F488346

General Info

Members Datasets Scaffolds Average Seq Length
1019 432 2038 340

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10431565|Ga0163162_104315651
Length 389
Sequence LIICVYLKKYQILNIQRSIFNAQLETLIKNKGESDSQELHYQVLIMNIQNIQLPDFPLLLAPMEDVSDPPFRAVCKANGADLMYTEFISSEGLIRDAIKSRQKLDIFDYERPVGIQIFGGDEEAMALSAKIVDAVQPDLVDINFGCPVKKVVSKGAGAAVLKDVDLMVRLTRAVVNSTSLPVTVKTRLGWDITSINIIEVAERLQDVGIKALAIHGRTRNQLYKGVADWSWIARVKDNPRIQIPIFGNGDIDSPEKALEYKKRYGIDGIMIGRAAIGYPWIFNEIKHYFATGEHLQPPTIEQRVEVIKQHLYRSVEWKGLIPGINEMRRHYTNYLKGLPNIKEHRLKLVTLNSVEEIDEVLSTVIHTYSGYVFEKRNIDMQAMAWSCEV

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
125 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
179 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
180 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
187 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
215 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
216 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
219 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
240 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
241 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
253 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
276 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
290 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
291 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
292 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
293 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
294 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
295 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
296 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
297 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
298 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
299 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
300 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
301 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
302 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
303 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
304 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
305 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
306 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
307 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
308 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
309 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
310 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
311 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
312 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
313 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
314 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
315 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
316 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
319 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
320 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
321 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
322 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
327 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
332 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
333 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
334 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
335 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
336 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
337 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
338 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
339 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
340 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
343 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
344 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
345 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
346 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
347 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
348 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
351 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
352 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
353 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
354 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
355 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
356 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
357 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
358 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
359 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
360 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
361 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
362 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
363 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
364 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
365 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
366 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
367 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
368 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
369 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
370 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
371 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
372 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
373 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
374 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
375 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
376 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
377 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
378 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
379 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
380 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
381 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
382 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
383 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
384 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
385 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
386 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
387 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
388 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
389 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
390 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
391 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
392 2818991444 Filimonas endophytica 3197 Isolate Unclassified
393 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
394 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
395 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
396 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
397 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
398 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
399 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
400 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
401 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
402 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
403 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
404 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
405 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
406 2914759650 Rhizosphaericola mali Isolate Rhizosphere
407 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
408 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
409 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
410 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
411 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
412 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
413 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
414 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
415 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
416 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
417 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
418 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
419 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
420 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
421 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
422 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
423 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
424 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
425 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
426 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
427 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
428 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
429 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
430 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
431 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
432 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.66
Metatranscriptomes 0.1
Isolates 8.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.2
Bulb 0
Endosphere 4.71
Nodule 0.59
Rhizoplane 0.79
Rhizosphere 85.97
Stem 0
Stem Tuber 0
Unclassified 0.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10431565 3300013306 Bacteria 1450
2 SwRhRL2b_contig_1762647 2162886007 Bacteria 207340
3 SwRhRL2b_contig_2146348 2162886007 Bacteria 2953
4 SwRhRL2b_contig_3089144 2162886007 Bacteria 1614
5 SwRhRL2b_contig_3744328 2162886007 Bacteria 2651
6 ARcpr5yngRDRAFT_c004404 3300000043 Bacteria 1335
7 JGI24741J21665_1001247 3300001915 Bacteria 7493
8 JGI24740J21852_10006855 3300001979 Bacteria 4676
9 JGI24740J21852_10012210 3300001979 Bacteria 3243
10 JGI24739J22299_10000030 3300001989 Bacteria 39896
11 JGI24739J22299_10004900 3300001989 Bacteria 5099
12 JGI25406J46586_10002360 3300003203 Bacteria 8925
13 rootH1_10179098 3300003316 Bacteria 2534
14 rootH2_10001614 3300003320 Bacteria 29985
15 rootH2_10041791 3300003320 Unclassified 4311
16 rootH2_10174439 3300003320 Bacteria 3208
17 rootL2_10044922 3300003322 Bacteria 10708
18 rootL2_10172144 3300003322 Bacteria 1521
19 rootL2_10210758 3300003322 Bacteria 2682
20 rootH1_10047353 3300003323 Bacteria 13442
21 rootH1_10271838 3300003323 Bacteria 3321
22 JGI25160J50197_1001552 3300003354 Bacteria 11373
23 JGI25160J50197_1002016 3300003354 Bacteria 9682
24 JGI25160J50197_1010570 3300003354 Bacteria 3325
25 Ga0055528_1001162 3300003790 Bacteria 17034
26 Ga0055528_1004225 3300003790 Bacteria 6959
27 Ga0055530_10000185 3300003791 Bacteria 55895
28 Ga0055530_10007526 3300003791 Bacteria 4561
29 Ga0065165_1000022 3300005262 Bacteria 253404
30 Ga0065165_1000658 3300005262 Bacteria 49852
31 Ga0065714_10008309 3300005288 Bacteria 3390
32 Ga0065714_10017333 3300005288 Bacteria 1547
33 Ga0065714_10064676 3300005288 Bacteria 24213
34 Ga0065714_10071468 3300005288 Bacteria 3570
35 Ga0065714_10080303 3300005288 Bacteria 2448
36 Ga0065714_10120467 3300005288 Bacteria 1354
37 Ga0065704_10070151 3300005289 Bacteria 259038
38 Ga0065704_10070973 3300005289 Bacteria 14113
39 Ga0065704_10071864 3300005289 Bacteria 9725
40 Ga0065704_10076791 3300005289 Bacteria 4975
41 Ga0065704_10132245 3300005289 Bacteria 1614
42 Ga0065707_10094266 3300005295 Bacteria 3519
43 Ga0070658_10006593 3300005327 Bacteria 9409
44 Ga0070658_10053620 3300005327 Bacteria 3273
45 Ga0070676_10021589 3300005328 Bacteria 3604
46 Ga0070676_10087849 3300005328 Bacteria 1898
47 Ga0070676_10131609 3300005328 Bacteria 1582
48 Ga0070676_10195526 3300005328 Bacteria 1323
49 Ga0070683_100002289 3300005329 Bacteria 15182
50 Ga0070683_100002723 3300005329 Bacteria 14112
51 Ga0070683_100011531 3300005329 Bacteria 7647
52 Ga0070683_100067799 3300005329 Bacteria 3323
53 Ga0070683_100143582 3300005329 Bacteria 2261
54 Ga0070690_100077925 3300005330 Bacteria 2164
55 Ga0070690_100081965 3300005330 Bacteria 2112
56 Ga0070690_100262372 3300005330 Bacteria 1226
57 Ga0070670_100015571 3300005331 Bacteria 6531
58 Ga0070670_100080556 3300005331 Bacteria 2798
59 Ga0070670_100085579 3300005331 Bacteria 2708
60 Ga0070670_100123527 3300005331 Bacteria 2234
61 Ga0070670_100174562 3300005331 Bacteria 1865
62 Ga0070670_100434362 3300005331 Bacteria 1162
63 Ga0070677_10013222 3300005333 Bacteria 2882
64 Ga0070677_10017217 3300005333 Bacteria 2585
65 Ga0068869_100005447 3300005334 Bacteria 8006
66 Ga0068869_100023797 3300005334 Bacteria 4237
67 Ga0068869_100028069 3300005334 Bacteria 3929
68 Ga0068869_100104461 3300005334 Bacteria 2147
69 Ga0068869_100117754 3300005334 Bacteria 2028
70 Ga0068869_100118507 3300005334 Bacteria 2022
71 Ga0070666_10000072 3300005335 Bacteria 75356
72 Ga0070666_10028673 3300005335 Bacteria 3654
73 Ga0070666_10071337 3300005335 Bacteria 2364
74 Ga0070666_10253139 3300005335 Bacteria 1247
75 Ga0070680_100000802 3300005336 Bacteria 22132
76 Ga0070680_100024400 3300005336 Bacteria 4831
77 Ga0070682_100000019 3300005337 Bacteria 220844
78 Ga0070682_100000092 3300005337 Bacteria 81794
79 Ga0070682_100011862 3300005337 Bacteria 4986
80 Ga0070682_100018150 3300005337 Bacteria 4108
81 Ga0070682_100318101 3300005337 Bacteria 1148
82 Ga0068868_100060814 3300005338 Bacteria 2992
83 Ga0068868_100106001 3300005338 Bacteria 2280
84 Ga0068868_100139272 3300005338 Bacteria 1991
85 Ga0068868_100171027 3300005338 Bacteria 1799
86 Ga0070660_100010460 3300005339 Bacteria 6558
87 Ga0070660_100016382 3300005339 Bacteria 5379
88 Ga0070660_100067822 3300005339 Bacteria 2780
89 Ga0070689_100030159 3300005340 Bacteria 4114
90 Ga0070689_100069854 3300005340 Bacteria 2741
91 Ga0070689_100094432 3300005340 Bacteria 2361
92 Ga0070689_100097967 3300005340 Bacteria 2319
93 Ga0070687_100123049 3300005343 Bacteria 1487
94 Ga0070661_100014526 3300005344 Bacteria 5549
95 Ga0070661_100023078 3300005344 Bacteria 4458
96 Ga0070661_100104773 3300005344 Bacteria 2107
97 Ga0070661_100243935 3300005344 Bacteria 1384
98 Ga0070668_100020552 3300005347 Bacteria 4984
99 Ga0070668_100030775 3300005347 Bacteria 4083
100 Ga0070668_100059635 3300005347 Bacteria 2954
101 Ga0070668_100136802 3300005347 Bacteria 1971
102 Ga0070669_100001473 3300005353 Bacteria 17021
103 Ga0070669_100002379 3300005353 Bacteria 13607
104 Ga0070669_100082829 3300005353 Bacteria 2392
105 Ga0070675_100009851 3300005354 Bacteria 7447
106 Ga0070675_100034520 3300005354 Bacteria 4106
107 Ga0070675_100107513 3300005354 Bacteria 2356
108 Ga0070675_100115895 3300005354 Bacteria 2272
109 Ga0070675_100247316 3300005354 Bacteria 1560
110 Ga0070675_100375629 3300005354 Bacteria 1264
111 Ga0070671_100020969 3300005355 Bacteria 5331
112 Ga0070671_100040806 3300005355 Bacteria 3856
113 Ga0070671_100065988 3300005355 Bacteria 3016
114 Ga0070671_100090383 3300005355 Bacteria 2563
115 Ga0070673_100031329 3300005364 Bacteria 3989
116 Ga0070673_100044898 3300005364 Bacteria 3424
117 Ga0070673_100050796 3300005364 Bacteria 3244
118 Ga0070673_100072585 3300005364 Bacteria 2768
119 Ga0070673_100089978 3300005364 Bacteria 2506
120 Ga0070688_100002343 3300005365 Bacteria 9553
121 Ga0070688_100057986 3300005365 Bacteria 2436
122 Ga0070659_100010768 3300005366 Bacteria 6742
123 Ga0070659_100018911 3300005366 Bacteria 5205
124 Ga0070667_100077551 3300005367 Bacteria 2837
125 Ga0070667_100119808 3300005367 Bacteria 2289
126 Ga0070667_100124886 3300005367 Bacteria 2242
127 Ga0070700_100033053 3300005441 Bacteria 3114
128 Ga0070663_100370844 3300005455 Bacteria 1163
129 Ga0070678_100041667 3300005456 Bacteria 3257
130 Ga0070678_100045184 3300005456 Bacteria 3149
131 Ga0070662_100018727 3300005457 Bacteria 4689
132 Ga0070662_100066850 3300005457 Bacteria 2638
133 Ga0070662_100194735 3300005457 Bacteria 1605
134 Ga0070681_10032352 3300005458 Bacteria 5248
135 Ga0070681_10105005 3300005458 Bacteria 2767
136 Ga0070681_10339475 3300005458 Bacteria 1412
137 Ga0068867_100003996 3300005459 Bacteria 10372
138 Ga0068867_100040969 3300005459 Bacteria 3384
139 Ga0068867_100042323 3300005459 Bacteria 3332
140 Ga0070685_10071541 3300005466 Bacteria 2056
141 Ga0070685_10104902 3300005466 Bacteria 1732
142 Ga0070698_100007114 3300005471 Bacteria 12118
143 Ga0070698_100013253 3300005471 Bacteria 8723
144 Ga0070679_100000158 3300005530 Bacteria 54895
145 Ga0070679_100006985 3300005530 Bacteria 10536
146 Ga0070679_100104012 3300005530 Bacteria 2826
147 Ga0070684_100002319 3300005535 Bacteria 14029
148 Ga0070684_100018695 3300005535 Bacteria 5716
149 Ga0070684_100023156 3300005535 Bacteria 5189
150 Ga0070684_100024714 3300005535 Bacteria 5042
151 Ga0070684_100043825 3300005535 Bacteria 3865
152 Ga0068853_100007045 3300005539 Bacteria 8988
153 Ga0068853_100020379 3300005539 Bacteria 5513
154 Ga0068853_100031963 3300005539 Bacteria 4455
155 Ga0068853_100055184 3300005539 Bacteria 3424
156 Ga0068853_100071844 3300005539 Bacteria 3015
157 Ga0068853_100093472 3300005539 Bacteria 2647
158 Ga0070672_100004510 3300005543 Bacteria 9115
159 Ga0070672_100096625 3300005543 Bacteria 2390
160 Ga0070686_100038536 3300005544 Bacteria 2972
161 Ga0070693_100022765 3300005547 Bacteria 3337
162 Ga0070665_100017638 3300005548 Bacteria 7169
163 Ga0070665_100115341 3300005548 Bacteria 2689
164 Ga0068855_100001027 3300005563 Bacteria 34809
165 Ga0068855_100010998 3300005563 Bacteria 10920
166 Ga0068855_100066421 3300005563 Bacteria 4205
167 Ga0068855_100155975 3300005563 Bacteria 2594
168 Ga0068855_100239327 3300005563 Bacteria 2029
169 Ga0068855_100248675 3300005563 Bacteria 1984
170 Ga0070664_100009600 3300005564 Bacteria 7848
171 Ga0070664_100014826 3300005564 Bacteria 6363
172 Ga0070664_100019613 3300005564 Bacteria 5564
173 Ga0070664_100120393 3300005564 Bacteria 2298
174 Ga0070664_100126604 3300005564 Bacteria 2241
175 Ga0070664_100174179 3300005564 Bacteria 1910
176 Ga0070664_100468832 3300005564 Bacteria 1158
177 Ga0068857_100004302 3300005577 Bacteria 12015
178 Ga0068857_100088934 3300005577 Bacteria 2763
179 Ga0068857_100096888 3300005577 Bacteria 2644
180 Ga0068857_100100130 3300005577 Bacteria 2600
181 Ga0068857_100183656 3300005577 Bacteria 1903
182 Ga0068857_100333384 3300005577 Bacteria 1402
183 Ga0068857_100353539 3300005577 Bacteria 1361
184 Ga0068854_100016936 3300005578 Bacteria 4869
185 Ga0068854_100064535 3300005578 Bacteria 2661
186 Ga0068854_100081578 3300005578 Bacteria 2389
187 Ga0068854_100264763 3300005578 Bacteria 1378
188 Ga0068856_100032446 3300005614 Bacteria 5113
189 Ga0070702_100245648 3300005615 Bacteria 1210
190 Ga0068852_100000989 3300005616 Bacteria 18732
191 Ga0068852_100005736 3300005616 Bacteria 8906
192 Ga0068852_100013321 3300005616 Bacteria 6292
193 Ga0068852_100028296 3300005616 Bacteria 4585
194 Ga0068852_100211770 3300005616 Bacteria 1839
195 Ga0068859_100000006 3300005617 Bacteria 421509
196 Ga0068859_100007990 3300005617 Bacteria 10726
197 Ga0068859_100011125 3300005617 Bacteria 9049
198 Ga0068859_100031496 3300005617 Bacteria 5326
199 Ga0068859_100175683 3300005617 Bacteria 2223
200 Ga0068859_100316494 3300005617 Bacteria 1654
201 Ga0068859_100363917 3300005617 Bacteria 1541
202 Ga0068864_100012944 3300005618 Bacteria 6903
203 Ga0068864_100017013 3300005618 Bacteria 6060
204 Ga0068864_100035108 3300005618 Bacteria 4267
205 Ga0068864_100059981 3300005618 Bacteria 3293
206 Ga0068866_10042032 3300005718 Bacteria 2272
207 Ga0068861_100039435 3300005719 Bacteria 3525
208 Ga0068861_100102518 3300005719 Bacteria 2278
209 Ga0068861_100313605 3300005719 Bacteria 1363
210 Ga0068861_100388585 3300005719 Bacteria 1235
211 Ga0068851_10111325 3300005834 Bacteria 1462
212 Ga0068870_10012058 3300005840 Bacteria 4027
213 Ga0068870_10015090 3300005840 Bacteria 3659
214 Ga0068863_100055268 3300005841 Bacteria 3759
215 Ga0068863_100059836 3300005841 Bacteria 3604
216 Ga0068863_100144604 3300005841 Bacteria 2274
217 Ga0068863_100150025 3300005841 Bacteria 2230
218 Ga0068863_100490368 3300005841 Bacteria 1209
219 Ga0068858_100070848 3300005842 Bacteria 3232
220 Ga0068858_100332303 3300005842 Bacteria 1454
221 Ga0068860_100000061 3300005843 Bacteria 192548
222 Ga0068860_100001096 3300005843 Bacteria 29818
223 Ga0068860_100005681 3300005843 Bacteria 12594
224 Ga0068860_100028006 3300005843 Bacteria 5425
225 Ga0068860_100136937 3300005843 Bacteria 2352
226 Ga0068860_100144733 3300005843 Bacteria 2286
227 Ga0068860_100498108 3300005843 Bacteria 1216
228 Ga0081539_10000338 3300005985 Bacteria 103849
229 Ga0070715_10061328 3300006163 Bacteria 1651
230 Ga0075366_10011421 3300006195 Bacteria 5015
231 Ga0075366_10018211 3300006195 Bacteria 4054
232 Ga0075366_10051273 3300006195 Bacteria 2452
233 Ga0097621_100000448 3300006237 Bacteria 28883
234 Ga0097621_100014754 3300006237 Bacteria 5857
235 Ga0097621_100072683 3300006237 Bacteria 2845
236 Ga0097621_100088492 3300006237 Bacteria 2588
237 Ga0068871_100001237 3300006358 Bacteria 17045
238 Ga0068871_100018019 3300006358 Bacteria 5358
239 Ga0068871_100228938 3300006358 Bacteria 1613
240 Ga0068871_100259362 3300006358 Bacteria 1516
241 Ga0075428_100010088 3300006844 Bacteria 10494
242 Ga0075428_100011391 3300006844 Bacteria 9893
243 Ga0075428_100071436 3300006844 Bacteria 3793
244 Ga0075430_100002480 3300006846 Bacteria 15380
245 Ga0075430_100030429 3300006846 Bacteria 4586
246 Ga0075429_100040575 3300006880 Unclassified 4053
247 Ga0068865_100016555 3300006881 Bacteria 4720
248 Ga0068865_100097245 3300006881 Bacteria 2148
249 Ga0097620_100000006 3300006931 Bacteria 421509
250 Ga0097620_100001537 3300006931 Bacteria 23548
251 Ga0097620_100007990 3300006931 Bacteria 10726
252 Ga0097620_100011125 3300006931 Bacteria 9049
253 Ga0097620_100031496 3300006931 Bacteria 5326
254 Ga0097620_100175687 3300006931 Bacteria 2223
255 Ga0097620_100316508 3300006931 Bacteria 1654
256 Ga0097620_100363926 3300006931 Bacteria 1541
257 Ga0099824_1000500 3300006942 Bacteria 46562
258 Ga0079104_1000079 3300006946 Bacteria 141480
259 Ga0099826_10000143 3300006948 Bacteria 30506
260 Ga0105251_10035505 3300009011 Bacteria 2459
261 Ga0105244_10000001 3300009036 Bacteria 1034899
262 Ga0105244_10000054 3300009036 Bacteria 133715
263 Ga0105250_10006702 3300009092 Bacteria 5005
264 Ga0105240_10001787 3300009093 Bacteria 36277
265 Ga0105240_10001808 3300009093 Bacteria 36002
266 Ga0105240_10003852 3300009093 Bacteria 23176
267 Ga0105240_10004358 3300009093 Bacteria 21601
268 Ga0105240_10006347 3300009093 Bacteria 17410
269 Ga0105240_10013595 3300009093 Bacteria 11168
270 Ga0105240_10034582 3300009093 Bacteria 6517
271 Ga0105240_10061820 3300009093 Bacteria 4665
272 Ga0111539_10001303 3300009094 Bacteria 33322
273 Ga0111539_10094577 3300009094 Bacteria 3511
274 Ga0111539_10321138 3300009094 Bacteria 1802
275 Ga0111539_10588248 3300009094 Bacteria 1296
276 Ga0105247_10018425 3300009101 Bacteria 4187
277 Ga0105247_10213756 3300009101 Bacteria 1302
278 Ga0114129_10020886 3300009147 Bacteria 9302
279 Ga0114129_10465245 3300009147 Bacteria 1657
280 Ga0105243_10001053 3300009148 Bacteria 25253
281 Ga0105243_10450247 3300009148 Bacteria 1208
282 Ga0105241_10000886 3300009174 Bacteria 22612
283 Ga0105241_10007561 3300009174 Bacteria 7990
284 Ga0105241_10008379 3300009174 Bacteria 7613
285 Ga0105241_10230277 3300009174 Bacteria 1562
286 Ga0105242_10007715 3300009176 Bacteria 8279
287 Ga0105242_10022259 3300009176 Bacteria 4983
288 Ga0105242_10031614 3300009176 Bacteria 4230
289 Ga0105242_10083440 3300009176 Bacteria 2676
290 Ga0105248_10044227 3300009177 Bacteria 4994
291 Ga0105237_10007301 3300009545 Bacteria 12120
292 Ga0105237_10013605 3300009545 Bacteria 8525
293 Ga0105237_10127578 3300009545 Bacteria 2538
294 Ga0105237_10210708 3300009545 Bacteria 1943
295 Ga0105237_10211779 3300009545 Bacteria 1938
296 Ga0105238_10000592 3300009551 Bacteria 38095
297 Ga0105238_10381080 3300009551 Bacteria 1402
298 Ga0105249_10000623 3300009553 Bacteria 32238
299 Ga0105249_10019091 3300009553 Bacteria 6116
300 Ga0105249_10052792 3300009553 Bacteria 3714
301 Ga0105249_10068255 3300009553 Bacteria 3278
302 Ga0105249_10081133 3300009553 Bacteria 3015
303 Ga0105249_10155163 3300009553 Bacteria 2207
304 Ga0105249_10209496 3300009553 Bacteria 1912
305 Ga0105239_10000019 3300010375 Bacteria 273836
306 Ga0105239_10001405 3300010375 Bacteria 32195
307 Ga0105239_10039800 3300010375 Bacteria 5150
308 Ga0105239_10045372 3300010375 Bacteria 4817
309 Ga0105246_10063689 3300011119 Bacteria 2572
310 Ga0105246_10075370 3300011119 Bacteria 2388
311 Ga0157373_10000035 3300013100 Bacteria 123284
312 Ga0157373_10000056 3300013100 Bacteria 100327
313 Ga0157373_10010363 3300013100 Bacteria 6861
314 Ga0157373_10010705 3300013100 Bacteria 6747
315 Ga0157373_10023444 3300013100 Bacteria 4474
316 Ga0157373_10051295 3300013100 Bacteria 2939
317 Ga0157373_10054280 3300013100 Bacteria 2848
318 Ga0157371_10000081 3300013102 Bacteria 151138
319 Ga0157371_10000218 3300013102 Bacteria 83919
320 Ga0157371_10001629 3300013102 Bacteria 22978
321 Ga0157371_10003874 3300013102 Bacteria 13340
322 Ga0157371_10007353 3300013102 Bacteria 8927
323 Ga0157371_10014811 3300013102 Bacteria 5870
324 Ga0157371_10050257 3300013102 Bacteria 2962
325 Ga0157370_10001029 3300013104 Bacteria 35080
326 Ga0157370_10001171 3300013104 Bacteria 32694
327 Ga0157370_10001492 3300013104 Bacteria 28987
328 Ga0157370_10004094 3300013104 Bacteria 16904
329 Ga0157370_10005329 3300013104 Bacteria 14440
330 Ga0157370_10007679 3300013104 Bacteria 11705
331 Ga0157370_10008275 3300013104 Bacteria 11231
332 Ga0157370_10015550 3300013104 Bacteria 7737
333 Ga0157370_10017727 3300013104 Bacteria 7179
334 Ga0157370_10022533 3300013104 Bacteria 6267
335 Ga0157370_10066766 3300013104 Bacteria 3401
336 Ga0157370_10103574 3300013104 Bacteria 2664
337 Ga0157369_10000474 3300013105 Bacteria 53237
338 Ga0157369_10002049 3300013105 Bacteria 24325
339 Ga0157369_10048167 3300013105 Bacteria 4624
340 Ga0157369_10092452 3300013105 Bacteria 3228
341 Ga0157369_10132396 3300013105 Bacteria 2642
342 Ga0157369_10202875 3300013105 Bacteria 2081
343 Ga0157369_10211675 3300013105 Bacteria 2031
344 Ga0157369_10301870 3300013105 Bacteria 1665
345 Ga0157369_10382259 3300013105 Bacteria 1461
346 Ga0157369_10532889 3300013105 Bacteria 1214
347 Ga0157369_10537215 3300013105 Bacteria 1209
348 Ga0157374_10003783 3300013296 Bacteria 12734
349 Ga0157374_10008939 3300013296 Bacteria 8584
350 Ga0157374_10021996 3300013296 Bacteria 5683
351 Ga0157374_10039978 3300013296 Bacteria 4318
352 Ga0157374_10045758 3300013296 Bacteria 4050
353 Ga0157374_10339748 3300013296 Bacteria 1490
354 Ga0157374_10345671 3300013296 Bacteria 1477
355 Ga0157378_10003090 3300013297 Bacteria 14801
356 Ga0157378_10016578 3300013297 Bacteria 6454
357 Ga0157378_10017446 3300013297 Bacteria 6301
358 Ga0157378_10019626 3300013297 Bacteria 5941
359 Ga0157378_10024744 3300013297 Bacteria 5286
360 Ga0157378_10033297 3300013297 Bacteria 4555
361 Ga0157378_10069352 3300013297 Bacteria 3163
362 Ga0157378_10099924 3300013297 Bacteria 2647
363 Ga0163162_10000131 3300013306 Bacteria 67924
364 Ga0163162_10002714 3300013306 Bacteria 16800
365 Ga0163162_10023335 3300013306 Bacteria 6105
366 Ga0163162_10031303 3300013306 Bacteria 5277
367 Ga0163162_10044775 3300013306 Bacteria 4433
368 Ga0163162_10081880 3300013306 Bacteria 3299
369 Ga0163162_10084128 3300013306 Bacteria 3256
370 Ga0163162_10179002 3300013306 Bacteria 2246
371 Ga0163162_10183242 3300013306 Bacteria 2220
372 Ga0157372_10003581 3300013307 Bacteria 16712
373 Ga0157372_10013617 3300013307 Bacteria 8694
374 Ga0157372_10019373 3300013307 Bacteria 7333
375 Ga0157372_10038889 3300013307 Bacteria 5250
376 Ga0157372_10061028 3300013307 Bacteria 4220
377 Ga0157372_10103820 3300013307 Bacteria 3248
378 Ga0157372_10114245 3300013307 Bacteria 3095
379 Ga0157372_10129714 3300013307 Bacteria 2900
380 Ga0157372_10193417 3300013307 Bacteria 2356
381 Ga0157372_10391584 3300013307 Bacteria 1619
382 Ga0157372_10577083 3300013307 Bacteria 1311
383 Ga0157375_10000280 3300013308 Bacteria 46461
384 Ga0157375_10004666 3300013308 Bacteria 11918
385 Ga0157375_10016191 3300013308 Bacteria 6688
386 Ga0157375_10116256 3300013308 Bacteria 2779
387 Ga0157375_10180596 3300013308 Bacteria 2261
388 Ga0163163_10000591 3300014325 Bacteria 31919
389 Ga0163163_10007372 3300014325 Bacteria 9704
390 Ga0163163_10066601 3300014325 Bacteria 3578
391 Ga0163163_10163969 3300014325 Bacteria 2268
392 Ga0157380_10000026 3300014326 Bacteria 106290
393 Ga0157380_10004078 3300014326 Bacteria 10083
394 Ga0157380_10004118 3300014326 Bacteria 10042
395 Ga0157380_10020610 3300014326 Bacteria 4930
396 Ga0157380_10044775 3300014326 Bacteria 3469
397 Ga0157380_10146262 3300014326 Bacteria 2037
398 Ga0182008_10000007 3300014497 Bacteria 372461
399 Ga0157377_10000583 3300014745 Bacteria 15210
400 Ga0157377_10008618 3300014745 Bacteria 4978
401 Ga0157377_10059269 3300014745 Bacteria 2181
402 Ga0157379_10090934 3300014968 Bacteria 2738
403 Ga0157379_10144775 3300014968 Bacteria 2143
404 Ga0157379_10168514 3300014968 Bacteria 1977
405 Ga0157379_10306013 3300014968 Bacteria 1449
406 Ga0157376_10002332 3300014969 Bacteria 12822
407 Ga0157376_10044790 3300014969 Bacteria 3639
408 Ga0157376_10053620 3300014969 Bacteria 3358
409 Ga0157376_10123046 3300014969 Bacteria 2302
410 Ga0157376_10124326 3300014969 Bacteria 2291
411 Ga0182006_1000003 3300015261 Bacteria 826681
412 Ga0182006_1001274 3300015261 Bacteria 15541
413 Ga0182006_1005678 3300015261 Bacteria 5909
414 Ga0182006_1020701 3300015261 Bacteria 2753
415 Ga0182007_10031544 3300015262 Bacteria 1803
416 Ga0182005_1000189 3300015265 Bacteria 42264
417 Ga0163161_10000091 3300017792 Bacteria 90927
418 Ga0163161_10002598 3300017792 Bacteria 12872
419 Ga0163161_10004744 3300017792 Bacteria 9453
420 Ga0163161_10004838 3300017792 Bacteria 9380
421 Ga0163161_10013026 3300017792 Bacteria 5778
422 Ga0163161_10038918 3300017792 Bacteria 3412
423 Ga0163161_10041186 3300017792 Bacteria 3319
424 Ga0163161_10073007 3300017792 Bacteria 2513
425 Ga0213876_10003238 3300021384 Bacteria 9342
426 Ga0213876_10126200 3300021384 Bacteria 1359
427 Ga0209673_1000519 3300025273 Bacteria 63063
428 Ga0209675_1000323 3300025291 Bacteria 42747
429 Ga0209050_1000129 3300025298 Bacteria 186356
430 Ga0209050_1000276 3300025298 Bacteria 109997
431 Ga0207426_1000019 3300025302 Bacteria 558579
432 Ga0207426_1000059 3300025302 Bacteria 363842
433 Ga0207426_1002756 3300025302 Bacteria 10629
434 Ga0207426_1003233 3300025302 Bacteria 9140
435 Ga0207426_1008034 3300025302 Unclassified 4328
436 Ga0209051_1027692 3300025303 Bacteria 2253
437 Ga0209257_1000736 3300025304 Bacteria 49668
438 Ga0209257_1001011 3300025304 Bacteria 38022
439 Ga0207656_10000237 3300025321 Bacteria 19366
440 Ga0207655_1000003 3300025728 Bacteria 1081376
441 Ga0207655_1000018 3300025728 Bacteria 537129
442 Ga0207710_10017235 3300025900 Bacteria 3062
443 Ga0207688_10006044 3300025901 Bacteria 6589
444 Ga0207680_10000137 3300025903 Bacteria 34668
445 Ga0207680_10067238 3300025903 Bacteria 2207
446 Ga0207680_10125416 3300025903 Bacteria 1685
447 Ga0207680_10133167 3300025903 Bacteria 1640
448 Ga0207680_10139605 3300025903 Bacteria 1605
449 Ga0207680_10161834 3300025903 Bacteria 1501
450 Ga0207647_10000025 3300025904 Bacteria 112150
451 Ga0207647_10015704 3300025904 Bacteria 5185
452 Ga0207647_10029562 3300025904 Bacteria 3545
453 Ga0207647_10058866 3300025904 Bacteria 2352
454 Ga0207647_10134471 3300025904 Bacteria 1452
455 Ga0207645_10001948 3300025907 Bacteria 16635
456 Ga0207645_10002012 3300025907 Bacteria 16324
457 Ga0207645_10031229 3300025907 Bacteria 3429
458 Ga0207643_10015283 3300025908 Bacteria 4177
459 Ga0207643_10105415 3300025908 Bacteria 1656
460 Ga0207705_10050927 3300025909 Bacteria 2981
461 Ga0207705_10286764 3300025909 Bacteria 1261
462 Ga0207654_10003375 3300025911 Bacteria 8086
463 Ga0207654_10005844 3300025911 Bacteria 6204
464 Ga0207707_10000238 3300025912 Bacteria 59675
465 Ga0207707_10018897 3300025912 Bacteria 6009
466 Ga0207707_10025973 3300025912 Bacteria 5121
467 Ga0207695_10000087 3300025913 Bacteria 276412
468 Ga0207695_10000863 3300025913 Bacteria 55452
469 Ga0207695_10001230 3300025913 Bacteria 43841
470 Ga0207695_10028221 3300025913 Bacteria 6229
471 Ga0207695_10034544 3300025913 Bacteria 5497
472 Ga0207695_10100032 3300025913 Bacteria 2896
473 Ga0207671_10000453 3300025914 Bacteria 56447
474 Ga0207671_10000931 3300025914 Bacteria 36651
475 Ga0207671_10002781 3300025914 Bacteria 18252
476 Ga0207671_10004520 3300025914 Bacteria 13223
477 Ga0207671_10043217 3300025914 Bacteria 3332
478 Ga0207671_10139128 3300025914 Bacteria 1869
479 Ga0207660_10013800 3300025917 Bacteria 5302
480 Ga0207660_10129301 3300025917 Bacteria 1921
481 Ga0207660_10144183 3300025917 Bacteria 1823
482 Ga0207657_10004391 3300025919 Bacteria 14923
483 Ga0207657_10064911 3300025919 Bacteria 3114
484 Ga0207657_10076939 3300025919 Bacteria 2814
485 Ga0207657_10089176 3300025919 Bacteria 2577
486 Ga0207657_10155020 3300025919 Bacteria 1863
487 Ga0207649_10014898 3300025920 Bacteria 4361
488 Ga0207649_10036342 3300025920 Bacteria 2966
489 Ga0207649_10096472 3300025920 Bacteria 1948
490 Ga0207649_10144393 3300025920 Bacteria 1632
491 Ga0207652_10000013 3300025921 Bacteria 222247
492 Ga0207652_10000346 3300025921 Bacteria 48060
493 Ga0207652_10002804 3300025921 Bacteria 14623
494 Ga0207652_10019984 3300025921 Bacteria 5514
495 Ga0207652_10065940 3300025921 Bacteria 3136
496 Ga0207681_10034279 3300025923 Bacteria 3336
497 Ga0207681_10095341 3300025923 Bacteria 2134
498 Ga0207681_10261993 3300025923 Bacteria 1354
499 Ga0207650_10026156 3300025925 Bacteria 4160
500 Ga0207650_10044809 3300025925 Bacteria 3252
501 Ga0207650_10100282 3300025925 Bacteria 2227
502 Ga0207650_10105413 3300025925 Bacteria 2176
503 Ga0207650_10120146 3300025925 Bacteria 2045
504 Ga0207650_10307646 3300025925 Bacteria 1296
505 Ga0207659_10082053 3300025926 Bacteria 2386
506 Ga0207659_10104323 3300025926 Bacteria 2144
507 Ga0207659_10120581 3300025926 Bacteria 2009
508 Ga0207644_10108647 3300025931 Bacteria 2094
509 Ga0207644_10115109 3300025931 Bacteria 2039
510 Ga0207644_10186164 3300025931 Bacteria 1630
511 Ga0207690_10024343 3300025932 Bacteria 3792
512 Ga0207706_10003226 3300025933 Bacteria 15653
513 Ga0207706_10004884 3300025933 Bacteria 12541
514 Ga0207706_10031139 3300025933 Bacteria 4754
515 Ga0207706_10060968 3300025933 Bacteria 3322
516 Ga0207706_10228973 3300025933 Bacteria 1627
517 Ga0207686_10000764 3300025934 Bacteria 19790
518 Ga0207686_10039056 3300025934 Bacteria 2877
519 Ga0207686_10039701 3300025934 Bacteria 2857
520 Ga0207686_10098422 3300025934 Bacteria 1948
521 Ga0207709_10018839 3300025935 Bacteria 3871
522 Ga0207670_10066676 3300025936 Bacteria 2474
523 Ga0207670_10379291 3300025936 Bacteria 1126
524 Ga0207669_10102152 3300025937 Bacteria 1898
525 Ga0207704_10050591 3300025938 Bacteria 2507
526 Ga0207704_10170504 3300025938 Bacteria 1560
527 Ga0207691_10005909 3300025940 Bacteria 11820
528 Ga0207691_10011514 3300025940 Bacteria 8488
529 Ga0207691_10030031 3300025940 Bacteria 5082
530 Ga0207691_10053331 3300025940 Bacteria 3692
531 Ga0207691_10234383 3300025940 Bacteria 1588
532 Ga0207691_10316332 3300025940 Bacteria 1339
533 Ga0207689_10005782 3300025942 Bacteria 10981
534 Ga0207689_10011456 3300025942 Bacteria 7601
535 Ga0207689_10024448 3300025942 Bacteria 5070
536 Ga0207689_10044372 3300025942 Bacteria 3676
537 Ga0207689_10045457 3300025942 Bacteria 3630
538 Ga0207689_10049261 3300025942 Bacteria 3475
539 Ga0207689_10067587 3300025942 Bacteria 2937
540 Ga0207689_10073106 3300025942 Unclassified 2817
541 Ga0207689_10106592 3300025942 Bacteria 2303
542 Ga0207689_10112809 3300025942 Bacteria 2234
543 Ga0207689_10153764 3300025942 Bacteria 1896
544 Ga0207689_10286726 3300025942 Bacteria 1364
545 Ga0207661_10010032 3300025944 Bacteria 6805
546 Ga0207661_10013439 3300025944 Bacteria 5980
547 Ga0207661_10014911 3300025944 Bacteria 5704
548 Ga0207661_10045858 3300025944 Bacteria 3463
549 Ga0207661_10136717 3300025944 Bacteria 2105
550 Ga0207679_10005881 3300025945 Bacteria 7711
551 Ga0207679_10067158 3300025945 Bacteria 2689
552 Ga0207679_10080716 3300025945 Bacteria 2484
553 Ga0207679_10125104 3300025945 Bacteria 2053
554 Ga0207679_10341674 3300025945 Bacteria 1302
555 Ga0207667_10000098 3300025949 Bacteria 140051
556 Ga0207667_10000279 3300025949 Bacteria 70460
557 Ga0207667_10004703 3300025949 Bacteria 16703
558 Ga0207667_10017739 3300025949 Bacteria 8005
559 Ga0207667_10094333 3300025949 Bacteria 3089
560 Ga0207667_10139609 3300025949 Bacteria 2495
561 Ga0207667_10402029 3300025949 Bacteria 1394
562 Ga0207651_10036784 3300025960 Bacteria 3200
563 Ga0207651_10226625 3300025960 Bacteria 1514
564 Ga0207712_10001013 3300025961 Bacteria 20020
565 Ga0207712_10006008 3300025961 Bacteria 7660
566 Ga0207712_10011002 3300025961 Bacteria 5760
567 Ga0207712_10050698 3300025961 Bacteria 2899
568 Ga0207712_10058121 3300025961 Bacteria 2732
569 Ga0207668_10038802 3300025972 Bacteria 3200
570 Ga0207668_10062514 3300025972 Bacteria 2622
571 Ga0207668_10111780 3300025972 Bacteria 2051
572 Ga0207668_10129220 3300025972 Bacteria 1926
573 Ga0207640_10064742 3300025981 Bacteria 2436
574 Ga0207640_10067157 3300025981 Bacteria 2398
575 Ga0207640_10089030 3300025981 Bacteria 2133
576 Ga0207658_10078470 3300025986 Bacteria 2523
577 Ga0207658_10119552 3300025986 Bacteria 2098
578 Ga0207658_10364932 3300025986 Bacteria 1261
579 Ga0207677_10022316 3300026023 Bacteria 3888
580 Ga0207677_10040671 3300026023 Bacteria 3067
581 Ga0207703_10035603 3300026035 Bacteria 3956
582 Ga0207639_10009075 3300026041 Bacteria 6850
583 Ga0207639_10015542 3300026041 Bacteria 5373
584 Ga0207639_10034582 3300026041 Bacteria 3736
585 Ga0207639_10062045 3300026041 Bacteria 2889
586 Ga0207639_10067739 3300026041 Bacteria 2779
587 Ga0207678_10006330 3300026067 Bacteria 10512
588 Ga0207678_10026007 3300026067 Bacteria 5106
589 Ga0207678_10074008 3300026067 Bacteria 2919
590 Ga0207708_10152859 3300026075 Bacteria 1818
591 Ga0207702_10409025 3300026078 Bacteria 1310
592 Ga0207702_10475984 3300026078 Bacteria 1215
593 Ga0207641_10000058 3300026088 Bacteria 166385
594 Ga0207641_10024998 3300026088 Bacteria 4925
595 Ga0207641_10085922 3300026088 Bacteria 2742
596 Ga0207641_10186361 3300026088 Bacteria 1904
597 Ga0207641_10354235 3300026088 Bacteria 1400
598 Ga0207641_10389677 3300026088 Bacteria 1336
599 Ga0207648_10003197 3300026089 Bacteria 17252
600 Ga0207648_10003482 3300026089 Bacteria 16493
601 Ga0207648_10026917 3300026089 Bacteria 5107
602 Ga0207648_10036267 3300026089 Bacteria 4343
603 Ga0207648_10188745 3300026089 Bacteria 1826
604 Ga0207676_10010326 3300026095 Bacteria 6648
605 Ga0207676_10028711 3300026095 Bacteria 4158
606 Ga0207674_10000969 3300026116 Bacteria 37567
607 Ga0207674_10005452 3300026116 Bacteria 15110
608 Ga0207674_10021460 3300026116 Bacteria 6953
609 Ga0207674_10023895 3300026116 Bacteria 6538
610 Ga0207674_10053972 3300026116 Bacteria 4094
611 Ga0207674_10324755 3300026116 Bacteria 1488
612 Ga0207675_100000654 3300026118 Bacteria 34117
613 Ga0207675_100022585 3300026118 Bacteria 5857
614 Ga0207675_100054133 3300026118 Bacteria 3743
615 Ga0207675_100062593 3300026118 Bacteria 3475
616 Ga0207675_100122687 3300026118 Bacteria 2460
617 Ga0207675_100156470 3300026118 Bacteria 2172
618 Ga0207675_100257898 3300026118 Bacteria 1689
619 Ga0207675_100377666 3300026118 Bacteria 1393
620 Ga0207683_10035923 3300026121 Bacteria 4311
621 Ga0207698_10000937 3300026142 Bacteria 16993
622 Ga0207698_10017486 3300026142 Bacteria 4866
623 Ga0207698_10023447 3300026142 Bacteria 4312
624 Ga0207698_10038320 3300026142 Bacteria 3540
625 Ga0207698_10090624 3300026142 Unclassified 2501
626 Ga0207698_10260174 3300026142 Bacteria 1594
627 Ga0207698_10335523 3300026142 Bacteria 1422
628 Ga0209281_1000045 3300027111 Bacteria 328124
629 Ga0209489_108596 3300027361 Bacteria 13695
630 Ga0210002_1001089 3300027617 Bacteria 3768
631 Ga0268266_10000068 3300028379 Bacteria 241100
632 Ga0268266_10090840 3300028379 Bacteria 2677
633 Ga0268264_10000079 3300028381 Bacteria 249516
634 Ga0268264_10002043 3300028381 Bacteria 18025
635 Ga0268264_10003074 3300028381 Bacteria 14443
636 Ga0268264_10006028 3300028381 Bacteria 10253
637 Ga0268264_10010056 3300028381 Bacteria 7831
638 Ga0268264_10013025 3300028381 Bacteria 6836
639 Ga0268264_10081602 3300028381 Bacteria 2764
640 Ga0268264_10109398 3300028381 Bacteria 2418
641 Ga0265334_10013415 3300028573 Bacteria 3432
642 Ga0307517_10001481 3300028786 Bacteria 39285
643 Ga0307515_10000001 3300028794 Bacteria 4259510
644 Ga0307515_10000059 3300028794 Bacteria 257520
645 Ga0265324_10028844 3300029957 Bacteria 1955
646 Ga0307511_10000201 3300030521 Bacteria 60079
647 Ga0265327_10000009 3300031251 Bacteria 616360
648 Ga0265327_10000013 3300031251 Bacteria 519549
649 Ga0265327_10000031 3300031251 Bacteria 325718
650 Ga0265327_10004168 3300031251 Bacteria 13044
651 Ga0265327_10028535 3300031251 Bacteria 3190
652 Ga0307509_10029227 3300031507 Bacteria 6120
653 Ga0307509_10090993 3300031507 Bacteria 3124
654 Ga0307509_10326538 3300031507 Bacteria 1268
655 Ga0307408_100000375 3300031548 Bacteria 40830
656 Ga0307408_100000600 3300031548 Bacteria 30960
657 Ga0307408_100209884 3300031548 Bacteria 1582
658 Ga0307508_10001083 3300031616 Bacteria 31499
659 Ga0307508_10055089 3300031616 Bacteria 3524
660 Ga0265314_10105638 3300031711 Bacteria 1800
661 Ga0307516_10090526 3300031730 Bacteria 2888
662 Ga0307405_10000001 3300031731 Bacteria 1731270
663 Ga0307413_10000001 3300031824 Bacteria 159157
664 Ga0307413_10251205 3300031824 Bacteria 1312
665 Ga0307410_10000024 3300031852 Bacteria 59872
666 Ga0307410_10114427 3300031852 Bacteria 1957
667 Ga0307410_10177734 3300031852 Bacteria 1609
668 Ga0307406_10000028 3300031901 Bacteria 91602
669 Ga0307406_10003873 3300031901 Bacteria 8148
670 Ga0307406_10060682 3300031901 Bacteria 2439
671 Ga0307407_10000286 3300031903 Bacteria 14911
672 Ga0307412_10000062 3300031911 Bacteria 126099
673 Ga0307412_10000155 3300031911 Bacteria 48968
674 Ga0307412_10116424 3300031911 Bacteria 1917
675 Ga0307412_10192377 3300031911 Bacteria 1543
676 Ga0307416_100000013 3300032002 Bacteria 283585
677 Ga0307416_100000066 3300032002 Bacteria 94549
678 Ga0307416_100048785 3300032002 Bacteria 3362
679 Ga0307414_10000022 3300032004 Bacteria 212123
680 Ga0307414_10000041 3300032004 Bacteria 144783
681 Ga0307414_10000241 3300032004 Bacteria 34897
682 Ga0307414_10006659 3300032004 Bacteria 6460
683 Ga0307414_10019595 3300032004 Bacteria 4195
684 Ga0307414_10025485 3300032004 Bacteria 3790
685 Ga0307414_10031050 3300032004 Bacteria 3498
686 Ga0307414_10034030 3300032004 Bacteria 3374
687 Ga0307414_10047614 3300032004 Bacteria 2952
688 Ga0307414_10093659 3300032004 Bacteria 2240
689 Ga0307414_10144565 3300032004 Bacteria 1867
690 Ga0307414_10162064 3300032004 Bacteria 1778
691 Ga0307411_10000003 3300032005 Bacteria 477556
692 Ga0307411_10151934 3300032005 Bacteria 1722
693 Ga0307510_10009446 3300033180 Bacteria 11614
694 Ga0373934_0015585 3300035086 Bacteria 2886
695 Ga0373943_0071141 3300035170 Bacteria 1762
696 Ga0373955_0040882 3300035172 Bacteria 2483
697 Ga0373933_0040967 3300035724 Bacteria 2732
698 Ga0395899_0000025 3300037312 Bacteria 350927
699 Ga0395899_0000528 3300037312 Bacteria 41982
700 Ga0395899_0057783 3300037312 Bacteria 2862
701 Ga0395899_0225469 3300037312 Bacteria 1296
702 Ga0395899_0250777 3300037312 Bacteria 1215
703 Ga0395900_0008628 3300037418 Bacteria 10473
704 Ga0395900_0011009 3300037418 Bacteria 9248
705 Ga0395900_0014908 3300037418 Bacteria 7919
706 Ga0395898_0000595 3300037466 Bacteria 67162
707 Ga0395898_0017447 3300037466 Bacteria 7329
708 Ga0395905_0004944 3300037471 Bacteria 13731
709 Ga0395905_0011815 3300037471 Bacteria 8429
710 Ga0395905_0255495 3300037471 Bacteria 1637
711 Ga0395905_0385700 3300037471 Bacteria 1295
712 Ga0395901_0001672 3300038443 Bacteria 22890
713 Ga0395901_0007597 3300038443 Bacteria 10947
714 Ga0395901_0007671 3300038443 Bacteria 10885
715 Ga0395901_0237157 3300038443 Bacteria 1903
716 Ga0436365_0022529 3300039437 Bacteria 15767
717 Ga0436365_1412273 3300039437 Bacteria 1581
718 Ga0439439_0049448 3300041406 Bacteria 1101
719 Ga0439447_000106 3300041407 Bacteria 28341
720 Ga0439466_0000940 3300041411 Bacteria 11161
721 Ga0439466_0042247 3300041411 Bacteria 1518
722 Ga0439465_0000262 3300041413 Bacteria 14602
723 Ga0439431_0003814 3300041997 Bacteria 3331
724 Ga0439445_0000338 3300042004 Bacteria 9216
725 Ga0439445_0062334 3300042004 Bacteria 1021
726 Ga0439449_0066059 3300042007 Bacteria 1334
727 Ga0439449_0068842 3300042007 Bacteria 1305
728 Ga0450923_001224 3300042125 Bacteria 3316
729 Ga0451577_0004359 3300042876 Bacteria 14984
730 Ga0451577_0281484 3300042876 Bacteria 1507
731 Ga0466969_0017149 3300044656 Bacteria 3785
732 Ga0466972_0000057 3300044658 Bacteria 110775
733 Ga0466972_0001286 3300044658 Bacteria 12123
734 Ga0466972_0008805 3300044658 Bacteria 5063
735 Ga0466972_0097797 3300044658 Bacteria 1390
736 Ga0453683_0030268 3300044673 Bacteria 3422
737 Ga0466965_0086049 3300044683 Bacteria 1594
738 Ga0466961_0009575 3300044693 Bacteria 6169
739 Ga0453684_0002754 3300044712 Bacteria 41627
740 Ga0453684_0124591 3300044712 Bacteria 3104
741 Ga0466971_0050848 3300044719 Bacteria 1865
742 Ga0466968_0040610 3300044735 Bacteria 1962
743 Ga0466970_0021478 3300044765 Bacteria 3361
744 Ga0466970_0053550 3300044765 Bacteria 2155
745 Ga0466957_0035214 3300044842 Bacteria 3004
746 Ga0466959_0110634 3300045049 Bacteria 1961
747 Ga0451576_0022638 3300045051 Bacteria 6810
748 Ga0495627_000068 3300046453 Bacteria 126904
749 Ga0495627_000603 3300046453 Bacteria 28682
750 Ga0495627_016911 3300046453 Bacteria 2489
751 Ga0495638_0000232 3300046460 Bacteria 76388
752 Ga0495638_0143017 3300046460 Bacteria 1394
753 Ga0495653_0207807 3300046463 Bacteria 1324
754 Ga0495650_0028739 3300046471 Bacteria 2545
755 Ga0495596_0031846 3300046500 Bacteria 2104
756 Ga0495607_0018038 3300046501 Bacteria 4510
757 Ga0495606_0006163 3300046507 Bacteria 11163
758 Ga0495606_0007463 3300046507 Bacteria 9776
759 Ga0495606_0009602 3300046507 Bacteria 8155
760 Ga0495606_0035609 3300046507 Bacteria 3401
761 Ga0495610_0000006 3300046512 Bacteria 856822
762 Ga0495616_0034144 3300046513 Bacteria 2644
763 Ga0495628_0062222 3300046516 Bacteria 2926
764 Ga0495630_0300517 3300046517 Bacteria 1226
765 Ga0495632_0002092 3300046519 Bacteria 15620
766 Ga0495643_0007483 3300046522 Bacteria 7031
767 Ga0495643_0075879 3300046522 Bacteria 1759
768 Ga0495643_0115736 3300046522 Bacteria 1359
769 Ga0495663_0000044 3300046525 Bacteria 62856
770 Ga0495663_0003868 3300046525 Bacteria 4268
771 Ga0495654_0000017 3300046530 Bacteria 295999
772 Ga0495609_0000017 3300046538 Bacteria 306684
773 Ga0495633_0000037 3300046558 Bacteria 184006
774 Ga0495633_0000152 3300046558 Bacteria 91044
775 Ga0495633_0002058 3300046558 Bacteria 14500
776 Ga0495634_0035114 3300046642 Bacteria 3436
777 Ga0495611_0001026 3300046648 Bacteria 14788
778 Ga0495625_0000501 3300046660 Bacteria 58243
779 Ga0495625_0022817 3300046660 Bacteria 4790
780 Ga0495625_0062229 3300046660 Bacteria 2638
781 Ga0495657_0102592 3300046675 Bacteria 1821
782 Ga0495658_0156079 3300046683 Unclassified 1405
783 Ga0495600_0050484 3300046809 Bacteria 2715
784 Ga0495674_0244498 3300047319 Bacteria 1478
785 Ga0495672_0061739 3300047320 Bacteria 2159
786 Ga0495686_0000005 3300047472 Bacteria 827143
787 Ga0495686_0002112 3300047472 Bacteria 19479
788 Ga0495686_0006110 3300047472 Bacteria 9328
789 Ga0495686_0029992 3300047472 Bacteria 3534
790 Ga0496108_0144112 3300048911 Bacteria 2053
791 Ga0496109_0342993 3300048912 Bacteria 1411
792 Ga0496110_0019668 3300048913 Bacteria 5688
793 Ga0496110_0093365 3300048913 Bacteria 2694
794 Ga0496110_0229900 3300048913 Bacteria 1687
795 Ga0496113_0147693 3300048916 Bacteria 1853
796 Ga0496114_0000243 3300048917 Bacteria 39610
797 Ga0496115_0117601 3300048918 Bacteria 2186
798 Ga0496116_0000002 3300048919 Bacteria 920291
799 Ga0496116_0000052 3300048919 Bacteria 295469
800 Ga0496117_0000082 3300048920 Bacteria 220895
801 Ga0496118_0000321 3300048921 Bacteria 82959
802 Ga0496119_0000006 3300048922 Bacteria 505999
803 Ga0496122_0000230 3300048925 Bacteria 125542
804 Ga0496122_0001851 3300048925 Bacteria 32256
805 Ga0496122_0001875 3300048925 Bacteria 31961
806 Ga0496122_0002049 3300048925 Bacteria 29920
807 Ga0496123_0000476 3300048926 Bacteria 69684
808 Ga0496124_0003570 3300048927 Bacteria 18914
809 Ga0496124_0086776 3300048927 Bacteria 2560
810 Ga0496125_0000024 3300048928 Bacteria 442149
811 Ga0496125_0000108 3300048928 Bacteria 196060
812 Ga0496125_0001315 3300048928 Bacteria 36765
813 Ga0496125_0003723 3300048928 Bacteria 18187
814 Ga0496125_0104940 3300048928 Bacteria 2068
815 Ga0496126_0002224 3300048929 Bacteria 26840
816 Ga0496126_0002542 3300048929 Bacteria 24406
817 Ga0496126_0161957 3300048929 Bacteria 1911
818 Ga0501314_002013 3300049530 Bacteria 1537
819 Ga0501031_0009537 3300049568 Bacteria 6318
820 Ga0501032_0011337 3300049569 Bacteria 6402
821 Ga0501032_0081454 3300049569 Bacteria 2154
822 Ga0501033_0008636 3300049570 Bacteria 7884
823 Ga0501033_0159822 3300049570 Bacteria 1622
824 Ga0501034_0000004 3300049571 Bacteria 382255
825 Ga0501034_0005186 3300049571 Bacteria 14296
826 Ga0501034_0006447 3300049571 Bacteria 12635
827 Ga0501034_0014518 3300049571 Bacteria 8110
828 Ga0501034_0021095 3300049571 Bacteria 6648
829 Ga0501034_0023070 3300049571 Bacteria 6341
830 Ga0501034_0284455 3300049571 Bacteria 1593
831 Ga0501036_0005238 3300049572 Bacteria 10492
832 Ga0501036_0034412 3300049572 Bacteria 4285
833 Ga0501036_0043744 3300049572 Bacteria 3793
834 Ga0501037_0011972 3300049573 Bacteria 6391
835 Ga0501037_0094518 3300049573 Bacteria 2161
836 Ga0501037_0107272 3300049573 Bacteria 2012
837 Ga0501038_0009087 3300049574 Bacteria 9123
838 Ga0501038_0273111 3300049574 Bacteria 1332
839 Ga0501039_0048454 3300049575 Bacteria 3284
840 Ga0501039_0075619 3300049575 Bacteria 2618
841 Ga0501043_0027568 3300049579 Bacteria 4459
842 Ga0501043_0028125 3300049579 Bacteria 4413
843 Ga0501043_0048474 3300049579 Bacteria 3339
844 Ga0501043_0070852 3300049579 Bacteria 2739
845 Ga0501043_0220619 3300049579 Bacteria 1467
846 Ga0501043_0330112 3300049579 Unclassified 1162
847 Ga0501046_0071552 3300049580 Bacteria 2694
848 Ga0501047_0011756 3300049581 Bacteria 8277
849 Ga0501047_0088188 3300049581 Bacteria 2979
850 Ga0501047_0110018 3300049581 Unclassified 2638
851 Ga0501070_0004592 3300049586 Bacteria 11836
852 Ga0501073_0009930 3300049589 Bacteria 7001
853 Ga0501073_0280474 3300049589 Bacteria 1150
854 Ga0501074_0000494 3300049590 Bacteria 24088
855 Ga0501198_000130 3300049649 Bacteria 11288
856 Ga0501201_000295 3300049651 Bacteria 4543
857 Ga0501202_009961 3300049652 Bacteria 1756
858 Ga0501206_001400 3300049653 Bacteria 3016
859 Ga0501207_000851 3300049654 Bacteria 3634
860 Ga0501208_004664 3300049655 Bacteria 1632
861 Ga0501216_001408 3300049660 Bacteria 3242
862 Ga0501217_000325 3300049661 Bacteria 7599
863 Ga0501222_000182 3300049662 Bacteria 11323
864 Ga0501223_000751 3300049663 Bacteria 7717
865 Ga0501223_009084 3300049663 Bacteria 2018
866 Ga0501233_003367 3300049668 Bacteria 2873
867 Ga0501235_009289 3300049669 Bacteria 2148
868 Ga0501238_002406 3300049671 Bacteria 2235
869 Ga0501242_004215 3300049674 Bacteria 1591
870 Ga0501243_000074 3300049675 Bacteria 10068
871 Ga0501243_006226 3300049675 Bacteria 1807
872 Ga0501249_000002 3300049679 Bacteria 262756
873 Ga0501249_002827 3300049679 Bacteria 3495
874 Ga0501252_000534 3300049682 Bacteria 2967
875 Ga0501257_016825 3300049686 Bacteria 1698
876 Ga0501259_000075 3300049688 Bacteria 13606
877 Ga0501259_005676 3300049688 Bacteria 1982
878 Ga0501261_000902 3300049690 Bacteria 3674
879 Ga0501221_000128 3300049704 Bacteria 9662
880 Ga0501225_0001304 3300049705 Bacteria 7731
881 Ga0501234_003950 3300049707 Bacteria 2328
882 Ga0501245_000976 3300049708 Bacteria 3666
883 Ga0501079_0169872 3300049741 Bacteria 1700
884 Ga0501080_0064882 3300049742 Bacteria 3396
885 Ga0501083_0002163 3300049744 Bacteria 13478
886 Ga0501241_000003 3300049758 Bacteria 178857
887 Ga0501241_000260 3300049758 Bacteria 11730
888 Ga0501266_000003 3300049763 Bacteria 388836
889 Ga0501266_005058 3300049763 Bacteria 1641
890 Ga0501266_010532 3300049763 Bacteria 1178
891 Ga0501268_001347 3300049765 Bacteria 3048
892 Ga0501269_000407 3300049766 Bacteria 9932
893 Ga0501269_001345 3300049766 Bacteria 3243
894 Ga0501279_001305 3300049775 Bacteria 3276
895 Ga0501035_0011149 3300049822 Bacteria 8324
896 Ga0501035_0021889 3300049822 Bacteria 5872
897 Ga0501035_0042406 3300049822 Bacteria 4104
898 Ga0501035_0081067 3300049822 Bacteria 2864
899 Ga0501044_0006596 3300049823 Bacteria 12806
900 Ga0501044_0009390 3300049823 Bacteria 10656
901 Ga0501044_0015667 3300049823 Bacteria 8165
902 Ga0501044_0110416 3300049823 Bacteria 2759
903 Ga0501045_0185999 3300049824 Bacteria 1548
904 Ga0501212_000118 3300049851 Bacteria 6342
905 nmdc:mga0k408_16132_c1 3300050493 Bacteria 2386
906 nmdc:mga09592_164823_c1 3300050508 Bacteria 1915
907 nmdc:mga09592_177938_c1 3300050508 Bacteria 1840
908 nmdc:mga09592_18052_c1 3300050508 Bacteria 5784
909 nmdc:mga09592_215515_c1 3300050508 Bacteria 1664
910 nmdc:mga0qj67_4627_c1 3300050509 Bacteria 9984
911 nmdc:mga0n895_85610_c1 3300050512 Bacteria 3147
912 Ga0500578_0000144 3300053086 Bacteria 85335
913 Ga0500646_0001397 3300053090 Bacteria 6401
914 Ga0500651_0176972 3300053093 Bacteria 1269
915 Ga0500641_0000005 3300053096 Bacteria 226810
916 Ga0500641_0000077 3300053096 Bacteria 40051
917 Ga0500641_0010652 3300053096 Bacteria 3327
918 Ga0500641_0011045 3300053096 Bacteria 3274
919 Ga0500562_000013 3300053108 Bacteria 150003
920 Ga0500592_005291 3300053116 Bacteria 2053
921 Ga0500594_0008302 3300053118 Bacteria 2364
922 Ga0500652_025391 3300053131 Bacteria 2270
923 Ga0500658_0000015 3300053134 Bacteria 151134
924 Ga0500559_0027776 3300053136 Bacteria 2415
925 Ga0500568_0004540 3300053139 Bacteria 7403
926 Ga0500590_118540 3300053148 Bacteria 1244
927 Ga0500616_0024488 3300053153 Bacteria 3353
928 Ga0500616_0032999 3300053153 Bacteria 2827
929 Ga0500622_0000242 3300053156 Bacteria 56575
930 Ga0500636_0023141 3300053177 Bacteria 3672
931 Ga0500636_0118204 3300053177 Bacteria 1490
932 Ga0500637_0055291 3300053178 Bacteria 2267
933 Ga0500584_040685 3300053726 Bacteria 2132
934 Ga0500611_000060 3300053727 Bacteria 47744
935 Ga0501082_0237970 3300060353 Bacteria 1584
936 2511232900 2511231000 Bacteria 4488346
937 2513234718 2513020052 Bacteria 5120511
938 2520880479 2519899754 Bacteria 5336938
939 2524004949 2523533629 Bacteria 2982326
940 2585143701 2582581278 Bacteria 5296881
941 2585157624 2582581281 Bacteria 4487904
942 2585162022 2582581282 Bacteria 4495830
943 2585425748 2582581873 Bacteria 3032664
944 2587679352 2585428045 Bacteria 5203023
945 2587747215 2585428060 Bacteria 5304711
946 2587753500 2585428061 Bacteria 3939663
947 2587867182 2585428095 Bacteria 3789702
948 2587945151 2585428115 Bacteria 4420269
949 2588210467 2585428182 Bacteria 5007281
950 2588214296 2585428183 Bacteria 5166119
951 2588217060 2585428184 Bacteria 4978681
952 2588223261 2585428185 Bacteria 4969476
953 2588232766 2585428187 Bacteria 4629388
954 2588443851 2588253712 Bacteria 5403181
955 2590601728 2588254255 Bacteria 5014294
956 2590613564 2588254257 Bacteria 5436094
957 2644012120 2643221600 Bacteria 5530138
958 2644371299 2643221667 Bacteria 5627472
959 2644641396 2643221716 Bacteria 4986332
960 2644682486 2643221725 Bacteria 5087956
961 2729200243 2728369107 Bacteria 5082720
962 2738699916 2738541273 Bacteria 4048577
963 2738733901 2738541279 Bacteria 6149495
964 2738766142 2738541285 Bacteria 6150075
965 2739215482 2738543007 Bacteria 6149845
966 2739253665 2738543014 Bacteria 4048139
967 2740000342 2739367857 Bacteria 5433684
968 2740005158 2739367858 Bacteria 5432813
969 2740059231 2739367874 Bacteria 4872888
970 2753673292 2751185877 Bacteria 4921427
971 2765574396 2765235839 Bacteria 5314748
972 2772607470 2772190705 Bacteria 4666226
973 2775671793 2775506739 Bacteria 3855222
974 2802651258 2802428842 Bacteria 4926114
975 2816874620 2816332188 Bacteria 5133218
976 2817414143 2816332280 Bacteria 5109718
977 2819575417 2818991442 Bacteria 8318214
978 2819585659 2818991444 Bacteria 6968812
979 2821137961 2821136567 Bacteria 8080116
980 2842085172 2842083920 Bacteria 4857652
981 2857617782 2857613821 Bacteria 4917088
982 2857621402 2857618242 Bacteria 5635925
983 2871722145 2871720351 Bacteria 4862476
984 2881250401 2881247448 Bacteria 3717788
985 2881361446 2881359912 Bacteria 4935907
986 2889295088 2889290771 Bacteria 5530962
987 2903895221 2903895155 Bacteria 5258610
988 2904420382 2904419702 Bacteria 5166287
989 2904468753 2904467357 Bacteria 8057758
990 2904557772 2904555929 Bacteria 5218588
991 2906001963 2905999023 Bacteria 4591259
992 2914762945 2914759650 Bacteria 4701441
993 2919098768 2919097161 Bacteria 3860339
994 2919192414 2919191525 Bacteria 5765973
995 2919402226 2919399522 Bacteria 5164947
996 2919512999 2919509842 Bacteria 4104664
997 2919684179 2919683626 Bacteria 5534354
998 2929151297 2929150217 Bacteria 5462483
999 2929159616 2929154850 Bacteria 6753285
1000 2929240017 2929239360 Bacteria 7745570
1001 2929921725 2929921140 Bacteria 8649150
1002 2929927857 2929921140 Bacteria 8649150
1003 2945925871 2945924605 Bacteria 4296724
1004 2946022859 2946019816 Bacteria 4621265
1005 2958459568 2958458903 Bacteria 5301041
1006 2958515494 2958512119 Bacteria 4528530
1007 2965322537 2965320100 Bacteria 3975600
1008 2977244793 2977243572 Bacteria 4374394
1009 2977272672 2977268062 Bacteria 5243061
1010 2984573301 2984572630 Bacteria 4186940
1011 2984606736 2984606641 Bacteria 4186971
1012 2993376218 2993372514 Bacteria 4214139
1013 2993483032 2993480792 Bacteria 4022225
1014 8003154272 8003151029 Bacteria 8187759
1015 8036737282 8036736890 Bacteria 2944828
1016 8054310857 8054307821 Bacteria 5212224
1017 8055420109 8055419101 Bacteria 5289643
1018 8055596998 8055592153 Bacteria 5961247
1019 8056440908 8056440228 Bacteria 4946504
1020 Ga0163162_10431565
1021 SwRhRL2b_contig_1762647
1022 SwRhRL2b_contig_2146348
1023 SwRhRL2b_contig_3089144
1024 SwRhRL2b_contig_3744328
1025 ARcpr5yngRDRAFT_c004404
1026 JGI24741J21665_1001247
1027 JGI24740J21852_10006855
1028 JGI24740J21852_10012210
1029 JGI24739J22299_10000030
1030 JGI24739J22299_10004900
1031 JGI25406J46586_10002360
1032 rootH1_10179098
1033 rootH2_10001614
1034 rootH2_10041791
1035 rootH2_10174439
1036 rootL2_10044922
1037 rootL2_10172144
1038 rootL2_10210758
1039 rootH1_10047353
1040 rootH1_10271838
1041 JGI25160J50197_1001552
1042 JGI25160J50197_1002016
1043 JGI25160J50197_1010570
1044 Ga0055528_1001162
1045 Ga0055528_1004225
1046 Ga0055530_10000185
1047 Ga0055530_10007526
1048 Ga0065165_1000022
1049 Ga0065165_1000658
1050 Ga0065714_10008309
1051 Ga0065714_10017333
1052 Ga0065714_10064676
1053 Ga0065714_10071468
1054 Ga0065714_10080303
1055 Ga0065714_10120467
1056 Ga0065704_10070151
1057 Ga0065704_10070973
1058 Ga0065704_10071864
1059 Ga0065704_10076791
1060 Ga0065704_10132245
1061 Ga0065707_10094266
1062 Ga0070658_10006593
1063 Ga0070658_10053620
1064 Ga0070676_10021589
1065 Ga0070676_10087849
1066 Ga0070676_10131609
1067 Ga0070676_10195526
1068 Ga0070683_100002289
1069 Ga0070683_100002723
1070 Ga0070683_100011531
1071 Ga0070683_100067799
1072 Ga0070683_100143582
1073 Ga0070690_100077925
1074 Ga0070690_100081965
1075 Ga0070690_100262372
1076 Ga0070670_100015571
1077 Ga0070670_100080556
1078 Ga0070670_100085579
1079 Ga0070670_100123527
1080 Ga0070670_100174562
1081 Ga0070670_100434362
1082 Ga0070677_10013222
1083 Ga0070677_10017217
1084 Ga0068869_100005447
1085 Ga0068869_100023797
1086 Ga0068869_100028069
1087 Ga0068869_100104461
1088 Ga0068869_100117754
1089 Ga0068869_100118507
1090 Ga0070666_10000072
1091 Ga0070666_10028673
1092 Ga0070666_10071337
1093 Ga0070666_10253139
1094 Ga0070680_100000802
1095 Ga0070680_100024400
1096 Ga0070682_100000019
1097 Ga0070682_100000092
1098 Ga0070682_100011862
1099 Ga0070682_100018150
1100 Ga0070682_100318101
1101 Ga0068868_100060814
1102 Ga0068868_100106001
1103 Ga0068868_100139272
1104 Ga0068868_100171027
1105 Ga0070660_100010460
1106 Ga0070660_100016382
1107 Ga0070660_100067822
1108 Ga0070689_100030159
1109 Ga0070689_100069854
1110 Ga0070689_100094432
1111 Ga0070689_100097967
1112 Ga0070687_100123049
1113 Ga0070661_100014526
1114 Ga0070661_100023078
1115 Ga0070661_100104773
1116 Ga0070661_100243935
1117 Ga0070668_100020552
1118 Ga0070668_100030775
1119 Ga0070668_100059635
1120 Ga0070668_100136802
1121 Ga0070669_100001473
1122 Ga0070669_100002379
1123 Ga0070669_100082829
1124 Ga0070675_100009851
1125 Ga0070675_100034520
1126 Ga0070675_100107513
1127 Ga0070675_100115895
1128 Ga0070675_100247316
1129 Ga0070675_100375629
1130 Ga0070671_100020969
1131 Ga0070671_100040806
1132 Ga0070671_100065988
1133 Ga0070671_100090383
1134 Ga0070673_100031329
1135 Ga0070673_100044898
1136 Ga0070673_100050796
1137 Ga0070673_100072585
1138 Ga0070673_100089978
1139 Ga0070688_100002343
1140 Ga0070688_100057986
1141 Ga0070659_100010768
1142 Ga0070659_100018911
1143 Ga0070667_100077551
1144 Ga0070667_100119808
1145 Ga0070667_100124886
1146 Ga0070700_100033053
1147 Ga0070663_100370844
1148 Ga0070678_100041667
1149 Ga0070678_100045184
1150 Ga0070662_100018727
1151 Ga0070662_100066850
1152 Ga0070662_100194735
1153 Ga0070681_10032352
1154 Ga0070681_10105005
1155 Ga0070681_10339475
1156 Ga0068867_100003996
1157 Ga0068867_100040969
1158 Ga0068867_100042323
1159 Ga0070685_10071541
1160 Ga0070685_10104902
1161 Ga0070698_100007114
1162 Ga0070698_100013253
1163 Ga0070679_100000158
1164 Ga0070679_100006985
1165 Ga0070679_100104012
1166 Ga0070684_100002319
1167 Ga0070684_100018695
1168 Ga0070684_100023156
1169 Ga0070684_100024714
1170 Ga0070684_100043825
1171 Ga0068853_100007045
1172 Ga0068853_100020379
1173 Ga0068853_100031963
1174 Ga0068853_100055184
1175 Ga0068853_100071844
1176 Ga0068853_100093472
1177 Ga0070672_100004510
1178 Ga0070672_100096625
1179 Ga0070686_100038536
1180 Ga0070693_100022765
1181 Ga0070665_100017638
1182 Ga0070665_100115341
1183 Ga0068855_100001027
1184 Ga0068855_100010998
1185 Ga0068855_100066421
1186 Ga0068855_100155975
1187 Ga0068855_100239327
1188 Ga0068855_100248675
1189 Ga0070664_100009600
1190 Ga0070664_100014826
1191 Ga0070664_100019613
1192 Ga0070664_100120393
1193 Ga0070664_100126604
1194 Ga0070664_100174179
1195 Ga0070664_100468832
1196 Ga0068857_100004302
1197 Ga0068857_100088934
1198 Ga0068857_100096888
1199 Ga0068857_100100130
1200 Ga0068857_100183656
1201 Ga0068857_100333384
1202 Ga0068857_100353539
1203 Ga0068854_100016936
1204 Ga0068854_100064535
1205 Ga0068854_100081578
1206 Ga0068854_100264763
1207 Ga0068856_100032446
1208 Ga0070702_100245648
1209 Ga0068852_100000989
1210 Ga0068852_100005736
1211 Ga0068852_100013321
1212 Ga0068852_100028296
1213 Ga0068852_100211770
1214 Ga0068859_100000006
1215 Ga0068859_100007990
1216 Ga0068859_100011125
1217 Ga0068859_100031496
1218 Ga0068859_100175683
1219 Ga0068859_100316494
1220 Ga0068859_100363917
1221 Ga0068864_100012944
1222 Ga0068864_100017013
1223 Ga0068864_100035108
1224 Ga0068864_100059981
1225 Ga0068866_10042032
1226 Ga0068861_100039435
1227 Ga0068861_100102518
1228 Ga0068861_100313605
1229 Ga0068861_100388585
1230 Ga0068851_10111325
1231 Ga0068870_10012058
1232 Ga0068870_10015090
1233 Ga0068863_100055268
1234 Ga0068863_100059836
1235 Ga0068863_100144604
1236 Ga0068863_100150025
1237 Ga0068863_100490368
1238 Ga0068858_100070848
1239 Ga0068858_100332303
1240 Ga0068860_100000061
1241 Ga0068860_100001096
1242 Ga0068860_100005681
1243 Ga0068860_100028006
1244 Ga0068860_100136937
1245 Ga0068860_100144733
1246 Ga0068860_100498108
1247 Ga0081539_10000338
1248 Ga0070715_10061328
1249 Ga0075366_10011421
1250 Ga0075366_10018211
1251 Ga0075366_10051273
1252 Ga0097621_100000448
1253 Ga0097621_100014754
1254 Ga0097621_100072683
1255 Ga0097621_100088492
1256 Ga0068871_100001237
1257 Ga0068871_100018019
1258 Ga0068871_100228938
1259 Ga0068871_100259362
1260 Ga0075428_100010088
1261 Ga0075428_100011391
1262 Ga0075428_100071436
1263 Ga0075430_100002480
1264 Ga0075430_100030429
1265 Ga0075429_100040575
1266 Ga0068865_100016555
1267 Ga0068865_100097245
1268 Ga0097620_100000006
1269 Ga0097620_100001537
1270 Ga0097620_100007990
1271 Ga0097620_100011125
1272 Ga0097620_100031496
1273 Ga0097620_100175687
1274 Ga0097620_100316508
1275 Ga0097620_100363926
1276 Ga0099824_1000500
1277 Ga0079104_1000079
1278 Ga0099826_10000143
1279 Ga0105251_10035505
1280 Ga0105244_10000001
1281 Ga0105244_10000054
1282 Ga0105250_10006702
1283 Ga0105240_10001787
1284 Ga0105240_10001808
1285 Ga0105240_10003852
1286 Ga0105240_10004358
1287 Ga0105240_10006347
1288 Ga0105240_10013595
1289 Ga0105240_10034582
1290 Ga0105240_10061820
1291 Ga0111539_10001303
1292 Ga0111539_10094577
1293 Ga0111539_10321138
1294 Ga0111539_10588248
1295 Ga0105247_10018425
1296 Ga0105247_10213756
1297 Ga0114129_10020886
1298 Ga0114129_10465245
1299 Ga0105243_10001053
1300 Ga0105243_10450247
1301 Ga0105241_10000886
1302 Ga0105241_10007561
1303 Ga0105241_10008379
1304 Ga0105241_10230277
1305 Ga0105242_10007715
1306 Ga0105242_10022259
1307 Ga0105242_10031614
1308 Ga0105242_10083440
1309 Ga0105248_10044227
1310 Ga0105237_10007301
1311 Ga0105237_10013605
1312 Ga0105237_10127578
1313 Ga0105237_10210708
1314 Ga0105237_10211779
1315 Ga0105238_10000592
1316 Ga0105238_10381080
1317 Ga0105249_10000623
1318 Ga0105249_10019091
1319 Ga0105249_10052792
1320 Ga0105249_10068255
1321 Ga0105249_10081133
1322 Ga0105249_10155163
1323 Ga0105249_10209496
1324 Ga0105239_10000019
1325 Ga0105239_10001405
1326 Ga0105239_10039800
1327 Ga0105239_10045372
1328 Ga0105246_10063689
1329 Ga0105246_10075370
1330 Ga0157373_10000035
1331 Ga0157373_10000056
1332 Ga0157373_10010363
1333 Ga0157373_10010705
1334 Ga0157373_10023444
1335 Ga0157373_10051295
1336 Ga0157373_10054280
1337 Ga0157371_10000081
1338 Ga0157371_10000218
1339 Ga0157371_10001629
1340 Ga0157371_10003874
1341 Ga0157371_10007353
1342 Ga0157371_10014811
1343 Ga0157371_10050257
1344 Ga0157370_10001029
1345 Ga0157370_10001171
1346 Ga0157370_10001492
1347 Ga0157370_10004094
1348 Ga0157370_10005329
1349 Ga0157370_10007679
1350 Ga0157370_10008275
1351 Ga0157370_10015550
1352 Ga0157370_10017727
1353 Ga0157370_10022533
1354 Ga0157370_10066766
1355 Ga0157370_10103574
1356 Ga0157369_10000474
1357 Ga0157369_10002049
1358 Ga0157369_10048167
1359 Ga0157369_10092452
1360 Ga0157369_10132396
1361 Ga0157369_10202875
1362 Ga0157369_10211675
1363 Ga0157369_10301870
1364 Ga0157369_10382259
1365 Ga0157369_10532889
1366 Ga0157369_10537215
1367 Ga0157374_10003783
1368 Ga0157374_10008939
1369 Ga0157374_10021996
1370 Ga0157374_10039978
1371 Ga0157374_10045758
1372 Ga0157374_10339748
1373 Ga0157374_10345671
1374 Ga0157378_10003090
1375 Ga0157378_10016578
1376 Ga0157378_10017446
1377 Ga0157378_10019626
1378 Ga0157378_10024744
1379 Ga0157378_10033297
1380 Ga0157378_10069352
1381 Ga0157378_10099924
1382 Ga0163162_10000131
1383 Ga0163162_10002714
1384 Ga0163162_10023335
1385 Ga0163162_10031303
1386 Ga0163162_10044775
1387 Ga0163162_10081880
1388 Ga0163162_10084128
1389 Ga0163162_10179002
1390 Ga0163162_10183242
1391 Ga0157372_10003581
1392 Ga0157372_10013617
1393 Ga0157372_10019373
1394 Ga0157372_10038889
1395 Ga0157372_10061028
1396 Ga0157372_10103820
1397 Ga0157372_10114245
1398 Ga0157372_10129714
1399 Ga0157372_10193417
1400 Ga0157372_10391584
1401 Ga0157372_10577083
1402 Ga0157375_10000280
1403 Ga0157375_10004666
1404 Ga0157375_10016191
1405 Ga0157375_10116256
1406 Ga0157375_10180596
1407 Ga0163163_10000591
1408 Ga0163163_10007372
1409 Ga0163163_10066601
1410 Ga0163163_10163969
1411 Ga0157380_10000026
1412 Ga0157380_10004078
1413 Ga0157380_10004118
1414 Ga0157380_10020610
1415 Ga0157380_10044775
1416 Ga0157380_10146262
1417 Ga0182008_10000007
1418 Ga0157377_10000583
1419 Ga0157377_10008618
1420 Ga0157377_10059269
1421 Ga0157379_10090934
1422 Ga0157379_10144775
1423 Ga0157379_10168514
1424 Ga0157379_10306013
1425 Ga0157376_10002332
1426 Ga0157376_10044790
1427 Ga0157376_10053620
1428 Ga0157376_10123046
1429 Ga0157376_10124326
1430 Ga0182006_1000003
1431 Ga0182006_1001274
1432 Ga0182006_1005678
1433 Ga0182006_1020701
1434 Ga0182007_10031544
1435 Ga0182005_1000189
1436 Ga0163161_10000091
1437 Ga0163161_10002598
1438 Ga0163161_10004744
1439 Ga0163161_10004838
1440 Ga0163161_10013026
1441 Ga0163161_10038918
1442 Ga0163161_10041186
1443 Ga0163161_10073007
1444 Ga0213876_10003238
1445 Ga0213876_10126200
1446 Ga0209673_1000519
1447 Ga0209675_1000323
1448 Ga0209050_1000129
1449 Ga0209050_1000276
1450 Ga0207426_1000019
1451 Ga0207426_1000059
1452 Ga0207426_1002756
1453 Ga0207426_1003233
1454 Ga0207426_1008034
1455 Ga0209051_1027692
1456 Ga0209257_1000736
1457 Ga0209257_1001011
1458 Ga0207656_10000237
1459 Ga0207655_1000003
1460 Ga0207655_1000018
1461 Ga0207710_10017235
1462 Ga0207688_10006044
1463 Ga0207680_10000137
1464 Ga0207680_10067238
1465 Ga0207680_10125416
1466 Ga0207680_10133167
1467 Ga0207680_10139605
1468 Ga0207680_10161834
1469 Ga0207647_10000025
1470 Ga0207647_10015704
1471 Ga0207647_10029562
1472 Ga0207647_10058866
1473 Ga0207647_10134471
1474 Ga0207645_10001948
1475 Ga0207645_10002012
1476 Ga0207645_10031229
1477 Ga0207643_10015283
1478 Ga0207643_10105415
1479 Ga0207705_10050927
1480 Ga0207705_10286764
1481 Ga0207654_10003375
1482 Ga0207654_10005844
1483 Ga0207707_10000238
1484 Ga0207707_10018897
1485 Ga0207707_10025973
1486 Ga0207695_10000087
1487 Ga0207695_10000863
1488 Ga0207695_10001230
1489 Ga0207695_10028221
1490 Ga0207695_10034544
1491 Ga0207695_10100032
1492 Ga0207671_10000453
1493 Ga0207671_10000931
1494 Ga0207671_10002781
1495 Ga0207671_10004520
1496 Ga0207671_10043217
1497 Ga0207671_10139128
1498 Ga0207660_10013800
1499 Ga0207660_10129301
1500 Ga0207660_10144183
1501 Ga0207657_10004391
1502 Ga0207657_10064911
1503 Ga0207657_10076939
1504 Ga0207657_10089176
1505 Ga0207657_10155020
1506 Ga0207649_10014898
1507 Ga0207649_10036342
1508 Ga0207649_10096472
1509 Ga0207649_10144393
1510 Ga0207652_10000013
1511 Ga0207652_10000346
1512 Ga0207652_10002804
1513 Ga0207652_10019984
1514 Ga0207652_10065940
1515 Ga0207681_10034279
1516 Ga0207681_10095341
1517 Ga0207681_10261993
1518 Ga0207650_10026156
1519 Ga0207650_10044809
1520 Ga0207650_10100282
1521 Ga0207650_10105413
1522 Ga0207650_10120146
1523 Ga0207650_10307646
1524 Ga0207659_10082053
1525 Ga0207659_10104323
1526 Ga0207659_10120581
1527 Ga0207644_10108647
1528 Ga0207644_10115109
1529 Ga0207644_10186164
1530 Ga0207690_10024343
1531 Ga0207706_10003226
1532 Ga0207706_10004884
1533 Ga0207706_10031139
1534 Ga0207706_10060968
1535 Ga0207706_10228973
1536 Ga0207686_10000764
1537 Ga0207686_10039056
1538 Ga0207686_10039701
1539 Ga0207686_10098422
1540 Ga0207709_10018839
1541 Ga0207670_10066676
1542 Ga0207670_10379291
1543 Ga0207669_10102152
1544 Ga0207704_10050591
1545 Ga0207704_10170504
1546 Ga0207691_10005909
1547 Ga0207691_10011514
1548 Ga0207691_10030031
1549 Ga0207691_10053331
1550 Ga0207691_10234383
1551 Ga0207691_10316332
1552 Ga0207689_10005782
1553 Ga0207689_10011456
1554 Ga0207689_10024448
1555 Ga0207689_10044372
1556 Ga0207689_10045457
1557 Ga0207689_10049261
1558 Ga0207689_10067587
1559 Ga0207689_10073106
1560 Ga0207689_10106592
1561 Ga0207689_10112809
1562 Ga0207689_10153764
1563 Ga0207689_10286726
1564 Ga0207661_10010032
1565 Ga0207661_10013439
1566 Ga0207661_10014911
1567 Ga0207661_10045858
1568 Ga0207661_10136717
1569 Ga0207679_10005881
1570 Ga0207679_10067158
1571 Ga0207679_10080716
1572 Ga0207679_10125104
1573 Ga0207679_10341674
1574 Ga0207667_10000098
1575 Ga0207667_10000279
1576 Ga0207667_10004703
1577 Ga0207667_10017739
1578 Ga0207667_10094333
1579 Ga0207667_10139609
1580 Ga0207667_10402029
1581 Ga0207651_10036784
1582 Ga0207651_10226625
1583 Ga0207712_10001013
1584 Ga0207712_10006008
1585 Ga0207712_10011002
1586 Ga0207712_10050698
1587 Ga0207712_10058121
1588 Ga0207668_10038802
1589 Ga0207668_10062514
1590 Ga0207668_10111780
1591 Ga0207668_10129220
1592 Ga0207640_10064742
1593 Ga0207640_10067157
1594 Ga0207640_10089030
1595 Ga0207658_10078470
1596 Ga0207658_10119552
1597 Ga0207658_10364932
1598 Ga0207677_10022316
1599 Ga0207677_10040671
1600 Ga0207703_10035603
1601 Ga0207639_10009075
1602 Ga0207639_10015542
1603 Ga0207639_10034582
1604 Ga0207639_10062045
1605 Ga0207639_10067739
1606 Ga0207678_10006330
1607 Ga0207678_10026007
1608 Ga0207678_10074008
1609 Ga0207708_10152859
1610 Ga0207702_10409025
1611 Ga0207702_10475984
1612 Ga0207641_10000058
1613 Ga0207641_10024998
1614 Ga0207641_10085922
1615 Ga0207641_10186361
1616 Ga0207641_10354235
1617 Ga0207641_10389677
1618 Ga0207648_10003197
1619 Ga0207648_10003482
1620 Ga0207648_10026917
1621 Ga0207648_10036267
1622 Ga0207648_10188745
1623 Ga0207676_10010326
1624 Ga0207676_10028711
1625 Ga0207674_10000969
1626 Ga0207674_10005452
1627 Ga0207674_10021460
1628 Ga0207674_10023895
1629 Ga0207674_10053972
1630 Ga0207674_10324755
1631 Ga0207675_100000654
1632 Ga0207675_100022585
1633 Ga0207675_100054133
1634 Ga0207675_100062593
1635 Ga0207675_100122687
1636 Ga0207675_100156470
1637 Ga0207675_100257898
1638 Ga0207675_100377666
1639 Ga0207683_10035923
1640 Ga0207698_10000937
1641 Ga0207698_10017486
1642 Ga0207698_10023447
1643 Ga0207698_10038320
1644 Ga0207698_10090624
1645 Ga0207698_10260174
1646 Ga0207698_10335523
1647 Ga0209281_1000045
1648 Ga0209489_108596
1649 Ga0210002_1001089
1650 Ga0268266_10000068
1651 Ga0268266_10090840
1652 Ga0268264_10000079
1653 Ga0268264_10002043
1654 Ga0268264_10003074
1655 Ga0268264_10006028
1656 Ga0268264_10010056
1657 Ga0268264_10013025
1658 Ga0268264_10081602
1659 Ga0268264_10109398
1660 Ga0265334_10013415
1661 Ga0307517_10001481
1662 Ga0307515_10000001
1663 Ga0307515_10000059
1664 Ga0265324_10028844
1665 Ga0307511_10000201
1666 Ga0265327_10000009
1667 Ga0265327_10000013
1668 Ga0265327_10000031
1669 Ga0265327_10004168
1670 Ga0265327_10028535
1671 Ga0307509_10029227
1672 Ga0307509_10090993
1673 Ga0307509_10326538
1674 Ga0307408_100000375
1675 Ga0307408_100000600
1676 Ga0307408_100209884
1677 Ga0307508_10001083
1678 Ga0307508_10055089
1679 Ga0265314_10105638
1680 Ga0307516_10090526
1681 Ga0307405_10000001
1682 Ga0307413_10000001
1683 Ga0307413_10251205
1684 Ga0307410_10000024
1685 Ga0307410_10114427
1686 Ga0307410_10177734
1687 Ga0307406_10000028
1688 Ga0307406_10003873
1689 Ga0307406_10060682
1690 Ga0307407_10000286
1691 Ga0307412_10000062
1692 Ga0307412_10000155
1693 Ga0307412_10116424
1694 Ga0307412_10192377
1695 Ga0307416_100000013
1696 Ga0307416_100000066
1697 Ga0307416_100048785
1698 Ga0307414_10000022
1699 Ga0307414_10000041
1700 Ga0307414_10000241
1701 Ga0307414_10006659
1702 Ga0307414_10019595
1703 Ga0307414_10025485
1704 Ga0307414_10031050
1705 Ga0307414_10034030
1706 Ga0307414_10047614
1707 Ga0307414_10093659
1708 Ga0307414_10144565
1709 Ga0307414_10162064
1710 Ga0307411_10000003
1711 Ga0307411_10151934
1712 Ga0307510_10009446
1713 Ga0373934_0015585
1714 Ga0373943_0071141
1715 Ga0373955_0040882
1716 Ga0373933_0040967
1717 Ga0395899_0000025
1718 Ga0395899_0000528
1719 Ga0395899_0057783
1720 Ga0395899_0225469
1721 Ga0395899_0250777
1722 Ga0395900_0008628
1723 Ga0395900_0011009
1724 Ga0395900_0014908
1725 Ga0395898_0000595
1726 Ga0395898_0017447
1727 Ga0395905_0004944
1728 Ga0395905_0011815
1729 Ga0395905_0255495
1730 Ga0395905_0385700
1731 Ga0395901_0001672
1732 Ga0395901_0007597
1733 Ga0395901_0007671
1734 Ga0395901_0237157
1735 Ga0436365_0022529
1736 Ga0436365_1412273
1737 Ga0439439_0049448
1738 Ga0439447_000106
1739 Ga0439466_0000940
1740 Ga0439466_0042247
1741 Ga0439465_0000262
1742 Ga0439431_0003814
1743 Ga0439445_0000338
1744 Ga0439445_0062334
1745 Ga0439449_0066059
1746 Ga0439449_0068842
1747 Ga0450923_001224
1748 Ga0451577_0004359
1749 Ga0451577_0281484
1750 Ga0466969_0017149
1751 Ga0466972_0000057
1752 Ga0466972_0001286
1753 Ga0466972_0008805
1754 Ga0466972_0097797
1755 Ga0453683_0030268
1756 Ga0466965_0086049
1757 Ga0466961_0009575
1758 Ga0453684_0002754
1759 Ga0453684_0124591
1760 Ga0466971_0050848
1761 Ga0466968_0040610
1762 Ga0466970_0021478
1763 Ga0466970_0053550
1764 Ga0466957_0035214
1765 Ga0466959_0110634
1766 Ga0451576_0022638
1767 Ga0495627_000068
1768 Ga0495627_000603
1769 Ga0495627_016911
1770 Ga0495638_0000232
1771 Ga0495638_0143017
1772 Ga0495653_0207807
1773 Ga0495650_0028739
1774 Ga0495596_0031846
1775 Ga0495607_0018038
1776 Ga0495606_0006163
1777 Ga0495606_0007463
1778 Ga0495606_0009602
1779 Ga0495606_0035609
1780 Ga0495610_0000006
1781 Ga0495616_0034144
1782 Ga0495628_0062222
1783 Ga0495630_0300517
1784 Ga0495632_0002092
1785 Ga0495643_0007483
1786 Ga0495643_0075879
1787 Ga0495643_0115736
1788 Ga0495663_0000044
1789 Ga0495663_0003868
1790 Ga0495654_0000017
1791 Ga0495609_0000017
1792 Ga0495633_0000037
1793 Ga0495633_0000152
1794 Ga0495633_0002058
1795 Ga0495634_0035114
1796 Ga0495611_0001026
1797 Ga0495625_0000501
1798 Ga0495625_0022817
1799 Ga0495625_0062229
1800 Ga0495657_0102592
1801 Ga0495658_0156079
1802 Ga0495600_0050484
1803 Ga0495674_0244498
1804 Ga0495672_0061739
1805 Ga0495686_0000005
1806 Ga0495686_0002112
1807 Ga0495686_0006110
1808 Ga0495686_0029992
1809 Ga0496108_0144112
1810 Ga0496109_0342993
1811 Ga0496110_0019668
1812 Ga0496110_0093365
1813 Ga0496110_0229900
1814 Ga0496113_0147693
1815 Ga0496114_0000243
1816 Ga0496115_0117601
1817 Ga0496116_0000002
1818 Ga0496116_0000052
1819 Ga0496117_0000082
1820 Ga0496118_0000321
1821 Ga0496119_0000006
1822 Ga0496122_0000230
1823 Ga0496122_0001851
1824 Ga0496122_0001875
1825 Ga0496122_0002049
1826 Ga0496123_0000476
1827 Ga0496124_0003570
1828 Ga0496124_0086776
1829 Ga0496125_0000024
1830 Ga0496125_0000108
1831 Ga0496125_0001315
1832 Ga0496125_0003723
1833 Ga0496125_0104940
1834 Ga0496126_0002224
1835 Ga0496126_0002542
1836 Ga0496126_0161957
1837 Ga0501314_002013
1838 Ga0501031_0009537
1839 Ga0501032_0011337
1840 Ga0501032_0081454
1841 Ga0501033_0008636
1842 Ga0501033_0159822
1843 Ga0501034_0000004
1844 Ga0501034_0005186
1845 Ga0501034_0006447
1846 Ga0501034_0014518
1847 Ga0501034_0021095
1848 Ga0501034_0023070
1849 Ga0501034_0284455
1850 Ga0501036_0005238
1851 Ga0501036_0034412
1852 Ga0501036_0043744
1853 Ga0501037_0011972
1854 Ga0501037_0094518
1855 Ga0501037_0107272
1856 Ga0501038_0009087
1857 Ga0501038_0273111
1858 Ga0501039_0048454
1859 Ga0501039_0075619
1860 Ga0501043_0027568
1861 Ga0501043_0028125
1862 Ga0501043_0048474
1863 Ga0501043_0070852
1864 Ga0501043_0220619
1865 Ga0501043_0330112
1866 Ga0501046_0071552
1867 Ga0501047_0011756
1868 Ga0501047_0088188
1869 Ga0501047_0110018
1870 Ga0501070_0004592
1871 Ga0501073_0009930
1872 Ga0501073_0280474
1873 Ga0501074_0000494
1874 Ga0501198_000130
1875 Ga0501201_000295
1876 Ga0501202_009961
1877 Ga0501206_001400
1878 Ga0501207_000851
1879 Ga0501208_004664
1880 Ga0501216_001408
1881 Ga0501217_000325
1882 Ga0501222_000182
1883 Ga0501223_000751
1884 Ga0501223_009084
1885 Ga0501233_003367
1886 Ga0501235_009289
1887 Ga0501238_002406
1888 Ga0501242_004215
1889 Ga0501243_000074
1890 Ga0501243_006226
1891 Ga0501249_000002
1892 Ga0501249_002827
1893 Ga0501252_000534
1894 Ga0501257_016825
1895 Ga0501259_000075
1896 Ga0501259_005676
1897 Ga0501261_000902
1898 Ga0501221_000128
1899 Ga0501225_0001304
1900 Ga0501234_003950
1901 Ga0501245_000976
1902 Ga0501079_0169872
1903 Ga0501080_0064882
1904 Ga0501083_0002163
1905 Ga0501241_000003
1906 Ga0501241_000260
1907 Ga0501266_000003
1908 Ga0501266_005058
1909 Ga0501266_010532
1910 Ga0501268_001347
1911 Ga0501269_000407
1912 Ga0501269_001345
1913 Ga0501279_001305
1914 Ga0501035_0011149
1915 Ga0501035_0021889
1916 Ga0501035_0042406
1917 Ga0501035_0081067
1918 Ga0501044_0006596
1919 Ga0501044_0009390
1920 Ga0501044_0015667
1921 Ga0501044_0110416
1922 Ga0501045_0185999
1923 Ga0501212_000118
1924 nmdc:mga0k408_16132_c1
1925 nmdc:mga09592_164823_c1
1926 nmdc:mga09592_177938_c1
1927 nmdc:mga09592_18052_c1
1928 nmdc:mga09592_215515_c1
1929 nmdc:mga0qj67_4627_c1
1930 nmdc:mga0n895_85610_c1
1931 Ga0500578_0000144
1932 Ga0500646_0001397
1933 Ga0500651_0176972
1934 Ga0500641_0000005
1935 Ga0500641_0000077
1936 Ga0500641_0010652
1937 Ga0500641_0011045
1938 Ga0500562_000013
1939 Ga0500592_005291
1940 Ga0500594_0008302
1941 Ga0500652_025391
1942 Ga0500658_0000015
1943 Ga0500559_0027776
1944 Ga0500568_0004540
1945 Ga0500590_118540
1946 Ga0500616_0024488
1947 Ga0500616_0032999
1948 Ga0500622_0000242
1949 Ga0500636_0023141
1950 Ga0500636_0118204
1951 Ga0500637_0055291
1952 Ga0500584_040685
1953 Ga0500611_000060
1954 Ga0501082_0237970
1955 2511232900
1956 2513234718
1957 2520880479
1958 2524004949
1959 2585143701
1960 2585157624
1961 2585162022
1962 2585425748
1963 2587679352
1964 2587747215
1965 2587753500
1966 2587867182
1967 2587945151
1968 2588210467
1969 2588214296
1970 2588217060
1971 2588223261
1972 2588232766
1973 2588443851
1974 2590601728
1975 2590613564
1976 2644012120
1977 2644371299
1978 2644641396
1979 2644682486
1980 2729200243
1981 2738699916
1982 2738733901
1983 2738766142
1984 2739215482
1985 2739253665
1986 2740000342
1987 2740005158
1988 2740059231
1989 2753673292
1990 2765574396
1991 2772607470
1992 2775671793
1993 2802651258
1994 2816874620
1995 2817414143
1996 2819575417
1997 2819585659
1998 2821137961
1999 2842085172
2000 2857617782
2001 2857621402
2002 2871722145
2003 2881250401
2004 2881361446
2005 2889295088
2006 2903895221
2007 2904420382
2008 2904468753
2009 2904557772
2010 2906001963
2011 2914762945
2012 2919098768
2013 2919192414
2014 2919402226
2015 2919512999
2016 2919684179
2017 2929151297
2018 2929159616
2019 2929240017
2020 2929921725
2021 2929927857
2022 2945925871
2023 2946022859
2024 2958459568
2025 2958515494
2026 2965322537
2027 2977244793
2028 2977272672
2029 2984573301
2030 2984606736
2031 2993376218
2032 2993483032
2033 8003154272
2034 8036737282
2035 8054310857
2036 8055420109
2037 8055596998
2038 8056440908

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01207

Dus

Dihydrouridine synthase (Dus)

59

368

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vhn-assembly1.cif.gz_A crystal structure of a putative flavin oxidoreductase with flavin 0.9469 13 323
1vhn-assembly1.cif.gz_A crystal structure of a putative flavin oxidoreductase with flavin 0.9349 13 323
6ei9-assembly2.cif.gz_B crystal structure of e. coli trna-dihydrouridine synthase b (dusb) 0.9296 2 322
6ei9-assembly2.cif.gz_B crystal structure of e. coli trna-dihydrouridine synthase b (dusb) 0.9063 2 322
3b0p-assembly1.cif.gz_A trna-dihydrouridine synthase from thermus thermophilus 0.8515 10 323
ID Description Score Start End Superfamily
af_P0ABT5_6_247_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9672 14 251 3.20.20.70
af_Q9VIS4_253_495_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9526 13 243 3.20.20.70
1vhnA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9515 13 253 3.20.20.70
af_Q54ES7_56_285_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9466 15 239 3.20.20.70
1vhnA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9435 13 253 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4Q3W6G6-F1-model_v4 tRNA-dihydrouridine synthase family protein 0.9919 1 224 GO:0003723
GO:0017150
GO:0050660
AF-A0A090WNH1-F1-model_v4 tRNA-dihydrouridine synthase (EC 1.3.1.-) 0.9887 1 279 GO:0003723
GO:0017150
GO:0050660
AF-A0A3C0ZCP8-F1-model_v4 tRNA dihydrouridine synthase DusB 0.9877 2 146 GO:0003723
GO:0017150
GO:0050660
AF-A0A4Q3W6G6-F1-model_v4 tRNA-dihydrouridine synthase family protein 0.9875 1 224 GO:0003723
GO:0017150
GO:0050660
AF-A0A3D6B101-F1-model_v4 tRNA dihydrouridine synthase DusB 0.9871 3 235 GO:0003723
GO:0017150
GO:0050660

Map