F488341

General Info

Members Datasets Scaffolds Average Seq Length
1019 313 1018 113

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100331294|Ga0070667_1003312942
Length 105
Sequence MSKKNKPDNRGFVYSTDPEFKFLPAAQQKLKIRLDTKHRAGKAVTLIEGFTGKEEDLEDLGKKLKSFCGTGGSAKDGEIIVQGDQREKVLQWLIKNGYKNSRKTG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
202 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
205 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
206 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
207 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
212 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
213 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
214 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
217 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
218 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
219 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
222 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
223 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
224 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
225 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
226 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
227 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
228 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
229 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
233 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
247 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
248 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
258 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
280 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
283 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
284 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
285 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
286 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
300 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
303 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
306 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
309 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
310 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
311 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.9
Metatranscriptomes 0
Isolates 0.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0
Rhizoplane 1.47
Rhizosphere 95.09
Stem 0
Stem Tuber 0
Unclassified 1.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1580370 2162886007 Bacteria 910
2 SwRhRL2b_contig_942247 2162886007 Bacteria 903
3 ARcpr5yngRDRAFT_c011162 3300000043 Bacteria 760
4 JGI24735J21928_10022974 3300002067 Bacteria 1893
5 JGI24751J29686_10000360 3300002459 Bacteria 15823
6 rootL2_10182482 3300003322 Bacteria 2480
7 rootL2_10224766 3300003322 Bacteria 1719
8 rootL2_10300896 3300003322 Bacteria 1227
9 rootH1_10017808 3300003323 Bacteria 3962
10 Ga0065714_10101230 3300005288 Bacteria 1648
11 Ga0065704_10120433 3300005289 Bacteria 1768
12 Ga0065704_10494583 3300005289 Unclassified 672
13 Ga0065712_10001246 3300005290 Bacteria 8768
14 Ga0065712_10010559 3300005290 Bacteria 2149
15 Ga0065712_10160118 3300005290 Bacteria 1306
16 Ga0065715_10004024 3300005293 Bacteria 4807
17 Ga0065707_10126934 3300005295 Bacteria 1993
18 Ga0065707_10898219 3300005295 Bacteria 567
19 Ga0070658_10203888 3300005327 Bacteria 1669
20 Ga0070658_10771285 3300005327 Bacteria 835
21 Ga0070676_10005845 3300005328 Bacteria 6563
22 Ga0070676_10063316 3300005328 Bacteria 2203
23 Ga0070676_10584658 3300005328 Bacteria 803
24 Ga0070676_10729671 3300005328 Unclassified 726
25 Ga0070683_100004596 3300005329 Bacteria 11396
26 Ga0070683_100080455 3300005329 Bacteria 3050
27 Ga0070683_100113788 3300005329 Bacteria 2554
28 Ga0070683_100160047 3300005329 Bacteria 2136
29 Ga0070690_100004279 3300005330 Bacteria 7907
30 Ga0070690_100142125 3300005330 Bacteria 1630
31 Ga0070690_100424827 3300005330 Bacteria 980
32 Ga0070690_100622132 3300005330 Unclassified 822
33 Ga0070670_100005255 3300005331 Bacteria 10908
34 Ga0070670_100015474 3300005331 Bacteria 6552
35 Ga0070670_100169780 3300005331 Bacteria 1892
36 Ga0070670_100285072 3300005331 Bacteria 1442
37 Ga0070670_100385025 3300005331 Bacteria 1236
38 Ga0070670_100549754 3300005331 Bacteria 1030
39 Ga0070670_100951485 3300005331 Bacteria 780
40 Ga0070677_10078448 3300005333 Bacteria 1407
41 Ga0070677_10295193 3300005333 Bacteria 821
42 Ga0070677_10352086 3300005333 Bacteria 763
43 Ga0070677_10443069 3300005333 Bacteria 693
44 Ga0068869_100036673 3300005334 Bacteria 3482
45 Ga0068869_100058928 3300005334 Bacteria 2810
46 Ga0068869_100086488 3300005334 Bacteria 2350
47 Ga0068869_100106493 3300005334 Bacteria 2128
48 Ga0068869_100163534 3300005334 Bacteria 1734
49 Ga0068869_100231521 3300005334 Bacteria 1468
50 Ga0068869_100324197 3300005334 Bacteria 1250
51 Ga0068869_100553890 3300005334 Bacteria 966
52 Ga0068869_101464314 3300005334 Unclassified 606
53 Ga0070666_10013142 3300005335 Bacteria 5246
54 Ga0070666_10073096 3300005335 Bacteria 2335
55 Ga0070680_100030579 3300005336 Bacteria 4326
56 Ga0070680_100346120 3300005336 Bacteria 1264
57 Ga0070680_101119374 3300005336 Bacteria 681
58 Ga0070682_100089216 3300005337 Bacteria 2014
59 Ga0070682_100974016 3300005337 Bacteria 702
60 Ga0070682_100978604 3300005337 Bacteria 701
61 Ga0068868_100000543 3300005338 Bacteria 25349
62 Ga0068868_100266290 3300005338 Bacteria 1447
63 Ga0068868_100344639 3300005338 Bacteria 1275
64 Ga0070660_100000647 3300005339 Bacteria 23049
65 Ga0070660_100110890 3300005339 Bacteria 2182
66 Ga0070660_100307379 3300005339 Bacteria 1301
67 Ga0070660_100410270 3300005339 Bacteria 1121
68 Ga0070660_101087677 3300005339 Bacteria 677
69 Ga0070660_101362826 3300005339 Bacteria 602
70 Ga0070689_100004881 3300005340 Bacteria 9104
71 Ga0070689_100035973 3300005340 Bacteria 3786
72 Ga0070689_100102142 3300005340 Bacteria 2271
73 Ga0070689_100103588 3300005340 Bacteria 2255
74 Ga0070689_100129781 3300005340 Bacteria 2020
75 Ga0070689_100399922 3300005340 Bacteria 1161
76 Ga0070689_100429290 3300005340 Bacteria 1121
77 Ga0070689_100964328 3300005340 Unclassified 757
78 Ga0070691_10343897 3300005341 Bacteria 826
79 Ga0070687_100097851 3300005343 Bacteria 1637
80 Ga0070687_100225299 3300005343 Unclassified 1151
81 Ga0070687_100785099 3300005343 Unclassified 673
82 Ga0070661_100000111 3300005344 Bacteria 68066
83 Ga0070661_100184872 3300005344 Bacteria 1587
84 Ga0070661_100633736 3300005344 Unclassified 866
85 Ga0070661_101628530 3300005344 Bacteria 546
86 Ga0070692_10026463 3300005345 Bacteria 2868
87 Ga0070692_10307479 3300005345 Bacteria 970
88 Ga0070692_11108538 3300005345 Unclassified 559
89 Ga0070668_100072114 3300005347 Bacteria 2691
90 Ga0070668_100101573 3300005347 Unclassified 2279
91 Ga0070668_100162676 3300005347 Bacteria 1812
92 Ga0070668_100167301 3300005347 Bacteria 1788
93 Ga0070668_100224006 3300005347 Bacteria 1552
94 Ga0070668_100257219 3300005347 Bacteria 1451
95 Ga0070668_100876369 3300005347 Unclassified 801
96 Ga0070668_100935392 3300005347 Bacteria 776
97 Ga0070669_100002767 3300005353 Bacteria 12650
98 Ga0070669_100145398 3300005353 Bacteria 1831
99 Ga0070669_100395934 3300005353 Unclassified 1129
100 Ga0070669_100423097 3300005353 Unclassified 1093
101 Ga0070669_101074626 3300005353 Bacteria 692
102 Ga0070669_101488746 3300005353 Unclassified 588
103 Ga0070675_100001118 3300005354 Bacteria 19352
104 Ga0070675_100018336 3300005354 Bacteria 5570
105 Ga0070675_100177621 3300005354 Unclassified 1839
106 Ga0070675_100228031 3300005354 Bacteria 1624
107 Ga0070671_100074050 3300005355 Bacteria 2845
108 Ga0070671_100494667 3300005355 Unclassified 1052
109 Ga0070671_100639121 3300005355 Bacteria 921
110 Ga0070674_100009989 3300005356 Bacteria 5715
111 Ga0070674_100242382 3300005356 Bacteria 1412
112 Ga0070674_100259112 3300005356 Bacteria 1369
113 Ga0070674_100845386 3300005356 Bacteria 793
114 Ga0070674_102160360 3300005356 Unclassified 508
115 Ga0070673_100129777 3300005364 Bacteria 2113
116 Ga0070673_100138920 3300005364 Bacteria 2048
117 Ga0070673_100174884 3300005364 Bacteria 1834
118 Ga0070673_100193532 3300005364 Bacteria 1748
119 Ga0070673_100220071 3300005364 Bacteria 1643
120 Ga0070673_100280754 3300005364 Bacteria 1461
121 Ga0070673_100433804 3300005364 Bacteria 1180
122 Ga0070673_101225394 3300005364 Bacteria 703
123 Ga0070688_100017227 3300005365 Bacteria 4144
124 Ga0070688_100027855 3300005365 Bacteria 3367
125 Ga0070688_100031884 3300005365 Bacteria 3173
126 Ga0070688_100320696 3300005365 Bacteria 1126
127 Ga0070688_100416517 3300005365 Bacteria 998
128 Ga0070688_101040424 3300005365 Unclassified 652
129 Ga0070659_100006959 3300005366 Bacteria 8191
130 Ga0070659_100042462 3300005366 Bacteria 3554
131 Ga0070659_100065305 3300005366 Bacteria 2882
132 Ga0070659_100134986 3300005366 Bacteria 2006
133 Ga0070659_100155893 3300005366 Bacteria 1865
134 Ga0070659_100197196 3300005366 Bacteria 1656
135 Ga0070659_100241857 3300005366 Bacteria 1494
136 Ga0070667_100005088 3300005367 Bacteria 11005
137 Ga0070667_100089394 3300005367 Bacteria 2646
138 Ga0070667_100240360 3300005367 Bacteria 1617
139 Ga0070667_100323457 3300005367 Bacteria 1392
140 Ga0070667_100331294 3300005367 Unclassified 1375
141 Ga0070667_100372078 3300005367 Unclassified 1297
142 Ga0070667_101377321 3300005367 Bacteria 661
143 Ga0070667_101487820 3300005367 Unclassified 636
144 Ga0070667_101978532 3300005367 Bacteria 549
145 Ga0070701_10039194 3300005438 Bacteria 2402
146 Ga0070701_10313150 3300005438 Unclassified 969
147 Ga0070705_101309602 3300005440 Unclassified 601
148 Ga0070700_100071081 3300005441 Bacteria 2221
149 Ga0070700_100366148 3300005441 Bacteria 1073
150 Ga0070663_100283988 3300005455 Unclassified 1320
151 Ga0070663_100380496 3300005455 Bacteria 1149
152 Ga0070663_100476845 3300005455 Bacteria 1032
153 Ga0070678_100007620 3300005456 Bacteria 6431
154 Ga0070678_100352482 3300005456 Bacteria 1266
155 Ga0070678_100488904 3300005456 Bacteria 1084
156 Ga0070678_101824856 3300005456 Unclassified 573
157 Ga0070678_101826733 3300005456 Bacteria 573
158 Ga0070678_101880785 3300005456 Unclassified 565
159 Ga0070678_102082329 3300005456 Unclassified 537
160 Ga0070662_100006327 3300005457 Bacteria 7627
161 Ga0070662_100016061 3300005457 Bacteria 5022
162 Ga0070662_100030265 3300005457 Bacteria 3786
163 Ga0070681_10103549 3300005458 Bacteria 2790
164 Ga0070681_10262077 3300005458 Bacteria 1640
165 Ga0070681_10265667 3300005458 Bacteria 1627
166 Ga0068867_100007969 3300005459 Bacteria 7483
167 Ga0068867_100014817 3300005459 Bacteria 5528
168 Ga0068867_100018800 3300005459 Bacteria 4916
169 Ga0068867_100070063 3300005459 Unclassified 2620
170 Ga0068867_100140807 3300005459 Bacteria 1885
171 Ga0068867_100196427 3300005459 Bacteria 1613
172 Ga0068867_101385560 3300005459 Unclassified 652
173 Ga0070685_10011831 3300005466 Bacteria 4575
174 Ga0070685_10013277 3300005466 Bacteria 4342
175 Ga0070685_10043005 3300005466 Bacteria 2581
176 Ga0070685_10044166 3300005466 Unclassified 2551
177 Ga0070685_10094402 3300005466 Bacteria 1817
178 Ga0070685_10193721 3300005466 Bacteria 1317
179 Ga0070685_10375101 3300005466 Bacteria 979
180 Ga0070706_101110149 3300005467 Unclassified 728
181 Ga0070698_100001074 3300005471 Bacteria 30038
182 Ga0070698_100009628 3300005471 Bacteria 10336
183 Ga0070698_100015207 3300005471 Bacteria 8137
184 Ga0070698_100182933 3300005471 Bacteria 2034
185 Ga0070699_100068012 3300005518 Bacteria 3093
186 Ga0070679_100001516 3300005530 Bacteria 20680
187 Ga0070679_100125043 3300005530 Bacteria 2554
188 Ga0070679_100244490 3300005530 Bacteria 1751
189 Ga0070679_101145985 3300005530 Bacteria 722
190 Ga0070679_101301507 3300005530 Unclassified 672
191 Ga0070684_100012277 3300005535 Bacteria 6860
192 Ga0070684_100119148 3300005535 Bacteria 2373
193 Ga0070684_101110014 3300005535 Unclassified 743
194 Ga0070697_100241043 3300005536 Bacteria 1544
195 Ga0068853_100014798 3300005539 Bacteria 6403
196 Ga0068853_100027463 3300005539 Bacteria 4781
197 Ga0068853_100228322 3300005539 Unclassified 1702
198 Ga0068853_100319566 3300005539 Bacteria 1439
199 Ga0068853_100377403 3300005539 Bacteria 1323
200 Ga0068853_100409159 3300005539 Bacteria 1271
201 Ga0068853_100515092 3300005539 Unclassified 1130
202 Ga0068853_100597028 3300005539 Bacteria 1048
203 Ga0068853_101002797 3300005539 Bacteria 804
204 Ga0068853_101069712 3300005539 Bacteria 778
205 Ga0070672_100036130 3300005543 Bacteria 3762
206 Ga0070672_100255414 3300005543 Bacteria 1477
207 Ga0070672_101665980 3300005543 Unclassified 573
208 Ga0070672_102131282 3300005543 Bacteria 505
209 Ga0070686_100004001 3300005544 Bacteria 8104
210 Ga0070686_100121073 3300005544 Bacteria 1797
211 Ga0070686_100641040 3300005544 Bacteria 841
212 Ga0070686_101911460 3300005544 Bacteria 507
213 Ga0070695_100188470 3300005545 Bacteria 1466
214 Ga0070695_101604237 3300005545 Unclassified 543
215 Ga0070665_100958532 3300005548 Bacteria 868
216 Ga0070704_100580009 3300005549 Unclassified 983
217 Ga0070704_101042199 3300005549 Unclassified 741
218 Ga0068855_100000145 3300005563 Bacteria 91452
219 Ga0068855_100003314 3300005563 Bacteria 19707
220 Ga0068855_100094911 3300005563 Bacteria 3439
221 Ga0068855_100125794 3300005563 Bacteria 2931
222 Ga0068855_100140061 3300005563 Bacteria 2758
223 Ga0068855_100146818 3300005563 Bacteria 2684
224 Ga0068855_100352365 3300005563 Bacteria 1621
225 Ga0068855_100933037 3300005563 Bacteria 915
226 Ga0068855_101231581 3300005563 Unclassified 777
227 Ga0070664_100000243 3300005564 Bacteria 39166
228 Ga0070664_100278400 3300005564 Bacteria 1508
229 Ga0070664_100607112 3300005564 Unclassified 1015
230 Ga0070664_101354238 3300005564 Bacteria 672
231 Ga0068857_100001483 3300005577 Bacteria 18682
232 Ga0068857_100002097 3300005577 Bacteria 16192
233 Ga0068857_100017217 3300005577 Bacteria 6332
234 Ga0068857_100097876 3300005577 Bacteria 2631
235 Ga0068857_100220722 3300005577 Bacteria 1731
236 Ga0068857_100295744 3300005577 Bacteria 1492
237 Ga0068857_100343486 3300005577 Bacteria 1381
238 Ga0068857_100355853 3300005577 Bacteria 1356
239 Ga0068857_100365443 3300005577 Bacteria 1338
240 Ga0068857_100667668 3300005577 Unclassified 986
241 Ga0068857_100778807 3300005577 Unclassified 912
242 Ga0068857_101203789 3300005577 Unclassified 733
243 Ga0068857_101393431 3300005577 Bacteria 682
244 Ga0068857_102091613 3300005577 Unclassified 555
245 Ga0068857_102247341 3300005577 Bacteria 535
246 Ga0068854_100031969 3300005578 Bacteria 3659
247 Ga0068854_100074627 3300005578 Bacteria 2488
248 Ga0068854_100114212 3300005578 Bacteria 2041
249 Ga0068854_100317444 3300005578 Bacteria 1265
250 Ga0068854_100340479 3300005578 Bacteria 1225
251 Ga0068854_101780553 3300005578 Bacteria 564
252 Ga0068856_100023593 3300005614 Bacteria 5982
253 Ga0068856_100044165 3300005614 Bacteria 4384
254 Ga0068856_100205533 3300005614 Bacteria 1984
255 Ga0068856_100335347 3300005614 Bacteria 1530
256 Ga0068856_101690405 3300005614 Bacteria 645
257 Ga0068852_100002726 3300005616 Bacteria 12214
258 Ga0068852_100026651 3300005616 Bacteria 4703
259 Ga0068852_100235284 3300005616 Bacteria 1748
260 Ga0068852_100382901 3300005616 Bacteria 1380
261 Ga0068852_100653796 3300005616 Bacteria 1059
262 Ga0068852_100677826 3300005616 Unclassified 1040
263 Ga0068852_101185278 3300005616 Bacteria 785
264 Ga0068852_102072628 3300005616 Unclassified 591
265 Ga0068859_100016081 3300005617 Bacteria 7517
266 Ga0068859_100059890 3300005617 Bacteria 3836
267 Ga0068859_100166408 3300005617 Bacteria 2285
268 Ga0068859_100186862 3300005617 Bacteria 2156
269 Ga0068859_100200658 3300005617 Bacteria 2079
270 Ga0068859_100339164 3300005617 Bacteria 1597
271 Ga0068859_100531688 3300005617 Bacteria 1270
272 Ga0068859_101431419 3300005617 Bacteria 762
273 Ga0068859_101789151 3300005617 Unclassified 679
274 Ga0068859_103052632 3300005617 Bacteria 511
275 Ga0068864_100006400 3300005618 Bacteria 9651
276 Ga0068864_100124308 3300005618 Unclassified 2310
277 Ga0068864_100237825 3300005618 Bacteria 1686
278 Ga0068864_100338587 3300005618 Bacteria 1417
279 Ga0068864_100360431 3300005618 Bacteria 1374
280 Ga0068864_100390057 3300005618 Bacteria 1321
281 Ga0068866_10029543 3300005718 Bacteria 2623
282 Ga0068866_10113877 3300005718 Bacteria 1513
283 Ga0068866_10217925 3300005718 Bacteria 1150
284 Ga0068861_100007430 3300005719 Bacteria 7511
285 Ga0068861_100052573 3300005719 Unclassified 3096
286 Ga0068861_100157247 3300005719 Bacteria 1871
287 Ga0068861_100286841 3300005719 Bacteria 1420
288 Ga0068861_100346859 3300005719 Bacteria 1301
289 Ga0068861_100502652 3300005719 Bacteria 1096
290 Ga0068861_101125681 3300005719 Unclassified 756
291 Ga0068861_101249133 3300005719 Bacteria 720
292 Ga0068851_10567664 3300005834 Bacteria 687
293 Ga0068870_10009968 3300005840 Bacteria 4343
294 Ga0068870_10211602 3300005840 Unclassified 1181
295 Ga0068863_100014068 3300005841 Bacteria 7710
296 Ga0068863_100020130 3300005841 Bacteria 6383
297 Ga0068863_100063616 3300005841 Bacteria 3489
298 Ga0068863_100311080 3300005841 Bacteria 1529
299 Ga0068863_100473288 3300005841 Bacteria 1231
300 Ga0068863_100986907 3300005841 Bacteria 845
301 Ga0068863_101277784 3300005841 Unclassified 741
302 Ga0068863_101457457 3300005841 Unclassified 693
303 Ga0068863_101834240 3300005841 Bacteria 616
304 Ga0068858_100056174 3300005842 Bacteria 3639
305 Ga0068858_100261028 3300005842 Bacteria 1646
306 Ga0068858_101039195 3300005842 Bacteria 803
307 Ga0068858_102005184 3300005842 Unclassified 572
308 Ga0068860_100038000 3300005843 Bacteria 4607
309 Ga0068860_100364160 3300005843 Bacteria 1425
310 Ga0068860_100364671 3300005843 Bacteria 1424
311 Ga0068860_100580204 3300005843 Unclassified 1125
312 Ga0068860_100593590 3300005843 Bacteria 1112
313 Ga0068860_100655051 3300005843 Bacteria 1058
314 Ga0068860_100838760 3300005843 Unclassified 933
315 Ga0068860_100865714 3300005843 Bacteria 919
316 Ga0068860_101150488 3300005843 Bacteria 796
317 Ga0068860_101881403 3300005843 Bacteria 620
318 Ga0068860_102824736 3300005843 Bacteria 503
319 Ga0068862_100114924 3300005844 Bacteria 2366
320 Ga0068862_100195821 3300005844 Bacteria 1820
321 Ga0068862_100196777 3300005844 Bacteria 1816
322 Ga0068862_100197710 3300005844 Bacteria 1811
323 Ga0068862_100310651 3300005844 Unclassified 1453
324 Ga0068862_100319909 3300005844 Bacteria 1432
325 Ga0068862_101092915 3300005844 Bacteria 792
326 Ga0068862_101368253 3300005844 Unclassified 710
327 Ga0068862_101461805 3300005844 Bacteria 688
328 Ga0068862_101519662 3300005844 Bacteria 675
329 Ga0081539_10120430 3300005985 Bacteria 1304
330 Ga0070715_10027365 3300006163 Bacteria 2278
331 Ga0070715_10046476 3300006163 Bacteria 1846
332 Ga0075366_10183517 3300006195 Bacteria 1271
333 Ga0097621_100264271 3300006237 Bacteria 1510
334 Ga0097621_100614270 3300006237 Bacteria 995
335 Ga0097621_101616740 3300006237 Unclassified 616
336 Ga0097621_102004036 3300006237 Bacteria 553
337 Ga0068871_100014874 3300006358 Bacteria 5813
338 Ga0068871_100105996 3300006358 Bacteria 2359
339 Ga0068871_100285359 3300006358 Bacteria 1445
340 Ga0068871_100909023 3300006358 Unclassified 816
341 Ga0068871_100952134 3300006358 Bacteria 798
342 Ga0075428_100012646 3300006844 Bacteria 9385
343 Ga0075428_100416303 3300006844 Unclassified 1440
344 Ga0075428_100452833 3300006844 Bacteria 1375
345 Ga0075428_100604721 3300006844 Bacteria 1171
346 Ga0075428_101884212 3300006844 Unclassified 621
347 Ga0075430_100044970 3300006846 Bacteria 3732
348 Ga0075431_100038737 3300006847 Bacteria 4910
349 Ga0075433_11430664 3300006852 Bacteria 598
350 Ga0075434_100250681 3300006871 Bacteria 1790
351 Ga0075429_100035605 3300006880 Bacteria 4330
352 Ga0075429_100086034 3300006880 Bacteria 2740
353 Ga0068865_100267382 3300006881 Bacteria 1356
354 Ga0068865_100456138 3300006881 Bacteria 1058
355 Ga0068865_101624266 3300006881 Bacteria 581
356 Ga0097620_100016082 3300006931 Bacteria 7517
357 Ga0097620_100059889 3300006931 Bacteria 3836
358 Ga0097620_100166414 3300006931 Bacteria 2285
359 Ga0097620_100186869 3300006931 Bacteria 2156
360 Ga0097620_100200656 3300006931 Bacteria 2079
361 Ga0097620_100339163 3300006931 Bacteria 1597
362 Ga0097620_100531691 3300006931 Bacteria 1270
363 Ga0097620_101431425 3300006931 Bacteria 762
364 Ga0097620_101789168 3300006931 Unclassified 679
365 Ga0097620_103051072 3300006931 Bacteria 511
366 Ga0105240_10008412 3300009093 Bacteria 14764
367 Ga0105240_10013970 3300009093 Bacteria 10992
368 Ga0105240_10048294 3300009093 Bacteria 5381
369 Ga0105240_10158930 3300009093 Bacteria 2686
370 Ga0111539_10140833 3300009094 Bacteria 2823
371 Ga0111539_10161304 3300009094 Bacteria 2622
372 Ga0111539_10478553 3300009094 Bacteria 1450
373 Ga0111539_10926299 3300009094 Bacteria 1013
374 Ga0111539_12108073 3300009094 Bacteria 654
375 Ga0111539_12418412 3300009094 Bacteria 609
376 Ga0105247_10005318 3300009101 Bacteria 8116
377 Ga0105247_10257803 3300009101 Unclassified 1194
378 Ga0105247_10273914 3300009101 Bacteria 1162
379 Ga0105247_10497523 3300009101 Unclassified 888
380 Ga0114129_10027834 3300009147 Bacteria 8005
381 Ga0114129_10047706 3300009147 Bacteria 6017
382 Ga0114129_13240719 3300009147 Bacteria 528
383 Ga0105243_10369475 3300009148 Bacteria 1323
384 Ga0105243_10507510 3300009148 Bacteria 1144
385 Ga0105241_10000460 3300009174 Bacteria 30681
386 Ga0105241_10416031 3300009174 Unclassified 1182
387 Ga0105241_10456955 3300009174 Bacteria 1131
388 Ga0105241_10471635 3300009174 Bacteria 1114
389 Ga0105241_10521220 3300009174 Unclassified 1063
390 Ga0105241_12507995 3300009174 Bacteria 516
391 Ga0105242_10036767 3300009176 Bacteria 3930
392 Ga0105242_10038912 3300009176 Bacteria 3827
393 Ga0105242_10041913 3300009176 Bacteria 3695
394 Ga0105242_10057460 3300009176 Bacteria 3187
395 Ga0105242_10078592 3300009176 Bacteria 2754
396 Ga0105242_10377044 3300009176 Bacteria 1317
397 Ga0105242_10554226 3300009176 Bacteria 1103
398 Ga0105242_11117850 3300009176 Bacteria 803
399 Ga0105242_11272156 3300009176 Bacteria 758
400 Ga0105242_13050904 3300009176 Bacteria 519
401 Ga0105248_10337014 3300009177 Bacteria 1698
402 Ga0105248_10405758 3300009177 Unclassified 1534
403 Ga0105237_10009688 3300009545 Bacteria 10307
404 Ga0105238_10000488 3300009551 Bacteria 41712
405 Ga0105238_10019337 3300009551 Bacteria 6936
406 Ga0105238_10021278 3300009551 Bacteria 6610
407 Ga0105238_11060670 3300009551 Bacteria 832
408 Ga0105249_10001044 3300009553 Bacteria 24495
409 Ga0105249_10003251 3300009553 Bacteria 14076
410 Ga0105249_10008489 3300009553 Bacteria 8951
411 Ga0105249_10021033 3300009553 Bacteria 5840
412 Ga0105249_10031881 3300009553 Bacteria 4768
413 Ga0105249_10155331 3300009553 Bacteria 2206
414 Ga0105249_10350109 3300009553 Bacteria 1496
415 Ga0105249_10438787 3300009553 Unclassified 1343
416 Ga0105249_10560999 3300009553 Bacteria 1194
417 Ga0105249_10727350 3300009553 Bacteria 1054
418 Ga0105249_10766227 3300009553 Unclassified 1028
419 Ga0105249_11166446 3300009553 Unclassified 841
420 Ga0105249_11556370 3300009553 Unclassified 733
421 Ga0105239_10032094 3300010375 Bacteria 5771
422 Ga0105239_10084716 3300010375 Bacteria 3492
423 Ga0105246_10176787 3300011119 Bacteria 1640
424 Ga0105246_10178053 3300011119 Bacteria 1635
425 Ga0105246_10500332 3300011119 Bacteria 1032
426 Ga0157373_10027634 3300013100 Bacteria 4093
427 Ga0157373_10138537 3300013100 Bacteria 1711
428 Ga0157373_10142570 3300013100 Bacteria 1685
429 Ga0157373_10172867 3300013100 Bacteria 1520
430 Ga0157373_10287471 3300013100 Bacteria 1166
431 Ga0157373_10527391 3300013100 Bacteria 855
432 Ga0157373_10904612 3300013100 Unclassified 655
433 Ga0157373_11071155 3300013100 Unclassified 604
434 Ga0157371_10000868 3300013102 Bacteria 34292
435 Ga0157371_10005115 3300013102 Bacteria 11187
436 Ga0157371_10039547 3300013102 Bacteria 3372
437 Ga0157371_10162582 3300013102 Bacteria 1594
438 Ga0157371_10183168 3300013102 Bacteria 1498
439 Ga0157371_10433342 3300013102 Bacteria 965
440 Ga0157371_10457951 3300013102 Bacteria 938
441 Ga0157371_10651042 3300013102 Unclassified 786
442 Ga0157371_10833826 3300013102 Unclassified 696
443 Ga0157371_10907198 3300013102 Bacteria 668
444 Ga0157370_10000313 3300013104 Bacteria 60838
445 Ga0157370_10000628 3300013104 Bacteria 43950
446 Ga0157370_10034855 3300013104 Bacteria 4897
447 Ga0157370_10045234 3300013104 Bacteria 4224
448 Ga0157370_10191488 3300013104 Bacteria 1898
449 Ga0157370_10453106 3300013104 Bacteria 1179
450 Ga0157370_10620036 3300013104 Unclassified 990
451 Ga0157370_10700953 3300013104 Bacteria 924
452 Ga0157369_10008510 3300013105 Bacteria 11765
453 Ga0157369_10014518 3300013105 Bacteria 8888
454 Ga0157369_10025886 3300013105 Bacteria 6509
455 Ga0157369_10259455 3300013105 Bacteria 1812
456 Ga0157374_10007342 3300013296 Bacteria 9400
457 Ga0157374_10007442 3300013296 Bacteria 9340
458 Ga0157374_10050953 3300013296 Bacteria 3851
459 Ga0157374_10191600 3300013296 Bacteria 2000
460 Ga0157374_10513022 3300013296 Bacteria 1204
461 Ga0157374_10862023 3300013296 Bacteria 923
462 Ga0157378_10177225 3300013297 Bacteria 2003
463 Ga0157378_10403637 3300013297 Bacteria 1347
464 Ga0157378_10483881 3300013297 Bacteria 1234
465 Ga0157378_11368833 3300013297 Bacteria 750
466 Ga0157378_12396900 3300013297 Bacteria 579
467 Ga0157378_13170480 3300013297 Unclassified 511
468 Ga0163162_10002193 3300013306 Bacteria 18320
469 Ga0163162_10019306 3300013306 Bacteria 6684
470 Ga0163162_10039481 3300013306 Bacteria 4718
471 Ga0163162_10046225 3300013306 Bacteria 4363
472 Ga0163162_10058280 3300013306 Bacteria 3891
473 Ga0163162_10188340 3300013306 Bacteria 2191
474 Ga0163162_10247492 3300013306 Bacteria 1914
475 Ga0163162_10282674 3300013306 Bacteria 1791
476 Ga0163162_10425596 3300013306 Bacteria 1460
477 Ga0163162_10840113 3300013306 Bacteria 1034
478 Ga0163162_11579920 3300013306 Unclassified 748
479 Ga0163162_12223275 3300013306 Bacteria 630
480 Ga0163162_12314021 3300013306 Bacteria 617
481 Ga0157372_10001983 3300013307 Bacteria 22252
482 Ga0157372_10010278 3300013307 Bacteria 9942
483 Ga0157372_10017315 3300013307 Bacteria 7736
484 Ga0157372_10094848 3300013307 Bacteria 3399
485 Ga0157372_10101634 3300013307 Bacteria 3282
486 Ga0157372_10126077 3300013307 Unclassified 2944
487 Ga0157372_10214413 3300013307 Bacteria 2231
488 Ga0157372_10470989 3300013307 Bacteria 1464
489 Ga0157372_10479674 3300013307 Bacteria 1450
490 Ga0157372_10505769 3300013307 Bacteria 1409
491 Ga0157372_10666193 3300013307 Bacteria 1211
492 Ga0157372_13483023 3300013307 Bacteria 500
493 Ga0157375_10007261 3300013308 Bacteria 9694
494 Ga0157375_10011768 3300013308 Bacteria 7737
495 Ga0157375_10023657 3300013308 Bacteria 5673
496 Ga0157375_10076285 3300013308 Bacteria 3378
497 Ga0157375_10087559 3300013308 Bacteria 3167
498 Ga0157375_10097502 3300013308 Bacteria 3014
499 Ga0157375_10970445 3300013308 Bacteria 991
500 Ga0157375_12224419 3300013308 Unclassified 653
501 Ga0157375_12273375 3300013308 Bacteria 646
502 Ga0157375_12829655 3300013308 Unclassified 580
503 Ga0157375_13671857 3300013308 Bacteria 510
504 Ga0163163_10005376 3300014325 Bacteria 11069
505 Ga0163163_10042028 3300014325 Bacteria 4474
506 Ga0163163_10061006 3300014325 Bacteria 3736
507 Ga0163163_10139040 3300014325 Bacteria 2470
508 Ga0163163_10185645 3300014325 Bacteria 2127
509 Ga0163163_10188446 3300014325 Bacteria 2111
510 Ga0163163_10302420 3300014325 Bacteria 1652
511 Ga0163163_11429461 3300014325 Bacteria 753
512 Ga0163163_12887016 3300014325 Unclassified 536
513 Ga0157380_10018730 3300014326 Bacteria 5146
514 Ga0157380_10027818 3300014326 Bacteria 4304
515 Ga0157380_10266159 3300014326 Bacteria 1560
516 Ga0157380_10414794 3300014326 Unclassified 1282
517 Ga0157380_10594697 3300014326 Unclassified 1093
518 Ga0157380_10739259 3300014326 Bacteria 994
519 Ga0157380_11579148 3300014326 Unclassified 711
520 Ga0157380_11894687 3300014326 Unclassified 657
521 Ga0157380_12412174 3300014326 Bacteria 591
522 Ga0157377_10000678 3300014745 Bacteria 14088
523 Ga0157377_10008049 3300014745 Bacteria 5126
524 Ga0157377_10010005 3300014745 Bacteria 4678
525 Ga0157377_10238428 3300014745 Unclassified 1173
526 Ga0157377_10264540 3300014745 Bacteria 1120
527 Ga0157377_10365055 3300014745 Bacteria 973
528 Ga0157377_10461175 3300014745 Bacteria 879
529 Ga0157377_10484089 3300014745 Bacteria 861
530 Ga0157377_10684990 3300014745 Bacteria 742
531 Ga0157379_10085475 3300014968 Bacteria 2827
532 Ga0157379_10246758 3300014968 Bacteria 1620
533 Ga0157379_10605657 3300014968 Bacteria 1023
534 Ga0157379_10667471 3300014968 Bacteria 974
535 Ga0157379_10748182 3300014968 Bacteria 920
536 Ga0157379_10833434 3300014968 Bacteria 872
537 Ga0157376_10006599 3300014969 Bacteria 8210
538 Ga0157376_10171063 3300014969 Bacteria 1979
539 Ga0157376_10661862 3300014969 Bacteria 1046
540 Ga0157376_11339872 3300014969 Bacteria 746
541 Ga0163161_10006695 3300017792 Bacteria 7974
542 Ga0163161_10160993 3300017792 Bacteria 1711
543 Ga0163161_10241650 3300017792 Bacteria 1404
544 Ga0163161_10303358 3300017792 Bacteria 1258
545 Ga0163161_10630074 3300017792 Unclassified 887
546 Ga0213876_10093846 3300021384 Bacteria 1590
547 Ga0207697_10015840 3300025315 Bacteria 3110
548 Ga0207697_10055750 3300025315 Bacteria 1639
549 Ga0207642_10368139 3300025899 Bacteria 852
550 Ga0207642_10997564 3300025899 Unclassified 539
551 Ga0207710_10008757 3300025900 Unclassified 4263
552 Ga0207680_10041487 3300025903 Bacteria 2685
553 Ga0207680_10719785 3300025903 Bacteria 715
554 Ga0207647_10013169 3300025904 Bacteria 5745
555 Ga0207647_10057441 3300025904 Bacteria 2386
556 Ga0207647_10062815 3300025904 Bacteria 2262
557 Ga0207685_10088628 3300025905 Bacteria 1297
558 Ga0207685_10375486 3300025905 Bacteria 723
559 Ga0207645_10024141 3300025907 Bacteria 3945
560 Ga0207645_10034576 3300025907 Bacteria 3247
561 Ga0207645_10273779 3300025907 Bacteria 1120
562 Ga0207643_10009087 3300025908 Bacteria 5337
563 Ga0207643_10023317 3300025908 Bacteria 3412
564 Ga0207643_10042085 3300025908 Bacteria 2575
565 Ga0207705_10002807 3300025909 Bacteria 13316
566 Ga0207705_10026743 3300025909 Bacteria 4112
567 Ga0207705_10071547 3300025909 Bacteria 2514
568 Ga0207705_10084511 3300025909 Unclassified 2317
569 Ga0207705_11166062 3300025909 Bacteria 592
570 Ga0207684_11653904 3300025910 Unclassified 517
571 Ga0207654_10069535 3300025911 Unclassified 2087
572 Ga0207654_10869588 3300025911 Bacteria 653
573 Ga0207707_10059337 3300025912 Bacteria 3329
574 Ga0207707_10194289 3300025912 Bacteria 1770
575 Ga0207707_10370432 3300025912 Bacteria 1232
576 Ga0207707_10795303 3300025912 Bacteria 788
577 Ga0207695_10001387 3300025913 Bacteria 40927
578 Ga0207695_10038130 3300025913 Bacteria 5178
579 Ga0207695_10052655 3300025913 Bacteria 4262
580 Ga0207695_11463290 3300025913 Bacteria 563
581 Ga0207671_10007829 3300025914 Bacteria 9188
582 Ga0207660_10011907 3300025917 Bacteria 5675
583 Ga0207660_10119703 3300025917 Bacteria 1993
584 Ga0207660_10309496 3300025917 Bacteria 1259
585 Ga0207660_10491296 3300025917 Bacteria 995
586 Ga0207662_10003292 3300025918 Bacteria 8290
587 Ga0207662_10059491 3300025918 Bacteria 2290
588 Ga0207662_10073654 3300025918 Bacteria 2072
589 Ga0207657_10005023 3300025919 Bacteria 13884
590 Ga0207657_10029703 3300025919 Bacteria 4971
591 Ga0207657_10132123 3300025919 Bacteria 2045
592 Ga0207657_10186480 3300025919 Bacteria 1675
593 Ga0207657_10312403 3300025919 Bacteria 1244
594 Ga0207657_10812087 3300025919 Bacteria 723
595 Ga0207649_10019365 3300025920 Bacteria 3888
596 Ga0207649_10264292 3300025920 Bacteria 1245
597 Ga0207649_10337821 3300025920 Unclassified 1111
598 Ga0207649_10428886 3300025920 Bacteria 994
599 Ga0207652_10000187 3300025921 Bacteria 65282
600 Ga0207652_10000198 3300025921 Bacteria 63388
601 Ga0207652_10029289 3300025921 Bacteria 4602
602 Ga0207652_10115311 3300025921 Bacteria 2386
603 Ga0207652_11844939 3300025921 Bacteria 510
604 Ga0207681_10002024 3300025923 Bacteria 13028
605 Ga0207681_10165742 3300025923 Bacteria 1670
606 Ga0207681_10187394 3300025923 Bacteria 1580
607 Ga0207681_10448510 3300025923 Bacteria 1049
608 Ga0207681_10767913 3300025923 Bacteria 804
609 Ga0207681_11423202 3300025923 Bacteria 582
610 Ga0207694_10002191 3300025924 Bacteria 16050
611 Ga0207694_10028517 3300025924 Bacteria 4257
612 Ga0207694_11570389 3300025924 Unclassified 555
613 Ga0207650_10023273 3300025925 Bacteria 4391
614 Ga0207650_10039444 3300025925 Bacteria 3451
615 Ga0207650_10145425 3300025925 Bacteria 1867
616 Ga0207650_10237979 3300025925 Bacteria 1471
617 Ga0207659_10022937 3300025926 Bacteria 4162
618 Ga0207659_10151721 3300025926 Bacteria 1810
619 Ga0207659_10271986 3300025926 Bacteria 1382
620 Ga0207659_10571682 3300025926 Bacteria 962
621 Ga0207644_10093875 3300025931 Unclassified 2241
622 Ga0207644_10227264 3300025931 Bacteria 1482
623 Ga0207690_10003750 3300025932 Bacteria 9010
624 Ga0207690_10030767 3300025932 Bacteria 3428
625 Ga0207690_10048458 3300025932 Bacteria 2825
626 Ga0207690_10089507 3300025932 Bacteria 2171
627 Ga0207690_10143848 3300025932 Bacteria 1760
628 Ga0207690_10604401 3300025932 Bacteria 895
629 Ga0207706_10005261 3300025933 Bacteria 12070
630 Ga0207706_10020449 3300025933 Bacteria 5951
631 Ga0207706_10020556 3300025933 Bacteria 5933
632 Ga0207706_10375299 3300025933 Bacteria 1235
633 Ga0207706_11076955 3300025933 Bacteria 672
634 Ga0207686_10001189 3300025934 Bacteria 15075
635 Ga0207686_10012292 3300025934 Bacteria 4705
636 Ga0207686_10018765 3300025934 Bacteria 3920
637 Ga0207686_10040292 3300025934 Bacteria 2839
638 Ga0207686_10357787 3300025934 Unclassified 1101
639 Ga0207670_10004279 3300025936 Bacteria 7663
640 Ga0207670_10042128 3300025936 Bacteria 3006
641 Ga0207670_10080757 3300025936 Bacteria 2274
642 Ga0207670_10094296 3300025936 Unclassified 2123
643 Ga0207670_10137271 3300025936 Bacteria 1799
644 Ga0207670_10426793 3300025936 Bacteria 1065
645 Ga0207670_10501171 3300025936 Unclassified 986
646 Ga0207670_11743416 3300025936 Bacteria 530
647 Ga0207669_10019812 3300025937 Bacteria 3512
648 Ga0207669_10535287 3300025937 Bacteria 943
649 Ga0207691_10017962 3300025940 Bacteria 6700
650 Ga0207691_10554754 3300025940 Bacteria 974
651 Ga0207691_10774475 3300025940 Bacteria 807
652 Ga0207711_10480404 3300025941 Bacteria 1158
653 Ga0207711_10561142 3300025941 Bacteria 1065
654 Ga0207689_10002851 3300025942 Bacteria 15954
655 Ga0207689_10007932 3300025942 Bacteria 9273
656 Ga0207689_10009313 3300025942 Bacteria 8492
657 Ga0207689_10023684 3300025942 Bacteria 5149
658 Ga0207689_10103461 3300025942 Unclassified 2340
659 Ga0207689_10236602 3300025942 Bacteria 1509
660 Ga0207689_10505107 3300025942 Bacteria 1013
661 Ga0207689_11516867 3300025942 Bacteria 559
662 Ga0207661_10005152 3300025944 Bacteria 9184
663 Ga0207661_10034029 3300025944 Bacteria 3959
664 Ga0207661_10144280 3300025944 Bacteria 2052
665 Ga0207661_10169413 3300025944 Bacteria 1900
666 Ga0207661_10190896 3300025944 Bacteria 1796
667 Ga0207661_10286707 3300025944 Bacteria 1473
668 Ga0207661_10707131 3300025944 Bacteria 927
669 Ga0207679_10000091 3300025945 Bacteria 78725
670 Ga0207679_10018927 3300025945 Bacteria 4621
671 Ga0207679_10138763 3300025945 Bacteria 1962
672 Ga0207679_10240570 3300025945 Bacteria 1533
673 Ga0207679_10445790 3300025945 Bacteria 1147
674 Ga0207679_11226232 3300025945 Unclassified 688
675 Ga0207667_10000492 3300025949 Bacteria 52207
676 Ga0207667_10001760 3300025949 Bacteria 27253
677 Ga0207667_10027086 3300025949 Bacteria 6249
678 Ga0207667_10098972 3300025949 Bacteria 3008
679 Ga0207667_10424044 3300025949 Bacteria 1353
680 Ga0207667_10597744 3300025949 Unclassified 1113
681 Ga0207651_10111794 3300025960 Bacteria 2052
682 Ga0207651_10182526 3300025960 Unclassified 1666
683 Ga0207651_10184834 3300025960 Bacteria 1657
684 Ga0207651_10399407 3300025960 Bacteria 1169
685 Ga0207651_10405797 3300025960 Bacteria 1160
686 Ga0207651_10762505 3300025960 Bacteria 856
687 Ga0207651_10764818 3300025960 Unclassified 854
688 Ga0207651_11391031 3300025960 Bacteria 631
689 Ga0207712_10001457 3300025961 Bacteria 16141
690 Ga0207712_10033161 3300025961 Bacteria 3490
691 Ga0207712_10112787 3300025961 Bacteria 2042
692 Ga0207712_10318529 3300025961 Bacteria 1282
693 Ga0207712_10370752 3300025961 Bacteria 1195
694 Ga0207712_10450586 3300025961 Bacteria 1091
695 Ga0207712_11588561 3300025961 Unclassified 586
696 Ga0207668_10094208 3300025972 Bacteria 2208
697 Ga0207668_10098112 3300025972 Unclassified 2170
698 Ga0207668_10141362 3300025972 Bacteria 1852
699 Ga0207668_10171258 3300025972 Bacteria 1703
700 Ga0207668_10234022 3300025972 Bacteria 1483
701 Ga0207668_11869941 3300025972 Unclassified 541
702 Ga0207640_10181913 3300025981 Bacteria 1577
703 Ga0207640_10365833 3300025981 Bacteria 1164
704 Ga0207640_10445036 3300025981 Bacteria 1066
705 Ga0207640_10843356 3300025981 Bacteria 797
706 Ga0207640_12067380 3300025981 Bacteria 516
707 Ga0207658_10293330 3300025986 Unclassified 1398
708 Ga0207658_10581807 3300025986 Bacteria 1004
709 Ga0207658_10797309 3300025986 Bacteria 857
710 Ga0207658_11803949 3300025986 Bacteria 558
711 Ga0207658_11875546 3300025986 Bacteria 546
712 Ga0207677_10043771 3300026023 Bacteria 2978
713 Ga0207677_10091214 3300026023 Bacteria 2216
714 Ga0207677_10142611 3300026023 Bacteria 1837
715 Ga0207677_10608853 3300026023 Bacteria 959
716 Ga0207677_10925223 3300026023 Bacteria 787
717 Ga0207677_11197777 3300026023 Bacteria 695
718 Ga0207703_10615323 3300026035 Bacteria 1028
719 Ga0207703_10822432 3300026035 Bacteria 887
720 Ga0207703_10872006 3300026035 Bacteria 861
721 Ga0207703_11126320 3300026035 Bacteria 754
722 Ga0207639_10019684 3300026041 Bacteria 4818
723 Ga0207639_10073993 3300026041 Bacteria 2673
724 Ga0207639_10092796 3300026041 Bacteria 2420
725 Ga0207639_10115198 3300026041 Bacteria 2198
726 Ga0207639_10330791 3300026041 Unclassified 1355
727 Ga0207639_10458427 3300026041 Bacteria 1158
728 Ga0207639_10536754 3300026041 Bacteria 1073
729 Ga0207639_10553409 3300026041 Bacteria 1056
730 Ga0207639_10900829 3300026041 Bacteria 827
731 Ga0207639_11027077 3300026041 Unclassified 772
732 Ga0207678_10018070 3300026067 Bacteria 6193
733 Ga0207678_10025516 3300026067 Bacteria 5159
734 Ga0207708_10017202 3300026075 Bacteria 5442
735 Ga0207708_10147513 3300026075 Bacteria 1850
736 Ga0207708_10190030 3300026075 Bacteria 1634
737 Ga0207708_10514081 3300026075 Bacteria 1005
738 Ga0207708_11256877 3300026075 Unclassified 648
739 Ga0207702_10007374 3300026078 Bacteria 9391
740 Ga0207641_10002685 3300026088 Bacteria 16230
741 Ga0207641_10014674 3300026088 Bacteria 6424
742 Ga0207641_10021780 3300026088 Bacteria 5268
743 Ga0207641_10123766 3300026088 Unclassified 2312
744 Ga0207641_10144518 3300026088 Bacteria 2150
745 Ga0207641_10205387 3300026088 Bacteria 1819
746 Ga0207641_10409238 3300026088 Bacteria 1304
747 Ga0207641_11370123 3300026088 Unclassified 708
748 Ga0207648_10008642 3300026089 Bacteria 9835
749 Ga0207648_10043835 3300026089 Bacteria 3927
750 Ga0207648_10063299 3300026089 Bacteria 3224
751 Ga0207648_10176544 3300026089 Unclassified 1889
752 Ga0207648_10215118 3300026089 Bacteria 1707
753 Ga0207648_10829501 3300026089 Unclassified 862
754 Ga0207648_11048313 3300026089 Bacteria 764
755 Ga0207676_10012166 3300026095 Bacteria 6161
756 Ga0207676_10027882 3300026095 Bacteria 4212
757 Ga0207676_10054925 3300026095 Bacteria 3123
758 Ga0207676_10086183 3300026095 Bacteria 2565
759 Ga0207676_10147746 3300026095 Bacteria 2020
760 Ga0207676_10474709 3300026095 Bacteria 1183
761 Ga0207676_12096474 3300026095 Unclassified 564
762 Ga0207674_10006694 3300026116 Bacteria 13532
763 Ga0207674_10006896 3300026116 Bacteria 13314
764 Ga0207674_10019038 3300026116 Bacteria 7440
765 Ga0207674_10023357 3300026116 Bacteria 6626
766 Ga0207674_10228855 3300026116 Bacteria 1807
767 Ga0207674_10353433 3300026116 Unclassified 1421
768 Ga0207674_10373297 3300026116 Bacteria 1379
769 Ga0207674_10374571 3300026116 Bacteria 1376
770 Ga0207674_11123978 3300026116 Unclassified 755
771 Ga0207675_100000085 3300026118 Bacteria 73716
772 Ga0207675_100011340 3300026118 Bacteria 8340
773 Ga0207675_100142715 3300026118 Bacteria 2275
774 Ga0207675_100160960 3300026118 Bacteria 2141
775 Ga0207675_100187137 3300026118 Bacteria 1985
776 Ga0207675_100294295 3300026118 Bacteria 1580
777 Ga0207675_100335370 3300026118 Bacteria 1479
778 Ga0207675_100728933 3300026118 Bacteria 1001
779 Ga0207675_100895081 3300026118 Bacteria 904
780 Ga0207675_101440331 3300026118 Bacteria 710
781 Ga0207675_102562642 3300026118 Unclassified 520
782 Ga0207683_10012383 3300026121 Bacteria 7279
783 Ga0207683_10826837 3300026121 Bacteria 860
784 Ga0207683_11002180 3300026121 Bacteria 775
785 Ga0207683_11740019 3300026121 Unclassified 573
786 Ga0207698_10000340 3300026142 Bacteria 27673
787 Ga0207698_10026635 3300026142 Bacteria 4092
788 Ga0207698_10033125 3300026142 Bacteria 3751
789 Ga0207698_10065708 3300026142 Bacteria 2851
790 Ga0207698_10159407 3300026142 Bacteria 1971
791 Ga0207698_10281058 3300026142 Bacteria 1539
792 Ga0207698_10867347 3300026142 Bacteria 908
793 Ga0207698_10902057 3300026142 Unclassified 891
794 Ga0207428_10050789 3300027907 Bacteria 3316
795 Ga0207428_10315430 3300027907 Bacteria 1155
796 Ga0268265_10004802 3300028380 Bacteria 9318
797 Ga0268265_10066375 3300028380 Bacteria 2789
798 Ga0268265_10321709 3300028380 Bacteria 1401
799 Ga0268265_10392047 3300028380 Bacteria 1281
800 Ga0268265_10473322 3300028380 Bacteria 1175
801 Ga0268265_11300289 3300028380 Bacteria 727
802 Ga0268265_11311065 3300028380 Unclassified 724
803 Ga0268265_11355816 3300028380 Unclassified 712
804 Ga0268264_10027341 3300028381 Bacteria 4659
805 Ga0268264_10038894 3300028381 Bacteria 3928
806 Ga0268264_10081403 3300028381 Bacteria 2767
807 Ga0268264_10271614 3300028381 Bacteria 1584
808 Ga0268264_10500232 3300028381 Unclassified 1185
809 Ga0268264_10667574 3300028381 Bacteria 1030
810 Ga0268264_10674043 3300028381 Bacteria 1025
811 Ga0268264_10709910 3300028381 Unclassified 999
812 Ga0268264_11033787 3300028381 Bacteria 829
813 Ga0268264_11254784 3300028381 Bacteria 751
814 Ga0268264_11602209 3300028381 Bacteria 662
815 Ga0307517_10510855 3300028786 Unclassified 609
816 Ga0307511_10002747 3300030521 Bacteria 18300
817 Ga0316177_1121841 3300030731 Bacteria 897
818 Ga0265328_10276544 3300031239 Bacteria 646
819 Ga0265327_10009266 3300031251 Bacteria 7136
820 Ga0307513_10219809 3300031456 Bacteria 1722
821 Ga0307513_10550569 3300031456 Bacteria 866
822 Ga0307513_11048326 3300031456 Bacteria 526
823 Ga0307509_10106400 3300031507 Bacteria 2824
824 Ga0265313_10098314 3300031595 Bacteria 1303
825 Ga0307413_12012694 3300031824 Bacteria 521
826 Ga0307416_101388975 3300032002 Unclassified 808
827 Ga0307414_10247074 3300032004 Bacteria 1481
828 Ga0307414_10290691 3300032004 Bacteria 1378
829 Ga0307414_11228193 3300032004 Unclassified 694
830 Ga0307414_11883152 3300032004 Bacteria 558
831 Ga0307411_10307778 3300032005 Bacteria 1274
832 Ga0373932_0396271 3300035112 Bacteria 533
833 Ga0373936_0292345 3300035113 Bacteria 734
834 Ga0373943_0813620 3300035170 Bacteria 556
835 Ga0373955_0049638 3300035172 Unclassified 2279
836 Ga0373924_0016787 3300035410 Bacteria 2800
837 Ga0373931_0462994 3300035691 Unclassified 813
838 Ga0373935_0135645 3300035692 Unclassified 1658
839 Ga0373935_0466453 3300035692 Bacteria 914
840 Ga0373947_0037890 3300035725 Bacteria 2862
841 Ga0373937_0028695 3300036401 Bacteria 5036
842 Ga0395899_0003604 3300037312 Bacteria 12245
843 Ga0395899_0007612 3300037312 Bacteria 8353
844 Ga0395899_0035542 3300037312 Bacteria 3739
845 Ga0395899_0039093 3300037312 Bacteria 3553
846 Ga0395899_0287047 3300037312 Unclassified 1117
847 Ga0395899_0824244 3300037312 Bacteria 571
848 Ga0395899_0835106 3300037312 Bacteria 567
849 Ga0395900_0026756 3300037418 Bacteria 5903
850 Ga0395900_0068173 3300037418 Bacteria 3655
851 Ga0395900_0076792 3300037418 Bacteria 3432
852 Ga0395900_0197612 3300037418 Bacteria 2036
853 Ga0395900_0514622 3300037418 Unclassified 1145
854 Ga0395900_0890876 3300037418 Unclassified 814
855 Ga0395898_0003818 3300037466 Bacteria 16686
856 Ga0395898_0041299 3300037466 Bacteria 4557
857 Ga0395898_0055555 3300037466 Bacteria 3861
858 Ga0395898_0063252 3300037466 Bacteria 3591
859 Ga0395898_0276176 3300037466 Bacteria 1602
860 Ga0395898_0516745 3300037466 Bacteria 1135
861 Ga0395898_0865374 3300037466 Bacteria 843
862 Ga0395905_0285293 3300037471 Bacteria 1538
863 Ga0395905_0408526 3300037471 Bacteria 1253
864 Ga0395901_0006287 3300038443 Bacteria 12032
865 Ga0395901_0015165 3300038443 Bacteria 7837
866 Ga0395901_0041546 3300038443 Bacteria 4766
867 Ga0395901_0130611 3300038443 Bacteria 2639
868 Ga0395901_0161314 3300038443 Bacteria 2355
869 Ga0395901_0444758 3300038443 Unclassified 1326
870 Ga0436365_1066023 3300039437 Bacteria 2519
871 Ga0436365_1111130 3300039437 Bacteria 1896
872 Ga0439436_0027239 3300041404 Bacteria 1672
873 Ga0439439_0018325 3300041406 Bacteria 1729
874 Ga0439439_0060288 3300041406 Bacteria 1007
875 Ga0439465_0370875 3300041413 Bacteria 542
876 Ga0451787_601744 3300041441 Bacteria 534
877 Ga0451789_1085436 3300041443 Bacteria 599
878 Ga0451791_0709903 3300041451 Bacteria 703
879 Ga0451791_0976880 3300041451 Bacteria 1292
880 Ga0451791_1417606 3300041451 Unclassified 515
881 Ga0451797_0143917 3300041453 Bacteria 506
882 Ga0451800_0573962 3300041459 Bacteria 759
883 Ga0451802_0505948 3300041460 Unclassified 586
884 Ga0451802_0744852 3300041460 Bacteria 988
885 Ga0451807_1283653 3300041486 Bacteria 517
886 Ga0451807_2598025 3300041486 Bacteria 673
887 Ga0451833_0407819 3300041491 Bacteria 736
888 Ga0451837_0560980 3300041494 Bacteria 1029
889 Ga0451851_0639284 3300041507 Bacteria 789
890 Ga0451843_0288465 3300041509 Bacteria 858
891 Ga0451853_0925438 3300041512 Bacteria 942
892 Ga0451853_1827383 3300041512 Unclassified 842
893 Ga0439431_0109007 3300041997 Bacteria 766
894 Ga0439433_0074625 3300041999 Bacteria 820
895 Ga0439441_001674 3300042001 Bacteria 2971
896 Ga0439445_0056666 3300042004 Unclassified 1066
897 Ga0439449_0008946 3300042007 Bacteria 3797
898 Ga0439449_0012910 3300042007 Bacteria 3141
899 Ga0439454_013571 3300042011 Bacteria 1120
900 Ga0439457_000874 3300042014 Bacteria 9102
901 Ga0439462_0004114 3300042015 Bacteria 3533
902 Ga0450922_022258 3300042124 Bacteria 659
903 Ga0450897_022153 3300042128 Unclassified 686
904 Ga0450894_025993 3300042131 Bacteria 803
905 Ga0450896_044332 3300042133 Bacteria 698
906 Ga0450898_020988 3300042134 Bacteria 1148
907 Ga0450899_012799 3300042135 Unclassified 944
908 Ga0439434_0261570 3300042435 Bacteria 593
909 Ga0439435_0055381 3300042436 Bacteria 1144
910 Ga0439444_0070272 3300042437 Bacteria 748
911 Ga0439459_0142367 3300042438 Bacteria 621
912 Ga0439464_0129699 3300042439 Bacteria 780
913 Ga0439460_0010547 3300042461 Bacteria 2369
914 Ga0451577_1644303 3300042876 Bacteria 566
915 Ga0495592_0126013 3300046454 Bacteria 1797
916 Ga0495638_0035545 3300046460 Bacteria 3176
917 Ga0495584_0174665 3300046491 Bacteria 1092
918 Ga0495608_0066795 3300046511 Unclassified 2354
919 Ga0495618_0221260 3300046514 Bacteria 1194
920 Ga0495630_0014167 3300046517 Bacteria 5804
921 Ga0495632_0213052 3300046519 Bacteria 876
922 Ga0495643_0007703 3300046522 Bacteria 6901
923 Ga0495640_0081502 3300046533 Bacteria 2151
924 Ga0495598_0037398 3300046537 Bacteria 1400
925 Ga0495598_0251797 3300046537 Bacteria 654
926 Ga0495621_0074477 3300046539 Bacteria 1256
927 Ga0495667_0752181 3300046559 Bacteria 602
928 Ga0495634_0099314 3300046642 Bacteria 1882
929 Ga0495611_0129352 3300046648 Bacteria 1178
930 Ga0495657_0108124 3300046675 Bacteria 1765
931 Ga0495658_0128425 3300046683 Bacteria 1541
932 Ga0495613_0110120 3300046689 Unclassified 1985
933 Ga0495600_0736454 3300046809 Bacteria 591
934 Ga0495581_0359628 3300047315 Bacteria 850
935 Ga0495604_0227112 3300047317 Unclassified 1282
936 Ga0495636_0690415 3300047318 Bacteria 503
937 Ga0495672_0061725 3300047320 Bacteria 2159
938 Ga0495672_0362970 3300047320 Bacteria 670
939 Ga0495680_0507477 3300047322 Unclassified 818
940 Ga0495680_0896578 3300047322 Bacteria 573
941 Ga0495675_0204749 3300047444 Bacteria 1200
942 Ga0495677_0461501 3300047445 Bacteria 503
943 Ga0495684_0410038 3300047471 Unclassified 949
944 Ga0496107_0710618 3300048910 Bacteria 739
945 Ga0496110_0101779 3300048913 Bacteria 2576
946 Ga0496112_0460695 3300048915 Bacteria 1209
947 Ga0496112_0737494 3300048915 Bacteria 912
948 Ga0495682_0133351 3300049460 Unclassified 888
949 Ga0501032_0005001 3300049569 Bacteria 9914
950 Ga0501032_0285675 3300049569 Unclassified 1068
951 Ga0501033_0060506 3300049570 Bacteria 2794
952 Ga0501033_0208755 3300049570 Bacteria 1393
953 Ga0501034_0012357 3300049571 Bacteria 8821
954 Ga0501034_0041785 3300049571 Bacteria 4639
955 Ga0501034_0062096 3300049571 Bacteria 3751
956 Ga0501036_0032651 3300049572 Bacteria 4400
957 Ga0501037_0048748 3300049573 Bacteria 3102
958 Ga0501037_0452002 3300049573 Bacteria 876
959 Ga0501037_0701793 3300049573 Bacteria 673
960 Ga0501038_0072836 3300049574 Bacteria 2910
961 Ga0501038_0659550 3300049574 Bacteria 787
962 Ga0501039_0072471 3300049575 Bacteria 2676
963 Ga0501039_1276274 3300049575 Bacteria 567
964 Ga0501043_0003493 3300049579 Bacteria 12916
965 Ga0501043_0216530 3300049579 Bacteria 1483
966 Ga0501047_0004866 3300049581 Bacteria 12612
967 Ga0501047_0279843 3300049581 Bacteria 1513
968 Ga0501048_0016937 3300049582 Bacteria 5372
969 Ga0501069_0350827 3300049585 Bacteria 870
970 Ga0501070_0020247 3300049586 Bacteria 5580
971 Ga0501070_0425120 3300049586 Bacteria 1073
972 Ga0501072_0312892 3300049588 Bacteria 1248
973 Ga0501073_0753687 3300049589 Bacteria 671
974 Ga0501074_0004850 3300049590 Bacteria 9645
975 Ga0501216_149296 3300049660 Unclassified 554
976 Ga0501243_039873 3300049675 Bacteria 823
977 Ga0501221_149305 3300049704 Bacteria 618
978 Ga0501225_0004750 3300049705 Bacteria 4027
979 Ga0501225_0207819 3300049705 Unclassified 624
980 Ga0501080_0082856 3300049742 Bacteria 2979
981 Ga0501080_0130029 3300049742 Bacteria 2331
982 Ga0501083_0178906 3300049744 Bacteria 1385
983 Ga0501241_004041 3300049758 Bacteria 2760
984 Ga0501035_0010218 3300049822 Bacteria 8711
985 Ga0501035_0097171 3300049822 Bacteria 2587
986 Ga0501035_0114632 3300049822 Bacteria 2360
987 Ga0501044_0014761 3300049823 Bacteria 8421
988 Ga0501044_0219155 3300049823 Bacteria 1854
989 Ga0501045_0243704 3300049824 Bacteria 1338
990 nmdc:mga05p37_118879_c1 3300050507 Unclassified 3247
991 nmdc:mga05p37_25280_c1 3300050507 Bacteria 7221
992 nmdc:mga09592_12569_c2 3300050508 Bacteria 4830
993 nmdc:mga09592_363122_c1 3300050508 Bacteria 1253
994 nmdc:mga0qj67_370556_c1 3300050509 Unclassified 1157
995 nmdc:mga06r32_1364632_c1 3300050510 Bacteria 651
996 nmdc:mga06r32_58047_c1 3300050510 Bacteria 3719
997 nmdc:mga08y16_207810_c1 3300050511 Bacteria 2028
998 nmdc:mga08y16_21376_c1 3300050511 Bacteria 6834
999 nmdc:mga08y16_351456_c1 3300050511 Bacteria 1514
1000 nmdc:mga08y16_86504_c1 3300050511 Bacteria 3266
1001 nmdc:mga0n895_237077_c1 3300050512 Bacteria 1851
1002 nmdc:mga0rr50_600577_c1 3300050513 Bacteria 938
1003 Ga0500646_0034250 3300053090 Bacteria 1407
1004 Ga0500583_0127636 3300053092 Bacteria 1260
1005 Ga0500651_0225284 3300053093 Bacteria 1098
1006 Ga0500556_0066129 3300053104 Bacteria 1342
1007 Ga0500642_0109696 3300053130 Bacteria 1288
1008 Ga0500658_0132059 3300053134 Bacteria 1115
1009 Ga0500589_005991 3300053147 Bacteria 4808
1010 Ga0500604_0112489 3300053151 Bacteria 905
1011 Ga0500616_0134010 3300053153 Bacteria 1167
1012 Ga0500622_0061690 3300053156 Bacteria 1911
1013 Ga0500622_0201134 3300053156 Bacteria 906
1014 Ga0500627_0174523 3300053158 Unclassified 968
1015 Ga0500637_0045015 3300053178 Bacteria 2502
1016 Ga0500611_000039 3300053727 Bacteria 68825
1017 Ga0501084_0034594 3300054114 Bacteria 4224
1018 Ga0501082_1425286 3300060353 Unclassified 605

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005367 Ga0070667_100331294 Ga0070667_1003312942 103
2 3300005841 Ga0068863_100473288 Ga0068863_1004732882 103
3 3300009553 Ga0105249_10766227 Ga0105249_107662271 103
4 3300025961 Ga0207712_11588561 Ga0207712_115885611 103
5 3300025986 Ga0207658_10293330 Ga0207658_102933302 103
6 3300005334 Ga0068869_100058928 Ga0068869_1000589284 106
7 3300005337 Ga0070682_100089216 Ga0070682_1000892162 106
8 3300005340 Ga0070689_100103588 Ga0070689_1001035885 106
9 3300005364 Ga0070673_100433804 Ga0070673_1004338042 106
10 3300005365 Ga0070688_100017227 Ga0070688_1000172273 106
11 3300005366 Ga0070659_100241857 Ga0070659_1002418572 106
12 3300005455 Ga0070663_100283988 Ga0070663_1002839882 106
13 3300005539 Ga0068853_101069712 Ga0068853_1010697121 106
14 3300005548 Ga0070665_100958532 Ga0070665_1009585322 106
15 3300005563 Ga0068855_101231581 Ga0068855_1012315812 106
16 3300005564 Ga0070664_101354238 Ga0070664_1013542382 106
17 3300005577 Ga0068857_100355853 Ga0068857_1003558531 106
18 3300005577 Ga0068857_101203789 Ga0068857_1012037892 106
19 3300005616 Ga0068852_101185278 Ga0068852_1011852782 106
20 3300005617 Ga0068859_101431419 Ga0068859_1014314192 106
21 3300005844 Ga0068862_100196777 Ga0068862_1001967773 106
22 3300006931 Ga0097620_101431425 Ga0097620_1014314252 106
23 3300013296 Ga0157374_10007442 Ga0157374_100074429 106
24 3300013306 Ga0163162_10046225 Ga0163162_100462253 106
25 3300013308 Ga0157375_10023657 Ga0157375_100236572 106
26 3300014325 Ga0163163_10005376 Ga0163163_100053764 106
27 3300014745 Ga0157377_10238428 Ga0157377_102384282 106
28 3300014968 Ga0157379_10246758 Ga0157379_102467583 106
29 3300014968 Ga0157379_10748182 Ga0157379_107481822 106
30 3300025904 Ga0207647_10057441 Ga0207647_100574413 106
31 3300025920 Ga0207649_10428886 Ga0207649_104288862 106
32 3300025932 Ga0207690_10143848 Ga0207690_101438482 106
33 3300025936 Ga0207670_10042128 Ga0207670_100421284 106
34 3300025942 Ga0207689_10009313 Ga0207689_100093134 106
35 3300025944 Ga0207661_10005152 Ga0207661_100051523 106
36 3300025945 Ga0207679_10018927 Ga0207679_100189273 106
37 3300025945 Ga0207679_11226232 Ga0207679_112262322 106
38 3300025949 Ga0207667_10424044 Ga0207667_104240442 106
39 3300025960 Ga0207651_10405797 Ga0207651_104057972 106
40 3300026023 Ga0207677_11197777 Ga0207677_111977772 106
41 3300026035 Ga0207703_10872006 Ga0207703_108720062 106
42 3300026041 Ga0207639_10553409 Ga0207639_105534091 106
43 3300026067 Ga0207678_10025516 Ga0207678_100255162 106
44 3300026095 Ga0207676_10012166 Ga0207676_100121668 106
45 3300026116 Ga0207674_10019038 Ga0207674_100190384 106
46 3300026116 Ga0207674_11123978 Ga0207674_111239782 106
47 3300026142 Ga0207698_10867347 Ga0207698_108673472 106
48 3300028380 Ga0268265_10392047 Ga0268265_103920471 106
49 3300048913 Ga0496110_0101779 Ga0496110_0101779_1039_1380 106
50 3300048915 Ga0496112_0460695 Ga0496112_0460695_395_736 106
51 3300005347 Ga0070668_100224006 Ga0070668_1002240061 109
52 3300049758 Ga0501241_004041 Ga0501241_004041_2289_2621 109
53 iso_pu_bacteria 2738541278 2738725878 109
54 3300005834 Ga0068851_10567664 Ga0068851_105676642 110
55 3300013297 Ga0157378_12396900 Ga0157378_123969002 110
56 3300032004 Ga0307414_11228193 Ga0307414_112281932 110
57 3300035112 Ga0373932_0396271 Ga0373932_0396271_99_431 110
58 3300035691 Ga0373931_0462994 Ga0373931_0462994_29_361 110
59 3300005327 Ga0070658_10771285 Ga0070658_107712851 111
60 3300005333 Ga0070677_10352086 Ga0070677_103520862 111
61 3300005340 Ga0070689_100964328 Ga0070689_1009643282 111
62 3300005341 Ga0070691_10343897 Ga0070691_103438972 111
63 3300005344 Ga0070661_101628530 Ga0070661_1016285301 111
64 3300005366 Ga0070659_100197196 Ga0070659_1001971962 111
65 3300005367 Ga0070667_101377321 Ga0070667_1013773212 111
66 3300005563 Ga0068855_100094911 Ga0068855_1000949113 111
67 3300005563 Ga0068855_100140061 Ga0068855_1001400614 111
68 3300005577 Ga0068857_100001483 Ga0068857_1000014839 111
69 3300005578 Ga0068854_100114212 Ga0068854_1001142123 111
70 3300005578 Ga0068854_100340479 Ga0068854_1003404793 111
71 3300005614 Ga0068856_100044165 Ga0068856_1000441654 111
72 3300005616 Ga0068852_100002726 Ga0068852_1000027269 111
73 3300005616 Ga0068852_100382901 Ga0068852_1003829012 111
74 3300005617 Ga0068859_103052632 Ga0068859_1030526321 111
75 3300005841 Ga0068863_100311080 Ga0068863_1003110803 111
76 3300005843 Ga0068860_102824736 Ga0068860_1028247361 111
77 3300006847 Ga0075431_100038737 Ga0075431_1000387374 111
78 3300006931 Ga0097620_103051072 Ga0097620_1030510722 111
79 3300009093 Ga0105240_10008412 Ga0105240_1000841211 111
80 3300009093 Ga0105240_10013970 Ga0105240_100139707 111
81 3300009093 Ga0105240_10048294 Ga0105240_100482943 111
82 3300009101 Ga0105247_10257803 Ga0105247_102578032 111
83 3300009147 Ga0114129_10027834 Ga0114129_100278347 111
84 3300009174 Ga0105241_10000460 Ga0105241_100004606 111
85 3300009174 Ga0105241_10416031 Ga0105241_104160311 111
86 3300009176 Ga0105242_11117850 Ga0105242_111178502 111
87 3300009545 Ga0105237_10009688 Ga0105237_100096888 111
88 3300009551 Ga0105238_10000488 Ga0105238_1000048814 111
89 3300009551 Ga0105238_10019337 Ga0105238_100193373 111
90 3300009551 Ga0105238_10021278 Ga0105238_100212784 111
91 3300009551 Ga0105238_11060670 Ga0105238_110606702 111
92 3300010375 Ga0105239_10032094 Ga0105239_100320943 111
93 3300011119 Ga0105246_10176787 Ga0105246_101767872 111
94 3300013100 Ga0157373_10172867 Ga0157373_101728672 111
95 3300013100 Ga0157373_11071155 Ga0157373_110711552 111
96 3300013104 Ga0157370_10034855 Ga0157370_100348553 111
97 3300013105 Ga0157369_10025886 Ga0157369_100258863 111
98 3300013306 Ga0163162_12314021 Ga0163162_123140211 111
99 3300013307 Ga0157372_10001983 Ga0157372_100019838 111
100 3300013307 Ga0157372_10094848 Ga0157372_100948483 111
101 3300013307 Ga0157372_10214413 Ga0157372_102144133 111
102 3300025904 Ga0207647_10013169 Ga0207647_100131692 111
103 3300025911 Ga0207654_10069535 Ga0207654_100695352 111
104 3300025911 Ga0207654_10869588 Ga0207654_108695881 111
105 3300025913 Ga0207695_10001387 Ga0207695_1000138725 111
106 3300025913 Ga0207695_10038130 Ga0207695_100381306 111
107 3300025913 Ga0207695_10052655 Ga0207695_100526553 111
108 3300025913 Ga0207695_11463290 Ga0207695_114632902 111
109 3300025914 Ga0207671_10007829 Ga0207671_100078293 111
110 3300025923 Ga0207681_11423202 Ga0207681_114232021 111
111 3300025924 Ga0207694_10002191 Ga0207694_100021916 111
112 3300025924 Ga0207694_10028517 Ga0207694_100285173 111
113 3300025924 Ga0207694_11570389 Ga0207694_115703891 111
114 3300025932 Ga0207690_10604401 Ga0207690_106044011 111
115 3300025949 Ga0207667_10001760 Ga0207667_1000176022 111
116 3300025972 Ga0207668_10141362 Ga0207668_101413622 111
117 3300025981 Ga0207640_10843356 Ga0207640_108433562 111
118 3300026041 Ga0207639_10115198 Ga0207639_101151983 111
119 3300026041 Ga0207639_11027077 Ga0207639_110270772 111
120 3300026088 Ga0207641_10409238 Ga0207641_104092381 111
121 3300026116 Ga0207674_10006694 Ga0207674_100066948 111
122 3300026142 Ga0207698_10000340 Ga0207698_100003406 111
123 3300026142 Ga0207698_10902057 Ga0207698_109020573 111
124 3300030521 Ga0307511_10002747 Ga0307511_100027478 111
125 3300031824 Ga0307413_12012694 Ga0307413_120126941 111
126 3300032002 Ga0307416_101388975 Ga0307416_1013889752 111
127 3300032004 Ga0307414_11883152 Ga0307414_118831521 111
128 3300049460 Ga0495682_0133351 Ga0495682_0133351_250_591 111
129 3300049660 Ga0501216_149296 Ga0501216_149296_58_393 111
130 3300049705 Ga0501225_0207819 Ga0501225_0207819_262_597 111
131 3300050507 nmdc:mga05p37_25280_c1 nmdc:mga05p37_25280_c1_6283_6618 111
132 3300050510 nmdc:mga06r32_58047_c1 nmdc:mga06r32_58047_c1_282_617 111
133 3300053178 Ga0500637_0045015 Ga0500637_0045015_1691_2041 111
134 3300000043 ARcpr5yngRDRAFT_c011162 ARcpr5yngRDRAFT_0111622 112
135 3300002067 JGI24735J21928_10022974 JGI24735J21928_100229742 112
136 3300005295 Ga0065707_10898219 Ga0065707_108982191 112
137 3300005327 Ga0070658_10203888 Ga0070658_102038882 112
138 3300005328 Ga0070676_10005845 Ga0070676_100058456 112
139 3300005328 Ga0070676_10584658 Ga0070676_105846581 112
140 3300005329 Ga0070683_100080455 Ga0070683_1000804552 112
141 3300005329 Ga0070683_100113788 Ga0070683_1001137883 112
142 3300005329 Ga0070683_100160047 Ga0070683_1001600473 112
143 3300005330 Ga0070690_100004279 Ga0070690_1000042796 112
144 3300005330 Ga0070690_100142125 Ga0070690_1001421252 112
145 3300005330 Ga0070690_100622132 Ga0070690_1006221321 112
146 3300005331 Ga0070670_100549754 Ga0070670_1005497541 112
147 3300005333 Ga0070677_10295193 Ga0070677_102951932 112
148 3300005334 Ga0068869_100036673 Ga0068869_1000366733 112
149 3300005335 Ga0070666_10013142 Ga0070666_100131424 112
150 3300005335 Ga0070666_10073096 Ga0070666_100730961 112
151 3300005336 Ga0070680_100030579 Ga0070680_1000305793 112
152 3300005336 Ga0070680_100346120 Ga0070680_1003461202 112
153 3300005336 Ga0070680_101119374 Ga0070680_1011193742 112
154 3300005337 Ga0070682_100974016 Ga0070682_1009740161 112
155 3300005338 Ga0068868_100000543 Ga0068868_10000054327 112
156 3300005339 Ga0070660_100000647 Ga0070660_10000064711 112
157 3300005339 Ga0070660_100110890 Ga0070660_1001108903 112
158 3300005339 Ga0070660_100307379 Ga0070660_1003073792 112
159 3300005339 Ga0070660_100410270 Ga0070660_1004102702 112
160 3300005339 Ga0070660_101087677 Ga0070660_1010876772 112
161 3300005340 Ga0070689_100035973 Ga0070689_1000359731 112
162 3300005340 Ga0070689_100399922 Ga0070689_1003999222 112
163 3300005344 Ga0070661_100184872 Ga0070661_1001848722 112
164 3300005344 Ga0070661_100633736 Ga0070661_1006337362 112
165 3300005345 Ga0070692_10026463 Ga0070692_100264634 112
166 3300005345 Ga0070692_10307479 Ga0070692_103074791 112
167 3300005345 Ga0070692_11108538 Ga0070692_111085381 112
168 3300005347 Ga0070668_100101573 Ga0070668_1001015733 112
169 3300005347 Ga0070668_100257219 Ga0070668_1002572192 112
170 3300005354 Ga0070675_100177621 Ga0070675_1001776211 112
171 3300005354 Ga0070675_100228031 Ga0070675_1002280312 112
172 3300005355 Ga0070671_100074050 Ga0070671_1000740502 112
173 3300005355 Ga0070671_100494667 Ga0070671_1004946671 112
174 3300005356 Ga0070674_100259112 Ga0070674_1002591121 112
175 3300005364 Ga0070673_100138920 Ga0070673_1001389202 112
176 3300005364 Ga0070673_100193532 Ga0070673_1001935322 112
177 3300005365 Ga0070688_100320696 Ga0070688_1003206961 112
178 3300005365 Ga0070688_101040424 Ga0070688_1010404242 112
179 3300005366 Ga0070659_100042462 Ga0070659_1000424622 112
180 3300005366 Ga0070659_100065305 Ga0070659_1000653053 112
181 3300005366 Ga0070659_100134986 Ga0070659_1001349863 112
182 3300005366 Ga0070659_100155893 Ga0070659_1001558932 112
183 3300005367 Ga0070667_100005088 Ga0070667_1000050884 112
184 3300005367 Ga0070667_100089394 Ga0070667_1000893942 112
185 3300005367 Ga0070667_100323457 Ga0070667_1003234572 112
186 3300005367 Ga0070667_100372078 Ga0070667_1003720782 112
187 3300005440 Ga0070705_101309602 Ga0070705_1013096022 112
188 3300005455 Ga0070663_100380496 Ga0070663_1003804962 112
189 3300005456 Ga0070678_100007620 Ga0070678_1000076206 112
190 3300005456 Ga0070678_101824856 Ga0070678_1018248561 112
191 3300005457 Ga0070662_100016061 Ga0070662_1000160615 112
192 3300005457 Ga0070662_100030265 Ga0070662_1000302652 112
193 3300005458 Ga0070681_10103549 Ga0070681_101035493 112
194 3300005458 Ga0070681_10262077 Ga0070681_102620771 112
195 3300005458 Ga0070681_10265667 Ga0070681_102656673 112
196 3300005459 Ga0068867_100007969 Ga0068867_1000079697 112
197 3300005459 Ga0068867_100018800 Ga0068867_1000188003 112
198 3300005459 Ga0068867_100070063 Ga0068867_1000700631 112
199 3300005459 Ga0068867_100196427 Ga0068867_1001964272 112
200 3300005466 Ga0070685_10013277 Ga0070685_100132776 112
201 3300005466 Ga0070685_10044166 Ga0070685_100441663 112
202 3300005530 Ga0070679_100001516 Ga0070679_1000015168 112
203 3300005530 Ga0070679_100125043 Ga0070679_1001250433 112
204 3300005530 Ga0070679_100244490 Ga0070679_1002444902 112
205 3300005530 Ga0070679_101145985 Ga0070679_1011459852 112
206 3300005530 Ga0070679_101301507 Ga0070679_1013015071 112
207 3300005535 Ga0070684_100119148 Ga0070684_1001191483 112
208 3300005535 Ga0070684_101110014 Ga0070684_1011100141 112
209 3300005539 Ga0068853_100228322 Ga0068853_1002283222 112
210 3300005539 Ga0068853_100377403 Ga0068853_1003774033 112
211 3300005539 Ga0068853_100409159 Ga0068853_1004091592 112
212 3300005543 Ga0070672_100255414 Ga0070672_1002554143 112
213 3300005544 Ga0070686_100004001 Ga0070686_1000040014 112
214 3300005563 Ga0068855_100000145 Ga0068855_10000014570 112
215 3300005563 Ga0068855_100003314 Ga0068855_1000033147 112
216 3300005563 Ga0068855_100125794 Ga0068855_1001257943 112
217 3300005563 Ga0068855_100146818 Ga0068855_1001468183 112
218 3300005563 Ga0068855_100352365 Ga0068855_1003523652 112
219 3300005564 Ga0070664_100278400 Ga0070664_1002784003 112
220 3300005564 Ga0070664_100607112 Ga0070664_1006071122 112
221 3300005577 Ga0068857_100220722 Ga0068857_1002207222 112
222 3300005577 Ga0068857_100295744 Ga0068857_1002957441 112
223 3300005577 Ga0068857_100365443 Ga0068857_1003654432 112
224 3300005577 Ga0068857_102247341 Ga0068857_1022473411 112
225 3300005578 Ga0068854_100031969 Ga0068854_1000319694 112
226 3300005578 Ga0068854_100074627 Ga0068854_1000746275 112
227 3300005578 Ga0068854_101780553 Ga0068854_1017805531 112
228 3300005614 Ga0068856_100023593 Ga0068856_1000235933 112
229 3300005614 Ga0068856_100205533 Ga0068856_1002055333 112
230 3300005616 Ga0068852_100026651 Ga0068852_1000266512 112
231 3300005616 Ga0068852_100235284 Ga0068852_1002352843 112
232 3300005616 Ga0068852_100653796 Ga0068852_1006537962 112
233 3300005616 Ga0068852_100677826 Ga0068852_1006778262 112
234 3300005617 Ga0068859_100166408 Ga0068859_1001664083 112
235 3300005618 Ga0068864_100124308 Ga0068864_1001243083 112
236 3300005618 Ga0068864_100338587 Ga0068864_1003385872 112
237 3300005718 Ga0068866_10113877 Ga0068866_101138772 112
238 3300005719 Ga0068861_101249133 Ga0068861_1012491332 112
239 3300005842 Ga0068858_100261028 Ga0068858_1002610282 112
240 3300005842 Ga0068858_102005184 Ga0068858_1020051842 112
241 3300005843 Ga0068860_100364671 Ga0068860_1003646712 112
242 3300005843 Ga0068860_100655051 Ga0068860_1006550512 112
243 3300005843 Ga0068860_101881403 Ga0068860_1018814032 112
244 3300005844 Ga0068862_100310651 Ga0068862_1003106512 112
245 3300006163 Ga0070715_10046476 Ga0070715_100464762 112
246 3300006237 Ga0097621_100264271 Ga0097621_1002642712 112
247 3300006237 Ga0097621_101616740 Ga0097621_1016167402 112
248 3300006237 Ga0097621_102004036 Ga0097621_1020040361 112
249 3300006358 Ga0068871_100105996 Ga0068871_1001059962 112
250 3300006358 Ga0068871_100285359 Ga0068871_1002853592 112
251 3300006358 Ga0068871_100909023 Ga0068871_1009090232 112
252 3300006358 Ga0068871_100952134 Ga0068871_1009521342 112
253 3300006844 Ga0075428_101884212 Ga0075428_1018842121 112
254 3300006871 Ga0075434_100250681 Ga0075434_1002506812 112
255 3300006881 Ga0068865_100267382 Ga0068865_1002673822 112
256 3300006931 Ga0097620_100166414 Ga0097620_1001664143 112
257 3300009093 Ga0105240_10158930 Ga0105240_101589302 112
258 3300009101 Ga0105247_10497523 Ga0105247_104975232 112
259 3300009148 Ga0105243_10507510 Ga0105243_105075102 112
260 3300009174 Ga0105241_10456955 Ga0105241_104569551 112
261 3300009174 Ga0105241_10471635 Ga0105241_104716352 112
262 3300009176 Ga0105242_10038912 Ga0105242_100389122 112
263 3300009176 Ga0105242_10377044 Ga0105242_103770442 112
264 3300009177 Ga0105248_10337014 Ga0105248_103370143 112
265 3300009553 Ga0105249_10031881 Ga0105249_100318815 112
266 3300009553 Ga0105249_10438787 Ga0105249_104387872 112
267 3300009553 Ga0105249_11166446 Ga0105249_111664462 112
268 3300010375 Ga0105239_10084716 Ga0105239_100847163 112
269 3300013100 Ga0157373_10027634 Ga0157373_100276343 112
270 3300013100 Ga0157373_10138537 Ga0157373_101385372 112
271 3300013100 Ga0157373_10142570 Ga0157373_101425702 112
272 3300013100 Ga0157373_10287471 Ga0157373_102874712 112
273 3300013100 Ga0157373_10904612 Ga0157373_109046121 112
274 3300013102 Ga0157371_10000868 Ga0157371_1000086816 112
275 3300013102 Ga0157371_10005115 Ga0157371_1000511512 112
276 3300013102 Ga0157371_10039547 Ga0157371_100395472 112
277 3300013102 Ga0157371_10162582 Ga0157371_101625822 112
278 3300013102 Ga0157371_10183168 Ga0157371_101831682 112
279 3300013102 Ga0157371_10433342 Ga0157371_104333422 112
280 3300013102 Ga0157371_10457951 Ga0157371_104579512 112
281 3300013102 Ga0157371_10651042 Ga0157371_106510422 112
282 3300013102 Ga0157371_10833826 Ga0157371_108338262 112
283 3300013102 Ga0157371_10907198 Ga0157371_109071982 112
284 3300013104 Ga0157370_10000313 Ga0157370_1000031350 112
285 3300013104 Ga0157370_10000628 Ga0157370_1000062830 112
286 3300013104 Ga0157370_10045234 Ga0157370_100452344 112
287 3300013104 Ga0157370_10191488 Ga0157370_101914881 112
288 3300013104 Ga0157370_10453106 Ga0157370_104531061 112
289 3300013104 Ga0157370_10620036 Ga0157370_106200362 112
290 3300013104 Ga0157370_10700953 Ga0157370_107009532 112
291 3300013105 Ga0157369_10008510 Ga0157369_1000851011 112
292 3300013105 Ga0157369_10014518 Ga0157369_1001451810 112
293 3300013105 Ga0157369_10259455 Ga0157369_102594552 112
294 3300013296 Ga0157374_10007342 Ga0157374_100073424 112
295 3300013296 Ga0157374_10050953 Ga0157374_100509534 112
296 3300013296 Ga0157374_10513022 Ga0157374_105130222 112
297 3300013296 Ga0157374_10862023 Ga0157374_108620231 112
298 3300013297 Ga0157378_10177225 Ga0157378_101772252 112
299 3300013297 Ga0157378_10403637 Ga0157378_104036372 112
300 3300013297 Ga0157378_10483881 Ga0157378_104838812 112
301 3300013306 Ga0163162_10002193 Ga0163162_1000219316 112
302 3300013306 Ga0163162_10019306 Ga0163162_100193064 112
303 3300013306 Ga0163162_10039481 Ga0163162_100394817 112
304 3300013306 Ga0163162_10282674 Ga0163162_102826742 112
305 3300013306 Ga0163162_10425596 Ga0163162_104255961 112
306 3300013306 Ga0163162_12223275 Ga0163162_122232752 112
307 3300013307 Ga0157372_10010278 Ga0157372_100102787 112
308 3300013307 Ga0157372_10017315 Ga0157372_100173154 112
309 3300013307 Ga0157372_10101634 Ga0157372_101016343 112
310 3300013307 Ga0157372_10126077 Ga0157372_101260774 112
311 3300013307 Ga0157372_10470989 Ga0157372_104709892 112
312 3300013307 Ga0157372_10479674 Ga0157372_104796742 112
313 3300013307 Ga0157372_10505769 Ga0157372_105057692 112
314 3300013307 Ga0157372_10666193 Ga0157372_106661932 112
315 3300013308 Ga0157375_10007261 Ga0157375_100072618 112
316 3300013308 Ga0157375_10087559 Ga0157375_100875593 112
317 3300013308 Ga0157375_10970445 Ga0157375_109704451 112
318 3300013308 Ga0157375_12224419 Ga0157375_122244191 112
319 3300013308 Ga0157375_12829655 Ga0157375_128296551 112
320 3300013308 Ga0157375_13671857 Ga0157375_136718571 112
321 3300014325 Ga0163163_10139040 Ga0163163_101390402 112
322 3300014325 Ga0163163_10185645 Ga0163163_101856452 112
323 3300014325 Ga0163163_12887016 Ga0163163_128870161 112
324 3300014326 Ga0157380_10414794 Ga0157380_104147941 112
325 3300014326 Ga0157380_10594697 Ga0157380_105946972 112
326 3300014326 Ga0157380_12412174 Ga0157380_124121742 112
327 3300014745 Ga0157377_10008049 Ga0157377_100080493 112
328 3300014745 Ga0157377_10264540 Ga0157377_102645402 112
329 3300014745 Ga0157377_10461175 Ga0157377_104611752 112
330 3300014968 Ga0157379_10085475 Ga0157379_100854752 112
331 3300014968 Ga0157379_10605657 Ga0157379_106056572 112
332 3300014969 Ga0157376_10006599 Ga0157376_100065996 112
333 3300014969 Ga0157376_10661862 Ga0157376_106618621 112
334 3300017792 Ga0163161_10006695 Ga0163161_100066956 112
335 3300017792 Ga0163161_10160993 Ga0163161_101609933 112
336 3300017792 Ga0163161_10241650 Ga0163161_102416502 112
337 3300025899 Ga0207642_10368139 Ga0207642_103681391 112
338 3300025903 Ga0207680_10041487 Ga0207680_100414872 112
339 3300025903 Ga0207680_10719785 Ga0207680_107197852 112
340 3300025904 Ga0207647_10062815 Ga0207647_100628152 112
341 3300025905 Ga0207685_10088628 Ga0207685_100886282 112
342 3300025907 Ga0207645_10024141 Ga0207645_100241414 112
343 3300025909 Ga0207705_10002807 Ga0207705_1000280714 112
344 3300025909 Ga0207705_10026743 Ga0207705_100267435 112
345 3300025909 Ga0207705_10071547 Ga0207705_100715472 112
346 3300025909 Ga0207705_10084511 Ga0207705_100845112 112
347 3300025909 Ga0207705_11166062 Ga0207705_111660622 112
348 3300025912 Ga0207707_10059337 Ga0207707_100593373 112
349 3300025912 Ga0207707_10194289 Ga0207707_101942893 112
350 3300025912 Ga0207707_10370432 Ga0207707_103704322 112
351 3300025912 Ga0207707_10795303 Ga0207707_107953032 112
352 3300025917 Ga0207660_10011907 Ga0207660_100119073 112
353 3300025917 Ga0207660_10119703 Ga0207660_101197032 112
354 3300025917 Ga0207660_10309496 Ga0207660_103094962 112
355 3300025917 Ga0207660_10491296 Ga0207660_104912962 112
356 3300025919 Ga0207657_10005023 Ga0207657_100050236 112
357 3300025919 Ga0207657_10029703 Ga0207657_100297035 112
358 3300025919 Ga0207657_10132123 Ga0207657_101321233 112
359 3300025919 Ga0207657_10186480 Ga0207657_101864803 112
360 3300025919 Ga0207657_10312403 Ga0207657_103124032 112
361 3300025920 Ga0207649_10264292 Ga0207649_102642922 112
362 3300025920 Ga0207649_10337821 Ga0207649_103378211 112
363 3300025921 Ga0207652_10000187 Ga0207652_1000018740 112
364 3300025921 Ga0207652_10000198 Ga0207652_1000019822 112
365 3300025921 Ga0207652_10029289 Ga0207652_100292895 112
366 3300025921 Ga0207652_10115311 Ga0207652_101153113 112
367 3300025921 Ga0207652_11844939 Ga0207652_118449391 112
368 3300025923 Ga0207681_10767913 Ga0207681_107679132 112
369 3300025926 Ga0207659_10022937 Ga0207659_100229374 112
370 3300025931 Ga0207644_10093875 Ga0207644_100938752 112
371 3300025931 Ga0207644_10227264 Ga0207644_102272641 112
372 3300025932 Ga0207690_10003750 Ga0207690_100037504 112
373 3300025932 Ga0207690_10048458 Ga0207690_100484583 112
374 3300025932 Ga0207690_10089507 Ga0207690_100895073 112
375 3300025933 Ga0207706_10005261 Ga0207706_100052615 112
376 3300025933 Ga0207706_10020556 Ga0207706_100205563 112
377 3300025933 Ga0207706_10375299 Ga0207706_103752992 112
378 3300025934 Ga0207686_10018765 Ga0207686_100187653 112
379 3300025934 Ga0207686_10357787 Ga0207686_103577872 112
380 3300025936 Ga0207670_10004279 Ga0207670_1000427910 112
381 3300025936 Ga0207670_10426793 Ga0207670_104267932 112
382 3300025941 Ga0207711_10561142 Ga0207711_105611422 112
383 3300025942 Ga0207689_10002851 Ga0207689_1000285112 112
384 3300025944 Ga0207661_10144280 Ga0207661_101442802 112
385 3300025944 Ga0207661_10190896 Ga0207661_101908962 112
386 3300025944 Ga0207661_10286707 Ga0207661_102867071 112
387 3300025944 Ga0207661_10707131 Ga0207661_107071313 112
388 3300025945 Ga0207679_10138763 Ga0207679_101387633 112
389 3300025945 Ga0207679_10240570 Ga0207679_102405701 112
390 3300025949 Ga0207667_10000492 Ga0207667_100004929 112
391 3300025949 Ga0207667_10027086 Ga0207667_100270863 112
392 3300025949 Ga0207667_10098972 Ga0207667_100989724 112
393 3300025949 Ga0207667_10597744 Ga0207667_105977442 112
394 3300025960 Ga0207651_10182526 Ga0207651_101825262 112
395 3300025960 Ga0207651_10399407 Ga0207651_103994072 112
396 3300025972 Ga0207668_10234022 Ga0207668_102340222 112
397 3300025981 Ga0207640_10445036 Ga0207640_104450362 112
398 3300025981 Ga0207640_12067380 Ga0207640_120673802 112
399 3300025986 Ga0207658_10797309 Ga0207658_107973092 112
400 3300025986 Ga0207658_11875546 Ga0207658_118755461 112
401 3300026023 Ga0207677_10043771 Ga0207677_100437712 112
402 3300026023 Ga0207677_10142611 Ga0207677_101426112 112
403 3300026035 Ga0207703_10615323 Ga0207703_106153231 112
404 3300026041 Ga0207639_10073993 Ga0207639_100739933 112
405 3300026041 Ga0207639_10330791 Ga0207639_103307913 112
406 3300026041 Ga0207639_10900829 Ga0207639_109008291 112
407 3300026067 Ga0207678_10018070 Ga0207678_100180707 112
408 3300026078 Ga0207702_10007374 Ga0207702_100073742 112
409 3300026088 Ga0207641_10123766 Ga0207641_101237663 112
410 3300026088 Ga0207641_10144518 Ga0207641_101445182 112
411 3300026089 Ga0207648_10043835 Ga0207648_100438354 112
412 3300026089 Ga0207648_10063299 Ga0207648_100632992 112
413 3300026089 Ga0207648_11048313 Ga0207648_110483131 112
414 3300026095 Ga0207676_10054925 Ga0207676_100549254 112
415 3300026095 Ga0207676_10086183 Ga0207676_100861834 112
416 3300026116 Ga0207674_10228855 Ga0207674_102288553 112
417 3300026116 Ga0207674_10373297 Ga0207674_103732972 112
418 3300026116 Ga0207674_10374571 Ga0207674_103745712 112
419 3300026118 Ga0207675_100160960 Ga0207675_1001609602 112
420 3300026118 Ga0207675_101440331 Ga0207675_1014403312 112
421 3300026121 Ga0207683_10012383 Ga0207683_100123836 112
422 3300026121 Ga0207683_11740019 Ga0207683_117400192 112
423 3300026142 Ga0207698_10026635 Ga0207698_100266353 112
424 3300026142 Ga0207698_10065708 Ga0207698_100657082 112
425 3300026142 Ga0207698_10159407 Ga0207698_101594072 112
426 3300026142 Ga0207698_10281058 Ga0207698_102810581 112
427 3300028380 Ga0268265_10473322 Ga0268265_104733222 112
428 3300028381 Ga0268264_10500232 Ga0268264_105002322 112
429 3300028381 Ga0268264_10674043 Ga0268264_106740432 112
430 3300032004 Ga0307414_10247074 Ga0307414_102470742 112
431 3300035170 Ga0373943_0813620 Ga0373943_0813620_48_386 112
432 3300035692 Ga0373935_0466453 Ga0373935_0466453_183_521 112
433 3300035725 Ga0373947_0037890 Ga0373947_0037890_1100_1438 112
434 3300037312 Ga0395899_0003604 Ga0395899_0003604_5169_5510 112
435 3300037312 Ga0395899_0007612 Ga0395899_0007612_3689_4030 112
436 3300037312 Ga0395899_0035542 Ga0395899_0035542_1347_1688 112
437 3300037312 Ga0395899_0039093 Ga0395899_0039093_2775_3116 112
438 3300037312 Ga0395899_0287047 Ga0395899_0287047_427_768 112
439 3300037312 Ga0395899_0824244 Ga0395899_0824244_215_556 112
440 3300037312 Ga0395899_0835106 Ga0395899_0835106_122_463 112
441 3300037418 Ga0395900_0026756 Ga0395900_0026756_1635_1976 112
442 3300037418 Ga0395900_0068173 Ga0395900_0068173_421_762 112
443 3300037418 Ga0395900_0076792 Ga0395900_0076792_811_1152 112
444 3300037418 Ga0395900_0197612 Ga0395900_0197612_998_1339 112
445 3300037418 Ga0395900_0514622 Ga0395900_0514622_427_768 112
446 3300037466 Ga0395898_0003818 Ga0395898_0003818_12353_12694 112
447 3300037466 Ga0395898_0041299 Ga0395898_0041299_3207_3548 112
448 3300037466 Ga0395898_0055555 Ga0395898_0055555_2052_2393 112
449 3300037466 Ga0395898_0063252 Ga0395898_0063252_47_388 112
450 3300037466 Ga0395898_0276176 Ga0395898_0276176_451_792 112
451 3300037466 Ga0395898_0516745 Ga0395898_0516745_417_758 112
452 3300037466 Ga0395898_0865374 Ga0395898_0865374_245_586 112
453 3300037471 Ga0395905_0285293 Ga0395905_0285293_284_625 112
454 3300037471 Ga0395905_0408526 Ga0395905_0408526_559_900 112
455 3300038443 Ga0395901_0006287 Ga0395901_0006287_7304_7645 112
456 3300038443 Ga0395901_0015165 Ga0395901_0015165_7077_7418 112
457 3300038443 Ga0395901_0041546 Ga0395901_0041546_2260_2601 112
458 3300038443 Ga0395901_0130611 Ga0395901_0130611_1126_1467 112
459 3300038443 Ga0395901_0161314 Ga0395901_0161314_172_513 112
460 3300038443 Ga0395901_0444758 Ga0395901_0444758_330_671 112
461 3300041451 Ga0451791_1417606 Ga0451791_1417606_133_477 112
462 3300041494 Ga0451837_0560980 Ga0451837_0560980_111_455 112
463 3300046537 Ga0495598_0251797 Ga0495598_0251797_64_405 112
464 3300047315 Ga0495581_0359628 Ga0495581_0359628_394_732 112
465 3300048910 Ga0496107_0710618 Ga0496107_0710618_99_437 112
466 3300048915 Ga0496112_0737494 Ga0496112_0737494_67_405 112
467 3300049570 Ga0501033_0060506 Ga0501033_0060506_1989_2330 112
468 3300049570 Ga0501033_0208755 Ga0501033_0208755_745_1086 112
469 3300049571 Ga0501034_0012357 Ga0501034_0012357_3535_3876 112
470 3300049571 Ga0501034_0041785 Ga0501034_0041785_542_883 112
471 3300049573 Ga0501037_0701793 Ga0501037_0701793_260_601 112
472 3300049574 Ga0501038_0659550 Ga0501038_0659550_189_530 112
473 3300049575 Ga0501039_1276274 Ga0501039_1276274_198_539 112
474 3300049579 Ga0501043_0216530 Ga0501043_0216530_909_1250 112
475 3300049586 Ga0501070_0020247 Ga0501070_0020247_1931_2272 112
476 3300049822 Ga0501035_0097171 Ga0501035_0097171_1028_1369 112
477 3300049822 Ga0501035_0114632 Ga0501035_0114632_411_752 112
478 3300049823 Ga0501044_0219155 Ga0501044_0219155_1241_1582 112
479 3300050512 nmdc:mga0n895_237077_c1 nmdc:mga0n895_237077_c1_689_1027 112
480 3300050513 nmdc:mga0rr50_600577_c1 nmdc:mga0rr50_600577_c1_77_415 112
481 2162886007 SwRhRL2b_contig_1580370 SwRhRL2b_0382.00004760 113
482 2162886007 SwRhRL2b_contig_942247 SwRhRL2b_0387.00006580 113
483 3300002459 JGI24751J29686_10000360 JGI24751J29686_1000036011 113
484 3300003322 rootL2_10182482 rootL2_101824822 113
485 3300003322 rootL2_10224766 rootL2_102247663 113
486 3300003322 rootL2_10300896 rootL2_103008961 113
487 3300003323 rootH1_10017808 rootH1_100178086 113
488 3300005288 Ga0065714_10101230 Ga0065714_101012302 113
489 3300005289 Ga0065704_10120433 Ga0065704_101204333 113
490 3300005289 Ga0065704_10494583 Ga0065704_104945832 113
491 3300005290 Ga0065712_10001246 Ga0065712_100012467 113
492 3300005290 Ga0065712_10010559 Ga0065712_100105592 113
493 3300005290 Ga0065712_10160118 Ga0065712_101601182 113
494 3300005293 Ga0065715_10004024 Ga0065715_100040246 113
495 3300005295 Ga0065707_10126934 Ga0065707_101269342 113
496 3300005328 Ga0070676_10063316 Ga0070676_100633162 113
497 3300005328 Ga0070676_10729671 Ga0070676_107296712 113
498 3300005329 Ga0070683_100004596 Ga0070683_1000045965 113
499 3300005330 Ga0070690_100424827 Ga0070690_1004248272 113
500 3300005331 Ga0070670_100005255 Ga0070670_1000052559 113
501 3300005331 Ga0070670_100015474 Ga0070670_1000154747 113
502 3300005331 Ga0070670_100169780 Ga0070670_1001697802 113
503 3300005331 Ga0070670_100285072 Ga0070670_1002850722 113
504 3300005331 Ga0070670_100385025 Ga0070670_1003850252 113
505 3300005331 Ga0070670_100951485 Ga0070670_1009514851 113
506 3300005333 Ga0070677_10078448 Ga0070677_100784483 113
507 3300005333 Ga0070677_10443069 Ga0070677_104430692 113
508 3300005334 Ga0068869_100086488 Ga0068869_1000864882 113
509 3300005334 Ga0068869_100106493 Ga0068869_1001064931 113
510 3300005334 Ga0068869_100163534 Ga0068869_1001635344 113
511 3300005334 Ga0068869_100231521 Ga0068869_1002315212 113
512 3300005334 Ga0068869_100324197 Ga0068869_1003241972 113
513 3300005334 Ga0068869_100553890 Ga0068869_1005538901 113
514 3300005334 Ga0068869_101464314 Ga0068869_1014643142 113
515 3300005337 Ga0070682_100978604 Ga0070682_1009786041 113
516 3300005338 Ga0068868_100266290 Ga0068868_1002662902 113
517 3300005338 Ga0068868_100344639 Ga0068868_1003446391 113
518 3300005339 Ga0070660_101362826 Ga0070660_1013628262 113
519 3300005340 Ga0070689_100004881 Ga0070689_1000048813 113
520 3300005340 Ga0070689_100102142 Ga0070689_1001021424 113
521 3300005340 Ga0070689_100129781 Ga0070689_1001297812 113
522 3300005340 Ga0070689_100429290 Ga0070689_1004292901 113
523 3300005343 Ga0070687_100097851 Ga0070687_1000978511 113
524 3300005343 Ga0070687_100225299 Ga0070687_1002252992 113
525 3300005343 Ga0070687_100785099 Ga0070687_1007850991 113
526 3300005344 Ga0070661_100000111 Ga0070661_10000011130 113
527 3300005347 Ga0070668_100072114 Ga0070668_1000721143 113
528 3300005347 Ga0070668_100162676 Ga0070668_1001626762 113
529 3300005347 Ga0070668_100167301 Ga0070668_1001673012 113
530 3300005347 Ga0070668_100876369 Ga0070668_1008763692 113
531 3300005347 Ga0070668_100935392 Ga0070668_1009353923 113
532 3300005353 Ga0070669_100002767 Ga0070669_1000027674 113
533 3300005353 Ga0070669_100145398 Ga0070669_1001453983 113
534 3300005353 Ga0070669_100395934 Ga0070669_1003959342 113
535 3300005353 Ga0070669_100423097 Ga0070669_1004230973 113
536 3300005353 Ga0070669_101074626 Ga0070669_1010746261 113
537 3300005353 Ga0070669_101488746 Ga0070669_1014887461 113
538 3300005354 Ga0070675_100001118 Ga0070675_10000111822 113
539 3300005354 Ga0070675_100018336 Ga0070675_1000183364 113
540 3300005355 Ga0070671_100639121 Ga0070671_1006391211 113
541 3300005356 Ga0070674_100009989 Ga0070674_1000099894 113
542 3300005356 Ga0070674_100242382 Ga0070674_1002423822 113
543 3300005356 Ga0070674_100845386 Ga0070674_1008453862 113
544 3300005356 Ga0070674_102160360 Ga0070674_1021603601 113
545 3300005364 Ga0070673_100129777 Ga0070673_1001297773 113
546 3300005364 Ga0070673_100174884 Ga0070673_1001748842 113
547 3300005364 Ga0070673_100220071 Ga0070673_1002200712 113
548 3300005364 Ga0070673_100280754 Ga0070673_1002807543 113
549 3300005364 Ga0070673_101225394 Ga0070673_1012253942 113
550 3300005365 Ga0070688_100027855 Ga0070688_1000278552 113
551 3300005365 Ga0070688_100031884 Ga0070688_1000318841 113
552 3300005365 Ga0070688_100416517 Ga0070688_1004165172 113
553 3300005366 Ga0070659_100006959 Ga0070659_1000069599 113
554 3300005367 Ga0070667_100240360 Ga0070667_1002403603 113
555 3300005367 Ga0070667_101487820 Ga0070667_1014878202 113
556 3300005367 Ga0070667_101978532 Ga0070667_1019785322 113
557 3300005438 Ga0070701_10039194 Ga0070701_100391941 113
558 3300005438 Ga0070701_10313150 Ga0070701_103131502 113
559 3300005441 Ga0070700_100071081 Ga0070700_1000710811 113
560 3300005441 Ga0070700_100366148 Ga0070700_1003661482 113
561 3300005455 Ga0070663_100476845 Ga0070663_1004768452 113
562 3300005456 Ga0070678_100352482 Ga0070678_1003524821 113
563 3300005456 Ga0070678_100488904 Ga0070678_1004889043 113
564 3300005456 Ga0070678_101826733 Ga0070678_1018267331 113
565 3300005456 Ga0070678_101880785 Ga0070678_1018807851 113
566 3300005456 Ga0070678_102082329 Ga0070678_1020823291 113
567 3300005457 Ga0070662_100006327 Ga0070662_1000063279 113
568 3300005459 Ga0068867_100014817 Ga0068867_1000148172 113
569 3300005459 Ga0068867_100140807 Ga0068867_1001408074 113
570 3300005459 Ga0068867_101385560 Ga0068867_1013855601 113
571 3300005466 Ga0070685_10011831 Ga0070685_100118314 113
572 3300005466 Ga0070685_10043005 Ga0070685_100430054 113
573 3300005466 Ga0070685_10094402 Ga0070685_100944023 113
574 3300005466 Ga0070685_10193721 Ga0070685_101937212 113
575 3300005466 Ga0070685_10375101 Ga0070685_103751011 113
576 3300005467 Ga0070706_101110149 Ga0070706_1011101491 113
577 3300005471 Ga0070698_100001074 Ga0070698_10000107417 113
578 3300005471 Ga0070698_100009628 Ga0070698_1000096289 113
579 3300005471 Ga0070698_100015207 Ga0070698_1000152078 113
580 3300005471 Ga0070698_100182933 Ga0070698_1001829335 113
581 3300005518 Ga0070699_100068012 Ga0070699_1000680124 113
582 3300005535 Ga0070684_100012277 Ga0070684_1000122775 113
583 3300005536 Ga0070697_100241043 Ga0070697_1002410433 113
584 3300005539 Ga0068853_100014798 Ga0068853_1000147984 113
585 3300005539 Ga0068853_100027463 Ga0068853_1000274635 113
586 3300005539 Ga0068853_100319566 Ga0068853_1003195663 113
587 3300005539 Ga0068853_100515092 Ga0068853_1005150923 113
588 3300005539 Ga0068853_100597028 Ga0068853_1005970282 113
589 3300005539 Ga0068853_101002797 Ga0068853_1010027971 113
590 3300005543 Ga0070672_100036130 Ga0070672_1000361305 113
591 3300005543 Ga0070672_101665980 Ga0070672_1016659801 113
592 3300005543 Ga0070672_102131282 Ga0070672_1021312822 113
593 3300005544 Ga0070686_100121073 Ga0070686_1001210733 113
594 3300005544 Ga0070686_100641040 Ga0070686_1006410402 113
595 3300005544 Ga0070686_101911460 Ga0070686_1019114601 113
596 3300005545 Ga0070695_100188470 Ga0070695_1001884702 113
597 3300005545 Ga0070695_101604237 Ga0070695_1016042371 113
598 3300005549 Ga0070704_100580009 Ga0070704_1005800092 113
599 3300005549 Ga0070704_101042199 Ga0070704_1010421992 113
600 3300005563 Ga0068855_100933037 Ga0068855_1009330372 113
601 3300005564 Ga0070664_100000243 Ga0070664_10000024326 113
602 3300005577 Ga0068857_100002097 Ga0068857_10000209715 113
603 3300005577 Ga0068857_100017217 Ga0068857_1000172174 113
604 3300005577 Ga0068857_100097876 Ga0068857_1000978763 113
605 3300005577 Ga0068857_100343486 Ga0068857_1003434862 113
606 3300005577 Ga0068857_100667668 Ga0068857_1006676682 113
607 3300005577 Ga0068857_100778807 Ga0068857_1007788072 113
608 3300005577 Ga0068857_101393431 Ga0068857_1013934311 113
609 3300005577 Ga0068857_102091613 Ga0068857_1020916131 113
610 3300005578 Ga0068854_100317444 Ga0068854_1003174442 113
611 3300005614 Ga0068856_100335347 Ga0068856_1003353473 113
612 3300005614 Ga0068856_101690405 Ga0068856_1016904052 113
613 3300005616 Ga0068852_102072628 Ga0068852_1020726282 113
614 3300005617 Ga0068859_100016081 Ga0068859_1000160815 113
615 3300005617 Ga0068859_100059890 Ga0068859_1000598904 113
616 3300005617 Ga0068859_100186862 Ga0068859_1001868622 113
617 3300005617 Ga0068859_100200658 Ga0068859_1002006583 113
618 3300005617 Ga0068859_100339164 Ga0068859_1003391643 113
619 3300005617 Ga0068859_100531688 Ga0068859_1005316883 113
620 3300005617 Ga0068859_101789151 Ga0068859_1017891511 113
621 3300005618 Ga0068864_100006400 Ga0068864_1000064007 113
622 3300005618 Ga0068864_100237825 Ga0068864_1002378253 113
623 3300005618 Ga0068864_100360431 Ga0068864_1003604312 113
624 3300005618 Ga0068864_100390057 Ga0068864_1003900572 113
625 3300005718 Ga0068866_10029543 Ga0068866_100295433 113
626 3300005718 Ga0068866_10217925 Ga0068866_102179252 113
627 3300005719 Ga0068861_100007430 Ga0068861_1000074305 113
628 3300005719 Ga0068861_100052573 Ga0068861_1000525733 113
629 3300005719 Ga0068861_100157247 Ga0068861_1001572472 113
630 3300005719 Ga0068861_100286841 Ga0068861_1002868411 113
631 3300005719 Ga0068861_100346859 Ga0068861_1003468591 113
632 3300005719 Ga0068861_100502652 Ga0068861_1005026522 113
633 3300005719 Ga0068861_101125681 Ga0068861_1011256813 113
634 3300005840 Ga0068870_10009968 Ga0068870_100099684 113
635 3300005840 Ga0068870_10211602 Ga0068870_102116021 113
636 3300005841 Ga0068863_100014068 Ga0068863_1000140689 113
637 3300005841 Ga0068863_100020130 Ga0068863_1000201302 113
638 3300005841 Ga0068863_100063616 Ga0068863_1000636164 113
639 3300005841 Ga0068863_100986907 Ga0068863_1009869071 113
640 3300005841 Ga0068863_101277784 Ga0068863_1012777842 113
641 3300005841 Ga0068863_101457457 Ga0068863_1014574572 113
642 3300005841 Ga0068863_101834240 Ga0068863_1018342402 113
643 3300005842 Ga0068858_100056174 Ga0068858_1000561745 113
644 3300005842 Ga0068858_101039195 Ga0068858_1010391952 113
645 3300005843 Ga0068860_100038000 Ga0068860_1000380004 113
646 3300005843 Ga0068860_100364160 Ga0068860_1003641602 113
647 3300005843 Ga0068860_100580204 Ga0068860_1005802042 113
648 3300005843 Ga0068860_100593590 Ga0068860_1005935902 113
649 3300005843 Ga0068860_100838760 Ga0068860_1008387602 113
650 3300005843 Ga0068860_100865714 Ga0068860_1008657142 113
651 3300005843 Ga0068860_101150488 Ga0068860_1011504882 113
652 3300005844 Ga0068862_100114924 Ga0068862_1001149242 113
653 3300005844 Ga0068862_100195821 Ga0068862_1001958212 113
654 3300005844 Ga0068862_100197710 Ga0068862_1001977102 113
655 3300005844 Ga0068862_100319909 Ga0068862_1003199092 113
656 3300005844 Ga0068862_101092915 Ga0068862_1010929151 113
657 3300005844 Ga0068862_101368253 Ga0068862_1013682531 113
658 3300005844 Ga0068862_101461805 Ga0068862_1014618052 113
659 3300005844 Ga0068862_101519662 Ga0068862_1015196621 113
660 3300005985 Ga0081539_10120430 Ga0081539_101204302 113
661 3300006163 Ga0070715_10027365 Ga0070715_100273653 113
662 3300006195 Ga0075366_10183517 Ga0075366_101835172 113
663 3300006237 Ga0097621_100614270 Ga0097621_1006142702 113
664 3300006358 Ga0068871_100014874 Ga0068871_1000148746 113
665 3300006844 Ga0075428_100012646 Ga0075428_1000126468 113
666 3300006844 Ga0075428_100416303 Ga0075428_1004163033 113
667 3300006844 Ga0075428_100452833 Ga0075428_1004528332 113
668 3300006844 Ga0075428_100604721 Ga0075428_1006047213 113
669 3300006846 Ga0075430_100044970 Ga0075430_1000449704 113
670 3300006852 Ga0075433_11430664 Ga0075433_114306642 113
671 3300006880 Ga0075429_100035605 Ga0075429_1000356054 113
672 3300006880 Ga0075429_100086034 Ga0075429_1000860342 113
673 3300006881 Ga0068865_100456138 Ga0068865_1004561382 113
674 3300006881 Ga0068865_101624266 Ga0068865_1016242661 113
675 3300006931 Ga0097620_100016082 Ga0097620_1000160824 113
676 3300006931 Ga0097620_100059889 Ga0097620_1000598894 113
677 3300006931 Ga0097620_100186869 Ga0097620_1001868692 113
678 3300006931 Ga0097620_100200656 Ga0097620_1002006563 113
679 3300006931 Ga0097620_100339163 Ga0097620_1003391633 113
680 3300006931 Ga0097620_100531691 Ga0097620_1005316912 113
681 3300006931 Ga0097620_101789168 Ga0097620_1017891681 113
682 3300009094 Ga0111539_10140833 Ga0111539_101408332 113
683 3300009094 Ga0111539_10161304 Ga0111539_101613042 113
684 3300009094 Ga0111539_10478553 Ga0111539_104785533 113
685 3300009094 Ga0111539_10926299 Ga0111539_109262992 113
686 3300009094 Ga0111539_12108073 Ga0111539_121080732 113
687 3300009094 Ga0111539_12418412 Ga0111539_124184122 113
688 3300009101 Ga0105247_10005318 Ga0105247_100053181 113
689 3300009101 Ga0105247_10273914 Ga0105247_102739142 113
690 3300009147 Ga0114129_10047706 Ga0114129_100477067 113
691 3300009147 Ga0114129_13240719 Ga0114129_132407191 113
692 3300009148 Ga0105243_10369475 Ga0105243_103694751 113
693 3300009174 Ga0105241_10521220 Ga0105241_105212202 113
694 3300009174 Ga0105241_12507995 Ga0105241_125079951 113
695 3300009176 Ga0105242_10036767 Ga0105242_100367671 113
696 3300009176 Ga0105242_10041913 Ga0105242_100419135 113
697 3300009176 Ga0105242_10057460 Ga0105242_100574601 113
698 3300009176 Ga0105242_10078592 Ga0105242_100785921 113
699 3300009176 Ga0105242_10554226 Ga0105242_105542262 113
700 3300009176 Ga0105242_11272156 Ga0105242_112721562 113
701 3300009176 Ga0105242_13050904 Ga0105242_130509041 113
702 3300009177 Ga0105248_10405758 Ga0105248_104057582 113
703 3300009553 Ga0105249_10001044 Ga0105249_1000104422 113
704 3300009553 Ga0105249_10003251 Ga0105249_100032518 113
705 3300009553 Ga0105249_10008489 Ga0105249_100084899 113
706 3300009553 Ga0105249_10021033 Ga0105249_100210336 113
707 3300009553 Ga0105249_10155331 Ga0105249_101553312 113
708 3300009553 Ga0105249_10350109 Ga0105249_103501093 113
709 3300009553 Ga0105249_10560999 Ga0105249_105609992 113
710 3300009553 Ga0105249_10727350 Ga0105249_107273502 113
711 3300009553 Ga0105249_11556370 Ga0105249_115563701 113
712 3300011119 Ga0105246_10178053 Ga0105246_101780532 113
713 3300011119 Ga0105246_10500332 Ga0105246_105003322 113
714 3300013100 Ga0157373_10527391 Ga0157373_105273911 113
715 3300013296 Ga0157374_10191600 Ga0157374_101916003 113
716 3300013297 Ga0157378_11368833 Ga0157378_113688332 113
717 3300013297 Ga0157378_13170480 Ga0157378_131704801 113
718 3300013306 Ga0163162_10058280 Ga0163162_100582804 113
719 3300013306 Ga0163162_10188340 Ga0163162_101883402 113
720 3300013306 Ga0163162_10247492 Ga0163162_102474922 113
721 3300013306 Ga0163162_10840113 Ga0163162_108401132 113
722 3300013306 Ga0163162_11579920 Ga0163162_115799203 113
723 3300013307 Ga0157372_13483023 Ga0157372_134830231 113
724 3300013308 Ga0157375_10011768 Ga0157375_100117684 113
725 3300013308 Ga0157375_10076285 Ga0157375_100762852 113
726 3300013308 Ga0157375_10097502 Ga0157375_100975022 113
727 3300013308 Ga0157375_12273375 Ga0157375_122733752 113
728 3300014325 Ga0163163_10042028 Ga0163163_100420284 113
729 3300014325 Ga0163163_10061006 Ga0163163_100610063 113
730 3300014325 Ga0163163_10188446 Ga0163163_101884464 113
731 3300014325 Ga0163163_10302420 Ga0163163_103024201 113
732 3300014325 Ga0163163_11429461 Ga0163163_114294612 113
733 3300014326 Ga0157380_10018730 Ga0157380_100187303 113
734 3300014326 Ga0157380_10027818 Ga0157380_100278184 113
735 3300014326 Ga0157380_10266159 Ga0157380_102661592 113
736 3300014326 Ga0157380_10739259 Ga0157380_107392592 113
737 3300014326 Ga0157380_11579148 Ga0157380_115791481 113
738 3300014326 Ga0157380_11894687 Ga0157380_118946872 113
739 3300014745 Ga0157377_10000678 Ga0157377_100006789 113
740 3300014745 Ga0157377_10010005 Ga0157377_100100053 113
741 3300014745 Ga0157377_10365055 Ga0157377_103650552 113
742 3300014745 Ga0157377_10484089 Ga0157377_104840892 113
743 3300014745 Ga0157377_10684990 Ga0157377_106849901 113
744 3300014968 Ga0157379_10667471 Ga0157379_106674711 113
745 3300014968 Ga0157379_10833434 Ga0157379_108334342 113
746 3300014969 Ga0157376_10171063 Ga0157376_101710632 113
747 3300014969 Ga0157376_11339872 Ga0157376_113398721 113
748 3300017792 Ga0163161_10303358 Ga0163161_103033582 113
749 3300017792 Ga0163161_10630074 Ga0163161_106300743 113
750 3300021384 Ga0213876_10093846 Ga0213876_100938462 113
751 3300025315 Ga0207697_10015840 Ga0207697_100158402 113
752 3300025315 Ga0207697_10055750 Ga0207697_100557502 113
753 3300025899 Ga0207642_10997564 Ga0207642_109975641 113
754 3300025900 Ga0207710_10008757 Ga0207710_100087572 113
755 3300025905 Ga0207685_10375486 Ga0207685_103754862 113
756 3300025907 Ga0207645_10034576 Ga0207645_100345761 113
757 3300025907 Ga0207645_10273779 Ga0207645_102737791 113
758 3300025908 Ga0207643_10009087 Ga0207643_100090874 113
759 3300025908 Ga0207643_10023317 Ga0207643_100233173 113
760 3300025908 Ga0207643_10042085 Ga0207643_100420852 113
761 3300025910 Ga0207684_11653904 Ga0207684_116539041 113
762 3300025918 Ga0207662_10003292 Ga0207662_100032927 113
763 3300025918 Ga0207662_10059491 Ga0207662_100594914 113
764 3300025918 Ga0207662_10073654 Ga0207662_100736544 113
765 3300025919 Ga0207657_10812087 Ga0207657_108120872 113
766 3300025920 Ga0207649_10019365 Ga0207649_100193656 113
767 3300025923 Ga0207681_10002024 Ga0207681_1000202413 113
768 3300025923 Ga0207681_10165742 Ga0207681_101657423 113
769 3300025923 Ga0207681_10187394 Ga0207681_101873943 113
770 3300025923 Ga0207681_10448510 Ga0207681_104485102 113
771 3300025925 Ga0207650_10023273 Ga0207650_100232734 113
772 3300025925 Ga0207650_10039444 Ga0207650_100394442 113
773 3300025925 Ga0207650_10145425 Ga0207650_101454252 113
774 3300025925 Ga0207650_10237979 Ga0207650_102379792 113
775 3300025926 Ga0207659_10151721 Ga0207659_101517212 113
776 3300025926 Ga0207659_10271986 Ga0207659_102719863 113
777 3300025926 Ga0207659_10571682 Ga0207659_105716822 113
778 3300025932 Ga0207690_10030767 Ga0207690_100307673 113
779 3300025933 Ga0207706_10020449 Ga0207706_100204496 113
780 3300025933 Ga0207706_11076955 Ga0207706_110769551 113
781 3300025934 Ga0207686_10001189 Ga0207686_100011899 113
782 3300025934 Ga0207686_10012292 Ga0207686_100122925 113
783 3300025934 Ga0207686_10040292 Ga0207686_100402923 113
784 3300025936 Ga0207670_10080757 Ga0207670_100807574 113
785 3300025936 Ga0207670_10094296 Ga0207670_100942964 113
786 3300025936 Ga0207670_10137271 Ga0207670_101372712 113
787 3300025936 Ga0207670_10501171 Ga0207670_105011714 113
788 3300025936 Ga0207670_11743416 Ga0207670_117434161 113
789 3300025937 Ga0207669_10019812 Ga0207669_100198124 113
790 3300025937 Ga0207669_10535287 Ga0207669_105352872 113
791 3300025940 Ga0207691_10017962 Ga0207691_100179625 113
792 3300025940 Ga0207691_10554754 Ga0207691_105547542 113
793 3300025940 Ga0207691_10774475 Ga0207691_107744752 113
794 3300025941 Ga0207711_10480404 Ga0207711_104804042 113
795 3300025942 Ga0207689_10007932 Ga0207689_100079324 113
796 3300025942 Ga0207689_10023684 Ga0207689_100236842 113
797 3300025942 Ga0207689_10103461 Ga0207689_101034613 113
798 3300025942 Ga0207689_10236602 Ga0207689_102366022 113
799 3300025942 Ga0207689_10505107 Ga0207689_105051072 113
800 3300025942 Ga0207689_11516867 Ga0207689_115168671 113
801 3300025944 Ga0207661_10034029 Ga0207661_100340292 113
802 3300025944 Ga0207661_10169413 Ga0207661_101694133 113
803 3300025945 Ga0207679_10000091 Ga0207679_1000009154 113
804 3300025945 Ga0207679_10445790 Ga0207679_104457902 113
805 3300025960 Ga0207651_10111794 Ga0207651_101117942 113
806 3300025960 Ga0207651_10184834 Ga0207651_101848342 113
807 3300025960 Ga0207651_10762505 Ga0207651_107625051 113
808 3300025960 Ga0207651_10764818 Ga0207651_107648182 113
809 3300025960 Ga0207651_11391031 Ga0207651_113910312 113
810 3300025961 Ga0207712_10001457 Ga0207712_1000145712 113
811 3300025961 Ga0207712_10033161 Ga0207712_100331613 113
812 3300025961 Ga0207712_10112787 Ga0207712_101127874 113
813 3300025961 Ga0207712_10318529 Ga0207712_103185291 113
814 3300025961 Ga0207712_10370752 Ga0207712_103707521 113
815 3300025961 Ga0207712_10450586 Ga0207712_104505862 113
816 3300025972 Ga0207668_10094208 Ga0207668_100942082 113
817 3300025972 Ga0207668_10098112 Ga0207668_100981124 113
818 3300025972 Ga0207668_10171258 Ga0207668_101712582 113
819 3300025972 Ga0207668_11869941 Ga0207668_118699411 113
820 3300025981 Ga0207640_10181913 Ga0207640_101819132 113
821 3300025981 Ga0207640_10365833 Ga0207640_103658333 113
822 3300025986 Ga0207658_10581807 Ga0207658_105818071 113
823 3300025986 Ga0207658_11803949 Ga0207658_118039492 113
824 3300026023 Ga0207677_10091214 Ga0207677_100912143 113
825 3300026023 Ga0207677_10608853 Ga0207677_106088532 113
826 3300026023 Ga0207677_10925223 Ga0207677_109252232 113
827 3300026035 Ga0207703_10822432 Ga0207703_108224321 113
828 3300026035 Ga0207703_11126320 Ga0207703_111263202 113
829 3300026041 Ga0207639_10019684 Ga0207639_100196843 113
830 3300026041 Ga0207639_10092796 Ga0207639_100927961 113
831 3300026041 Ga0207639_10458427 Ga0207639_104584272 113
832 3300026041 Ga0207639_10536754 Ga0207639_105367542 113
833 3300026075 Ga0207708_10017202 Ga0207708_100172026 113
834 3300026075 Ga0207708_10147513 Ga0207708_101475133 113
835 3300026075 Ga0207708_10190030 Ga0207708_101900303 113
836 3300026075 Ga0207708_10514081 Ga0207708_105140811 113
837 3300026075 Ga0207708_11256877 Ga0207708_112568772 113
838 3300026088 Ga0207641_10002685 Ga0207641_1000268510 113
839 3300026088 Ga0207641_10014674 Ga0207641_100146742 113
840 3300026088 Ga0207641_10021780 Ga0207641_100217805 113
841 3300026088 Ga0207641_10205387 Ga0207641_102053871 113
842 3300026088 Ga0207641_11370123 Ga0207641_113701231 113
843 3300026089 Ga0207648_10008642 Ga0207648_100086426 113
844 3300026089 Ga0207648_10176544 Ga0207648_101765444 113
845 3300026089 Ga0207648_10215118 Ga0207648_102151182 113
846 3300026089 Ga0207648_10829501 Ga0207648_108295012 113
847 3300026095 Ga0207676_10027882 Ga0207676_100278822 113
848 3300026095 Ga0207676_10147746 Ga0207676_101477462 113
849 3300026095 Ga0207676_10474709 Ga0207676_104747092 113
850 3300026095 Ga0207676_12096474 Ga0207676_120964741 113
851 3300026116 Ga0207674_10006896 Ga0207674_100068965 113
852 3300026116 Ga0207674_10023357 Ga0207674_100233574 113
853 3300026116 Ga0207674_10353433 Ga0207674_103534331 113
854 3300026118 Ga0207675_100000085 Ga0207675_10000008555 113
855 3300026118 Ga0207675_100011340 Ga0207675_1000113406 113
856 3300026118 Ga0207675_100142715 Ga0207675_1001427153 113
857 3300026118 Ga0207675_100187137 Ga0207675_1001871372 113
858 3300026118 Ga0207675_100294295 Ga0207675_1002942951 113
859 3300026118 Ga0207675_100335370 Ga0207675_1003353703 113
860 3300026118 Ga0207675_100728933 Ga0207675_1007289331 113
861 3300026118 Ga0207675_100895081 Ga0207675_1008950812 113
862 3300026118 Ga0207675_102562642 Ga0207675_1025626421 113
863 3300026121 Ga0207683_10826837 Ga0207683_108268372 113
864 3300026121 Ga0207683_11002180 Ga0207683_110021802 113
865 3300026142 Ga0207698_10033125 Ga0207698_100331253 113
866 3300027907 Ga0207428_10050789 Ga0207428_100507895 113
867 3300027907 Ga0207428_10315430 Ga0207428_103154302 113
868 3300028380 Ga0268265_10004802 Ga0268265_100048023 113
869 3300028380 Ga0268265_10066375 Ga0268265_100663754 113
870 3300028380 Ga0268265_10321709 Ga0268265_103217091 113
871 3300028380 Ga0268265_11300289 Ga0268265_113002892 113
872 3300028380 Ga0268265_11311065 Ga0268265_113110652 113
873 3300028380 Ga0268265_11355816 Ga0268265_113558162 113
874 3300028381 Ga0268264_10027341 Ga0268264_100273414 113
875 3300028381 Ga0268264_10038894 Ga0268264_100388942 113
876 3300028381 Ga0268264_10081403 Ga0268264_100814033 113
877 3300028381 Ga0268264_10271614 Ga0268264_102716141 113
878 3300028381 Ga0268264_10667574 Ga0268264_106675742 113
879 3300028381 Ga0268264_10709910 Ga0268264_107099103 113
880 3300028381 Ga0268264_11033787 Ga0268264_110337871 113
881 3300028381 Ga0268264_11254784 Ga0268264_112547841 113
882 3300028381 Ga0268264_11602209 Ga0268264_116022092 113
883 3300028786 Ga0307517_10510855 Ga0307517_105108551 113
884 3300030731 Ga0316177_1121841 Ga0316177_11218412 113
885 3300031239 Ga0265328_10276544 Ga0265328_102765442 113
886 3300031251 Ga0265327_10009266 Ga0265327_100092662 113
887 3300031456 Ga0307513_10219809 Ga0307513_102198093 113
888 3300031456 Ga0307513_10550569 Ga0307513_105505692 113
889 3300031456 Ga0307513_11048326 Ga0307513_110483261 113
890 3300031507 Ga0307509_10106400 Ga0307509_101064003 113
891 3300031595 Ga0265313_10098314 Ga0265313_100983141 113
892 3300032004 Ga0307414_10290691 Ga0307414_102906912 113
893 3300032005 Ga0307411_10307778 Ga0307411_103077781 113
894 3300035113 Ga0373936_0292345 Ga0373936_0292345_160_501 113
895 3300035172 Ga0373955_0049638 Ga0373955_0049638_418_759 113
896 3300035410 Ga0373924_0016787 Ga0373924_0016787_2399_2740 113
897 3300035692 Ga0373935_0135645 Ga0373935_0135645_435_776 113
898 3300036401 Ga0373937_0028695 Ga0373937_0028695_4389_4730 113
899 3300037418 Ga0395900_0890876 Ga0395900_0890876_285_629 113
900 3300039437 Ga0436365_1066023 Ga0436365_1066023_1389_1733 113
901 3300039437 Ga0436365_1111130 Ga0436365_1111130_1153_1497 113
902 3300041404 Ga0439436_0027239 Ga0439436_0027239_847_1191 113
903 3300041406 Ga0439439_0018325 Ga0439439_0018325_900_1241 113
904 3300041406 Ga0439439_0060288 Ga0439439_0060288_32_373 113
905 3300041413 Ga0439465_0370875 Ga0439465_0370875_160_501 113
906 3300041441 Ga0451787_601744 Ga0451787_601744_60_404 113
907 3300041443 Ga0451789_1085436 Ga0451789_1085436_122_469 113
908 3300041451 Ga0451791_0709903 Ga0451791_0709903_277_621 113
909 3300041451 Ga0451791_0976880 Ga0451791_0976880_382_729 113
910 3300041453 Ga0451797_0143917 Ga0451797_0143917_42_386 113
911 3300041459 Ga0451800_0573962 Ga0451800_0573962_159_500 113
912 3300041460 Ga0451802_0505948 Ga0451802_0505948_118_459 113
913 3300041460 Ga0451802_0744852 Ga0451802_0744852_441_785 113
914 3300041486 Ga0451807_1283653 Ga0451807_1283653_16_357 113
915 3300041486 Ga0451807_2598025 Ga0451807_2598025_45_386 113
916 3300041491 Ga0451833_0407819 Ga0451833_0407819_245_589 113
917 3300041507 Ga0451851_0639284 Ga0451851_0639284_226_573 113
918 3300041509 Ga0451843_0288465 Ga0451843_0288465_454_801 113
919 3300041512 Ga0451853_0925438 Ga0451853_0925438_284_628 113
920 3300041512 Ga0451853_1827383 Ga0451853_1827383_340_684 113
921 3300041997 Ga0439431_0109007 Ga0439431_0109007_231_572 113
922 3300041999 Ga0439433_0074625 Ga0439433_0074625_57_398 113
923 3300042001 Ga0439441_001674 Ga0439441_001674_756_1100 113
924 3300042004 Ga0439445_0056666 Ga0439445_0056666_177_518 113
925 3300042007 Ga0439449_0008946 Ga0439449_0008946_565_909 113
926 3300042007 Ga0439449_0012910 Ga0439449_0012910_2215_2556 113
927 3300042011 Ga0439454_013571 Ga0439454_013571_109_450 113
928 3300042014 Ga0439457_000874 Ga0439457_000874_7793_8137 113
929 3300042015 Ga0439462_0004114 Ga0439462_0004114_2737_3081 113
930 3300042124 Ga0450922_022258 Ga0450922_022258_282_623 113
931 3300042128 Ga0450897_022153 Ga0450897_022153_25_366 113
932 3300042131 Ga0450894_025993 Ga0450894_025993_323_664 113
933 3300042133 Ga0450896_044332 Ga0450896_044332_233_574 113
934 3300042134 Ga0450898_020988 Ga0450898_020988_269_610 113
935 3300042135 Ga0450899_012799 Ga0450899_012799_55_396 113
936 3300042435 Ga0439434_0261570 Ga0439434_0261570_198_539 113
937 3300042436 Ga0439435_0055381 Ga0439435_0055381_29_370 113
938 3300042437 Ga0439444_0070272 Ga0439444_0070272_297_641 113
939 3300042438 Ga0439459_0142367 Ga0439459_0142367_203_544 113
940 3300042439 Ga0439464_0129699 Ga0439464_0129699_144_485 113
941 3300042461 Ga0439460_0010547 Ga0439460_0010547_343_687 113
942 3300042876 Ga0451577_1644303 Ga0451577_1644303_187_528 113
943 3300046454 Ga0495592_0126013 Ga0495592_0126013_575_916 113
944 3300046460 Ga0495638_0035545 Ga0495638_0035545_376_723 113
945 3300046491 Ga0495584_0174665 Ga0495584_0174665_319_660 113
946 3300046511 Ga0495608_0066795 Ga0495608_0066795_182_523 113
947 3300046514 Ga0495618_0221260 Ga0495618_0221260_761_1102 113
948 3300046517 Ga0495630_0014167 Ga0495630_0014167_192_533 113
949 3300046519 Ga0495632_0213052 Ga0495632_0213052_267_614 113
950 3300046522 Ga0495643_0007703 Ga0495643_0007703_6522_6863 113
951 3300046533 Ga0495640_0081502 Ga0495640_0081502_77_418 113
952 3300046537 Ga0495598_0037398 Ga0495598_0037398_886_1227 113
953 3300046539 Ga0495621_0074477 Ga0495621_0074477_528_869 113
954 3300046559 Ga0495667_0752181 Ga0495667_0752181_229_570 113
955 3300046642 Ga0495634_0099314 Ga0495634_0099314_22_363 113
956 3300046648 Ga0495611_0129352 Ga0495611_0129352_502_843 113
957 3300046675 Ga0495657_0108124 Ga0495657_0108124_1388_1729 113
958 3300046683 Ga0495658_0128425 Ga0495658_0128425_705_1046 113
959 3300046689 Ga0495613_0110120 Ga0495613_0110120_1460_1801 113
960 3300046809 Ga0495600_0736454 Ga0495600_0736454_45_386 113
961 3300047317 Ga0495604_0227112 Ga0495604_0227112_750_1091 113
962 3300047318 Ga0495636_0690415 Ga0495636_0690415_141_482 113
963 3300047320 Ga0495672_0061725 Ga0495672_0061725_623_964 113
964 3300047320 Ga0495672_0362970 Ga0495672_0362970_167_508 113
965 3300047322 Ga0495680_0507477 Ga0495680_0507477_460_801 113
966 3300047322 Ga0495680_0896578 Ga0495680_0896578_139_480 113
967 3300047444 Ga0495675_0204749 Ga0495675_0204749_34_375 113
968 3300047445 Ga0495677_0461501 Ga0495677_0461501_148_489 113
969 3300047471 Ga0495684_0410038 Ga0495684_0410038_536_877 113
970 3300049569 Ga0501032_0005001 Ga0501032_0005001_1931_2275 113
971 3300049569 Ga0501032_0285675 Ga0501032_0285675_568_912 113
972 3300049571 Ga0501034_0062096 Ga0501034_0062096_171_512 113
973 3300049572 Ga0501036_0032651 Ga0501036_0032651_413_757 113
974 3300049573 Ga0501037_0048748 Ga0501037_0048748_1955_2296 113
975 3300049573 Ga0501037_0452002 Ga0501037_0452002_467_811 113
976 3300049574 Ga0501038_0072836 Ga0501038_0072836_353_697 113
977 3300049575 Ga0501039_0072471 Ga0501039_0072471_1566_1907 113
978 3300049579 Ga0501043_0003493 Ga0501043_0003493_11231_11575 113
979 3300049581 Ga0501047_0004866 Ga0501047_0004866_11419_11763 113
980 3300049581 Ga0501047_0279843 Ga0501047_0279843_1084_1425 113
981 3300049582 Ga0501048_0016937 Ga0501048_0016937_1133_1477 113
982 3300049585 Ga0501069_0350827 Ga0501069_0350827_64_408 113
983 3300049586 Ga0501070_0425120 Ga0501070_0425120_440_784 113
984 3300049588 Ga0501072_0312892 Ga0501072_0312892_30_371 113
985 3300049589 Ga0501073_0753687 Ga0501073_0753687_170_511 113
986 3300049590 Ga0501074_0004850 Ga0501074_0004850_8877_9221 113
987 3300049675 Ga0501243_039873 Ga0501243_039873_368_712 113
988 3300049704 Ga0501221_149305 Ga0501221_149305_33_374 113
989 3300049705 Ga0501225_0004750 Ga0501225_0004750_1942_2286 113
990 3300049742 Ga0501080_0082856 Ga0501080_0082856_2346_2690 113
991 3300049742 Ga0501080_0130029 Ga0501080_0130029_151_492 113
992 3300049744 Ga0501083_0178906 Ga0501083_0178906_332_676 113
993 3300049822 Ga0501035_0010218 Ga0501035_0010218_7910_8254 113
994 3300049823 Ga0501044_0014761 Ga0501044_0014761_7910_8254 113
995 3300049824 Ga0501045_0243704 Ga0501045_0243704_489_833 113
996 3300050507 nmdc:mga05p37_118879_c1 nmdc:mga05p37_118879_c1_704_1045 113
997 3300050508 nmdc:mga09592_12569_c2 nmdc:mga09592_12569_c2_2891_3232 113
998 3300050508 nmdc:mga09592_363122_c1 nmdc:mga09592_363122_c1_902_1243 113
999 3300050509 nmdc:mga0qj67_370556_c1 nmdc:mga0qj67_370556_c1_499_840 113
1000 3300050510 nmdc:mga06r32_1364632_c1 nmdc:mga06r32_1364632_c1_201_542 113
1001 3300050511 nmdc:mga08y16_207810_c1 nmdc:mga08y16_207810_c1_1604_1945 113
1002 3300050511 nmdc:mga08y16_21376_c1 nmdc:mga08y16_21376_c1_4986_5327 113
1003 3300050511 nmdc:mga08y16_351456_c1 nmdc:mga08y16_351456_c1_45_386 113
1004 3300050511 nmdc:mga08y16_86504_c1 nmdc:mga08y16_86504_c1_2014_2355 113
1005 3300053090 Ga0500646_0034250 Ga0500646_0034250_758_1102 113
1006 3300053092 Ga0500583_0127636 Ga0500583_0127636_595_942 113
1007 3300053093 Ga0500651_0225284 Ga0500651_0225284_169_513 113
1008 3300053104 Ga0500556_0066129 Ga0500556_0066129_252_596 113
1009 3300053130 Ga0500642_0109696 Ga0500642_0109696_19_366 113
1010 3300053134 Ga0500658_0132059 Ga0500658_0132059_224_568 113
1011 3300053147 Ga0500589_005991 Ga0500589_005991_1749_2093 113
1012 3300053151 Ga0500604_0112489 Ga0500604_0112489_10_354 113
1013 3300053153 Ga0500616_0134010 Ga0500616_0134010_208_549 113
1014 3300053156 Ga0500622_0061690 Ga0500622_0061690_256_600 113
1015 3300053156 Ga0500622_0201134 Ga0500622_0201134_263_607 113
1016 3300053158 Ga0500627_0174523 Ga0500627_0174523_240_584 113
1017 3300053727 Ga0500611_000039 Ga0500611_000039_26174_26515 113
1018 3300054114 Ga0501084_0034594 Ga0501084_0034594_695_1039 113
1019 3300060353 Ga0501082_1425286 Ga0501082_1425286_222_563 113

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01253

SUI1

Translation initiation factor SUI1

26

99

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mo0-assembly1.cif.gz_A crystal structure of aif1 from methanocaldococcus jannaschii 0.8577 36 113
4mo0-assembly1.cif.gz_A crystal structure of aif1 from methanocaldococcus jannaschii 0.8376 36 113
5jb3-assembly1.cif.gz_1 cryo-em structure of a full archaeal ribosomal translation initiation complex in the p-remote conformation 0.8158 32 113
6ywe-assembly1.cif.gz_7 the structure of the mitoribosome from neurospora crassa in the p/e trna bound state 0.814 41 106
5zcy-assembly1.cif.gz_A crystal structure of archaeal translation initiation factor 1 at 1.5 angstroms resolution 0.8078 32 113
ID Description Score Start End Superfamily
af_P08245_28_108_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8937 35 113 3.30.780.10
4mo0A00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8577 36 113 3.30.780.10
af_P08245_28_108_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8527 35 113 3.30.780.10
4mo0A00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8376 36 113 3.30.780.10
af_Q9VYI3_47_179_3.30.780.10 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor Eif1;SUI1-like domain 0.8285 41 106 3.30.780.10
ID Description Score Start End GO Terms
AF-A0A4Q3W2D1-F1-model_v4 Translation initiation factor 0.9855 32 111 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-A0A2N2Z925-F1-model_v4 Translation initiation factor 0.9831 30 113 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-A0A534VZ28-F1-model_v4 Translation initiation factor 0.9711 41 113 GO:0003743
AF-A0A7J5F376-F1-model_v4 Translation initiation factor 0.9656 37 111 GO:0001731
GO:0002188
GO:0003729
GO:0003743
AF-A0A4Q3W2D1-F1-model_v4 Translation initiation factor 0.9618 32 111 GO:0001731
GO:0002188
GO:0003729
GO:0003743

Feature Viewer

pLDDT pTM Quality
78.92 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map