106 |
| 27 | 3300014745 | Ga0157377_10238428 | Ga0157377_102384282 | 106 |
| 28 | 3300014968 | Ga0157379_10246758 | Ga0157379_102467583 | 106 |
| 29 | 3300014968 | Ga0157379_10748182 | Ga0157379_107481822 | 106 |
| 30 | 3300025904 | Ga0207647_10057441 | Ga0207647_100574413 | 106 |
| 31 | 3300025920 | Ga0207649_10428886 | Ga0207649_104288862 | 106 |
| 32 | 3300025932 | Ga0207690_10143848 | Ga0207690_101438482 | 106 |
| 33 | 3300025936 | Ga0207670_10042128 | Ga0207670_100421284 | 106 |
| 34 | 3300025942 | Ga0207689_10009313 | Ga0207689_100093134 | 106 |
| 35 | 3300025944 | Ga0207661_10005152 | Ga0207661_100051523 | 106 |
| 36 | 3300025945 | Ga0207679_10018927 | Ga0207679_100189273 | 106 |
| 37 | 3300025945 | Ga0207679_11226232 | Ga0207679_112262322 | 106 |
| 38 | 3300025949 | Ga0207667_10424044 | Ga0207667_104240442 | 106 |
| 39 | 3300025960 | Ga0207651_10405797 | Ga0207651_104057972 | 106 |
| 40 | 3300026023 | Ga0207677_11197777 | Ga0207677_111977772 | 106 |
| 41 | 3300026035 | Ga0207703_10872006 | Ga0207703_108720062 | 106 |
| 42 | 3300026041 | Ga0207639_10553409 | Ga0207639_105534091 | 106 |
| 43 | 3300026067 | Ga0207678_10025516 | Ga0207678_100255162 | 106 |
| 44 | 3300026095 | Ga0207676_10012166 | Ga0207676_100121668 | 106 |
| 45 | 3300026116 | Ga0207674_10019038 | Ga0207674_100190384 | 106 |
| 46 | 3300026116 | Ga0207674_11123978 | Ga0207674_111239782 | 106 |
| 47 | 3300026142 | Ga0207698_10867347 | Ga0207698_108673472 | 106 |
| 48 | 3300028380 | Ga0268265_10392047 | Ga0268265_103920471 | 106 |
| 49 | 3300048913 | Ga0496110_0101779 | Ga0496110_0101779_1039_1380 | 106 |
| 50 | 3300048915 | Ga0496112_0460695 | Ga0496112_0460695_395_736 | 106 |
| 51 | 3300005347 | Ga0070668_100224006 | Ga0070668_1002240061 | 109 |
| 52 | 3300049758 | Ga0501241_004041 | Ga0501241_004041_2289_2621 | 109 |
| 53 | iso_pu_bacteria | 2738541278 | 2738725878 | 109 |
| 54 | 3300005834 | Ga0068851_10567664 | Ga0068851_105676642 | 110 |
| 55 | 3300013297 | Ga0157378_12396900 | Ga0157378_123969002 | 110 |
| 56 | 3300032004 | Ga0307414_11228193 | Ga0307414_112281932 | 110 |
| 57 | 3300035112 | Ga0373932_0396271 | Ga0373932_0396271_99_431 | 110 |
| 58 | 3300035691 | Ga0373931_0462994 | Ga0373931_0462994_29_361 | 110 |
| 59 | 3300005327 | Ga0070658_10771285 | Ga0070658_107712851 | 111 |
| 60 | 3300005333 | Ga0070677_10352086 | Ga0070677_103520862 | 111 |
| 61 | 3300005340 | Ga0070689_100964328 | Ga0070689_1009643282 | 111 |
| 62 | 3300005341 | Ga0070691_10343897 | Ga0070691_103438972 | 111 |
| 63 | 3300005344 | Ga0070661_101628530 | Ga0070661_1016285301 | 111 |
| 64 | 3300005366 | Ga0070659_100197196 | Ga0070659_1001971962 | 111 |
| 65 | 3300005367 | Ga0070667_101377321 | Ga0070667_1013773212 | 111 |
| 66 | 3300005563 | Ga0068855_100094911 | Ga0068855_1000949113 | 111 |
| 67 | 3300005563 | Ga0068855_100140061 | Ga0068855_1001400614 | 111 |
| 68 | 3300005577 | Ga0068857_100001483 | Ga0068857_1000014839 | 111 |
| 69 | 3300005578 | Ga0068854_100114212 | Ga0068854_1001142123 | 111 |
| 70 | 3300005578 | Ga0068854_100340479 | Ga0068854_1003404793 | 111 |
| 71 | 3300005614 | Ga0068856_100044165 | Ga0068856_1000441654 | 111 |
| 72 | 3300005616 | Ga0068852_100002726 | Ga0068852_1000027269 | 111 |
| 73 | 3300005616 | Ga0068852_100382901 | Ga0068852_1003829012 | 111 |
| 74 | 3300005617 | Ga0068859_103052632 | Ga0068859_1030526321 | 111 |
| 75 | 3300005841 | Ga0068863_100311080 | Ga0068863_1003110803 | 111 |
| 76 | 3300005843 | Ga0068860_102824736 | Ga0068860_1028247361 | 111 |
| 77 | 3300006847 | Ga0075431_100038737 | Ga0075431_1000387374 | 111 |
| 78 | 3300006931 | Ga0097620_103051072 | Ga0097620_1030510722 | 111 |
| 79 | 3300009093 | Ga0105240_10008412 | Ga0105240_1000841211 | 111 |
| 80 | 3300009093 | Ga0105240_10013970 | Ga0105240_100139707 | 111 |
| 81 | 3300009093 | Ga0105240_10048294 | Ga0105240_100482943 | 111 |
| 82 | 3300009101 | Ga0105247_10257803 | Ga0105247_102578032 | 111 |
| 83 | 3300009147 | Ga0114129_10027834 | Ga0114129_100278347 | 111 |
| 84 | 3300009174 | Ga0105241_10000460 | Ga0105241_100004606 | 111 |
| 85 | 3300009174 | Ga0105241_10416031 | Ga0105241_104160311 | 111 |
| 86 | 3300009176 | Ga0105242_11117850 | Ga0105242_111178502 | 111 |
| 87 | 3300009545 | Ga0105237_10009688 | Ga0105237_100096888 | 111 |
| 88 | 3300009551 | Ga0105238_10000488 | Ga0105238_1000048814 | 111 |
| 89 | 3300009551 | Ga0105238_10019337 | Ga0105238_100193373 | 111 |
| 90 | 3300009551 | Ga0105238_10021278 | Ga0105238_100212784 | 111 |
| 91 | 3300009551 | Ga0105238_11060670 | Ga0105238_110606702 | 111 |
| 92 | 3300010375 | Ga0105239_10032094 | Ga0105239_100320943 | 111 |
| 93 | 3300011119 | Ga0105246_10176787 | Ga0105246_101767872 | 111 |
| 94 | 3300013100 | Ga0157373_10172867 | Ga0157373_101728672 | 111 |
| 95 | 3300013100 | Ga0157373_11071155 | Ga0157373_110711552 | 111 |
| 96 | 3300013104 | Ga0157370_10034855 | Ga0157370_100348553 | 111 |
| 97 | 3300013105 | Ga0157369_10025886 | Ga0157369_100258863 | 111 |
| 98 | 3300013306 | Ga0163162_12314021 | Ga0163162_123140211 | 111 |
| 99 | 3300013307 | Ga0157372_10001983 | Ga0157372_100019838 | 111 |
| 100 | 3300013307 | Ga0157372_10094848 | Ga0157372_100948483 | 111 |
| 101 | 3300013307 | Ga0157372_10214413 | Ga0157372_102144133 | 111 |
| 102 | 3300025904 | Ga0207647_10013169 | Ga0207647_100131692 | 111 |
| 103 | 3300025911 | Ga0207654_10069535 | Ga0207654_100695352 | 111 |
| 104 | 3300025911 | Ga0207654_10869588 | Ga0207654_108695881 | 111 |
| 105 | 3300025913 | Ga0207695_10001387 | Ga0207695_1000138725 | 111 |
| 106 | 3300025913 | Ga0207695_10038130 | Ga0207695_100381306 | 111 |
| 107 | 3300025913 | Ga0207695_10052655 | Ga0207695_100526553 | 111 |
| 108 | 3300025913 | Ga0207695_11463290 | Ga0207695_114632902 | 111 |
| 109 | 3300025914 | Ga0207671_10007829 | Ga0207671_100078293 | 111 |
| 110 | 3300025923 | Ga0207681_11423202 | Ga0207681_114232021 | 111 |
| 111 | 3300025924 | Ga0207694_10002191 | Ga0207694_100021916 | 111 |
| 112 | 3300025924 | Ga0207694_10028517 | Ga0207694_100285173 | 111 |
| 113 | 3300025924 | Ga0207694_11570389 | Ga0207694_115703891 | 111 |
| 114 | 3300025932 | Ga0207690_10604401 | Ga0207690_106044011 | 111 |
| 115 | 3300025949 | Ga0207667_10001760 | Ga0207667_1000176022 | 111 |
| 116 | 3300025972 | Ga0207668_10141362 | Ga0207668_101413622 | 111 |
| 117 | 3300025981 | Ga0207640_10843356 | Ga0207640_108433562 | 111 |
| 118 | 3300026041 | Ga0207639_10115198 | Ga0207639_101151983 | 111 |
| 119 | 3300026041 | Ga0207639_11027077 | Ga0207639_110270772 | 111 |
| 120 | 3300026088 | Ga0207641_10409238 | Ga0207641_104092381 | 111 |
| 121 | 3300026116 | Ga0207674_10006694 | Ga0207674_100066948 | 111 |
| 122 | 3300026142 | Ga0207698_10000340 | Ga0207698_100003406 | 111 |
| 123 | 3300026142 | Ga0207698_10902057 | Ga0207698_109020573 | 111 |
| 124 | 3300030521 | Ga0307511_10002747 | Ga0307511_100027478 | 111 |
| 125 | 3300031824 | Ga0307413_12012694 | Ga0307413_120126941 | 111 |
| 126 | 3300032002 | Ga0307416_101388975 | Ga0307416_1013889752 | 111 |
| 127 | 3300032004 | Ga0307414_11883152 | Ga0307414_118831521 | 111 |
| 128 | 3300049460 | Ga0495682_0133351 | Ga0495682_0133351_250_591 | 111 |
| 129 | 3300049660 | Ga0501216_149296 | Ga0501216_149296_58_393 | 111 |
| 130 | 3300049705 | Ga0501225_0207819 | Ga0501225_0207819_262_597 | 111 |
| 131 | 3300050507 | nmdc:mga05p37_25280_c1 | nmdc:mga05p37_25280_c1_6283_6618 | 111 |
| 132 | 3300050510 | nmdc:mga06r32_58047_c1 | nmdc:mga06r32_58047_c1_282_617 | 111 |
| 133 | 3300053178 | Ga0500637_0045015 | Ga0500637_0045015_1691_2041 | 111 |
| 134 | 3300000043 | ARcpr5yngRDRAFT_c011162 | ARcpr5yngRDRAFT_0111622 | 112 |
| 135 | 3300002067 | JGI24735J21928_10022974 | JGI24735J21928_100229742 | 112 |
| 136 | 3300005295 | Ga0065707_10898219 | Ga0065707_108982191 | 112 |
| 137 | 3300005327 | Ga0070658_10203888 | Ga0070658_102038882 | 112 |
| 138 | 3300005328 | Ga0070676_10005845 | Ga0070676_100058456 | 112 |
| 139 | 3300005328 | Ga0070676_10584658 | Ga0070676_105846581 | 112 |
| 140 | 3300005329 | Ga0070683_100080455 | Ga0070683_1000804552 | 112 |
| 141 | 3300005329 | Ga0070683_100113788 | Ga0070683_1001137883 | 112 |
| 142 | 3300005329 | Ga0070683_100160047 | Ga0070683_1001600473 | 112 |
| 143 | 3300005330 | Ga0070690_100004279 | Ga0070690_1000042796 | 112 |
| 144 | 3300005330 | Ga0070690_100142125 | Ga0070690_1001421252 | 112 |
| 145 | 3300005330 | Ga0070690_100622132 | Ga0070690_1006221321 | 112 |
| 146 | 3300005331 | Ga0070670_100549754 | Ga0070670_1005497541 | 112 |
| 147 | 3300005333 | Ga0070677_10295193 | Ga0070677_102951932 | 112 |
| 148 | 3300005334 | Ga0068869_100036673 | Ga0068869_1000366733 | 112 |
| 149 | 3300005335 | Ga0070666_10013142 | Ga0070666_100131424 | 112 |
| 150 | 3300005335 | Ga0070666_10073096 | Ga0070666_100730961 | 112 |
| 151 | 3300005336 | Ga0070680_100030579 | Ga0070680_1000305793 | 112 |
| 152 | 3300005336 | Ga0070680_100346120 | Ga0070680_1003461202 | 112 |
| 153 | 3300005336 | Ga0070680_101119374 | Ga0070680_1011193742 | 112 |
| 154 | 3300005337 | Ga0070682_100974016 | Ga0070682_1009740161 | 112 |
| 155 | 3300005338 | Ga0068868_100000543 | Ga0068868_10000054327 | 112 |
| 156 | 3300005339 | Ga0070660_100000647 | Ga0070660_10000064711 | 112 |
| 157 | 3300005339 | Ga0070660_100110890 | Ga0070660_1001108903 | 112 |
| 158 | 3300005339 | Ga0070660_100307379 | Ga0070660_1003073792 | 112 |
| 159 | 3300005339 | Ga0070660_100410270 | Ga0070660_1004102702 | 112 |
| 160 | 3300005339 | Ga0070660_101087677 | Ga0070660_1010876772 | 112 |
| 161 | 3300005340 | Ga0070689_100035973 | Ga0070689_1000359731 | 112 |
| 162 | 3300005340 | Ga0070689_100399922 | Ga0070689_1003999222 | 112 |
| 163 | 3300005344 | Ga0070661_100184872 | Ga0070661_1001848722 | 112 |
| 164 | 3300005344 | Ga0070661_100633736 | Ga0070661_1006337362 | 112 |
| 165 | 3300005345 | Ga0070692_10026463 | Ga0070692_100264634 | 112 |
| 166 | 3300005345 | Ga0070692_10307479 | Ga0070692_103074791 | 112 |
| 167 | 3300005345 | Ga0070692_11108538 | Ga0070692_111085381 | 112 |
| 168 | 3300005347 | Ga0070668_100101573 | Ga0070668_1001015733 | 112 |
| 169 | 3300005347 | Ga0070668_100257219 | Ga0070668_1002572192 | 112 |
| 170 | 3300005354 | Ga0070675_100177621 | Ga0070675_1001776211 | 112 |
| 171 | 3300005354 | Ga0070675_100228031 | Ga0070675_1002280312 | 112 |
| 172 | 3300005355 | Ga0070671_100074050 | Ga0070671_1000740502 | 112 |
| 173 | 3300005355 | Ga0070671_100494667 | Ga0070671_1004946671 | 112 |
| 174 | 3300005356 | Ga0070674_100259112 | Ga0070674_1002591121 | 112 |
| 175 | 3300005364 | Ga0070673_100138920 | Ga0070673_1001389202 | 112 |
| 176 | 3300005364 | Ga0070673_100193532 | Ga0070673_1001935322 | 112 |
| 177 | 3300005365 | Ga0070688_100320696 | Ga0070688_1003206961 | 112 |
| 178 | 3300005365 | Ga0070688_101040424 | Ga0070688_1010404242 | 112 |
| 179 | 3300005366 | Ga0070659_100042462 | Ga0070659_1000424622 | 112 |
| 180 | 3300005366 | Ga0070659_100065305 | Ga0070659_1000653053 | 112 |
| 181 | 3300005366 | Ga0070659_100134986 | Ga0070659_1001349863 | 112 |
| 182 | 3300005366 | Ga0070659_100155893 | Ga0070659_1001558932 | 112 |
| 183 | 3300005367 | Ga0070667_100005088 | Ga0070667_1000050884 | 112 |
| 184 | 3300005367 | Ga0070667_100089394 | Ga0070667_1000893942 | 112 |
| 185 | 3300005367 | Ga0070667_100323457 | Ga0070667_1003234572 | 112 |
| 186 | 3300005367 | Ga0070667_100372078 | Ga0070667_1003720782 | 112 |
| 187 | 3300005440 | Ga0070705_101309602 | Ga0070705_1013096022 | 112 |
| 188 | 3300005455 | Ga0070663_100380496 | Ga0070663_1003804962 | 112 |
| 189 | 3300005456 | Ga0070678_100007620 | Ga0070678_1000076206 | 112 |
| 190 | 3300005456 | Ga0070678_101824856 | Ga0070678_1018248561 | 112 |
| 191 | 3300005457 | Ga0070662_100016061 | Ga0070662_1000160615 | 112 |
| 192 | 3300005457 | Ga0070662_100030265 | Ga0070662_1000302652 | 112 |
| 193 | 3300005458 | Ga0070681_10103549 | Ga0070681_101035493 | 112 |
| 194 | 3300005458 | Ga0070681_10262077 | Ga0070681_102620771 | 112 |
| 195 | 3300005458 | Ga0070681_10265667 | Ga0070681_102656673 | 112 |
| 196 | 3300005459 | Ga0068867_100007969 | Ga0068867_1000079697 | 112 |
| 197 | 3300005459 | Ga0068867_100018800 | Ga0068867_1000188003 | 112 |
| 198 | 3300005459 | Ga0068867_100070063 | Ga0068867_1000700631 | 112 |
| 199 | 3300005459 | Ga0068867_100196427 | Ga0068867_1001964272 | 112 |
| 200 | 3300005466 | Ga0070685_10013277 | Ga0070685_100132776 | 112 |
| 201 | 3300005466 | Ga0070685_10044166 | Ga0070685_100441663 | 112 |
| 202 | 3300005530 | Ga0070679_100001516 | Ga0070679_1000015168 | 112 |
| 203 | 3300005530 | Ga0070679_100125043 | Ga0070679_1001250433 | 112 |
| 204 | 3300005530 | Ga0070679_100244490 | Ga0070679_1002444902 | 112 |
| 205 | 3300005530 | Ga0070679_101145985 | Ga0070679_1011459852 | 112 |
| 206 | 3300005530 | Ga0070679_101301507 | Ga0070679_1013015071 | 112 |
| 207 | 3300005535 | Ga0070684_100119148 | Ga0070684_1001191483 | 112 |
| 208 | 3300005535 | Ga0070684_101110014 | Ga0070684_1011100141 | 112 |
| 209 | 3300005539 | Ga0068853_100228322 | Ga0068853_1002283222 | 112 |
| 210 | 3300005539 | Ga0068853_100377403 | Ga0068853_1003774033 | 112 |
| 211 | 3300005539 | Ga0068853_100409159 | Ga0068853_1004091592 | 112 |
| 212 | 3300005543 | Ga0070672_100255414 | Ga0070672_1002554143 | 112 |
| 213 | 3300005544 | Ga0070686_100004001 | Ga0070686_1000040014 | 112 |
| 214 | 3300005563 | Ga0068855_100000145 | Ga0068855_10000014570 | 112 |
| 215 | 3300005563 | Ga0068855_100003314 | Ga0068855_1000033147 | 112 |
| 216 | 3300005563 | Ga0068855_100125794 | Ga0068855_1001257943 | 112 |
| 217 | 3300005563 | Ga0068855_100146818 | Ga0068855_1001468183 | 112 |
| 218 | 3300005563 | Ga0068855_100352365 | Ga0068855_1003523652 | 112 |
| 219 | 3300005564 | Ga0070664_100278400 | Ga0070664_1002784003 | 112 |
| 220 | 3300005564 | Ga0070664_100607112 | Ga0070664_1006071122 | 112 |
| 221 | 3300005577 | Ga0068857_100220722 | Ga0068857_1002207222 | 112 |
| 222 | 3300005577 | Ga0068857_100295744 | Ga0068857_1002957441 | 112 |
| 223 | 3300005577 | Ga0068857_100365443 | Ga0068857_1003654432 | 112 |
| 224 | 3300005577 | Ga0068857_102247341 | Ga0068857_1022473411 | 112 |
| 225 | 3300005578 | Ga0068854_100031969 | Ga0068854_1000319694 | 112 |
| 226 | 3300005578 | Ga0068854_100074627 | Ga0068854_1000746275 | 112 |
| 227 | 3300005578 | Ga0068854_101780553 | Ga0068854_1017805531 | 112 |
| 228 | 3300005614 | Ga0068856_100023593 | Ga0068856_1000235933 | 112 |
| 229 | 3300005614 | Ga0068856_100205533 | Ga0068856_1002055333 | 112 |
| 230 | 3300005616 | Ga0068852_100026651 | Ga0068852_1000266512 | 112 |
| 231 | 3300005616 | Ga0068852_100235284 | Ga0068852_1002352843 | 112 |
| 232 | 3300005616 | Ga0068852_100653796 | Ga0068852_1006537962 | 112 |
| 233 | 3300005616 | Ga0068852_100677826 | Ga0068852_1006778262 | 112 |
| 234 | 3300005617 | Ga0068859_100166408 | Ga0068859_1001664083 | 112 |
| 235 | 3300005618 | Ga0068864_100124308 | Ga0068864_1001243083 | 112 |
| 236 | 3300005618 | Ga0068864_100338587 | Ga0068864_1003385872 | 112 |
| 237 | 3300005718 | Ga0068866_10113877 | Ga0068866_101138772 | 112 |
| 238 | 3300005719 | Ga0068861_101249133 | Ga0068861_1012491332 | 112 |
| 239 | 3300005842 | Ga0068858_100261028 | Ga0068858_1002610282 | 112 |
| 240 | 3300005842 | Ga0068858_102005184 | Ga0068858_1020051842 | 112 |
| 241 | 3300005843 | Ga0068860_100364671 | Ga0068860_1003646712 | 112 |
| 242 | 3300005843 | Ga0068860_100655051 | Ga0068860_1006550512 | 112 |
| 243 | 3300005843 | Ga0068860_101881403 | Ga0068860_1018814032 | 112 |
| 244 | 3300005844 | Ga0068862_100310651 | Ga0068862_1003106512 | 112 |
| 245 | 3300006163 | Ga0070715_10046476 | Ga0070715_100464762 | 112 |
| 246 | 3300006237 | Ga0097621_100264271 | Ga0097621_1002642712 | 112 |
| 247 | 3300006237 | Ga0097621_101616740 | Ga0097621_1016167402 | 112 |
| 248 | 3300006237 | Ga0097621_102004036 | Ga0097621_1020040361 | 112 |
| 249 | 3300006358 | Ga0068871_100105996 | Ga0068871_1001059962 | 112 |
| 250 | 3300006358 | Ga0068871_100285359 | Ga0068871_1002853592 | 112 |
| 251 | 3300006358 | Ga0068871_100909023 | Ga0068871_1009090232 | 112 |
| 252 | 3300006358 | Ga0068871_100952134 | Ga0068871_1009521342 | 112 |
| 253 | 3300006844 | Ga0075428_101884212 | Ga0075428_1018842121 | 112 |
| 254 | 3300006871 | Ga0075434_100250681 | Ga0075434_1002506812 | 112 |
| 255 | 3300006881 | Ga0068865_100267382 | Ga0068865_1002673822 | 112 |
| 256 | 3300006931 | Ga0097620_100166414 | Ga0097620_1001664143 | 112 |
| 257 | 3300009093 | Ga0105240_10158930 | Ga0105240_101589302 | 112 |
| 258 | 3300009101 | Ga0105247_10497523 | Ga0105247_104975232 | 112 |
| 259 | 3300009148 | Ga0105243_10507510 | Ga0105243_105075102 | 112 |
| 260 | 3300009174 | Ga0105241_10456955 | Ga0105241_104569551 | 112 |
| 261 | 3300009174 | Ga0105241_10471635 | Ga0105241_104716352 | 112 |
| 262 | 3300009176 | Ga0105242_10038912 | Ga0105242_100389122 | 112 |
| 263 | 3300009176 | Ga0105242_10377044 | Ga0105242_103770442 | 112 |
| 264 | 3300009177 | Ga0105248_10337014 | Ga0105248_103370143 | 112 |
| 265 | 3300009553 | Ga0105249_10031881 | Ga0105249_100318815 | 112 |
| 266 | 3300009553 | Ga0105249_10438787 | Ga0105249_104387872 | 112 |
| 267 | 3300009553 | Ga0105249_11166446 | Ga0105249_111664462 | 112 |
| 268 | 3300010375 | Ga0105239_10084716 | Ga0105239_100847163 | 112 |
| 269 | 3300013100 | Ga0157373_10027634 | Ga0157373_100276343 | 112 |
| 270 | 3300013100 | Ga0157373_10138537 | Ga0157373_101385372 | 112 |
| 271 | 3300013100 | Ga0157373_10142570 | Ga0157373_101425702 | 112 |
| 272 | 3300013100 | Ga0157373_10287471 | Ga0157373_102874712 | 112 |
| 273 | 3300013100 | Ga0157373_10904612 | Ga0157373_109046121 | 112 |
| 274 | 3300013102 | Ga0157371_10000868 | Ga0157371_1000086816 | 112 |
| 275 | 3300013102 | Ga0157371_10005115 | Ga0157371_1000511512 | 112 |
| 276 | 3300013102 | Ga0157371_10039547 | Ga0157371_100395472 | 112 |
| 277 | 3300013102 | Ga0157371_10162582 | Ga0157371_101625822 | 112 |
| 278 | 3300013102 | Ga0157371_10183168 | Ga0157371_101831682 | 112 |
| 279 | 3300013102 | Ga0157371_10433342 | Ga0157371_104333422 | 112 |
| 280 | 3300013102 | Ga0157371_10457951 | Ga0157371_104579512 | 112 |
| 281 | 3300013102 | Ga0157371_10651042 | Ga0157371_106510422 | 112 |
| 282 | 3300013102 | Ga0157371_10833826 | Ga0157371_108338262 | 112 |
| 283 | 3300013102 | Ga0157371_10907198 | Ga0157371_109071982 | 112 |
| 284 | 3300013104 | Ga0157370_10000313 | Ga0157370_1000031350 | 112 |
| 285 | 3300013104 | Ga0157370_10000628 | Ga0157370_1000062830 | 112 |
| 286 | 3300013104 | Ga0157370_10045234 | Ga0157370_100452344 | 112 |
| 287 | 3300013104 | Ga0157370_10191488 | Ga0157370_101914881 | 112 |
| 288 | 3300013104 | Ga0157370_10453106 | Ga0157370_104531061 | 112 |
| 289 | 3300013104 | Ga0157370_10620036 | Ga0157370_106200362 | 112 |
| 290 | 3300013104 | Ga0157370_10700953 | Ga0157370_107009532 | 112 |
| 291 | 3300013105 | Ga0157369_10008510 | Ga0157369_1000851011 | 112 |
| 292 | 3300013105 | Ga0157369_10014518 | Ga0157369_1001451810 | 112 |
| 293 | 3300013105 | Ga0157369_10259455 | Ga0157369_102594552 | 112 |
| 294 | 3300013296 | Ga0157374_10007342 | Ga0157374_100073424 | 112 |
| 295 | 3300013296 | Ga0157374_10050953 | Ga0157374_100509534 | 112 |
| 296 | 3300013296 | Ga0157374_10513022 | Ga0157374_105130222 | 112 |
| 297 | 3300013296 | Ga0157374_10862023 | Ga0157374_108620231 | 112 |
| 298 | 3300013297 | Ga0157378_10177225 | Ga0157378_101772252 | 112 |
| 299 | 3300013297 | Ga0157378_10403637 | Ga0157378_104036372 | 112 |
| 300 | 3300013297 | Ga0157378_10483881 | Ga0157378_104838812 | 112 |
| 301 | 3300013306 | Ga0163162_10002193 | Ga0163162_1000219316 | 112 |
| 302 | 3300013306 | Ga0163162_10019306 | Ga0163162_100193064 | 112 |
| 303 | 3300013306 | Ga0163162_10039481 | Ga0163162_100394817 | 112 |
| 304 | 3300013306 | Ga0163162_10282674 | Ga0163162_102826742 | 112 |
| 305 | 3300013306 | Ga0163162_10425596 | Ga0163162_104255961 | 112 |
| 306 | 3300013306 | Ga0163162_12223275 | Ga0163162_122232752 | 112 |
| 307 | 3300013307 | Ga0157372_10010278 | Ga0157372_100102787 | 112 |
| 308 | 3300013307 | Ga0157372_10017315 | Ga0157372_100173154 | 112 |
| 309 | 3300013307 | Ga0157372_10101634 | Ga0157372_101016343 | 112 |
| 310 | 3300013307 | Ga0157372_10126077 | Ga0157372_101260774 | 112 |
| 311 | 3300013307 | Ga0157372_10470989 | Ga0157372_104709892 | 112 |
| 312 | 3300013307 | Ga0157372_10479674 | Ga0157372_104796742 | 112 |
| 313 | 3300013307 | Ga0157372_10505769 | Ga0157372_105057692 | 112 |
| 314 | 3300013307 | Ga0157372_10666193 | Ga0157372_106661932 | 112 |
| 315 | 3300013308 | Ga0157375_10007261 | Ga0157375_100072618 | 112 |
| 316 | 3300013308 | Ga0157375_10087559 | Ga0157375_100875593 | 112 |
| 317 | 3300013308 | Ga0157375_10970445 | Ga0157375_109704451 | 112 |
| 318 | 3300013308 | Ga0157375_12224419 | Ga0157375_122244191 | 112 |
| 319 | 3300013308 | Ga0157375_12829655 | Ga0157375_128296551 | 112 |
| 320 | 3300013308 | Ga0157375_13671857 | Ga0157375_136718571 | 112 |
| 321 | 3300014325 | Ga0163163_10139040 | Ga0163163_101390402 | 112 |
| 322 | 3300014325 | Ga0163163_10185645 | Ga0163163_101856452 | 112 |
| 323 | 3300014325 | Ga0163163_12887016 | Ga0163163_128870161 | 112 |
| 324 | 3300014326 | Ga0157380_10414794 | Ga0157380_104147941 | 112 |
| 325 | 3300014326 | Ga0157380_10594697 | Ga0157380_105946972 | 112 |
| 326 | 3300014326 | Ga0157380_12412174 | Ga0157380_124121742 | 112 |
| 327 | 3300014745 | Ga0157377_10008049 | Ga0157377_100080493 | 112 |
| 328 | 3300014745 | Ga0157377_10264540 | Ga0157377_102645402 | 112 |
| 329 | 3300014745 | Ga0157377_10461175 | Ga0157377_104611752 | 112 |
| 330 | 3300014968 | Ga0157379_10085475 | Ga0157379_100854752 | 112 |
| 331 | 3300014968 | Ga0157379_10605657 | Ga0157379_106056572 | 112 |
| 332 | 3300014969 | Ga0157376_10006599 | Ga0157376_100065996 | 112 |
| 333 | 3300014969 | Ga0157376_10661862 | Ga0157376_106618621 | 112 |
| 334 | 3300017792 | Ga0163161_10006695 | Ga0163161_100066956 | 112 |
| 335 | 3300017792 | Ga0163161_10160993 | Ga0163161_101609933 | 112 |
| 336 | 3300017792 | Ga0163161_10241650 | Ga0163161_102416502 | 112 |
| 337 | 3300025899 | Ga0207642_10368139 | Ga0207642_103681391 | 112 |
| 338 | 3300025903 | Ga0207680_10041487 | Ga0207680_100414872 | 112 |
| 339 | 3300025903 | Ga0207680_10719785 | Ga0207680_107197852 | 112 |
| 340 | 3300025904 | Ga0207647_10062815 | Ga0207647_100628152 | 112 |
| 341 | 3300025905 | Ga0207685_10088628 | Ga0207685_100886282 | 112 |
| 342 | 3300025907 | Ga0207645_10024141 | Ga0207645_100241414 | 112 |
| 343 | 3300025909 | Ga0207705_10002807 | Ga0207705_1000280714 | 112 |
| 344 | 3300025909 | Ga0207705_10026743 | Ga0207705_100267435 | 112 |
| 345 | 3300025909 | Ga0207705_10071547 | Ga0207705_100715472 | 112 |
| 346 | 3300025909 | Ga0207705_10084511 | Ga0207705_100845112 | 112 |
| 347 | 3300025909 | Ga0207705_11166062 | Ga0207705_111660622 | 112 |
| 348 | 3300025912 | Ga0207707_10059337 | Ga0207707_100593373 | 112 |
| 349 | 3300025912 | Ga0207707_10194289 | Ga0207707_101942893 | 112 |
| 350 | 3300025912 | Ga0207707_10370432 | Ga0207707_103704322 | 112 |
| 351 | 3300025912 | Ga0207707_10795303 | Ga0207707_107953032 | 112 |
| 352 | 3300025917 | Ga0207660_10011907 | Ga0207660_100119073 | 112 |
| 353 | 3300025917 | Ga0207660_10119703 | Ga0207660_101197032 | 112 |
| 354 | 3300025917 | Ga0207660_10309496 | Ga0207660_103094962 | 112 |
| 355 | 3300025917 | Ga0207660_10491296 | Ga0207660_104912962 | 112 |
| 356 | 3300025919 | Ga0207657_10005023 | Ga0207657_100050236 | 112 |
| 357 | 3300025919 | Ga0207657_10029703 | Ga0207657_100297035 | 112 |
| 358 | 3300025919 | Ga0207657_10132123 | Ga0207657_101321233 | 112 |
| 359 | 3300025919 | Ga0207657_10186480 | Ga0207657_101864803 | 112 |
| 360 | 3300025919 | Ga0207657_10312403 | Ga0207657_103124032 | 112 |
| 361 | 3300025920 | Ga0207649_10264292 | Ga0207649_102642922 | 112 |
| 362 | 3300025920 | Ga0207649_10337821 | Ga0207649_103378211 | 112 |
| 363 | 3300025921 | Ga0207652_10000187 | Ga0207652_1000018740 | 112 |
| 364 | 3300025921 | Ga0207652_10000198 | Ga0207652_1000019822 | 112 |
| 365 | 3300025921 | Ga0207652_10029289 | Ga0207652_100292895 | 112 |
| 366 | 3300025921 | Ga0207652_10115311 | Ga0207652_101153113 | 112 |
| 367 | 3300025921 | Ga0207652_11844939 | Ga0207652_118449391 | 112 |
| 368 | 3300025923 | Ga0207681_10767913 | Ga0207681_107679132 | 112 |
| 369 | 3300025926 | Ga0207659_10022937 | Ga0207659_100229374 | 112 |
| 370 | 3300025931 | Ga0207644_10093875 | Ga0207644_100938752 | 112 |
| 371 | 3300025931 | Ga0207644_10227264 | Ga0207644_102272641 | 112 |
| 372 | 3300025932 | Ga0207690_10003750 | Ga0207690_100037504 | 112 |
| 373 | 3300025932 | Ga0207690_10048458 | Ga0207690_100484583 | 112 |
| 374 | 3300025932 | Ga0207690_10089507 | Ga0207690_100895073 | 112 |
| 375 | 3300025933 | Ga0207706_10005261 | Ga0207706_100052615 | 112 |
| 376 | 3300025933 | Ga0207706_10020556 | Ga0207706_100205563 | 112 |
| 377 | 3300025933 | Ga0207706_10375299 | Ga0207706_103752992 | 112 |
| 378 | 3300025934 | Ga0207686_10018765 | Ga0207686_100187653 | 112 |
| 379 | 3300025934 | Ga0207686_10357787 | Ga0207686_103577872 | 112 |
| 380 | 3300025936 | Ga0207670_10004279 | Ga0207670_1000427910 | 112 |
| 381 | 3300025936 | Ga0207670_10426793 | Ga0207670_104267932 | 112 |
| 382 | 3300025941 | Ga0207711_10561142 | Ga0207711_105611422 | 112 |
| 383 | 3300025942 | Ga0207689_10002851 | Ga0207689_1000285112 | 112 |
| 384 | 3300025944 | Ga0207661_10144280 | Ga0207661_101442802 | 112 |
| 385 | 3300025944 | Ga0207661_10190896 | Ga0207661_101908962 | 112 |
| 386 | 3300025944 | Ga0207661_10286707 | Ga0207661_102867071 | 112 |
| 387 | 3300025944 | Ga0207661_10707131 | Ga0207661_107071313 | 112 |
| 388 | 3300025945 | Ga0207679_10138763 | Ga0207679_101387633 | 112 |
| 389 | 3300025945 | Ga0207679_10240570 | Ga0207679_102405701 | 112 |
| 390 | 3300025949 | Ga0207667_10000492 | Ga0207667_100004929 | 112 |
| 391 | 3300025949 | Ga0207667_10027086 | Ga0207667_100270863 | 112 |
| 392 | 3300025949 | Ga0207667_10098972 | Ga0207667_100989724 | 112 |
| 393 | 3300025949 | Ga0207667_10597744 | Ga0207667_105977442 | 112 |
| 394 | 3300025960 | Ga0207651_10182526 | Ga0207651_101825262 | 112 |
| 395 | 3300025960 | Ga0207651_10399407 | Ga0207651_103994072 | 112 |
| 396 | 3300025972 | Ga0207668_10234022 | Ga0207668_102340222 | 112 |
| 397 | 3300025981 | Ga0207640_10445036 | Ga0207640_104450362 | 112 |
| 398 | 3300025981 | Ga0207640_12067380 | Ga0207640_120673802 | 112 |
| 399 | 3300025986 | Ga0207658_10797309 | Ga0207658_107973092 | 112 |
| 400 | 3300025986 | Ga0207658_11875546 | Ga0207658_118755461 | 112 |
| 401 | 3300026023 | Ga0207677_10043771 | Ga0207677_100437712 | 112 |
| 402 | 3300026023 | Ga0207677_10142611 | Ga0207677_101426112 | 112 |
| 403 | 3300026035 | Ga0207703_10615323 | Ga0207703_106153231 | 112 |
| 404 | 3300026041 | Ga0207639_10073993 | Ga0207639_100739933 | 112 |
| 405 | 3300026041 | Ga0207639_10330791 | Ga0207639_103307913 | 112 |
| 406 | 3300026041 | Ga0207639_10900829 | Ga0207639_109008291 | 112 |
| 407 | 3300026067 | Ga0207678_10018070 | Ga0207678_100180707 | 112 |
| 408 | 3300026078 | Ga0207702_10007374 | Ga0207702_100073742 | 112 |
| 409 | 3300026088 | Ga0207641_10123766 | Ga0207641_101237663 | 112 |
| 410 | 3300026088 | Ga0207641_10144518 | Ga0207641_101445182 | 112 |
| 411 | 3300026089 | Ga0207648_10043835 | Ga0207648_100438354 | 112 |
| 412 | 3300026089 | Ga0207648_10063299 | Ga0207648_100632992 | 112 |
| 413 | 3300026089 | Ga0207648_11048313 | Ga0207648_110483131 | 112 |
| 414 | 3300026095 | Ga0207676_10054925 | Ga0207676_100549254 | 112 |
| 415 | 3300026095 | Ga0207676_10086183 | Ga0207676_100861834 | 112 |
| 416 | 3300026116 | Ga0207674_10228855 | Ga0207674_102288553 | 112 |
| 417 | 3300026116 | Ga0207674_10373297 | Ga0207674_103732972 | 112 |
| 418 | 3300026116 | Ga0207674_10374571 | Ga0207674_103745712 | 112 |
| 419 | 3300026118 | Ga0207675_100160960 | Ga0207675_1001609602 | 112 |
| 420 | 3300026118 | Ga0207675_101440331 | Ga0207675_1014403312 | 112 |
| 421 | 3300026121 | Ga0207683_10012383 | Ga0207683_100123836 | 112 |
| 422 | 3300026121 | Ga0207683_11740019 | Ga0207683_117400192 | 112 |
| 423 | 3300026142 | Ga0207698_10026635 | Ga0207698_100266353 | 112 |
| 424 | 3300026142 | Ga0207698_10065708 | Ga0207698_100657082 | 112 |
| 425 | 3300026142 | Ga0207698_10159407 | Ga0207698_101594072 | 112 |
| 426 | 3300026142 | Ga0207698_10281058 | Ga0207698_102810581 | 112 |
| 427 | 3300028380 | Ga0268265_10473322 | Ga0268265_104733222 | 112 |
| 428 | 3300028381 | Ga0268264_10500232 | Ga0268264_105002322 | 112 |
| 429 | 3300028381 | Ga0268264_10674043 | Ga0268264_106740432 | 112 |
| 430 | 3300032004 | Ga0307414_10247074 | Ga0307414_102470742 | 112 |
| 431 | 3300035170 | Ga0373943_0813620 | Ga0373943_0813620_48_386 | 112 |
| 432 | 3300035692 | Ga0373935_0466453 | Ga0373935_0466453_183_521 | 112 |
| 433 | 3300035725 | Ga0373947_0037890 | Ga0373947_0037890_1100_1438 | 112 |
| 434 | 3300037312 | Ga0395899_0003604 | Ga0395899_0003604_5169_5510 | 112 |
| 435 | 3300037312 | Ga0395899_0007612 | Ga0395899_0007612_3689_4030 | 112 |
| 436 | 3300037312 | Ga0395899_0035542 | Ga0395899_0035542_1347_1688 | 112 |
| 437 | 3300037312 | Ga0395899_0039093 | Ga0395899_0039093_2775_3116 | 112 |
| 438 | 3300037312 | Ga0395899_0287047 | Ga0395899_0287047_427_768 | 112 |
| 439 | 3300037312 | Ga0395899_0824244 | Ga0395899_0824244_215_556 | 112 |
| 440 | 3300037312 | Ga0395899_0835106 | Ga0395899_0835106_122_463 | 112 |
| 441 | 3300037418 | Ga0395900_0026756 | Ga0395900_0026756_1635_1976 | 112 |
| 442 | 3300037418 | Ga0395900_0068173 | Ga0395900_0068173_421_762 | 112 |
| 443 | 3300037418 | Ga0395900_0076792 | Ga0395900_0076792_811_1152 | 112 |
| 444 | 3300037418 | Ga0395900_0197612 | Ga0395900_0197612_998_1339 | 112 |
| 445 | 3300037418 | Ga0395900_0514622 | Ga0395900_0514622_427_768 | 112 |
| 446 | 3300037466 | Ga0395898_0003818 | Ga0395898_0003818_12353_12694 | 112 |
| 447 | 3300037466 | Ga0395898_0041299 | Ga0395898_0041299_3207_3548 | 112 |
| 448 | 3300037466 | Ga0395898_0055555 | Ga0395898_0055555_2052_2393 | 112 |
| 449 | 3300037466 | Ga0395898_0063252 | Ga0395898_0063252_47_388 | 112 |
| 450 | 3300037466 | Ga0395898_0276176 | Ga0395898_0276176_451_792 | 112 |
| 451 | 3300037466 | Ga0395898_0516745 | Ga0395898_0516745_417_758 | 112 |
| 452 | 3300037466 | Ga0395898_0865374 | Ga0395898_0865374_245_586 | 112 |
| 453 | 3300037471 | Ga0395905_0285293 | Ga0395905_0285293_284_625 | 112 |
| 454 | 3300037471 | Ga0395905_0408526 | Ga0395905_0408526_559_900 | 112 |
| 455 | 3300038443 | Ga0395901_0006287 | Ga0395901_0006287_7304_7645 | 112 |
| 456 | 3300038443 | Ga0395901_0015165 | Ga0395901_0015165_7077_7418 | 112 |
| 457 | 3300038443 | Ga0395901_0041546 | Ga0395901_0041546_2260_2601 | 112 |
| 458 | 3300038443 | Ga0395901_0130611 | Ga0395901_0130611_1126_1467 | 112 |
| 459 | 3300038443 | Ga0395901_0161314 | Ga0395901_0161314_172_513 | 112 |
| 460 | 3300038443 | Ga0395901_0444758 | Ga0395901_0444758_330_671 | 112 |
| 461 | 3300041451 | Ga0451791_1417606 | Ga0451791_1417606_133_477 | 112 |
| 462 | 3300041494 | Ga0451837_0560980 | Ga0451837_0560980_111_455 | 112 |
| 463 | 3300046537 | Ga0495598_0251797 | Ga0495598_0251797_64_405 | 112 |
| 464 | 3300047315 | Ga0495581_0359628 | Ga0495581_0359628_394_732 | 112 |
| 465 | 3300048910 | Ga0496107_0710618 | Ga0496107_0710618_99_437 | 112 |
| 466 | 3300048915 | Ga0496112_0737494 | Ga0496112_0737494_67_405 | 112 |
| 467 | 3300049570 | Ga0501033_0060506 | Ga0501033_0060506_1989_2330 | 112 |
| 468 | 3300049570 | Ga0501033_0208755 | Ga0501033_0208755_745_1086 | 112 |
| 469 | 3300049571 | Ga0501034_0012357 | Ga0501034_0012357_3535_3876 | 112 |
| 470 | 3300049571 | Ga0501034_0041785 | Ga0501034_0041785_542_883 | 112 |
| 471 | 3300049573 | Ga0501037_0701793 | Ga0501037_0701793_260_601 | 112 |
| 472 | 3300049574 | Ga0501038_0659550 | Ga0501038_0659550_189_530 | 112 |
| 473 | 3300049575 | Ga0501039_1276274 | Ga0501039_1276274_198_539 | 112 |
| 474 | 3300049579 | Ga0501043_0216530 | Ga0501043_0216530_909_1250 | 112 |
| 475 | 3300049586 | Ga0501070_0020247 | Ga0501070_0020247_1931_2272 | 112 |
| 476 | 3300049822 | Ga0501035_0097171 | Ga0501035_0097171_1028_1369 | 112 |
| 477 | 3300049822 | Ga0501035_0114632 | Ga0501035_0114632_411_752 | 112 |
| 478 | 3300049823 | Ga0501044_0219155 | Ga0501044_0219155_1241_1582 | 112 |
| 479 | 3300050512 | nmdc:mga0n895_237077_c1 | nmdc:mga0n895_237077_c1_689_1027 | 112 |
| 480 | 3300050513 | nmdc:mga0rr50_600577_c1 | nmdc:mga0rr50_600577_c1_77_415 | 112 |
| 481 | 2162886007 | SwRhRL2b_contig_1580370 | SwRhRL2b_0382.00004760 | 113 |
| 482 | 2162886007 | SwRhRL2b_contig_942247 | SwRhRL2b_0387.00006580 | 113 |
| 483 | 3300002459 | JGI24751J29686_10000360 | JGI24751J29686_1000036011 | 113 |
| 484 | 3300003322 | rootL2_10182482 | rootL2_101824822 | 113 |
| 485 | 3300003322 | rootL2_10224766 | rootL2_102247663 | 113 |
| 486 | 3300003322 | rootL2_10300896 | rootL2_103008961 | 113 |
| 487 | 3300003323 | rootH1_10017808 | rootH1_100178086 | 113 |
| 488 | 3300005288 | Ga0065714_10101230 | Ga0065714_101012302 | 113 |
| 489 | 3300005289 | Ga0065704_10120433 | Ga0065704_101204333 | 113 |
| 490 | 3300005289 | Ga0065704_10494583 | Ga0065704_104945832 | 113 |
| 491 | 3300005290 | Ga0065712_10001246 | Ga0065712_100012467 | 113 |
| 492 | 3300005290 | Ga0065712_10010559 | Ga0065712_100105592 | 113 |
| 493 | 3300005290 | Ga0065712_10160118 | Ga0065712_101601182 | 113 |
| 494 | 3300005293 | Ga0065715_10004024 | Ga0065715_100040246 | 113 |
| 495 | 3300005295 | Ga0065707_10126934 | Ga0065707_101269342 | 113 |
| 496 | 3300005328 | Ga0070676_10063316 | Ga0070676_100633162 | 113 |
| 497 | 3300005328 | Ga0070676_10729671 | Ga0070676_107296712 | 113 |
| 498 | 3300005329 | Ga0070683_100004596 | Ga0070683_1000045965 | 113 |
| 499 | 3300005330 | Ga0070690_100424827 | Ga0070690_1004248272 | 113 |
| 500 | 3300005331 | Ga0070670_100005255 | Ga0070670_1000052559 | 113 |
| 501 | 3300005331 | Ga0070670_100015474 | Ga0070670_1000154747 | 113 |
| 502 | 3300005331 | Ga0070670_100169780 | Ga0070670_1001697802 | 113 |
| 503 | 3300005331 | Ga0070670_100285072 | Ga0070670_1002850722 | 113 |
| 504 | 3300005331 | Ga0070670_100385025 | Ga0070670_1003850252 | 113 |
| 505 | 3300005331 | Ga0070670_100951485 | Ga0070670_1009514851 | 113 |
| 506 | 3300005333 | Ga0070677_10078448 | Ga0070677_100784483 | 113 |
| 507 | 3300005333 | Ga0070677_10443069 | Ga0070677_104430692 | 113 |
| 508 | 3300005334 | Ga0068869_100086488 | Ga0068869_1000864882 | 113 |
| 509 | 3300005334 | Ga0068869_100106493 | Ga0068869_1001064931 | 113 |
| 510 | 3300005334 | Ga0068869_100163534 | Ga0068869_1001635344 | 113 |
| 511 | 3300005334 | Ga0068869_100231521 | Ga0068869_1002315212 | 113 |
| 512 | 3300005334 | Ga0068869_100324197 | Ga0068869_1003241972 | 113 |
| 513 | 3300005334 | Ga0068869_100553890 | Ga0068869_1005538901 | 113 |
| 514 | 3300005334 | Ga0068869_101464314 | Ga0068869_1014643142 | 113 |
| 515 | 3300005337 | Ga0070682_100978604 | Ga0070682_1009786041 | 113 |
| 516 | 3300005338 | Ga0068868_100266290 | Ga0068868_1002662902 | 113 |
| 517 | 3300005338 | Ga0068868_100344639 | Ga0068868_1003446391 | 113 |
| 518 | 3300005339 | Ga0070660_101362826 | Ga0070660_1013628262 | 113 |
| 519 | 3300005340 | Ga0070689_100004881 | Ga0070689_1000048813 | 113 |
| 520 | 3300005340 | Ga0070689_100102142 | Ga0070689_1001021424 | 113 |
| 521 | 3300005340 | Ga0070689_100129781 | Ga0070689_1001297812 | 113 |
| 522 | 3300005340 | Ga0070689_100429290 | Ga0070689_1004292901 | 113 |
| 523 | 3300005343 | Ga0070687_100097851 | Ga0070687_1000978511 | 113 |
| 524 | 3300005343 | Ga0070687_100225299 | Ga0070687_1002252992 | 113 |
| 525 | 3300005343 | Ga0070687_100785099 | Ga0070687_1007850991 | 113 |
| 526 | 3300005344 | Ga0070661_100000111 | Ga0070661_10000011130 | 113 |
| 527 | 3300005347 | Ga0070668_100072114 | Ga0070668_1000721143 | 113 |
| 528 | 3300005347 | Ga0070668_100162676 | Ga0070668_1001626762 | 113 |
| 529 | 3300005347 | Ga0070668_100167301 | Ga0070668_1001673012 | 113 |
| 530 | 3300005347 | Ga0070668_100876369 | Ga0070668_1008763692 | 113 |
| 531 | 3300005347 | Ga0070668_100935392 | Ga0070668_1009353923 | 113 |
| 532 | 3300005353 | Ga0070669_100002767 | Ga0070669_1000027674 | 113 |
| 533 | 3300005353 | Ga0070669_100145398 | Ga0070669_1001453983 | 113 |
| 534 | 3300005353 | Ga0070669_100395934 | Ga0070669_1003959342 | 113 |
| 535 | 3300005353 | Ga0070669_100423097 | Ga0070669_1004230973 | 113 |
| 536 | 3300005353 | Ga0070669_101074626 | Ga0070669_1010746261 | 113 |
| 537 | 3300005353 | Ga0070669_101488746 | Ga0070669_1014887461 | 113 |
| 538 | 3300005354 | Ga0070675_100001118 | Ga0070675_10000111822 | 113 |
| 539 | 3300005354 | Ga0070675_100018336 | Ga0070675_1000183364 | 113 |
| 540 | 3300005355 | Ga0070671_100639121 | Ga0070671_1006391211 | 113 |
| 541 | 3300005356 | Ga0070674_100009989 | Ga0070674_1000099894 | 113 |
| 542 | 3300005356 | Ga0070674_100242382 | Ga0070674_1002423822 | 113 |
| 543 | 3300005356 | Ga0070674_100845386 | Ga0070674_1008453862 | 113 |
| 544 | 3300005356 | Ga0070674_102160360 | Ga0070674_1021603601 | 113 |
| 545 | 3300005364 | Ga0070673_100129777 | Ga0070673_1001297773 | 113 |
| 546 | 3300005364 | Ga0070673_100174884 | Ga0070673_1001748842 | 113 |
| 547 | 3300005364 | Ga0070673_100220071 | Ga0070673_1002200712 | 113 |
| 548 | 3300005364 | Ga0070673_100280754 | Ga0070673_1002807543 | 113 |
| 549 | 3300005364 | Ga0070673_101225394 | Ga0070673_1012253942 | 113 |
| 550 | 3300005365 | Ga0070688_100027855 | Ga0070688_1000278552 | 113 |
| 551 | 3300005365 | Ga0070688_100031884 | Ga0070688_1000318841 | 113 |
| 552 | 3300005365 | Ga0070688_100416517 | Ga0070688_1004165172 | 113 |
| 553 | 3300005366 | Ga0070659_100006959 | Ga0070659_1000069599 | 113 |
| 554 | 3300005367 | Ga0070667_100240360 | Ga0070667_1002403603 | 113 |
| 555 | 3300005367 | Ga0070667_101487820 | Ga0070667_1014878202 | 113 |
| 556 | 3300005367 | Ga0070667_101978532 | Ga0070667_1019785322 | 113 |
| 557 | 3300005438 | Ga0070701_10039194 | Ga0070701_100391941 | 113 |
| 558 | 3300005438 | Ga0070701_10313150 | Ga0070701_103131502 | 113 |
| 559 | 3300005441 | Ga0070700_100071081 | Ga0070700_1000710811 | 113 |
| 560 | 3300005441 | Ga0070700_100366148 | Ga0070700_1003661482 | 113 |
| 561 | 3300005455 | Ga0070663_100476845 | Ga0070663_1004768452 | 113 |
| 562 | 3300005456 | Ga0070678_100352482 | Ga0070678_1003524821 | 113 |
| 563 | 3300005456 | Ga0070678_100488904 | Ga0070678_1004889043 | 113 |
| 564 | 3300005456 | Ga0070678_101826733 | Ga0070678_1018267331 | 113 |
| 565 | 3300005456 | Ga0070678_101880785 | Ga0070678_1018807851 | 113 |
| 566 | 3300005456 | Ga0070678_102082329 | Ga0070678_1020823291 | 113 |
| 567 | 3300005457 | Ga0070662_100006327 | Ga0070662_1000063279 | 113 |
| 568 | 3300005459 | Ga0068867_100014817 | Ga0068867_1000148172 | 113 |
| 569 | 3300005459 | Ga0068867_100140807 | Ga0068867_1001408074 | 113 |
| 570 | 3300005459 | Ga0068867_101385560 | Ga0068867_1013855601 | 113 |
| 571 | 3300005466 | Ga0070685_10011831 | Ga0070685_100118314 | 113 |
| 572 | 3300005466 | Ga0070685_10043005 | Ga0070685_100430054 | 113 |
| 573 | 3300005466 | Ga0070685_10094402 | Ga0070685_100944023 | 113 |
| 574 | 3300005466 | Ga0070685_10193721 | Ga0070685_101937212 | 113 |
| 575 | 3300005466 | Ga0070685_10375101 | Ga0070685_103751011 | 113 |
| 576 | 3300005467 | Ga0070706_101110149 | Ga0070706_1011101491 | 113 |
| 577 | 3300005471 | Ga0070698_100001074 | Ga0070698_10000107417 | 113 |
| 578 | 3300005471 | Ga0070698_100009628 | Ga0070698_1000096289 | 113 |
| 579 | 3300005471 | Ga0070698_100015207 | Ga0070698_1000152078 | 113 |
| 580 | 3300005471 | Ga0070698_100182933 | Ga0070698_1001829335 | 113 |
| 581 | 3300005518 | Ga0070699_100068012 | Ga0070699_1000680124 | 113 |
| 582 | 3300005535 | Ga0070684_100012277 | Ga0070684_1000122775 | 113 |
| 583 | 3300005536 | Ga0070697_100241043 | Ga0070697_1002410433 | 113 |
| 584 | 3300005539 | Ga0068853_100014798 | Ga0068853_1000147984 | 113 |
| 585 | 3300005539 | Ga0068853_100027463 | Ga0068853_1000274635 | 113 |
| 586 | 3300005539 | Ga0068853_100319566 | Ga0068853_1003195663 | 113 |
| 587 | 3300005539 | Ga0068853_100515092 | Ga0068853_1005150923 | 113 |
| 588 | 3300005539 | Ga0068853_100597028 | Ga0068853_1005970282 | 113 |
| 589 | 3300005539 | Ga0068853_101002797 | Ga0068853_1010027971 | 113 |
| 590 | 3300005543 | Ga0070672_100036130 | Ga0070672_1000361305 | 113 |
| 591 | 3300005543 | Ga0070672_101665980 | Ga0070672_1016659801 | 113 |
| 592 | 3300005543 | Ga0070672_102131282 | Ga0070672_1021312822 | 113 |
| 593 | 3300005544 | Ga0070686_100121073 | Ga0070686_1001210733 | 113 |
| 594 | 3300005544 | Ga0070686_100641040 | Ga0070686_1006410402 | 113 |
| 595 | 3300005544 | Ga0070686_101911460 | Ga0070686_1019114601 | 113 |
| 596 | 3300005545 | Ga0070695_100188470 | Ga0070695_1001884702 | 113 |
| 597 | 3300005545 | Ga0070695_101604237 | Ga0070695_1016042371 | 113 |
| 598 | 3300005549 | Ga0070704_100580009 | Ga0070704_1005800092 | 113 |
| 599 | 3300005549 | Ga0070704_101042199 | Ga0070704_1010421992 | 113 |
| 600 | 3300005563 | Ga0068855_100933037 | Ga0068855_1009330372 | 113 |
| 601 | 3300005564 | Ga0070664_100000243 | Ga0070664_10000024326 | 113 |
| 602 | 3300005577 | Ga0068857_100002097 | Ga0068857_10000209715 | 113 |
| 603 | 3300005577 | Ga0068857_100017217 | Ga0068857_1000172174 | 113 |
| 604 | 3300005577 | Ga0068857_100097876 | Ga0068857_1000978763 | 113 |
| 605 | 3300005577 | Ga0068857_100343486 | Ga0068857_1003434862 | 113 |
| 606 | 3300005577 | Ga0068857_100667668 | Ga0068857_1006676682 | 113 |
| 607 | 3300005577 | Ga0068857_100778807 | Ga0068857_1007788072 | 113 |
| 608 | 3300005577 | Ga0068857_101393431 | Ga0068857_1013934311 | 113 |
| 609 | 3300005577 | Ga0068857_102091613 | Ga0068857_1020916131 | 113 |
| 610 | 3300005578 | Ga0068854_100317444 | Ga0068854_1003174442 | 113 |
| 611 | 3300005614 | Ga0068856_100335347 | Ga0068856_1003353473 | 113 |
| 612 | 3300005614 | Ga0068856_101690405 | Ga0068856_1016904052 | 113 |
| 613 | 3300005616 | Ga0068852_102072628 | Ga0068852_1020726282 | 113 |
| 614 | 3300005617 | Ga0068859_100016081 | Ga0068859_1000160815 | 113 |
| 615 | 3300005617 | Ga0068859_100059890 | Ga0068859_1000598904 | 113 |
| 616 | 3300005617 | Ga0068859_100186862 | Ga0068859_1001868622 | 113 |
| 617 | 3300005617 | Ga0068859_100200658 | Ga0068859_1002006583 | 113 |
| 618 | 3300005617 | Ga0068859_100339164 | Ga0068859_1003391643 | 113 |
| 619 | 3300005617 | Ga0068859_100531688 | Ga0068859_1005316883 | 113 |
| 620 | 3300005617 | Ga0068859_101789151 | Ga0068859_1017891511 | 113 |
| 621 | 3300005618 | Ga0068864_100006400 | Ga0068864_1000064007 | 113 |
| 622 | 3300005618 | Ga0068864_100237825 | Ga0068864_1002378253 | 113 |
| 623 | 3300005618 | Ga0068864_100360431 | Ga0068864_1003604312 | 113 |
| 624 | 3300005618 | Ga0068864_100390057 | Ga0068864_1003900572 | 113 |
| 625 | 3300005718 | Ga0068866_10029543 | Ga0068866_100295433 | 113 |
| 626 | 3300005718 | Ga0068866_10217925 | Ga0068866_102179252 | 113 |
| 627 | 3300005719 | Ga0068861_100007430 | Ga0068861_1000074305 | 113 |
| 628 | 3300005719 | Ga0068861_100052573 | Ga0068861_1000525733 | 113 |
| 629 | 3300005719 | Ga0068861_100157247 | Ga0068861_1001572472 | 113 |
| 630 | 3300005719 | Ga0068861_100286841 | Ga0068861_1002868411 | 113 |
| 631 | 3300005719 | Ga0068861_100346859 | Ga0068861_1003468591 | 113 |
| 632 | 3300005719 | Ga0068861_100502652 | Ga0068861_1005026522 | 113 |
| 633 | 3300005719 | Ga0068861_101125681 | Ga0068861_1011256813 | 113 |
| 634 | 3300005840 | Ga0068870_10009968 | Ga0068870_100099684 | 113 |
| 635 | 3300005840 | Ga0068870_10211602 | Ga0068870_102116021 | 113 |
| 636 | 3300005841 | Ga0068863_100014068 | Ga0068863_1000140689 | 113 |
| 637 | 3300005841 | Ga0068863_100020130 | Ga0068863_1000201302 | 113 |
| 638 | 3300005841 | Ga0068863_100063616 | Ga0068863_1000636164 | 113 |
| 639 | 3300005841 | Ga0068863_100986907 | Ga0068863_1009869071 | 113 |
| 640 | 3300005841 | Ga0068863_101277784 | Ga0068863_1012777842 | 113 |
| 641 | 3300005841 | Ga0068863_101457457 | Ga0068863_1014574572 | 113 |
| 642 | 3300005841 | Ga0068863_101834240 | Ga0068863_1018342402 | 113 |
| 643 | 3300005842 | Ga0068858_100056174 | Ga0068858_1000561745 | 113 |
| 644 | 3300005842 | Ga0068858_101039195 | Ga0068858_1010391952 | 113 |
| 645 | 3300005843 | Ga0068860_100038000 | Ga0068860_1000380004 | 113 |
| 646 | 3300005843 | Ga0068860_100364160 | Ga0068860_1003641602 | 113 |
| 647 | 3300005843 | Ga0068860_100580204 | Ga0068860_1005802042 | 113 |
| 648 | 3300005843 | Ga0068860_100593590 | Ga0068860_1005935902 | 113 |
| 649 | 3300005843 | Ga0068860_100838760 | Ga0068860_1008387602 | 113 |
| 650 | 3300005843 | Ga0068860_100865714 | Ga0068860_1008657142 | 113 |
| 651 | 3300005843 | Ga0068860_101150488 | Ga0068860_1011504882 | 113 |
| 652 | 3300005844 | Ga0068862_100114924 | Ga0068862_1001149242 | 113 |
| 653 | 3300005844 | Ga0068862_100195821 | Ga0068862_1001958212 | 113 |
| 654 | 3300005844 | Ga0068862_100197710 | Ga0068862_1001977102 | 113 |
| 655 | 3300005844 | Ga0068862_100319909 | Ga0068862_1003199092 | 113 |
| 656 | 3300005844 | Ga0068862_101092915 | Ga0068862_1010929151 | 113 |
| 657 | 3300005844 | Ga0068862_101368253 | Ga0068862_1013682531 | 113 |
| 658 | 3300005844 | Ga0068862_101461805 | Ga0068862_1014618052 | 113 |
| 659 | 3300005844 | Ga0068862_101519662 | Ga0068862_1015196621 | 113 |
| 660 | 3300005985 | Ga0081539_10120430 | Ga0081539_101204302 | 113 |
| 661 | 3300006163 | Ga0070715_10027365 | Ga0070715_100273653 | 113 |
| 662 | 3300006195 | Ga0075366_10183517 | Ga0075366_101835172 | 113 |
| 663 | 3300006237 | Ga0097621_100614270 | Ga0097621_1006142702 | 113 |
| 664 | 3300006358 | Ga0068871_100014874 | Ga0068871_1000148746 | 113 |
| 665 | 3300006844 | Ga0075428_100012646 | Ga0075428_1000126468 | 113 |
| 666 | 3300006844 | Ga0075428_100416303 | Ga0075428_1004163033 | 113 |
| 667 | 3300006844 | Ga0075428_100452833 | Ga0075428_1004528332 | 113 |
| 668 | 3300006844 | Ga0075428_100604721 | Ga0075428_1006047213 | 113 |
| 669 | 3300006846 | Ga0075430_100044970 | Ga0075430_1000449704 | 113 |
| 670 | 3300006852 | Ga0075433_11430664 | Ga0075433_114306642 | 113 |
| 671 | 3300006880 | Ga0075429_100035605 | Ga0075429_1000356054 | 113 |
| 672 | 3300006880 | Ga0075429_100086034 | Ga0075429_1000860342 | 113 |
| 673 | 3300006881 | Ga0068865_100456138 | Ga0068865_1004561382 | 113 |
| 674 | 3300006881 | Ga0068865_101624266 | Ga0068865_1016242661 | 113 |
| 675 | 3300006931 | Ga0097620_100016082 | Ga0097620_1000160824 | 113 |
| 676 | 3300006931 | Ga0097620_100059889 | Ga0097620_1000598894 | 113 |
| 677 | 3300006931 | Ga0097620_100186869 | Ga0097620_1001868692 | 113 |
| 678 | 3300006931 | Ga0097620_100200656 | Ga0097620_1002006563 | 113 |
| 679 | 3300006931 | Ga0097620_100339163 | Ga0097620_1003391633 | 113 |
| 680 | 3300006931 | Ga0097620_100531691 | Ga0097620_1005316912 | 113 |
| 681 | 3300006931 | Ga0097620_101789168 | Ga0097620_1017891681 | 113 |
| 682 | 3300009094 | Ga0111539_10140833 | Ga0111539_101408332 | 113 |
| 683 | 3300009094 | Ga0111539_10161304 | Ga0111539_101613042 | 113 |
| 684 | 3300009094 | Ga0111539_10478553 | Ga0111539_104785533 | 113 |
| 685 | 3300009094 | Ga0111539_10926299 | Ga0111539_109262992 | 113 |
| 686 | 3300009094 | Ga0111539_12108073 | Ga0111539_121080732 | 113 |
| 687 | 3300009094 | Ga0111539_12418412 | Ga0111539_124184122 | 113 |
| 688 | 3300009101 | Ga0105247_10005318 | Ga0105247_100053181 | 113 |
| 689 | 3300009101 | Ga0105247_10273914 | Ga0105247_102739142 | 113 |
| 690 | 3300009147 | Ga0114129_10047706 | Ga0114129_100477067 | 113 |
| 691 | 3300009147 | Ga0114129_13240719 | Ga0114129_132407191 | 113 |
| 692 | 3300009148 | Ga0105243_10369475 | Ga0105243_103694751 | 113 |
| 693 | 3300009174 | Ga0105241_10521220 | Ga0105241_105212202 | 113 |
| 694 | 3300009174 | Ga0105241_12507995 | Ga0105241_125079951 | 113 |
| 695 | 3300009176 | Ga0105242_10036767 | Ga0105242_100367671 | 113 |
| 696 | 3300009176 | Ga0105242_10041913 | Ga0105242_100419135 | 113 |
| 697 | 3300009176 | Ga0105242_10057460 | Ga0105242_100574601 | 113 |
| 698 | 3300009176 | Ga0105242_10078592 | Ga0105242_100785921 | 113 |
| 699 | 3300009176 | Ga0105242_10554226 | Ga0105242_105542262 | 113 |
| 700 | 3300009176 | Ga0105242_11272156 | Ga0105242_112721562 | 113 |
| 701 | 3300009176 | Ga0105242_13050904 | Ga0105242_130509041 | 113 |
| 702 | 3300009177 | Ga0105248_10405758 | Ga0105248_104057582 | 113 |
| 703 | 3300009553 | Ga0105249_10001044 | Ga0105249_1000104422 | 113 |
| 704 | 3300009553 | Ga0105249_10003251 | Ga0105249_100032518 | 113 |
| 705 | 3300009553 | Ga0105249_10008489 | Ga0105249_100084899 | 113 |
| 706 | 3300009553 | Ga0105249_10021033 | Ga0105249_100210336 | 113 |
| 707 | 3300009553 | Ga0105249_10155331 | Ga0105249_101553312 | 113 |
| 708 | 3300009553 | Ga0105249_10350109 | Ga0105249_103501093 | 113 |
| 709 | 3300009553 | Ga0105249_10560999 | Ga0105249_105609992 | 113 |
| 710 | 3300009553 | Ga0105249_10727350 | Ga0105249_107273502 | 113 |
| 711 | 3300009553 | Ga0105249_11556370 | Ga0105249_115563701 | 113 |
| 712 | 3300011119 | Ga0105246_10178053 | Ga0105246_101780532 | 113 |
| 713 | 3300011119 | Ga0105246_10500332 | Ga0105246_105003322 | 113 |
| 714 | 3300013100 | Ga0157373_10527391 | Ga0157373_105273911 | 113 |
| 715 | 3300013296 | Ga0157374_10191600 | Ga0157374_101916003 | 113 |
| 716 | 3300013297 | Ga0157378_11368833 | Ga0157378_113688332 | 113 |
| 717 | 3300013297 | Ga0157378_13170480 | Ga0157378_131704801 | 113 |
| 718 | 3300013306 | Ga0163162_10058280 | Ga0163162_100582804 | 113 |
| 719 | 3300013306 | Ga0163162_10188340 | Ga0163162_101883402 | 113 |
| 720 | 3300013306 | Ga0163162_10247492 | Ga0163162_102474922 | 113 |
| 721 | 3300013306 | Ga0163162_10840113 | Ga0163162_108401132 | 113 |
| 722 | 3300013306 | Ga0163162_11579920 | Ga0163162_115799203 | 113 |
| 723 | 3300013307 | Ga0157372_13483023 | Ga0157372_134830231 | 113 |
| 724 | 3300013308 | Ga0157375_10011768 | Ga0157375_100117684 | 113 |
| 725 | 3300013308 | Ga0157375_10076285 | Ga0157375_100762852 | 113 |
| 726 | 3300013308 | Ga0157375_10097502 | Ga0157375_100975022 | 113 |
| 727 | 3300013308 | Ga0157375_12273375 | Ga0157375_122733752 | 113 |
| 728 | 3300014325 | Ga0163163_10042028 | Ga0163163_100420284 | 113 |
| 729 | 3300014325 | Ga0163163_10061006 | Ga0163163_100610063 | 113 |
| 730 | 3300014325 | Ga0163163_10188446 | Ga0163163_101884464 | 113 |
| 731 | 3300014325 | Ga0163163_10302420 | Ga0163163_103024201 | 113 |
| 732 | 3300014325 | Ga0163163_11429461 | Ga0163163_114294612 | 113 |
| 733 | 3300014326 | Ga0157380_10018730 | Ga0157380_100187303 | 113 |
| 734 | 3300014326 | Ga0157380_10027818 | Ga0157380_100278184 | 113 |
| 735 | 3300014326 | Ga0157380_10266159 | Ga0157380_102661592 | 113 |
| 736 | 3300014326 | Ga0157380_10739259 | Ga0157380_107392592 | 113 |
| 737 | 3300014326 | Ga0157380_11579148 | Ga0157380_115791481 | 113 |
| 738 | 3300014326 | Ga0157380_11894687 | Ga0157380_118946872 | 113 |
| 739 | 3300014745 | Ga0157377_10000678 | Ga0157377_100006789 | 113 |
| 740 | 3300014745 | Ga0157377_10010005 | Ga0157377_100100053 | 113 |
| 741 | 3300014745 | Ga0157377_10365055 | Ga0157377_103650552 | 113 |
| 742 | 3300014745 | Ga0157377_10484089 | Ga0157377_104840892 | 113 |
| 743 | 3300014745 | Ga0157377_10684990 | Ga0157377_106849901 | 113 |
| 744 | 3300014968 | Ga0157379_10667471 | Ga0157379_106674711 | 113 |
| 745 | 3300014968 | Ga0157379_10833434 | Ga0157379_108334342 | 113 |
| 746 | 3300014969 | Ga0157376_10171063 | Ga0157376_101710632 | 113 |
| 747 | 3300014969 | Ga0157376_11339872 | Ga0157376_113398721 | 113 |
| 748 | 3300017792 | Ga0163161_10303358 | Ga0163161_103033582 | 113 |
| 749 | 3300017792 | Ga0163161_10630074 | Ga0163161_106300743 | 113 |
| 750 | 3300021384 | Ga0213876_10093846 | Ga0213876_100938462 | 113 |
| 751 | 3300025315 | Ga0207697_10015840 | Ga0207697_100158402 | 113 |
| 752 | 3300025315 | Ga0207697_10055750 | Ga0207697_100557502 | 113 |
| 753 | 3300025899 | Ga0207642_10997564 | Ga0207642_109975641 | 113 |
| 754 | 3300025900 | Ga0207710_10008757 | Ga0207710_100087572 | 113 |
| 755 | 3300025905 | Ga0207685_10375486 | Ga0207685_103754862 | 113 |
| 756 | 3300025907 | Ga0207645_10034576 | Ga0207645_100345761 | 113 |
| 757 | 3300025907 | Ga0207645_10273779 | Ga0207645_102737791 | 113 |
| 758 | 3300025908 | Ga0207643_10009087 | Ga0207643_100090874 | 113 |
| 759 | 3300025908 | Ga0207643_10023317 | Ga0207643_100233173 | 113 |
| 760 | 3300025908 | Ga0207643_10042085 | Ga0207643_100420852 | 113 |
| 761 | 3300025910 | Ga0207684_11653904 | Ga0207684_116539041 | 113 |
| 762 | 3300025918 | Ga0207662_10003292 | Ga0207662_100032927 | 113 |
| 763 | 3300025918 | Ga0207662_10059491 | Ga0207662_100594914 | 113 |
| 764 | 3300025918 | Ga0207662_10073654 | Ga0207662_100736544 | 113 |
| 765 | 3300025919 | Ga0207657_10812087 | Ga0207657_108120872 | 113 |
| 766 | 3300025920 | Ga0207649_10019365 | Ga0207649_100193656 | 113 |
| 767 | 3300025923 | Ga0207681_10002024 | Ga0207681_1000202413 | 113 |
| 768 | 3300025923 | Ga0207681_10165742 | Ga0207681_101657423 | 113 |
| 769 | 3300025923 | Ga0207681_10187394 | Ga0207681_101873943 | 113 |
| 770 | 3300025923 | Ga0207681_10448510 | Ga0207681_104485102 | 113 |
| 771 | 3300025925 | Ga0207650_10023273 | Ga0207650_100232734 | 113 |
| 772 | 3300025925 | Ga0207650_10039444 | Ga0207650_100394442 | 113 |
| 773 | 3300025925 | Ga0207650_10145425 | Ga0207650_101454252 | 113 |
| 774 | 3300025925 | Ga0207650_10237979 | Ga0207650_102379792 | 113 |
| 775 | 3300025926 | Ga0207659_10151721 | Ga0207659_101517212 | 113 |
| 776 | 3300025926 | Ga0207659_10271986 | Ga0207659_102719863 | 113 |
| 777 | 3300025926 | Ga0207659_10571682 | Ga0207659_105716822 | 113 |
| 778 | 3300025932 | Ga0207690_10030767 | Ga0207690_100307673 | 113 |
| 779 | 3300025933 | Ga0207706_10020449 | Ga0207706_100204496 | 113 |
| 780 | 3300025933 | Ga0207706_11076955 | Ga0207706_110769551 | 113 |
| 781 | 3300025934 | Ga0207686_10001189 | Ga0207686_100011899 | 113 |
| 782 | 3300025934 | Ga0207686_10012292 | Ga0207686_100122925 | 113 |
| 783 | 3300025934 | Ga0207686_10040292 | Ga0207686_100402923 | 113 |
| 784 | 3300025936 | Ga0207670_10080757 | Ga0207670_100807574 | 113 |
| 785 | 3300025936 | Ga0207670_10094296 | Ga0207670_100942964 | 113 |
| 786 | 3300025936 | Ga0207670_10137271 | Ga0207670_101372712 | 113 |
| 787 | 3300025936 | Ga0207670_10501171 | Ga0207670_105011714 | 113 |
| 788 | 3300025936 | Ga0207670_11743416 | Ga0207670_117434161 | 113 |
| 789 | 3300025937 | Ga0207669_10019812 | Ga0207669_100198124 | 113 |
| 790 | 3300025937 | Ga0207669_10535287 | Ga0207669_105352872 | 113 |
| 791 | 3300025940 | Ga0207691_10017962 | Ga0207691_100179625 | 113 |
| 792 | 3300025940 | Ga0207691_10554754 | Ga0207691_105547542 | 113 |
| 793 | 3300025940 | Ga0207691_10774475 | Ga0207691_107744752 | 113 |
| 794 | 3300025941 | Ga0207711_10480404 | Ga0207711_104804042 | 113 |
| 795 | 3300025942 | Ga0207689_10007932 | Ga0207689_100079324 | 113 |
| 796 | 3300025942 | Ga0207689_10023684 | Ga0207689_100236842 | 113 |
| 797 | 3300025942 | Ga0207689_10103461 | Ga0207689_101034613 | 113 |
| 798 | 3300025942 | Ga0207689_10236602 | Ga0207689_102366022 | 113 |
| 799 | 3300025942 | Ga0207689_10505107 | Ga0207689_105051072 | 113 |
| 800 | 3300025942 | Ga0207689_11516867 | Ga0207689_115168671 | 113 |
| 801 | 3300025944 | Ga0207661_10034029 | Ga0207661_100340292 | 113 |
| 802 | 3300025944 | Ga0207661_10169413 | Ga0207661_101694133 | 113 |
| 803 | 3300025945 | Ga0207679_10000091 | Ga0207679_1000009154 | 113 |
| 804 | 3300025945 | Ga0207679_10445790 | Ga0207679_104457902 | 113 |
| 805 | 3300025960 | Ga0207651_10111794 | Ga0207651_101117942 | 113 |
| 806 | 3300025960 | Ga0207651_10184834 | Ga0207651_101848342 | 113 |
| 807 | 3300025960 | Ga0207651_10762505 | Ga0207651_107625051 | 113 |
| 808 | 3300025960 | Ga0207651_10764818 | Ga0207651_107648182 | 113 |
| 809 | 3300025960 | Ga0207651_11391031 | Ga0207651_113910312 | 113 |
| 810 | 3300025961 | Ga0207712_10001457 | Ga0207712_1000145712 | 113 |
| 811 | 3300025961 | Ga0207712_10033161 | Ga0207712_100331613 | 113 |
| 812 | 3300025961 | Ga0207712_10112787 | Ga0207712_101127874 | 113 |
| 813 | 3300025961 | Ga0207712_10318529 | Ga0207712_103185291 | 113 |
| 814 | 3300025961 | Ga0207712_10370752 | Ga0207712_103707521 | 113 |
| 815 | 3300025961 | Ga0207712_10450586 | Ga0207712_104505862 | 113 |
| 816 | 3300025972 | Ga0207668_10094208 | Ga0207668_100942082 | 113 |
| 817 | 3300025972 | Ga0207668_10098112 | Ga0207668_100981124 | 113 |
| 818 | 3300025972 | Ga0207668_10171258 | Ga0207668_101712582 | 113 |
| 819 | 3300025972 | Ga0207668_11869941 | Ga0207668_118699411 | 113 |
| 820 | 3300025981 | Ga0207640_10181913 | Ga0207640_101819132 | 113 |
| 821 | 3300025981 | Ga0207640_10365833 | Ga0207640_103658333 | 113 |
| 822 | 3300025986 | Ga0207658_10581807 | Ga0207658_105818071 | 113 |
| 823 | 3300025986 | Ga0207658_11803949 | Ga0207658_118039492 | 113 |
| 824 | 3300026023 | Ga0207677_10091214 | Ga0207677_100912143 | 113 |
| 825 | 3300026023 | Ga0207677_10608853 | Ga0207677_106088532 | 113 |
| 826 | 3300026023 | Ga0207677_10925223 | Ga0207677_109252232 | 113 |
| 827 | 3300026035 | Ga0207703_10822432 | Ga0207703_108224321 | 113 |
| 828 | 3300026035 | Ga0207703_11126320 | Ga0207703_111263202 | 113 |
| 829 | 3300026041 | Ga0207639_10019684 | Ga0207639_100196843 | 113 |
| 830 | 3300026041 | Ga0207639_10092796 | Ga0207639_100927961 | 113 |
| 831 | 3300026041 | Ga0207639_10458427 | Ga0207639_104584272 | 113 |
| 832 | 3300026041 | Ga0207639_10536754 | Ga0207639_105367542 | 113 |
| 833 | 3300026075 | Ga0207708_10017202 | Ga0207708_100172026 | 113 |
| 834 | 3300026075 | Ga0207708_10147513 | Ga0207708_101475133 | 113 |
| 835 | 3300026075 | Ga0207708_10190030 | Ga0207708_101900303 | 113 |
| 836 | 3300026075 | Ga0207708_10514081 | Ga0207708_105140811 | 113 |
| 837 | 3300026075 | Ga0207708_11256877 | Ga0207708_112568772 | 113 |
| 838 | 3300026088 | Ga0207641_10002685 | Ga0207641_1000268510 | 113 |
| 839 | 3300026088 | Ga0207641_10014674 | Ga0207641_100146742 | 113 |
| 840 | 3300026088 | Ga0207641_10021780 | Ga0207641_100217805 | 113 |
| 841 | 3300026088 | Ga0207641_10205387 | Ga0207641_102053871 | 113 |
| 842 | 3300026088 | Ga0207641_11370123 | Ga0207641_113701231 | 113 |
| 843 | 3300026089 | Ga0207648_10008642 | Ga0207648_100086426 | 113 |
| 844 | 3300026089 | Ga0207648_10176544 | Ga0207648_101765444 | 113 |
| 845 | 3300026089 | Ga0207648_10215118 | Ga0207648_102151182 | 113 |
| 846 | 3300026089 | Ga0207648_10829501 | Ga0207648_108295012 | 113 |
| 847 | 3300026095 | Ga0207676_10027882 | Ga0207676_100278822 | 113 |
| 848 | 3300026095 | Ga0207676_10147746 | Ga0207676_101477462 | 113 |
| 849 | 3300026095 | Ga0207676_10474709 | Ga0207676_104747092 | 113 |
| 850 | 3300026095 | Ga0207676_12096474 | Ga0207676_120964741 | 113 |
| 851 | 3300026116 | Ga0207674_10006896 | Ga0207674_100068965 | 113 |
| 852 | 3300026116 | Ga0207674_10023357 | Ga0207674_100233574 | 113 |
| 853 | 3300026116 | Ga0207674_10353433 | Ga0207674_103534331 | 113 |
| 854 | 3300026118 | Ga0207675_100000085 | Ga0207675_10000008555 | 113 |
| 855 | 3300026118 | Ga0207675_100011340 | Ga0207675_1000113406 | 113 |
| 856 | 3300026118 | Ga0207675_100142715 | Ga0207675_1001427153 | 113 |
| 857 | 3300026118 | Ga0207675_100187137 | Ga0207675_1001871372 | 113 |
| 858 | 3300026118 | Ga0207675_100294295 | Ga0207675_1002942951 | 113 |
| 859 | 3300026118 | Ga0207675_100335370 | Ga0207675_1003353703 | 113 |
| 860 | 3300026118 | Ga0207675_100728933 | Ga0207675_1007289331 | 113 |
| 861 | 3300026118 | Ga0207675_100895081 | Ga0207675_1008950812 | 113 |
| 862 | 3300026118 | Ga0207675_102562642 | Ga0207675_1025626421 | 113 |
| 863 | 3300026121 | Ga0207683_10826837 | Ga0207683_108268372 | 113 |
| 864 | 3300026121 | Ga0207683_11002180 | Ga0207683_110021802 | 113 |
| 865 | 3300026142 | Ga0207698_10033125 | Ga0207698_100331253 | 113 |
| 866 | 3300027907 | Ga0207428_10050789 | Ga0207428_100507895 | 113 |
| 867 | 3300027907 | Ga0207428_10315430 | Ga0207428_103154302 | 113 |
| 868 | 3300028380 | Ga0268265_10004802 | Ga0268265_100048023 | 113 |
| 869 | 3300028380 | Ga0268265_10066375 | Ga0268265_100663754 | 113 |
| 870 | 3300028380 | Ga0268265_10321709 | Ga0268265_103217091 | 113 |
| 871 | 3300028380 | Ga0268265_11300289 | Ga0268265_113002892 | 113 |
| 872 | 3300028380 | Ga0268265_11311065 | Ga0268265_113110652 | 113 |
| 873 | 3300028380 | Ga0268265_11355816 | Ga0268265_113558162 | 113 |
| 874 | 3300028381 | Ga0268264_10027341 | Ga0268264_100273414 | 113 |
| 875 | 3300028381 | Ga0268264_10038894 | Ga0268264_100388942 | 113 |
| 876 | 3300028381 | Ga0268264_10081403 | Ga0268264_100814033 | 113 |
| 877 | 3300028381 | Ga0268264_10271614 | Ga0268264_102716141 | 113 |
| 878 | 3300028381 | Ga0268264_10667574 | Ga0268264_106675742 | 113 |
| 879 | 3300028381 | Ga0268264_10709910 | Ga0268264_107099103 | 113 |
| 880 | 3300028381 | Ga0268264_11033787 | Ga0268264_110337871 | 113 |
| 881 | 3300028381 | Ga0268264_11254784 | Ga0268264_112547841 | 113 |
| 882 | 3300028381 | Ga0268264_11602209 | Ga0268264_116022092 | 113 |
| 883 | 3300028786 | Ga0307517_10510855 | Ga0307517_105108551 | 113 |
| 884 | 3300030731 | Ga0316177_1121841 | Ga0316177_11218412 | 113 |
| 885 | 3300031239 | Ga0265328_10276544 | Ga0265328_102765442 | 113 |
| 886 | 3300031251 | Ga0265327_10009266 | Ga0265327_100092662 | 113 |
| 887 | 3300031456 | Ga0307513_10219809 | Ga0307513_102198093 | 113 |
| 888 | 3300031456 | Ga0307513_10550569 | Ga0307513_105505692 | 113 |
| 889 | 3300031456 | Ga0307513_11048326 | Ga0307513_110483261 | 113 |
| 890 | 3300031507 | Ga0307509_10106400 | Ga0307509_101064003 | 113 |
| 891 | 3300031595 | Ga0265313_10098314 | Ga0265313_100983141 | 113 |
| 892 | 3300032004 | Ga0307414_10290691 | Ga0307414_102906912 | 113 |
| 893 | 3300032005 | Ga0307411_10307778 | Ga0307411_103077781 | 113 |
| 894 | 3300035113 | Ga0373936_0292345 | Ga0373936_0292345_160_501 | 113 |
| 895 | 3300035172 | Ga0373955_0049638 | Ga0373955_0049638_418_759 | 113 |
| 896 | 3300035410 | Ga0373924_0016787 | Ga0373924_0016787_2399_2740 | 113 |
| 897 | 3300035692 | Ga0373935_0135645 | Ga0373935_0135645_435_776 | 113 |
| 898 | 3300036401 | Ga0373937_0028695 | Ga0373937_0028695_4389_4730 | 113 |
| 899 | 3300037418 | Ga0395900_0890876 | Ga0395900_0890876_285_629 | 113 |
| 900 | 3300039437 | Ga0436365_1066023 | Ga0436365_1066023_1389_1733 | 113 |
| 901 | 3300039437 | Ga0436365_1111130 | Ga0436365_1111130_1153_1497 | 113 |
| 902 | 3300041404 | Ga0439436_0027239 | Ga0439436_0027239_847_1191 | 113 |
| 903 | 3300041406 | Ga0439439_0018325 | Ga0439439_0018325_900_1241 | 113 |
| 904 | 3300041406 | Ga0439439_0060288 | Ga0439439_0060288_32_373 | 113 |
| 905 | 3300041413 | Ga0439465_0370875 | Ga0439465_0370875_160_501 | 113 |
| 906 | 3300041441 | Ga0451787_601744 | Ga0451787_601744_60_404 | 113 |
| 907 | 3300041443 | Ga0451789_1085436 | Ga0451789_1085436_122_469 | 113 |
| 908 | 3300041451 | Ga0451791_0709903 | Ga0451791_0709903_277_621 | 113 |
| 909 | 3300041451 | Ga0451791_0976880 | Ga0451791_0976880_382_729 | 113 |
| 910 | 3300041453 | Ga0451797_0143917 | Ga0451797_0143917_42_386 | 113 |
| 911 | 3300041459 | Ga0451800_0573962 | Ga0451800_0573962_159_500 | 113 |
| 912 | 3300041460 | Ga0451802_0505948 | Ga0451802_0505948_118_459 | 113 |
| 913 | 3300041460 | Ga0451802_0744852 | Ga0451802_0744852_441_785 | 113 |
| 914 | 3300041486 | Ga0451807_1283653 | Ga0451807_1283653_16_357 | 113 |
| 915 | 3300041486 | Ga0451807_2598025 | Ga0451807_2598025_45_386 | 113 |
| 916 | 3300041491 | Ga0451833_0407819 | Ga0451833_0407819_245_589 | 113 |
| 917 | 3300041507 | Ga0451851_0639284 | Ga0451851_0639284_226_573 | 113 |
| 918 | 3300041509 | Ga0451843_0288465 | Ga0451843_0288465_454_801 | 113 |
| 919 | 3300041512 | Ga0451853_0925438 | Ga0451853_0925438_284_628 | 113 |
| 920 | 3300041512 | Ga0451853_1827383 | Ga0451853_1827383_340_684 | 113 |
| 921 | 3300041997 | Ga0439431_0109007 | Ga0439431_0109007_231_572 | 113 |
| 922 | 3300041999 | Ga0439433_0074625 | Ga0439433_0074625_57_398 | 113 |
| 923 | 3300042001 | Ga0439441_001674 | Ga0439441_001674_756_1100 | 113 |
| 924 | 3300042004 | Ga0439445_0056666 | Ga0439445_0056666_177_518 | 113 |
| 925 | 3300042007 | Ga0439449_0008946 | Ga0439449_0008946_565_909 | 113 |
| 926 | 3300042007 | Ga0439449_0012910 | Ga0439449_0012910_2215_2556 | 113 |
| 927 | 3300042011 | Ga0439454_013571 | Ga0439454_013571_109_450 | 113 |
| 928 | 3300042014 | Ga0439457_000874 | Ga0439457_000874_7793_8137 | 113 |
| 929 | 3300042015 | Ga0439462_0004114 | Ga0439462_0004114_2737_3081 | 113 |
| 930 | 3300042124 | Ga0450922_022258 | Ga0450922_022258_282_623 | 113 |
| 931 | 3300042128 | Ga0450897_022153 | Ga0450897_022153_25_366 | 113 |
| 932 | 3300042131 | Ga0450894_025993 | Ga0450894_025993_323_664 | 113 |
| 933 | 3300042133 | Ga0450896_044332 | Ga0450896_044332_233_574 | 113 |
| 934 | 3300042134 | Ga0450898_020988 | Ga0450898_020988_269_610 | 113 |
| 935 | 3300042135 | Ga0450899_012799 | Ga0450899_012799_55_396 | 113 |
| 936 | 3300042435 | Ga0439434_0261570 | Ga0439434_0261570_198_539 | 113 |
| 937 | 3300042436 | Ga0439435_0055381 | Ga0439435_0055381_29_370 | 113 |
| 938 | 3300042437 | Ga0439444_0070272 | Ga0439444_0070272_297_641 | 113 |
| 939 | 3300042438 | Ga0439459_0142367 | Ga0439459_0142367_203_544 | 113 |
| 940 | 3300042439 | Ga0439464_0129699 | Ga0439464_0129699_144_485 | 113 |
| 941 | 3300042461 | Ga0439460_0010547 | Ga0439460_0010547_343_687 | 113 |
| 942 | 3300042876 | Ga0451577_1644303 | Ga0451577_1644303_187_528 | 113 |
| 943 | 3300046454 | Ga0495592_0126013 | Ga0495592_0126013_575_916 | 113 |
| 944 | 3300046460 | Ga0495638_0035545 | Ga0495638_0035545_376_723 | 113 |
| 945 | 3300046491 | Ga0495584_0174665 | Ga0495584_0174665_319_660 | 113 |
| 946 | 3300046511 | Ga0495608_0066795 | Ga0495608_0066795_182_523 | 113 |
| 947 | 3300046514 | Ga0495618_0221260 | Ga0495618_0221260_761_1102 | 113 |
| 948 | 3300046517 | Ga0495630_0014167 | Ga0495630_0014167_192_533 | 113 |
| 949 | 3300046519 | Ga0495632_0213052 | Ga0495632_0213052_267_614 | 113 |
| 950 | 3300046522 | Ga0495643_0007703 | Ga0495643_0007703_6522_6863 | 113 |
| 951 | 3300046533 | Ga0495640_0081502 | Ga0495640_0081502_77_418 | 113 |
| 952 | 3300046537 | Ga0495598_0037398 | Ga0495598_0037398_886_1227 | 113 |
| 953 | 3300046539 | Ga0495621_0074477 | Ga0495621_0074477_528_869 | 113 |
| 954 | 3300046559 | Ga0495667_0752181 | Ga0495667_0752181_229_570 | 113 |
| 955 | 3300046642 | Ga0495634_0099314 | Ga0495634_0099314_22_363 | 113 |
| 956 | 3300046648 | Ga0495611_0129352 | Ga0495611_0129352_502_843 | 113 |
| 957 | 3300046675 | Ga0495657_0108124 | Ga0495657_0108124_1388_1729 | 113 |
| 958 | 3300046683 | Ga0495658_0128425 | Ga0495658_0128425_705_1046 | 113 |
| 959 | 3300046689 | Ga0495613_0110120 | Ga0495613_0110120_1460_1801 | 113 |
| 960 | 3300046809 | Ga0495600_0736454 | Ga0495600_0736454_45_386 | 113 |
| 961 | 3300047317 | Ga0495604_0227112 | Ga0495604_0227112_750_1091 | 113 |
| 962 | 3300047318 | Ga0495636_0690415 | Ga0495636_0690415_141_482 | 113 |
| 963 | 3300047320 | Ga0495672_0061725 | Ga0495672_0061725_623_964 | 113 |
| 964 | 3300047320 | Ga0495672_0362970 | Ga0495672_0362970_167_508 | 113 |
| 965 | 3300047322 | Ga0495680_0507477 | Ga0495680_0507477_460_801 | 113 |
| 966 | 3300047322 | Ga0495680_0896578 | Ga0495680_0896578_139_480 | 113 |
| 967 | 3300047444 | Ga0495675_0204749 | Ga0495675_0204749_34_375 | 113 |
| 968 | 3300047445 | Ga0495677_0461501 | Ga0495677_0461501_148_489 | 113 |
| 969 | 3300047471 | Ga0495684_0410038 | Ga0495684_0410038_536_877 | 113 |
| 970 | 3300049569 | Ga0501032_0005001 | Ga0501032_0005001_1931_2275 | 113 |
| 971 | 3300049569 | Ga0501032_0285675 | Ga0501032_0285675_568_912 | 113 |
| 972 | 3300049571 | Ga0501034_0062096 | Ga0501034_0062096_171_512 | 113 |
| 973 | 3300049572 | Ga0501036_0032651 | Ga0501036_0032651_413_757 | 113 |
| 974 | 3300049573 | Ga0501037_0048748 | Ga0501037_0048748_1955_2296 | 113 |
| 975 | 3300049573 | Ga0501037_0452002 | Ga0501037_0452002_467_811 | 113 |
| 976 | 3300049574 | Ga0501038_0072836 | Ga0501038_0072836_353_697 | 113 |
| 977 | 3300049575 | Ga0501039_0072471 | Ga0501039_0072471_1566_1907 | 113 |
| 978 | 3300049579 | Ga0501043_0003493 | Ga0501043_0003493_11231_11575 | 113 |
| 979 | 3300049581 | Ga0501047_0004866 | Ga0501047_0004866_11419_11763 | 113 |
| 980 | 3300049581 | Ga0501047_0279843 | Ga0501047_0279843_1084_1425 | 113 |
| 981 | 3300049582 | Ga0501048_0016937 | Ga0501048_0016937_1133_1477 | 113 |
| 982 | 3300049585 | Ga0501069_0350827 | Ga0501069_0350827_64_408 | 113 |
| 983 | 3300049586 | Ga0501070_0425120 | Ga0501070_0425120_440_784 | 113 |
| 984 | 3300049588 | Ga0501072_0312892 | Ga0501072_0312892_30_371 | 113 |
| 985 | 3300049589 | Ga0501073_0753687 | Ga0501073_0753687_170_511 | 113 |
| 986 | 3300049590 | Ga0501074_0004850 | Ga0501074_0004850_8877_9221 | 113 |
| 987 | 3300049675 | Ga0501243_039873 | Ga0501243_039873_368_712 | 113 |
| 988 | 3300049704 | Ga0501221_149305 | Ga0501221_149305_33_374 | 113 |
| 989 | 3300049705 | Ga0501225_0004750 | Ga0501225_0004750_1942_2286 | 113 |
| 990 | 3300049742 | Ga0501080_0082856 | Ga0501080_0082856_2346_2690 | 113 |
| 991 | 3300049742 | Ga0501080_0130029 | Ga0501080_0130029_151_492 | 113 |
| 992 | 3300049744 | Ga0501083_0178906 | Ga0501083_0178906_332_676 | 113 |
| 993 | 3300049822 | Ga0501035_0010218 | Ga0501035_0010218_7910_8254 | 113 |
| 994 | 3300049823 | Ga0501044_0014761 | Ga0501044_0014761_7910_8254 | 113 |
| 995 | 3300049824 | Ga0501045_0243704 | Ga0501045_0243704_489_833 | 113 |
| 996 | 3300050507 | nmdc:mga05p37_118879_c1 | nmdc:mga05p37_118879_c1_704_1045 | 113 |
| 997 | 3300050508 | nmdc:mga09592_12569_c2 | nmdc:mga09592_12569_c2_2891_3232 | 113 |
| 998 | 3300050508 | nmdc:mga09592_363122_c1 | nmdc:mga09592_363122_c1_902_1243 | 113 |
| 999 | 3300050509 | nmdc:mga0qj67_370556_c1 | nmdc:mga0qj67_370556_c1_499_840 | 113 |
| 1000 | 3300050510 | nmdc:mga06r32_1364632_c1 | nmdc:mga06r32_1364632_c1_201_542 | 113 |
| 1001 | 3300050511 | nmdc:mga08y16_207810_c1 | nmdc:mga08y16_207810_c1_1604_1945 | 113 |
| 1002 | 3300050511 | nmdc:mga08y16_21376_c1 | nmdc:mga08y16_21376_c1_4986_5327 | 113 |
| 1003 | 3300050511 | nmdc:mga08y16_351456_c1 | nmdc:mga08y16_351456_c1_45_386 | 113 |
| 1004 | 3300050511 | nmdc:mga08y16_86504_c1 | nmdc:mga08y16_86504_c1_2014_2355 | 113 |
| 1005 | 3300053090 | Ga0500646_0034250 | Ga0500646_0034250_758_1102 | 113 |
| 1006 | 3300053092 | Ga0500583_0127636 | Ga0500583_0127636_595_942 | 113 |
| 1007 | 3300053093 | Ga0500651_0225284 | Ga0500651_0225284_169_513 | 113 |
| 1008 | 3300053104 | Ga0500556_0066129 | Ga0500556_0066129_252_596 | 113 |
| 1009 | 3300053130 | Ga0500642_0109696 | Ga0500642_0109696_19_366 | 113 |
| 1010 | 3300053134 | Ga0500658_0132059 | Ga0500658_0132059_224_568 | 113 |
| 1011 | 3300053147 | Ga0500589_005991 | Ga0500589_005991_1749_2093 | 113 |
| 1012 | 3300053151 | Ga0500604_0112489 | Ga0500604_0112489_10_354 | 113 |
| 1013 | 3300053153 | Ga0500616_0134010 | Ga0500616_0134010_208_549 | 113 |
| 1014 | 3300053156 | Ga0500622_0061690 | Ga0500622_0061690_256_600 | 113 |
| 1015 | 3300053156 | Ga0500622_0201134 | Ga0500622_0201134_263_607 | 113 |
| 1016 | 3300053158 | Ga0500627_0174523 | Ga0500627_0174523_240_584 | 113 |
| 1017 | 3300053727 | Ga0500611_000039 | Ga0500611_000039_26174_26515 | 113 |
| 1018 | 3300054114 | Ga0501084_0034594 | Ga0501084_0034594_695_1039 | 113 |
| 1019 | 3300060353 | Ga0501082_1425286 | Ga0501082_1425286_222_563 | 113 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mo0-assembly1.cif.gz_A | crystal structure of aif1 from methanocaldococcus jannaschii | 0.8577 | 36 | 113 |
| 4mo0-assembly1.cif.gz_A | crystal structure of aif1 from methanocaldococcus jannaschii | 0.8376 | 36 | 113 |
| 5jb3-assembly1.cif.gz_1 | cryo-em structure of a full archaeal ribosomal translation initiation complex in the p-remote conformation | 0.8158 | 32 | 113 |
| 6ywe-assembly1.cif.gz_7 | the structure of the mitoribosome from neurospora crassa in the p/e trna bound state | 0.814 | 41 | 106 |
| 5zcy-assembly1.cif.gz_A | crystal structure of archaeal translation initiation factor 1 at 1.5 angstroms resolution | 0.8078 | 32 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P08245_28_108_3.30.780.10 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain | 0.8937 | 35 | 113 | 3.30.780.10 |
| 4mo0A00 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain | 0.8577 | 36 | 113 | 3.30.780.10 |
| af_P08245_28_108_3.30.780.10 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain | 0.8527 | 35 | 113 | 3.30.780.10 |
| 4mo0A00 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain | 0.8376 | 36 | 113 | 3.30.780.10 |
| af_Q9VYI3_47_179_3.30.780.10 | Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain | 0.8285 | 41 | 106 | 3.30.780.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3W2D1-F1-model_v4 | Translation initiation factor | 0.9855 | 32 | 111 |
GO:0001731
GO:0002188 GO:0003729 GO:0003743 |
| AF-A0A2N2Z925-F1-model_v4 | Translation initiation factor | 0.9831 | 30 | 113 |
GO:0001731
GO:0002188 GO:0003729 GO:0003743 |
| AF-A0A534VZ28-F1-model_v4 | Translation initiation factor | 0.9711 | 41 | 113 |
GO:0003743
|
| AF-A0A7J5F376-F1-model_v4 | Translation initiation factor | 0.9656 | 37 | 111 |
GO:0001731
GO:0002188 GO:0003729 GO:0003743 |
| AF-A0A4Q3W2D1-F1-model_v4 | Translation initiation factor | 0.9618 | 32 | 111 |
GO:0001731
GO:0002188 GO:0003729 GO:0003743 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar