F488346
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1019 | 432 | 2038 | 340 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10431565|Ga0163162_104315651 |
| Length | 389 |
| Sequence | LIICVYLKKYQILNIQRSIFNAQLETLIKNKGESDSQELHYQVLIMNIQNIQLPDFPLLLAPMEDVSDPPFRAVCKANGADLMYTEFISSEGLIRDAIKSRQKLDIFDYERPVGIQIFGGDEEAMALSAKIVDAVQPDLVDINFGCPVKKVVSKGAGAAVLKDVDLMVRLTRAVVNSTSLPVTVKTRLGWDITSINIIEVAERLQDVGIKALAIHGRTRNQLYKGVADWSWIARVKDNPRIQIPIFGNGDIDSPEKALEYKKRYGIDGIMIGRAAIGYPWIFNEIKHYFATGEHLQPPTIEQRVEVIKQHLYRSVEWKGLIPGINEMRRHYTNYLKGLPNIKEHRLKLVTLNSVEEIDEVLSTVIHTYSGYVFEKRNIDMQAMAWSCEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 84 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 85 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 215 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 216 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 219 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 220 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 221 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 229 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 230 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 268 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 269 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 270 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 271 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 272 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 273 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 274 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 275 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 276 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 292 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 293 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 294 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 295 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 296 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 297 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 298 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 299 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 300 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 304 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 305 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 306 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 308 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 309 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 310 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 311 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 312 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 315 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 319 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 320 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 322 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 327 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 328 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 332 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 333 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 334 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 335 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 336 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 337 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 338 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 339 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 341 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 343 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 345 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 347 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 348 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 349 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 351 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 352 | 2519899754 | Flavobacterium sp. F52 | Isolate | Rhizosphere |
| 353 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 354 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 355 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 356 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 357 | 2582581873 | Chryseobacterium sp. OV259 | Isolate | Rhizosphere |
| 358 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 359 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 360 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 361 | 2585428095 | Chryseobacterium sp. YR005 | Isolate | Rhizosphere |
| 362 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 363 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 364 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 365 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 366 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 367 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 368 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 369 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 370 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 371 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 372 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 373 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 374 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 375 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 376 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 377 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 378 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 379 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 380 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 381 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 382 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 383 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 384 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 385 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 386 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 387 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 388 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 389 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 390 | 2816332280 | Flavobacterium johnsoniae GSE09 | Isolate | Unclassified |
| 391 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 392 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 393 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 394 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 395 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 396 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 397 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 398 | 2881247448 | Flavobacterium beibuense RSKm HC5 | Isolate | Rhizosphere |
| 399 | 2881359912 | Flavobacterium ustbae T13 | Isolate | Rhizosphere |
| 400 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 401 | 2903895155 | Flavobacterium sp. HBTb2-11-1 | Isolate | Rhizosphere |
| 402 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 403 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 404 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 405 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 406 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 407 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 408 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 409 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 410 | 2919509842 | Flavobacterium arsenatis 3773 | Isolate | Unclassified |
| 411 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 412 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 413 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 414 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 415 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 416 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 417 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 418 | 2958458903 | Flavobacterium anhuiense RCM74 | Isolate | Rhizosphere |
| 419 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
| 420 | 2965320100 | Flavobacterium agri MAH-1 | Isolate | Rhizosphere |
| 421 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 422 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 423 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 424 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 425 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 426 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 427 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 428 | 8036736890 | Flavobacterium dauae TCH3-2 | Isolate | Rhizosphere |
| 429 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 430 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 431 | 8055592153 | Flavobacterium panacis DCY106 | Isolate | Rhizosphere |
| 432 | 8056440228 | Flavobacterium hibisci THG-HG1.4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.66 |
| Metatranscriptomes | 0.1 |
| Isolates | 8.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.2 |
| Bulb | 0 |
| Endosphere | 4.71 |
| Nodule | 0.59 |
| Rhizoplane | 0.79 |
| Rhizosphere | 85.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_10431565 | 3300013306 | Bacteria | 1450 |
| 2 | SwRhRL2b_contig_1762647 | 2162886007 | Bacteria | 207340 |
| 3 | SwRhRL2b_contig_2146348 | 2162886007 | Bacteria | 2953 |
| 4 | SwRhRL2b_contig_3089144 | 2162886007 | Bacteria | 1614 |
| 5 | SwRhRL2b_contig_3744328 | 2162886007 | Bacteria | 2651 |
| 6 | ARcpr5yngRDRAFT_c004404 | 3300000043 | Bacteria | 1335 |
| 7 | JGI24741J21665_1001247 | 3300001915 | Bacteria | 7493 |
| 8 | JGI24740J21852_10006855 | 3300001979 | Bacteria | 4676 |
| 9 | JGI24740J21852_10012210 | 3300001979 | Bacteria | 3243 |
| 10 | JGI24739J22299_10000030 | 3300001989 | Bacteria | 39896 |
| 11 | JGI24739J22299_10004900 | 3300001989 | Bacteria | 5099 |
| 12 | JGI25406J46586_10002360 | 3300003203 | Bacteria | 8925 |
| 13 | rootH1_10179098 | 3300003316 | Bacteria | 2534 |
| 14 | rootH2_10001614 | 3300003320 | Bacteria | 29985 |
| 15 | rootH2_10041791 | 3300003320 | Unclassified | 4311 |
| 16 | rootH2_10174439 | 3300003320 | Bacteria | 3208 |
| 17 | rootL2_10044922 | 3300003322 | Bacteria | 10708 |
| 18 | rootL2_10172144 | 3300003322 | Bacteria | 1521 |
| 19 | rootL2_10210758 | 3300003322 | Bacteria | 2682 |
| 20 | rootH1_10047353 | 3300003323 | Bacteria | 13442 |
| 21 | rootH1_10271838 | 3300003323 | Bacteria | 3321 |
| 22 | JGI25160J50197_1001552 | 3300003354 | Bacteria | 11373 |
| 23 | JGI25160J50197_1002016 | 3300003354 | Bacteria | 9682 |
| 24 | JGI25160J50197_1010570 | 3300003354 | Bacteria | 3325 |
| 25 | Ga0055528_1001162 | 3300003790 | Bacteria | 17034 |
| 26 | Ga0055528_1004225 | 3300003790 | Bacteria | 6959 |
| 27 | Ga0055530_10000185 | 3300003791 | Bacteria | 55895 |
| 28 | Ga0055530_10007526 | 3300003791 | Bacteria | 4561 |
| 29 | Ga0065165_1000022 | 3300005262 | Bacteria | 253404 |
| 30 | Ga0065165_1000658 | 3300005262 | Bacteria | 49852 |
| 31 | Ga0065714_10008309 | 3300005288 | Bacteria | 3390 |
| 32 | Ga0065714_10017333 | 3300005288 | Bacteria | 1547 |
| 33 | Ga0065714_10064676 | 3300005288 | Bacteria | 24213 |
| 34 | Ga0065714_10071468 | 3300005288 | Bacteria | 3570 |
| 35 | Ga0065714_10080303 | 3300005288 | Bacteria | 2448 |
| 36 | Ga0065714_10120467 | 3300005288 | Bacteria | 1354 |
| 37 | Ga0065704_10070151 | 3300005289 | Bacteria | 259038 |
| 38 | Ga0065704_10070973 | 3300005289 | Bacteria | 14113 |
| 39 | Ga0065704_10071864 | 3300005289 | Bacteria | 9725 |
| 40 | Ga0065704_10076791 | 3300005289 | Bacteria | 4975 |
| 41 | Ga0065704_10132245 | 3300005289 | Bacteria | 1614 |
| 42 | Ga0065707_10094266 | 3300005295 | Bacteria | 3519 |
| 43 | Ga0070658_10006593 | 3300005327 | Bacteria | 9409 |
| 44 | Ga0070658_10053620 | 3300005327 | Bacteria | 3273 |
| 45 | Ga0070676_10021589 | 3300005328 | Bacteria | 3604 |
| 46 | Ga0070676_10087849 | 3300005328 | Bacteria | 1898 |
| 47 | Ga0070676_10131609 | 3300005328 | Bacteria | 1582 |
| 48 | Ga0070676_10195526 | 3300005328 | Bacteria | 1323 |
| 49 | Ga0070683_100002289 | 3300005329 | Bacteria | 15182 |
| 50 | Ga0070683_100002723 | 3300005329 | Bacteria | 14112 |
| 51 | Ga0070683_100011531 | 3300005329 | Bacteria | 7647 |
| 52 | Ga0070683_100067799 | 3300005329 | Bacteria | 3323 |
| 53 | Ga0070683_100143582 | 3300005329 | Bacteria | 2261 |
| 54 | Ga0070690_100077925 | 3300005330 | Bacteria | 2164 |
| 55 | Ga0070690_100081965 | 3300005330 | Bacteria | 2112 |
| 56 | Ga0070690_100262372 | 3300005330 | Bacteria | 1226 |
| 57 | Ga0070670_100015571 | 3300005331 | Bacteria | 6531 |
| 58 | Ga0070670_100080556 | 3300005331 | Bacteria | 2798 |
| 59 | Ga0070670_100085579 | 3300005331 | Bacteria | 2708 |
| 60 | Ga0070670_100123527 | 3300005331 | Bacteria | 2234 |
| 61 | Ga0070670_100174562 | 3300005331 | Bacteria | 1865 |
| 62 | Ga0070670_100434362 | 3300005331 | Bacteria | 1162 |
| 63 | Ga0070677_10013222 | 3300005333 | Bacteria | 2882 |
| 64 | Ga0070677_10017217 | 3300005333 | Bacteria | 2585 |
| 65 | Ga0068869_100005447 | 3300005334 | Bacteria | 8006 |
| 66 | Ga0068869_100023797 | 3300005334 | Bacteria | 4237 |
| 67 | Ga0068869_100028069 | 3300005334 | Bacteria | 3929 |
| 68 | Ga0068869_100104461 | 3300005334 | Bacteria | 2147 |
| 69 | Ga0068869_100117754 | 3300005334 | Bacteria | 2028 |
| 70 | Ga0068869_100118507 | 3300005334 | Bacteria | 2022 |
| 71 | Ga0070666_10000072 | 3300005335 | Bacteria | 75356 |
| 72 | Ga0070666_10028673 | 3300005335 | Bacteria | 3654 |
| 73 | Ga0070666_10071337 | 3300005335 | Bacteria | 2364 |
| 74 | Ga0070666_10253139 | 3300005335 | Bacteria | 1247 |
| 75 | Ga0070680_100000802 | 3300005336 | Bacteria | 22132 |
| 76 | Ga0070680_100024400 | 3300005336 | Bacteria | 4831 |
| 77 | Ga0070682_100000019 | 3300005337 | Bacteria | 220844 |
| 78 | Ga0070682_100000092 | 3300005337 | Bacteria | 81794 |
| 79 | Ga0070682_100011862 | 3300005337 | Bacteria | 4986 |
| 80 | Ga0070682_100018150 | 3300005337 | Bacteria | 4108 |
| 81 | Ga0070682_100318101 | 3300005337 | Bacteria | 1148 |
| 82 | Ga0068868_100060814 | 3300005338 | Bacteria | 2992 |
| 83 | Ga0068868_100106001 | 3300005338 | Bacteria | 2280 |
| 84 | Ga0068868_100139272 | 3300005338 | Bacteria | 1991 |
| 85 | Ga0068868_100171027 | 3300005338 | Bacteria | 1799 |
| 86 | Ga0070660_100010460 | 3300005339 | Bacteria | 6558 |
| 87 | Ga0070660_100016382 | 3300005339 | Bacteria | 5379 |
| 88 | Ga0070660_100067822 | 3300005339 | Bacteria | 2780 |
| 89 | Ga0070689_100030159 | 3300005340 | Bacteria | 4114 |
| 90 | Ga0070689_100069854 | 3300005340 | Bacteria | 2741 |
| 91 | Ga0070689_100094432 | 3300005340 | Bacteria | 2361 |
| 92 | Ga0070689_100097967 | 3300005340 | Bacteria | 2319 |
| 93 | Ga0070687_100123049 | 3300005343 | Bacteria | 1487 |
| 94 | Ga0070661_100014526 | 3300005344 | Bacteria | 5549 |
| 95 | Ga0070661_100023078 | 3300005344 | Bacteria | 4458 |
| 96 | Ga0070661_100104773 | 3300005344 | Bacteria | 2107 |
| 97 | Ga0070661_100243935 | 3300005344 | Bacteria | 1384 |
| 98 | Ga0070668_100020552 | 3300005347 | Bacteria | 4984 |
| 99 | Ga0070668_100030775 | 3300005347 | Bacteria | 4083 |
| 100 | Ga0070668_100059635 | 3300005347 | Bacteria | 2954 |
| 101 | Ga0070668_100136802 | 3300005347 | Bacteria | 1971 |
| 102 | Ga0070669_100001473 | 3300005353 | Bacteria | 17021 |
| 103 | Ga0070669_100002379 | 3300005353 | Bacteria | 13607 |
| 104 | Ga0070669_100082829 | 3300005353 | Bacteria | 2392 |
| 105 | Ga0070675_100009851 | 3300005354 | Bacteria | 7447 |
| 106 | Ga0070675_100034520 | 3300005354 | Bacteria | 4106 |
| 107 | Ga0070675_100107513 | 3300005354 | Bacteria | 2356 |
| 108 | Ga0070675_100115895 | 3300005354 | Bacteria | 2272 |
| 109 | Ga0070675_100247316 | 3300005354 | Bacteria | 1560 |
| 110 | Ga0070675_100375629 | 3300005354 | Bacteria | 1264 |
| 111 | Ga0070671_100020969 | 3300005355 | Bacteria | 5331 |
| 112 | Ga0070671_100040806 | 3300005355 | Bacteria | 3856 |
| 113 | Ga0070671_100065988 | 3300005355 | Bacteria | 3016 |
| 114 | Ga0070671_100090383 | 3300005355 | Bacteria | 2563 |
| 115 | Ga0070673_100031329 | 3300005364 | Bacteria | 3989 |
| 116 | Ga0070673_100044898 | 3300005364 | Bacteria | 3424 |
| 117 | Ga0070673_100050796 | 3300005364 | Bacteria | 3244 |
| 118 | Ga0070673_100072585 | 3300005364 | Bacteria | 2768 |
| 119 | Ga0070673_100089978 | 3300005364 | Bacteria | 2506 |
| 120 | Ga0070688_100002343 | 3300005365 | Bacteria | 9553 |
| 121 | Ga0070688_100057986 | 3300005365 | Bacteria | 2436 |
| 122 | Ga0070659_100010768 | 3300005366 | Bacteria | 6742 |
| 123 | Ga0070659_100018911 | 3300005366 | Bacteria | 5205 |
| 124 | Ga0070667_100077551 | 3300005367 | Bacteria | 2837 |
| 125 | Ga0070667_100119808 | 3300005367 | Bacteria | 2289 |
| 126 | Ga0070667_100124886 | 3300005367 | Bacteria | 2242 |
| 127 | Ga0070700_100033053 | 3300005441 | Bacteria | 3114 |
| 128 | Ga0070663_100370844 | 3300005455 | Bacteria | 1163 |
| 129 | Ga0070678_100041667 | 3300005456 | Bacteria | 3257 |
| 130 | Ga0070678_100045184 | 3300005456 | Bacteria | 3149 |
| 131 | Ga0070662_100018727 | 3300005457 | Bacteria | 4689 |
| 132 | Ga0070662_100066850 | 3300005457 | Bacteria | 2638 |
| 133 | Ga0070662_100194735 | 3300005457 | Bacteria | 1605 |
| 134 | Ga0070681_10032352 | 3300005458 | Bacteria | 5248 |
| 135 | Ga0070681_10105005 | 3300005458 | Bacteria | 2767 |
| 136 | Ga0070681_10339475 | 3300005458 | Bacteria | 1412 |
| 137 | Ga0068867_100003996 | 3300005459 | Bacteria | 10372 |
| 138 | Ga0068867_100040969 | 3300005459 | Bacteria | 3384 |
| 139 | Ga0068867_100042323 | 3300005459 | Bacteria | 3332 |
| 140 | Ga0070685_10071541 | 3300005466 | Bacteria | 2056 |
| 141 | Ga0070685_10104902 | 3300005466 | Bacteria | 1732 |
| 142 | Ga0070698_100007114 | 3300005471 | Bacteria | 12118 |
| 143 | Ga0070698_100013253 | 3300005471 | Bacteria | 8723 |
| 144 | Ga0070679_100000158 | 3300005530 | Bacteria | 54895 |
| 145 | Ga0070679_100006985 | 3300005530 | Bacteria | 10536 |
| 146 | Ga0070679_100104012 | 3300005530 | Bacteria | 2826 |
| 147 | Ga0070684_100002319 | 3300005535 | Bacteria | 14029 |
| 148 | Ga0070684_100018695 | 3300005535 | Bacteria | 5716 |
| 149 | Ga0070684_100023156 | 3300005535 | Bacteria | 5189 |
| 150 | Ga0070684_100024714 | 3300005535 | Bacteria | 5042 |
| 151 | Ga0070684_100043825 | 3300005535 | Bacteria | 3865 |
| 152 | Ga0068853_100007045 | 3300005539 | Bacteria | 8988 |
| 153 | Ga0068853_100020379 | 3300005539 | Bacteria | 5513 |
| 154 | Ga0068853_100031963 | 3300005539 | Bacteria | 4455 |
| 155 | Ga0068853_100055184 | 3300005539 | Bacteria | 3424 |
| 156 | Ga0068853_100071844 | 3300005539 | Bacteria | 3015 |
| 157 | Ga0068853_100093472 | 3300005539 | Bacteria | 2647 |
| 158 | Ga0070672_100004510 | 3300005543 | Bacteria | 9115 |
| 159 | Ga0070672_100096625 | 3300005543 | Bacteria | 2390 |
| 160 | Ga0070686_100038536 | 3300005544 | Bacteria | 2972 |
| 161 | Ga0070693_100022765 | 3300005547 | Bacteria | 3337 |
| 162 | Ga0070665_100017638 | 3300005548 | Bacteria | 7169 |
| 163 | Ga0070665_100115341 | 3300005548 | Bacteria | 2689 |
| 164 | Ga0068855_100001027 | 3300005563 | Bacteria | 34809 |
| 165 | Ga0068855_100010998 | 3300005563 | Bacteria | 10920 |
| 166 | Ga0068855_100066421 | 3300005563 | Bacteria | 4205 |
| 167 | Ga0068855_100155975 | 3300005563 | Bacteria | 2594 |
| 168 | Ga0068855_100239327 | 3300005563 | Bacteria | 2029 |
| 169 | Ga0068855_100248675 | 3300005563 | Bacteria | 1984 |
| 170 | Ga0070664_100009600 | 3300005564 | Bacteria | 7848 |
| 171 | Ga0070664_100014826 | 3300005564 | Bacteria | 6363 |
| 172 | Ga0070664_100019613 | 3300005564 | Bacteria | 5564 |
| 173 | Ga0070664_100120393 | 3300005564 | Bacteria | 2298 |
| 174 | Ga0070664_100126604 | 3300005564 | Bacteria | 2241 |
| 175 | Ga0070664_100174179 | 3300005564 | Bacteria | 1910 |
| 176 | Ga0070664_100468832 | 3300005564 | Bacteria | 1158 |
| 177 | Ga0068857_100004302 | 3300005577 | Bacteria | 12015 |
| 178 | Ga0068857_100088934 | 3300005577 | Bacteria | 2763 |
| 179 | Ga0068857_100096888 | 3300005577 | Bacteria | 2644 |
| 180 | Ga0068857_100100130 | 3300005577 | Bacteria | 2600 |
| 181 | Ga0068857_100183656 | 3300005577 | Bacteria | 1903 |
| 182 | Ga0068857_100333384 | 3300005577 | Bacteria | 1402 |
| 183 | Ga0068857_100353539 | 3300005577 | Bacteria | 1361 |
| 184 | Ga0068854_100016936 | 3300005578 | Bacteria | 4869 |
| 185 | Ga0068854_100064535 | 3300005578 | Bacteria | 2661 |
| 186 | Ga0068854_100081578 | 3300005578 | Bacteria | 2389 |
| 187 | Ga0068854_100264763 | 3300005578 | Bacteria | 1378 |
| 188 | Ga0068856_100032446 | 3300005614 | Bacteria | 5113 |
| 189 | Ga0070702_100245648 | 3300005615 | Bacteria | 1210 |
| 190 | Ga0068852_100000989 | 3300005616 | Bacteria | 18732 |
| 191 | Ga0068852_100005736 | 3300005616 | Bacteria | 8906 |
| 192 | Ga0068852_100013321 | 3300005616 | Bacteria | 6292 |
| 193 | Ga0068852_100028296 | 3300005616 | Bacteria | 4585 |
| 194 | Ga0068852_100211770 | 3300005616 | Bacteria | 1839 |
| 195 | Ga0068859_100000006 | 3300005617 | Bacteria | 421509 |
| 196 | Ga0068859_100007990 | 3300005617 | Bacteria | 10726 |
| 197 | Ga0068859_100011125 | 3300005617 | Bacteria | 9049 |
| 198 | Ga0068859_100031496 | 3300005617 | Bacteria | 5326 |
| 199 | Ga0068859_100175683 | 3300005617 | Bacteria | 2223 |
| 200 | Ga0068859_100316494 | 3300005617 | Bacteria | 1654 |
| 201 | Ga0068859_100363917 | 3300005617 | Bacteria | 1541 |
| 202 | Ga0068864_100012944 | 3300005618 | Bacteria | 6903 |
| 203 | Ga0068864_100017013 | 3300005618 | Bacteria | 6060 |
| 204 | Ga0068864_100035108 | 3300005618 | Bacteria | 4267 |
| 205 | Ga0068864_100059981 | 3300005618 | Bacteria | 3293 |
| 206 | Ga0068866_10042032 | 3300005718 | Bacteria | 2272 |
| 207 | Ga0068861_100039435 | 3300005719 | Bacteria | 3525 |
| 208 | Ga0068861_100102518 | 3300005719 | Bacteria | 2278 |
| 209 | Ga0068861_100313605 | 3300005719 | Bacteria | 1363 |
| 210 | Ga0068861_100388585 | 3300005719 | Bacteria | 1235 |
| 211 | Ga0068851_10111325 | 3300005834 | Bacteria | 1462 |
| 212 | Ga0068870_10012058 | 3300005840 | Bacteria | 4027 |
| 213 | Ga0068870_10015090 | 3300005840 | Bacteria | 3659 |
| 214 | Ga0068863_100055268 | 3300005841 | Bacteria | 3759 |
| 215 | Ga0068863_100059836 | 3300005841 | Bacteria | 3604 |
| 216 | Ga0068863_100144604 | 3300005841 | Bacteria | 2274 |
| 217 | Ga0068863_100150025 | 3300005841 | Bacteria | 2230 |
| 218 | Ga0068863_100490368 | 3300005841 | Bacteria | 1209 |
| 219 | Ga0068858_100070848 | 3300005842 | Bacteria | 3232 |
| 220 | Ga0068858_100332303 | 3300005842 | Bacteria | 1454 |
| 221 | Ga0068860_100000061 | 3300005843 | Bacteria | 192548 |
| 222 | Ga0068860_100001096 | 3300005843 | Bacteria | 29818 |
| 223 | Ga0068860_100005681 | 3300005843 | Bacteria | 12594 |
| 224 | Ga0068860_100028006 | 3300005843 | Bacteria | 5425 |
| 225 | Ga0068860_100136937 | 3300005843 | Bacteria | 2352 |
| 226 | Ga0068860_100144733 | 3300005843 | Bacteria | 2286 |
| 227 | Ga0068860_100498108 | 3300005843 | Bacteria | 1216 |
| 228 | Ga0081539_10000338 | 3300005985 | Bacteria | 103849 |
| 229 | Ga0070715_10061328 | 3300006163 | Bacteria | 1651 |
| 230 | Ga0075366_10011421 | 3300006195 | Bacteria | 5015 |
| 231 | Ga0075366_10018211 | 3300006195 | Bacteria | 4054 |
| 232 | Ga0075366_10051273 | 3300006195 | Bacteria | 2452 |
| 233 | Ga0097621_100000448 | 3300006237 | Bacteria | 28883 |
| 234 | Ga0097621_100014754 | 3300006237 | Bacteria | 5857 |
| 235 | Ga0097621_100072683 | 3300006237 | Bacteria | 2845 |
| 236 | Ga0097621_100088492 | 3300006237 | Bacteria | 2588 |
| 237 | Ga0068871_100001237 | 3300006358 | Bacteria | 17045 |
| 238 | Ga0068871_100018019 | 3300006358 | Bacteria | 5358 |
| 239 | Ga0068871_100228938 | 3300006358 | Bacteria | 1613 |
| 240 | Ga0068871_100259362 | 3300006358 | Bacteria | 1516 |
| 241 | Ga0075428_100010088 | 3300006844 | Bacteria | 10494 |
| 242 | Ga0075428_100011391 | 3300006844 | Bacteria | 9893 |
| 243 | Ga0075428_100071436 | 3300006844 | Bacteria | 3793 |
| 244 | Ga0075430_100002480 | 3300006846 | Bacteria | 15380 |
| 245 | Ga0075430_100030429 | 3300006846 | Bacteria | 4586 |
| 246 | Ga0075429_100040575 | 3300006880 | Unclassified | 4053 |
| 247 | Ga0068865_100016555 | 3300006881 | Bacteria | 4720 |
| 248 | Ga0068865_100097245 | 3300006881 | Bacteria | 2148 |
| 249 | Ga0097620_100000006 | 3300006931 | Bacteria | 421509 |
| 250 | Ga0097620_100001537 | 3300006931 | Bacteria | 23548 |
| 251 | Ga0097620_100007990 | 3300006931 | Bacteria | 10726 |
| 252 | Ga0097620_100011125 | 3300006931 | Bacteria | 9049 |
| 253 | Ga0097620_100031496 | 3300006931 | Bacteria | 5326 |
| 254 | Ga0097620_100175687 | 3300006931 | Bacteria | 2223 |
| 255 | Ga0097620_100316508 | 3300006931 | Bacteria | 1654 |
| 256 | Ga0097620_100363926 | 3300006931 | Bacteria | 1541 |
| 257 | Ga0099824_1000500 | 3300006942 | Bacteria | 46562 |
| 258 | Ga0079104_1000079 | 3300006946 | Bacteria | 141480 |
| 259 | Ga0099826_10000143 | 3300006948 | Bacteria | 30506 |
| 260 | Ga0105251_10035505 | 3300009011 | Bacteria | 2459 |
| 261 | Ga0105244_10000001 | 3300009036 | Bacteria | 1034899 |
| 262 | Ga0105244_10000054 | 3300009036 | Bacteria | 133715 |
| 263 | Ga0105250_10006702 | 3300009092 | Bacteria | 5005 |
| 264 | Ga0105240_10001787 | 3300009093 | Bacteria | 36277 |
| 265 | Ga0105240_10001808 | 3300009093 | Bacteria | 36002 |
| 266 | Ga0105240_10003852 | 3300009093 | Bacteria | 23176 |
| 267 | Ga0105240_10004358 | 3300009093 | Bacteria | 21601 |
| 268 | Ga0105240_10006347 | 3300009093 | Bacteria | 17410 |
| 269 | Ga0105240_10013595 | 3300009093 | Bacteria | 11168 |
| 270 | Ga0105240_10034582 | 3300009093 | Bacteria | 6517 |
| 271 | Ga0105240_10061820 | 3300009093 | Bacteria | 4665 |
| 272 | Ga0111539_10001303 | 3300009094 | Bacteria | 33322 |
| 273 | Ga0111539_10094577 | 3300009094 | Bacteria | 3511 |
| 274 | Ga0111539_10321138 | 3300009094 | Bacteria | 1802 |
| 275 | Ga0111539_10588248 | 3300009094 | Bacteria | 1296 |
| 276 | Ga0105247_10018425 | 3300009101 | Bacteria | 4187 |
| 277 | Ga0105247_10213756 | 3300009101 | Bacteria | 1302 |
| 278 | Ga0114129_10020886 | 3300009147 | Bacteria | 9302 |
| 279 | Ga0114129_10465245 | 3300009147 | Bacteria | 1657 |
| 280 | Ga0105243_10001053 | 3300009148 | Bacteria | 25253 |
| 281 | Ga0105243_10450247 | 3300009148 | Bacteria | 1208 |
| 282 | Ga0105241_10000886 | 3300009174 | Bacteria | 22612 |
| 283 | Ga0105241_10007561 | 3300009174 | Bacteria | 7990 |
| 284 | Ga0105241_10008379 | 3300009174 | Bacteria | 7613 |
| 285 | Ga0105241_10230277 | 3300009174 | Bacteria | 1562 |
| 286 | Ga0105242_10007715 | 3300009176 | Bacteria | 8279 |
| 287 | Ga0105242_10022259 | 3300009176 | Bacteria | 4983 |
| 288 | Ga0105242_10031614 | 3300009176 | Bacteria | 4230 |
| 289 | Ga0105242_10083440 | 3300009176 | Bacteria | 2676 |
| 290 | Ga0105248_10044227 | 3300009177 | Bacteria | 4994 |
| 291 | Ga0105237_10007301 | 3300009545 | Bacteria | 12120 |
| 292 | Ga0105237_10013605 | 3300009545 | Bacteria | 8525 |
| 293 | Ga0105237_10127578 | 3300009545 | Bacteria | 2538 |
| 294 | Ga0105237_10210708 | 3300009545 | Bacteria | 1943 |
| 295 | Ga0105237_10211779 | 3300009545 | Bacteria | 1938 |
| 296 | Ga0105238_10000592 | 3300009551 | Bacteria | 38095 |
| 297 | Ga0105238_10381080 | 3300009551 | Bacteria | 1402 |
| 298 | Ga0105249_10000623 | 3300009553 | Bacteria | 32238 |
| 299 | Ga0105249_10019091 | 3300009553 | Bacteria | 6116 |
| 300 | Ga0105249_10052792 | 3300009553 | Bacteria | 3714 |
| 301 | Ga0105249_10068255 | 3300009553 | Bacteria | 3278 |
| 302 | Ga0105249_10081133 | 3300009553 | Bacteria | 3015 |
| 303 | Ga0105249_10155163 | 3300009553 | Bacteria | 2207 |
| 304 | Ga0105249_10209496 | 3300009553 | Bacteria | 1912 |
| 305 | Ga0105239_10000019 | 3300010375 | Bacteria | 273836 |
| 306 | Ga0105239_10001405 | 3300010375 | Bacteria | 32195 |
| 307 | Ga0105239_10039800 | 3300010375 | Bacteria | 5150 |
| 308 | Ga0105239_10045372 | 3300010375 | Bacteria | 4817 |
| 309 | Ga0105246_10063689 | 3300011119 | Bacteria | 2572 |
| 310 | Ga0105246_10075370 | 3300011119 | Bacteria | 2388 |
| 311 | Ga0157373_10000035 | 3300013100 | Bacteria | 123284 |
| 312 | Ga0157373_10000056 | 3300013100 | Bacteria | 100327 |
| 313 | Ga0157373_10010363 | 3300013100 | Bacteria | 6861 |
| 314 | Ga0157373_10010705 | 3300013100 | Bacteria | 6747 |
| 315 | Ga0157373_10023444 | 3300013100 | Bacteria | 4474 |
| 316 | Ga0157373_10051295 | 3300013100 | Bacteria | 2939 |
| 317 | Ga0157373_10054280 | 3300013100 | Bacteria | 2848 |
| 318 | Ga0157371_10000081 | 3300013102 | Bacteria | 151138 |
| 319 | Ga0157371_10000218 | 3300013102 | Bacteria | 83919 |
| 320 | Ga0157371_10001629 | 3300013102 | Bacteria | 22978 |
| 321 | Ga0157371_10003874 | 3300013102 | Bacteria | 13340 |
| 322 | Ga0157371_10007353 | 3300013102 | Bacteria | 8927 |
| 323 | Ga0157371_10014811 | 3300013102 | Bacteria | 5870 |
| 324 | Ga0157371_10050257 | 3300013102 | Bacteria | 2962 |
| 325 | Ga0157370_10001029 | 3300013104 | Bacteria | 35080 |
| 326 | Ga0157370_10001171 | 3300013104 | Bacteria | 32694 |
| 327 | Ga0157370_10001492 | 3300013104 | Bacteria | 28987 |
| 328 | Ga0157370_10004094 | 3300013104 | Bacteria | 16904 |
| 329 | Ga0157370_10005329 | 3300013104 | Bacteria | 14440 |
| 330 | Ga0157370_10007679 | 3300013104 | Bacteria | 11705 |
| 331 | Ga0157370_10008275 | 3300013104 | Bacteria | 11231 |
| 332 | Ga0157370_10015550 | 3300013104 | Bacteria | 7737 |
| 333 | Ga0157370_10017727 | 3300013104 | Bacteria | 7179 |
| 334 | Ga0157370_10022533 | 3300013104 | Bacteria | 6267 |
| 335 | Ga0157370_10066766 | 3300013104 | Bacteria | 3401 |
| 336 | Ga0157370_10103574 | 3300013104 | Bacteria | 2664 |
| 337 | Ga0157369_10000474 | 3300013105 | Bacteria | 53237 |
| 338 | Ga0157369_10002049 | 3300013105 | Bacteria | 24325 |
| 339 | Ga0157369_10048167 | 3300013105 | Bacteria | 4624 |
| 340 | Ga0157369_10092452 | 3300013105 | Bacteria | 3228 |
| 341 | Ga0157369_10132396 | 3300013105 | Bacteria | 2642 |
| 342 | Ga0157369_10202875 | 3300013105 | Bacteria | 2081 |
| 343 | Ga0157369_10211675 | 3300013105 | Bacteria | 2031 |
| 344 | Ga0157369_10301870 | 3300013105 | Bacteria | 1665 |
| 345 | Ga0157369_10382259 | 3300013105 | Bacteria | 1461 |
| 346 | Ga0157369_10532889 | 3300013105 | Bacteria | 1214 |
| 347 | Ga0157369_10537215 | 3300013105 | Bacteria | 1209 |
| 348 | Ga0157374_10003783 | 3300013296 | Bacteria | 12734 |
| 349 | Ga0157374_10008939 | 3300013296 | Bacteria | 8584 |
| 350 | Ga0157374_10021996 | 3300013296 | Bacteria | 5683 |
| 351 | Ga0157374_10039978 | 3300013296 | Bacteria | 4318 |
| 352 | Ga0157374_10045758 | 3300013296 | Bacteria | 4050 |
| 353 | Ga0157374_10339748 | 3300013296 | Bacteria | 1490 |
| 354 | Ga0157374_10345671 | 3300013296 | Bacteria | 1477 |
| 355 | Ga0157378_10003090 | 3300013297 | Bacteria | 14801 |
| 356 | Ga0157378_10016578 | 3300013297 | Bacteria | 6454 |
| 357 | Ga0157378_10017446 | 3300013297 | Bacteria | 6301 |
| 358 | Ga0157378_10019626 | 3300013297 | Bacteria | 5941 |
| 359 | Ga0157378_10024744 | 3300013297 | Bacteria | 5286 |
| 360 | Ga0157378_10033297 | 3300013297 | Bacteria | 4555 |
| 361 | Ga0157378_10069352 | 3300013297 | Bacteria | 3163 |
| 362 | Ga0157378_10099924 | 3300013297 | Bacteria | 2647 |
| 363 | Ga0163162_10000131 | 3300013306 | Bacteria | 67924 |
| 364 | Ga0163162_10002714 | 3300013306 | Bacteria | 16800 |
| 365 | Ga0163162_10023335 | 3300013306 | Bacteria | 6105 |
| 366 | Ga0163162_10031303 | 3300013306 | Bacteria | 5277 |
| 367 | Ga0163162_10044775 | 3300013306 | Bacteria | 4433 |
| 368 | Ga0163162_10081880 | 3300013306 | Bacteria | 3299 |
| 369 | Ga0163162_10084128 | 3300013306 | Bacteria | 3256 |
| 370 | Ga0163162_10179002 | 3300013306 | Bacteria | 2246 |
| 371 | Ga0163162_10183242 | 3300013306 | Bacteria | 2220 |
| 372 | Ga0157372_10003581 | 3300013307 | Bacteria | 16712 |
| 373 | Ga0157372_10013617 | 3300013307 | Bacteria | 8694 |
| 374 | Ga0157372_10019373 | 3300013307 | Bacteria | 7333 |
| 375 | Ga0157372_10038889 | 3300013307 | Bacteria | 5250 |
| 376 | Ga0157372_10061028 | 3300013307 | Bacteria | 4220 |
| 377 | Ga0157372_10103820 | 3300013307 | Bacteria | 3248 |
| 378 | Ga0157372_10114245 | 3300013307 | Bacteria | 3095 |
| 379 | Ga0157372_10129714 | 3300013307 | Bacteria | 2900 |
| 380 | Ga0157372_10193417 | 3300013307 | Bacteria | 2356 |
| 381 | Ga0157372_10391584 | 3300013307 | Bacteria | 1619 |
| 382 | Ga0157372_10577083 | 3300013307 | Bacteria | 1311 |
| 383 | Ga0157375_10000280 | 3300013308 | Bacteria | 46461 |
| 384 | Ga0157375_10004666 | 3300013308 | Bacteria | 11918 |
| 385 | Ga0157375_10016191 | 3300013308 | Bacteria | 6688 |
| 386 | Ga0157375_10116256 | 3300013308 | Bacteria | 2779 |
| 387 | Ga0157375_10180596 | 3300013308 | Bacteria | 2261 |
| 388 | Ga0163163_10000591 | 3300014325 | Bacteria | 31919 |
| 389 | Ga0163163_10007372 | 3300014325 | Bacteria | 9704 |
| 390 | Ga0163163_10066601 | 3300014325 | Bacteria | 3578 |
| 391 | Ga0163163_10163969 | 3300014325 | Bacteria | 2268 |
| 392 | Ga0157380_10000026 | 3300014326 | Bacteria | 106290 |
| 393 | Ga0157380_10004078 | 3300014326 | Bacteria | 10083 |
| 394 | Ga0157380_10004118 | 3300014326 | Bacteria | 10042 |
| 395 | Ga0157380_10020610 | 3300014326 | Bacteria | 4930 |
| 396 | Ga0157380_10044775 | 3300014326 | Bacteria | 3469 |
| 397 | Ga0157380_10146262 | 3300014326 | Bacteria | 2037 |
| 398 | Ga0182008_10000007 | 3300014497 | Bacteria | 372461 |
| 399 | Ga0157377_10000583 | 3300014745 | Bacteria | 15210 |
| 400 | Ga0157377_10008618 | 3300014745 | Bacteria | 4978 |
| 401 | Ga0157377_10059269 | 3300014745 | Bacteria | 2181 |
| 402 | Ga0157379_10090934 | 3300014968 | Bacteria | 2738 |
| 403 | Ga0157379_10144775 | 3300014968 | Bacteria | 2143 |
| 404 | Ga0157379_10168514 | 3300014968 | Bacteria | 1977 |
| 405 | Ga0157379_10306013 | 3300014968 | Bacteria | 1449 |
| 406 | Ga0157376_10002332 | 3300014969 | Bacteria | 12822 |
| 407 | Ga0157376_10044790 | 3300014969 | Bacteria | 3639 |
| 408 | Ga0157376_10053620 | 3300014969 | Bacteria | 3358 |
| 409 | Ga0157376_10123046 | 3300014969 | Bacteria | 2302 |
| 410 | Ga0157376_10124326 | 3300014969 | Bacteria | 2291 |
| 411 | Ga0182006_1000003 | 3300015261 | Bacteria | 826681 |
| 412 | Ga0182006_1001274 | 3300015261 | Bacteria | 15541 |
| 413 | Ga0182006_1005678 | 3300015261 | Bacteria | 5909 |
| 414 | Ga0182006_1020701 | 3300015261 | Bacteria | 2753 |
| 415 | Ga0182007_10031544 | 3300015262 | Bacteria | 1803 |
| 416 | Ga0182005_1000189 | 3300015265 | Bacteria | 42264 |
| 417 | Ga0163161_10000091 | 3300017792 | Bacteria | 90927 |
| 418 | Ga0163161_10002598 | 3300017792 | Bacteria | 12872 |
| 419 | Ga0163161_10004744 | 3300017792 | Bacteria | 9453 |
| 420 | Ga0163161_10004838 | 3300017792 | Bacteria | 9380 |
| 421 | Ga0163161_10013026 | 3300017792 | Bacteria | 5778 |
| 422 | Ga0163161_10038918 | 3300017792 | Bacteria | 3412 |
| 423 | Ga0163161_10041186 | 3300017792 | Bacteria | 3319 |
| 424 | Ga0163161_10073007 | 3300017792 | Bacteria | 2513 |
| 425 | Ga0213876_10003238 | 3300021384 | Bacteria | 9342 |
| 426 | Ga0213876_10126200 | 3300021384 | Bacteria | 1359 |
| 427 | Ga0209673_1000519 | 3300025273 | Bacteria | 63063 |
| 428 | Ga0209675_1000323 | 3300025291 | Bacteria | 42747 |
| 429 | Ga0209050_1000129 | 3300025298 | Bacteria | 186356 |
| 430 | Ga0209050_1000276 | 3300025298 | Bacteria | 109997 |
| 431 | Ga0207426_1000019 | 3300025302 | Bacteria | 558579 |
| 432 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 433 | Ga0207426_1002756 | 3300025302 | Bacteria | 10629 |
| 434 | Ga0207426_1003233 | 3300025302 | Bacteria | 9140 |
| 435 | Ga0207426_1008034 | 3300025302 | Unclassified | 4328 |
| 436 | Ga0209051_1027692 | 3300025303 | Bacteria | 2253 |
| 437 | Ga0209257_1000736 | 3300025304 | Bacteria | 49668 |
| 438 | Ga0209257_1001011 | 3300025304 | Bacteria | 38022 |
| 439 | Ga0207656_10000237 | 3300025321 | Bacteria | 19366 |
| 440 | Ga0207655_1000003 | 3300025728 | Bacteria | 1081376 |
| 441 | Ga0207655_1000018 | 3300025728 | Bacteria | 537129 |
| 442 | Ga0207710_10017235 | 3300025900 | Bacteria | 3062 |
| 443 | Ga0207688_10006044 | 3300025901 | Bacteria | 6589 |
| 444 | Ga0207680_10000137 | 3300025903 | Bacteria | 34668 |
| 445 | Ga0207680_10067238 | 3300025903 | Bacteria | 2207 |
| 446 | Ga0207680_10125416 | 3300025903 | Bacteria | 1685 |
| 447 | Ga0207680_10133167 | 3300025903 | Bacteria | 1640 |
| 448 | Ga0207680_10139605 | 3300025903 | Bacteria | 1605 |
| 449 | Ga0207680_10161834 | 3300025903 | Bacteria | 1501 |
| 450 | Ga0207647_10000025 | 3300025904 | Bacteria | 112150 |
| 451 | Ga0207647_10015704 | 3300025904 | Bacteria | 5185 |
| 452 | Ga0207647_10029562 | 3300025904 | Bacteria | 3545 |
| 453 | Ga0207647_10058866 | 3300025904 | Bacteria | 2352 |
| 454 | Ga0207647_10134471 | 3300025904 | Bacteria | 1452 |
| 455 | Ga0207645_10001948 | 3300025907 | Bacteria | 16635 |
| 456 | Ga0207645_10002012 | 3300025907 | Bacteria | 16324 |
| 457 | Ga0207645_10031229 | 3300025907 | Bacteria | 3429 |
| 458 | Ga0207643_10015283 | 3300025908 | Bacteria | 4177 |
| 459 | Ga0207643_10105415 | 3300025908 | Bacteria | 1656 |
| 460 | Ga0207705_10050927 | 3300025909 | Bacteria | 2981 |
| 461 | Ga0207705_10286764 | 3300025909 | Bacteria | 1261 |
| 462 | Ga0207654_10003375 | 3300025911 | Bacteria | 8086 |
| 463 | Ga0207654_10005844 | 3300025911 | Bacteria | 6204 |
| 464 | Ga0207707_10000238 | 3300025912 | Bacteria | 59675 |
| 465 | Ga0207707_10018897 | 3300025912 | Bacteria | 6009 |
| 466 | Ga0207707_10025973 | 3300025912 | Bacteria | 5121 |
| 467 | Ga0207695_10000087 | 3300025913 | Bacteria | 276412 |
| 468 | Ga0207695_10000863 | 3300025913 | Bacteria | 55452 |
| 469 | Ga0207695_10001230 | 3300025913 | Bacteria | 43841 |
| 470 | Ga0207695_10028221 | 3300025913 | Bacteria | 6229 |
| 471 | Ga0207695_10034544 | 3300025913 | Bacteria | 5497 |
| 472 | Ga0207695_10100032 | 3300025913 | Bacteria | 2896 |
| 473 | Ga0207671_10000453 | 3300025914 | Bacteria | 56447 |
| 474 | Ga0207671_10000931 | 3300025914 | Bacteria | 36651 |
| 475 | Ga0207671_10002781 | 3300025914 | Bacteria | 18252 |
| 476 | Ga0207671_10004520 | 3300025914 | Bacteria | 13223 |
| 477 | Ga0207671_10043217 | 3300025914 | Bacteria | 3332 |
| 478 | Ga0207671_10139128 | 3300025914 | Bacteria | 1869 |
| 479 | Ga0207660_10013800 | 3300025917 | Bacteria | 5302 |
| 480 | Ga0207660_10129301 | 3300025917 | Bacteria | 1921 |
| 481 | Ga0207660_10144183 | 3300025917 | Bacteria | 1823 |
| 482 | Ga0207657_10004391 | 3300025919 | Bacteria | 14923 |
| 483 | Ga0207657_10064911 | 3300025919 | Bacteria | 3114 |
| 484 | Ga0207657_10076939 | 3300025919 | Bacteria | 2814 |
| 485 | Ga0207657_10089176 | 3300025919 | Bacteria | 2577 |
| 486 | Ga0207657_10155020 | 3300025919 | Bacteria | 1863 |
| 487 | Ga0207649_10014898 | 3300025920 | Bacteria | 4361 |
| 488 | Ga0207649_10036342 | 3300025920 | Bacteria | 2966 |
| 489 | Ga0207649_10096472 | 3300025920 | Bacteria | 1948 |
| 490 | Ga0207649_10144393 | 3300025920 | Bacteria | 1632 |
| 491 | Ga0207652_10000013 | 3300025921 | Bacteria | 222247 |
| 492 | Ga0207652_10000346 | 3300025921 | Bacteria | 48060 |
| 493 | Ga0207652_10002804 | 3300025921 | Bacteria | 14623 |
| 494 | Ga0207652_10019984 | 3300025921 | Bacteria | 5514 |
| 495 | Ga0207652_10065940 | 3300025921 | Bacteria | 3136 |
| 496 | Ga0207681_10034279 | 3300025923 | Bacteria | 3336 |
| 497 | Ga0207681_10095341 | 3300025923 | Bacteria | 2134 |
| 498 | Ga0207681_10261993 | 3300025923 | Bacteria | 1354 |
| 499 | Ga0207650_10026156 | 3300025925 | Bacteria | 4160 |
| 500 | Ga0207650_10044809 | 3300025925 | Bacteria | 3252 |
| 501 | Ga0207650_10100282 | 3300025925 | Bacteria | 2227 |
| 502 | Ga0207650_10105413 | 3300025925 | Bacteria | 2176 |
| 503 | Ga0207650_10120146 | 3300025925 | Bacteria | 2045 |
| 504 | Ga0207650_10307646 | 3300025925 | Bacteria | 1296 |
| 505 | Ga0207659_10082053 | 3300025926 | Bacteria | 2386 |
| 506 | Ga0207659_10104323 | 3300025926 | Bacteria | 2144 |
| 507 | Ga0207659_10120581 | 3300025926 | Bacteria | 2009 |
| 508 | Ga0207644_10108647 | 3300025931 | Bacteria | 2094 |
| 509 | Ga0207644_10115109 | 3300025931 | Bacteria | 2039 |
| 510 | Ga0207644_10186164 | 3300025931 | Bacteria | 1630 |
| 511 | Ga0207690_10024343 | 3300025932 | Bacteria | 3792 |
| 512 | Ga0207706_10003226 | 3300025933 | Bacteria | 15653 |
| 513 | Ga0207706_10004884 | 3300025933 | Bacteria | 12541 |
| 514 | Ga0207706_10031139 | 3300025933 | Bacteria | 4754 |
| 515 | Ga0207706_10060968 | 3300025933 | Bacteria | 3322 |
| 516 | Ga0207706_10228973 | 3300025933 | Bacteria | 1627 |
| 517 | Ga0207686_10000764 | 3300025934 | Bacteria | 19790 |
| 518 | Ga0207686_10039056 | 3300025934 | Bacteria | 2877 |
| 519 | Ga0207686_10039701 | 3300025934 | Bacteria | 2857 |
| 520 | Ga0207686_10098422 | 3300025934 | Bacteria | 1948 |
| 521 | Ga0207709_10018839 | 3300025935 | Bacteria | 3871 |
| 522 | Ga0207670_10066676 | 3300025936 | Bacteria | 2474 |
| 523 | Ga0207670_10379291 | 3300025936 | Bacteria | 1126 |
| 524 | Ga0207669_10102152 | 3300025937 | Bacteria | 1898 |
| 525 | Ga0207704_10050591 | 3300025938 | Bacteria | 2507 |
| 526 | Ga0207704_10170504 | 3300025938 | Bacteria | 1560 |
| 527 | Ga0207691_10005909 | 3300025940 | Bacteria | 11820 |
| 528 | Ga0207691_10011514 | 3300025940 | Bacteria | 8488 |
| 529 | Ga0207691_10030031 | 3300025940 | Bacteria | 5082 |
| 530 | Ga0207691_10053331 | 3300025940 | Bacteria | 3692 |
| 531 | Ga0207691_10234383 | 3300025940 | Bacteria | 1588 |
| 532 | Ga0207691_10316332 | 3300025940 | Bacteria | 1339 |
| 533 | Ga0207689_10005782 | 3300025942 | Bacteria | 10981 |
| 534 | Ga0207689_10011456 | 3300025942 | Bacteria | 7601 |
| 535 | Ga0207689_10024448 | 3300025942 | Bacteria | 5070 |
| 536 | Ga0207689_10044372 | 3300025942 | Bacteria | 3676 |
| 537 | Ga0207689_10045457 | 3300025942 | Bacteria | 3630 |
| 538 | Ga0207689_10049261 | 3300025942 | Bacteria | 3475 |
| 539 | Ga0207689_10067587 | 3300025942 | Bacteria | 2937 |
| 540 | Ga0207689_10073106 | 3300025942 | Unclassified | 2817 |
| 541 | Ga0207689_10106592 | 3300025942 | Bacteria | 2303 |
| 542 | Ga0207689_10112809 | 3300025942 | Bacteria | 2234 |
| 543 | Ga0207689_10153764 | 3300025942 | Bacteria | 1896 |
| 544 | Ga0207689_10286726 | 3300025942 | Bacteria | 1364 |
| 545 | Ga0207661_10010032 | 3300025944 | Bacteria | 6805 |
| 546 | Ga0207661_10013439 | 3300025944 | Bacteria | 5980 |
| 547 | Ga0207661_10014911 | 3300025944 | Bacteria | 5704 |
| 548 | Ga0207661_10045858 | 3300025944 | Bacteria | 3463 |
| 549 | Ga0207661_10136717 | 3300025944 | Bacteria | 2105 |
| 550 | Ga0207679_10005881 | 3300025945 | Bacteria | 7711 |
| 551 | Ga0207679_10067158 | 3300025945 | Bacteria | 2689 |
| 552 | Ga0207679_10080716 | 3300025945 | Bacteria | 2484 |
| 553 | Ga0207679_10125104 | 3300025945 | Bacteria | 2053 |
| 554 | Ga0207679_10341674 | 3300025945 | Bacteria | 1302 |
| 555 | Ga0207667_10000098 | 3300025949 | Bacteria | 140051 |
| 556 | Ga0207667_10000279 | 3300025949 | Bacteria | 70460 |
| 557 | Ga0207667_10004703 | 3300025949 | Bacteria | 16703 |
| 558 | Ga0207667_10017739 | 3300025949 | Bacteria | 8005 |
| 559 | Ga0207667_10094333 | 3300025949 | Bacteria | 3089 |
| 560 | Ga0207667_10139609 | 3300025949 | Bacteria | 2495 |
| 561 | Ga0207667_10402029 | 3300025949 | Bacteria | 1394 |
| 562 | Ga0207651_10036784 | 3300025960 | Bacteria | 3200 |
| 563 | Ga0207651_10226625 | 3300025960 | Bacteria | 1514 |
| 564 | Ga0207712_10001013 | 3300025961 | Bacteria | 20020 |
| 565 | Ga0207712_10006008 | 3300025961 | Bacteria | 7660 |
| 566 | Ga0207712_10011002 | 3300025961 | Bacteria | 5760 |
| 567 | Ga0207712_10050698 | 3300025961 | Bacteria | 2899 |
| 568 | Ga0207712_10058121 | 3300025961 | Bacteria | 2732 |
| 569 | Ga0207668_10038802 | 3300025972 | Bacteria | 3200 |
| 570 | Ga0207668_10062514 | 3300025972 | Bacteria | 2622 |
| 571 | Ga0207668_10111780 | 3300025972 | Bacteria | 2051 |
| 572 | Ga0207668_10129220 | 3300025972 | Bacteria | 1926 |
| 573 | Ga0207640_10064742 | 3300025981 | Bacteria | 2436 |
| 574 | Ga0207640_10067157 | 3300025981 | Bacteria | 2398 |
| 575 | Ga0207640_10089030 | 3300025981 | Bacteria | 2133 |
| 576 | Ga0207658_10078470 | 3300025986 | Bacteria | 2523 |
| 577 | Ga0207658_10119552 | 3300025986 | Bacteria | 2098 |
| 578 | Ga0207658_10364932 | 3300025986 | Bacteria | 1261 |
| 579 | Ga0207677_10022316 | 3300026023 | Bacteria | 3888 |
| 580 | Ga0207677_10040671 | 3300026023 | Bacteria | 3067 |
| 581 | Ga0207703_10035603 | 3300026035 | Bacteria | 3956 |
| 582 | Ga0207639_10009075 | 3300026041 | Bacteria | 6850 |
| 583 | Ga0207639_10015542 | 3300026041 | Bacteria | 5373 |
| 584 | Ga0207639_10034582 | 3300026041 | Bacteria | 3736 |
| 585 | Ga0207639_10062045 | 3300026041 | Bacteria | 2889 |
| 586 | Ga0207639_10067739 | 3300026041 | Bacteria | 2779 |
| 587 | Ga0207678_10006330 | 3300026067 | Bacteria | 10512 |
| 588 | Ga0207678_10026007 | 3300026067 | Bacteria | 5106 |
| 589 | Ga0207678_10074008 | 3300026067 | Bacteria | 2919 |
| 590 | Ga0207708_10152859 | 3300026075 | Bacteria | 1818 |
| 591 | Ga0207702_10409025 | 3300026078 | Bacteria | 1310 |
| 592 | Ga0207702_10475984 | 3300026078 | Bacteria | 1215 |
| 593 | Ga0207641_10000058 | 3300026088 | Bacteria | 166385 |
| 594 | Ga0207641_10024998 | 3300026088 | Bacteria | 4925 |
| 595 | Ga0207641_10085922 | 3300026088 | Bacteria | 2742 |
| 596 | Ga0207641_10186361 | 3300026088 | Bacteria | 1904 |
| 597 | Ga0207641_10354235 | 3300026088 | Bacteria | 1400 |
| 598 | Ga0207641_10389677 | 3300026088 | Bacteria | 1336 |
| 599 | Ga0207648_10003197 | 3300026089 | Bacteria | 17252 |
| 600 | Ga0207648_10003482 | 3300026089 | Bacteria | 16493 |
| 601 | Ga0207648_10026917 | 3300026089 | Bacteria | 5107 |
| 602 | Ga0207648_10036267 | 3300026089 | Bacteria | 4343 |
| 603 | Ga0207648_10188745 | 3300026089 | Bacteria | 1826 |
| 604 | Ga0207676_10010326 | 3300026095 | Bacteria | 6648 |
| 605 | Ga0207676_10028711 | 3300026095 | Bacteria | 4158 |
| 606 | Ga0207674_10000969 | 3300026116 | Bacteria | 37567 |
| 607 | Ga0207674_10005452 | 3300026116 | Bacteria | 15110 |
| 608 | Ga0207674_10021460 | 3300026116 | Bacteria | 6953 |
| 609 | Ga0207674_10023895 | 3300026116 | Bacteria | 6538 |
| 610 | Ga0207674_10053972 | 3300026116 | Bacteria | 4094 |
| 611 | Ga0207674_10324755 | 3300026116 | Bacteria | 1488 |
| 612 | Ga0207675_100000654 | 3300026118 | Bacteria | 34117 |
| 613 | Ga0207675_100022585 | 3300026118 | Bacteria | 5857 |
| 614 | Ga0207675_100054133 | 3300026118 | Bacteria | 3743 |
| 615 | Ga0207675_100062593 | 3300026118 | Bacteria | 3475 |
| 616 | Ga0207675_100122687 | 3300026118 | Bacteria | 2460 |
| 617 | Ga0207675_100156470 | 3300026118 | Bacteria | 2172 |
| 618 | Ga0207675_100257898 | 3300026118 | Bacteria | 1689 |
| 619 | Ga0207675_100377666 | 3300026118 | Bacteria | 1393 |
| 620 | Ga0207683_10035923 | 3300026121 | Bacteria | 4311 |
| 621 | Ga0207698_10000937 | 3300026142 | Bacteria | 16993 |
| 622 | Ga0207698_10017486 | 3300026142 | Bacteria | 4866 |
| 623 | Ga0207698_10023447 | 3300026142 | Bacteria | 4312 |
| 624 | Ga0207698_10038320 | 3300026142 | Bacteria | 3540 |
| 625 | Ga0207698_10090624 | 3300026142 | Unclassified | 2501 |
| 626 | Ga0207698_10260174 | 3300026142 | Bacteria | 1594 |
| 627 | Ga0207698_10335523 | 3300026142 | Bacteria | 1422 |
| 628 | Ga0209281_1000045 | 3300027111 | Bacteria | 328124 |
| 629 | Ga0209489_108596 | 3300027361 | Bacteria | 13695 |
| 630 | Ga0210002_1001089 | 3300027617 | Bacteria | 3768 |
| 631 | Ga0268266_10000068 | 3300028379 | Bacteria | 241100 |
| 632 | Ga0268266_10090840 | 3300028379 | Bacteria | 2677 |
| 633 | Ga0268264_10000079 | 3300028381 | Bacteria | 249516 |
| 634 | Ga0268264_10002043 | 3300028381 | Bacteria | 18025 |
| 635 | Ga0268264_10003074 | 3300028381 | Bacteria | 14443 |
| 636 | Ga0268264_10006028 | 3300028381 | Bacteria | 10253 |
| 637 | Ga0268264_10010056 | 3300028381 | Bacteria | 7831 |
| 638 | Ga0268264_10013025 | 3300028381 | Bacteria | 6836 |
| 639 | Ga0268264_10081602 | 3300028381 | Bacteria | 2764 |
| 640 | Ga0268264_10109398 | 3300028381 | Bacteria | 2418 |
| 641 | Ga0265334_10013415 | 3300028573 | Bacteria | 3432 |
| 642 | Ga0307517_10001481 | 3300028786 | Bacteria | 39285 |
| 643 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 644 | Ga0307515_10000059 | 3300028794 | Bacteria | 257520 |
| 645 | Ga0265324_10028844 | 3300029957 | Bacteria | 1955 |
| 646 | Ga0307511_10000201 | 3300030521 | Bacteria | 60079 |
| 647 | Ga0265327_10000009 | 3300031251 | Bacteria | 616360 |
| 648 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 649 | Ga0265327_10000031 | 3300031251 | Bacteria | 325718 |
| 650 | Ga0265327_10004168 | 3300031251 | Bacteria | 13044 |
| 651 | Ga0265327_10028535 | 3300031251 | Bacteria | 3190 |
| 652 | Ga0307509_10029227 | 3300031507 | Bacteria | 6120 |
| 653 | Ga0307509_10090993 | 3300031507 | Bacteria | 3124 |
| 654 | Ga0307509_10326538 | 3300031507 | Bacteria | 1268 |
| 655 | Ga0307408_100000375 | 3300031548 | Bacteria | 40830 |
| 656 | Ga0307408_100000600 | 3300031548 | Bacteria | 30960 |
| 657 | Ga0307408_100209884 | 3300031548 | Bacteria | 1582 |
| 658 | Ga0307508_10001083 | 3300031616 | Bacteria | 31499 |
| 659 | Ga0307508_10055089 | 3300031616 | Bacteria | 3524 |
| 660 | Ga0265314_10105638 | 3300031711 | Bacteria | 1800 |
| 661 | Ga0307516_10090526 | 3300031730 | Bacteria | 2888 |
| 662 | Ga0307405_10000001 | 3300031731 | Bacteria | 1731270 |
| 663 | Ga0307413_10000001 | 3300031824 | Bacteria | 159157 |
| 664 | Ga0307413_10251205 | 3300031824 | Bacteria | 1312 |
| 665 | Ga0307410_10000024 | 3300031852 | Bacteria | 59872 |
| 666 | Ga0307410_10114427 | 3300031852 | Bacteria | 1957 |
| 667 | Ga0307410_10177734 | 3300031852 | Bacteria | 1609 |
| 668 | Ga0307406_10000028 | 3300031901 | Bacteria | 91602 |
| 669 | Ga0307406_10003873 | 3300031901 | Bacteria | 8148 |
| 670 | Ga0307406_10060682 | 3300031901 | Bacteria | 2439 |
| 671 | Ga0307407_10000286 | 3300031903 | Bacteria | 14911 |
| 672 | Ga0307412_10000062 | 3300031911 | Bacteria | 126099 |
| 673 | Ga0307412_10000155 | 3300031911 | Bacteria | 48968 |
| 674 | Ga0307412_10116424 | 3300031911 | Bacteria | 1917 |
| 675 | Ga0307412_10192377 | 3300031911 | Bacteria | 1543 |
| 676 | Ga0307416_100000013 | 3300032002 | Bacteria | 283585 |
| 677 | Ga0307416_100000066 | 3300032002 | Bacteria | 94549 |
| 678 | Ga0307416_100048785 | 3300032002 | Bacteria | 3362 |
| 679 | Ga0307414_10000022 | 3300032004 | Bacteria | 212123 |
| 680 | Ga0307414_10000041 | 3300032004 | Bacteria | 144783 |
| 681 | Ga0307414_10000241 | 3300032004 | Bacteria | 34897 |
| 682 | Ga0307414_10006659 | 3300032004 | Bacteria | 6460 |
| 683 | Ga0307414_10019595 | 3300032004 | Bacteria | 4195 |
| 684 | Ga0307414_10025485 | 3300032004 | Bacteria | 3790 |
| 685 | Ga0307414_10031050 | 3300032004 | Bacteria | 3498 |
| 686 | Ga0307414_10034030 | 3300032004 | Bacteria | 3374 |
| 687 | Ga0307414_10047614 | 3300032004 | Bacteria | 2952 |
| 688 | Ga0307414_10093659 | 3300032004 | Bacteria | 2240 |
| 689 | Ga0307414_10144565 | 3300032004 | Bacteria | 1867 |
| 690 | Ga0307414_10162064 | 3300032004 | Bacteria | 1778 |
| 691 | Ga0307411_10000003 | 3300032005 | Bacteria | 477556 |
| 692 | Ga0307411_10151934 | 3300032005 | Bacteria | 1722 |
| 693 | Ga0307510_10009446 | 3300033180 | Bacteria | 11614 |
| 694 | Ga0373934_0015585 | 3300035086 | Bacteria | 2886 |
| 695 | Ga0373943_0071141 | 3300035170 | Bacteria | 1762 |
| 696 | Ga0373955_0040882 | 3300035172 | Bacteria | 2483 |
| 697 | Ga0373933_0040967 | 3300035724 | Bacteria | 2732 |
| 698 | Ga0395899_0000025 | 3300037312 | Bacteria | 350927 |
| 699 | Ga0395899_0000528 | 3300037312 | Bacteria | 41982 |
| 700 | Ga0395899_0057783 | 3300037312 | Bacteria | 2862 |
| 701 | Ga0395899_0225469 | 3300037312 | Bacteria | 1296 |
| 702 | Ga0395899_0250777 | 3300037312 | Bacteria | 1215 |
| 703 | Ga0395900_0008628 | 3300037418 | Bacteria | 10473 |
| 704 | Ga0395900_0011009 | 3300037418 | Bacteria | 9248 |
| 705 | Ga0395900_0014908 | 3300037418 | Bacteria | 7919 |
| 706 | Ga0395898_0000595 | 3300037466 | Bacteria | 67162 |
| 707 | Ga0395898_0017447 | 3300037466 | Bacteria | 7329 |
| 708 | Ga0395905_0004944 | 3300037471 | Bacteria | 13731 |
| 709 | Ga0395905_0011815 | 3300037471 | Bacteria | 8429 |
| 710 | Ga0395905_0255495 | 3300037471 | Bacteria | 1637 |
| 711 | Ga0395905_0385700 | 3300037471 | Bacteria | 1295 |
| 712 | Ga0395901_0001672 | 3300038443 | Bacteria | 22890 |
| 713 | Ga0395901_0007597 | 3300038443 | Bacteria | 10947 |
| 714 | Ga0395901_0007671 | 3300038443 | Bacteria | 10885 |
| 715 | Ga0395901_0237157 | 3300038443 | Bacteria | 1903 |
| 716 | Ga0436365_0022529 | 3300039437 | Bacteria | 15767 |
| 717 | Ga0436365_1412273 | 3300039437 | Bacteria | 1581 |
| 718 | Ga0439439_0049448 | 3300041406 | Bacteria | 1101 |
| 719 | Ga0439447_000106 | 3300041407 | Bacteria | 28341 |
| 720 | Ga0439466_0000940 | 3300041411 | Bacteria | 11161 |
| 721 | Ga0439466_0042247 | 3300041411 | Bacteria | 1518 |
| 722 | Ga0439465_0000262 | 3300041413 | Bacteria | 14602 |
| 723 | Ga0439431_0003814 | 3300041997 | Bacteria | 3331 |
| 724 | Ga0439445_0000338 | 3300042004 | Bacteria | 9216 |
| 725 | Ga0439445_0062334 | 3300042004 | Bacteria | 1021 |
| 726 | Ga0439449_0066059 | 3300042007 | Bacteria | 1334 |
| 727 | Ga0439449_0068842 | 3300042007 | Bacteria | 1305 |
| 728 | Ga0450923_001224 | 3300042125 | Bacteria | 3316 |
| 729 | Ga0451577_0004359 | 3300042876 | Bacteria | 14984 |
| 730 | Ga0451577_0281484 | 3300042876 | Bacteria | 1507 |
| 731 | Ga0466969_0017149 | 3300044656 | Bacteria | 3785 |
| 732 | Ga0466972_0000057 | 3300044658 | Bacteria | 110775 |
| 733 | Ga0466972_0001286 | 3300044658 | Bacteria | 12123 |
| 734 | Ga0466972_0008805 | 3300044658 | Bacteria | 5063 |
| 735 | Ga0466972_0097797 | 3300044658 | Bacteria | 1390 |
| 736 | Ga0453683_0030268 | 3300044673 | Bacteria | 3422 |
| 737 | Ga0466965_0086049 | 3300044683 | Bacteria | 1594 |
| 738 | Ga0466961_0009575 | 3300044693 | Bacteria | 6169 |
| 739 | Ga0453684_0002754 | 3300044712 | Bacteria | 41627 |
| 740 | Ga0453684_0124591 | 3300044712 | Bacteria | 3104 |
| 741 | Ga0466971_0050848 | 3300044719 | Bacteria | 1865 |
| 742 | Ga0466968_0040610 | 3300044735 | Bacteria | 1962 |
| 743 | Ga0466970_0021478 | 3300044765 | Bacteria | 3361 |
| 744 | Ga0466970_0053550 | 3300044765 | Bacteria | 2155 |
| 745 | Ga0466957_0035214 | 3300044842 | Bacteria | 3004 |
| 746 | Ga0466959_0110634 | 3300045049 | Bacteria | 1961 |
| 747 | Ga0451576_0022638 | 3300045051 | Bacteria | 6810 |
| 748 | Ga0495627_000068 | 3300046453 | Bacteria | 126904 |
| 749 | Ga0495627_000603 | 3300046453 | Bacteria | 28682 |
| 750 | Ga0495627_016911 | 3300046453 | Bacteria | 2489 |
| 751 | Ga0495638_0000232 | 3300046460 | Bacteria | 76388 |
| 752 | Ga0495638_0143017 | 3300046460 | Bacteria | 1394 |
| 753 | Ga0495653_0207807 | 3300046463 | Bacteria | 1324 |
| 754 | Ga0495650_0028739 | 3300046471 | Bacteria | 2545 |
| 755 | Ga0495596_0031846 | 3300046500 | Bacteria | 2104 |
| 756 | Ga0495607_0018038 | 3300046501 | Bacteria | 4510 |
| 757 | Ga0495606_0006163 | 3300046507 | Bacteria | 11163 |
| 758 | Ga0495606_0007463 | 3300046507 | Bacteria | 9776 |
| 759 | Ga0495606_0009602 | 3300046507 | Bacteria | 8155 |
| 760 | Ga0495606_0035609 | 3300046507 | Bacteria | 3401 |
| 761 | Ga0495610_0000006 | 3300046512 | Bacteria | 856822 |
| 762 | Ga0495616_0034144 | 3300046513 | Bacteria | 2644 |
| 763 | Ga0495628_0062222 | 3300046516 | Bacteria | 2926 |
| 764 | Ga0495630_0300517 | 3300046517 | Bacteria | 1226 |
| 765 | Ga0495632_0002092 | 3300046519 | Bacteria | 15620 |
| 766 | Ga0495643_0007483 | 3300046522 | Bacteria | 7031 |
| 767 | Ga0495643_0075879 | 3300046522 | Bacteria | 1759 |
| 768 | Ga0495643_0115736 | 3300046522 | Bacteria | 1359 |
| 769 | Ga0495663_0000044 | 3300046525 | Bacteria | 62856 |
| 770 | Ga0495663_0003868 | 3300046525 | Bacteria | 4268 |
| 771 | Ga0495654_0000017 | 3300046530 | Bacteria | 295999 |
| 772 | Ga0495609_0000017 | 3300046538 | Bacteria | 306684 |
| 773 | Ga0495633_0000037 | 3300046558 | Bacteria | 184006 |
| 774 | Ga0495633_0000152 | 3300046558 | Bacteria | 91044 |
| 775 | Ga0495633_0002058 | 3300046558 | Bacteria | 14500 |
| 776 | Ga0495634_0035114 | 3300046642 | Bacteria | 3436 |
| 777 | Ga0495611_0001026 | 3300046648 | Bacteria | 14788 |
| 778 | Ga0495625_0000501 | 3300046660 | Bacteria | 58243 |
| 779 | Ga0495625_0022817 | 3300046660 | Bacteria | 4790 |
| 780 | Ga0495625_0062229 | 3300046660 | Bacteria | 2638 |
| 781 | Ga0495657_0102592 | 3300046675 | Bacteria | 1821 |
| 782 | Ga0495658_0156079 | 3300046683 | Unclassified | 1405 |
| 783 | Ga0495600_0050484 | 3300046809 | Bacteria | 2715 |
| 784 | Ga0495674_0244498 | 3300047319 | Bacteria | 1478 |
| 785 | Ga0495672_0061739 | 3300047320 | Bacteria | 2159 |
| 786 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 787 | Ga0495686_0002112 | 3300047472 | Bacteria | 19479 |
| 788 | Ga0495686_0006110 | 3300047472 | Bacteria | 9328 |
| 789 | Ga0495686_0029992 | 3300047472 | Bacteria | 3534 |
| 790 | Ga0496108_0144112 | 3300048911 | Bacteria | 2053 |
| 791 | Ga0496109_0342993 | 3300048912 | Bacteria | 1411 |
| 792 | Ga0496110_0019668 | 3300048913 | Bacteria | 5688 |
| 793 | Ga0496110_0093365 | 3300048913 | Bacteria | 2694 |
| 794 | Ga0496110_0229900 | 3300048913 | Bacteria | 1687 |
| 795 | Ga0496113_0147693 | 3300048916 | Bacteria | 1853 |
| 796 | Ga0496114_0000243 | 3300048917 | Bacteria | 39610 |
| 797 | Ga0496115_0117601 | 3300048918 | Bacteria | 2186 |
| 798 | Ga0496116_0000002 | 3300048919 | Bacteria | 920291 |
| 799 | Ga0496116_0000052 | 3300048919 | Bacteria | 295469 |
| 800 | Ga0496117_0000082 | 3300048920 | Bacteria | 220895 |
| 801 | Ga0496118_0000321 | 3300048921 | Bacteria | 82959 |
| 802 | Ga0496119_0000006 | 3300048922 | Bacteria | 505999 |
| 803 | Ga0496122_0000230 | 3300048925 | Bacteria | 125542 |
| 804 | Ga0496122_0001851 | 3300048925 | Bacteria | 32256 |
| 805 | Ga0496122_0001875 | 3300048925 | Bacteria | 31961 |
| 806 | Ga0496122_0002049 | 3300048925 | Bacteria | 29920 |
| 807 | Ga0496123_0000476 | 3300048926 | Bacteria | 69684 |
| 808 | Ga0496124_0003570 | 3300048927 | Bacteria | 18914 |
| 809 | Ga0496124_0086776 | 3300048927 | Bacteria | 2560 |
| 810 | Ga0496125_0000024 | 3300048928 | Bacteria | 442149 |
| 811 | Ga0496125_0000108 | 3300048928 | Bacteria | 196060 |
| 812 | Ga0496125_0001315 | 3300048928 | Bacteria | 36765 |
| 813 | Ga0496125_0003723 | 3300048928 | Bacteria | 18187 |
| 814 | Ga0496125_0104940 | 3300048928 | Bacteria | 2068 |
| 815 | Ga0496126_0002224 | 3300048929 | Bacteria | 26840 |
| 816 | Ga0496126_0002542 | 3300048929 | Bacteria | 24406 |
| 817 | Ga0496126_0161957 | 3300048929 | Bacteria | 1911 |
| 818 | Ga0501314_002013 | 3300049530 | Bacteria | 1537 |
| 819 | Ga0501031_0009537 | 3300049568 | Bacteria | 6318 |
| 820 | Ga0501032_0011337 | 3300049569 | Bacteria | 6402 |
| 821 | Ga0501032_0081454 | 3300049569 | Bacteria | 2154 |
| 822 | Ga0501033_0008636 | 3300049570 | Bacteria | 7884 |
| 823 | Ga0501033_0159822 | 3300049570 | Bacteria | 1622 |
| 824 | Ga0501034_0000004 | 3300049571 | Bacteria | 382255 |
| 825 | Ga0501034_0005186 | 3300049571 | Bacteria | 14296 |
| 826 | Ga0501034_0006447 | 3300049571 | Bacteria | 12635 |
| 827 | Ga0501034_0014518 | 3300049571 | Bacteria | 8110 |
| 828 | Ga0501034_0021095 | 3300049571 | Bacteria | 6648 |
| 829 | Ga0501034_0023070 | 3300049571 | Bacteria | 6341 |
| 830 | Ga0501034_0284455 | 3300049571 | Bacteria | 1593 |
| 831 | Ga0501036_0005238 | 3300049572 | Bacteria | 10492 |
| 832 | Ga0501036_0034412 | 3300049572 | Bacteria | 4285 |
| 833 | Ga0501036_0043744 | 3300049572 | Bacteria | 3793 |
| 834 | Ga0501037_0011972 | 3300049573 | Bacteria | 6391 |
| 835 | Ga0501037_0094518 | 3300049573 | Bacteria | 2161 |
| 836 | Ga0501037_0107272 | 3300049573 | Bacteria | 2012 |
| 837 | Ga0501038_0009087 | 3300049574 | Bacteria | 9123 |
| 838 | Ga0501038_0273111 | 3300049574 | Bacteria | 1332 |
| 839 | Ga0501039_0048454 | 3300049575 | Bacteria | 3284 |
| 840 | Ga0501039_0075619 | 3300049575 | Bacteria | 2618 |
| 841 | Ga0501043_0027568 | 3300049579 | Bacteria | 4459 |
| 842 | Ga0501043_0028125 | 3300049579 | Bacteria | 4413 |
| 843 | Ga0501043_0048474 | 3300049579 | Bacteria | 3339 |
| 844 | Ga0501043_0070852 | 3300049579 | Bacteria | 2739 |
| 845 | Ga0501043_0220619 | 3300049579 | Bacteria | 1467 |
| 846 | Ga0501043_0330112 | 3300049579 | Unclassified | 1162 |
| 847 | Ga0501046_0071552 | 3300049580 | Bacteria | 2694 |
| 848 | Ga0501047_0011756 | 3300049581 | Bacteria | 8277 |
| 849 | Ga0501047_0088188 | 3300049581 | Bacteria | 2979 |
| 850 | Ga0501047_0110018 | 3300049581 | Unclassified | 2638 |
| 851 | Ga0501070_0004592 | 3300049586 | Bacteria | 11836 |
| 852 | Ga0501073_0009930 | 3300049589 | Bacteria | 7001 |
| 853 | Ga0501073_0280474 | 3300049589 | Bacteria | 1150 |
| 854 | Ga0501074_0000494 | 3300049590 | Bacteria | 24088 |
| 855 | Ga0501198_000130 | 3300049649 | Bacteria | 11288 |
| 856 | Ga0501201_000295 | 3300049651 | Bacteria | 4543 |
| 857 | Ga0501202_009961 | 3300049652 | Bacteria | 1756 |
| 858 | Ga0501206_001400 | 3300049653 | Bacteria | 3016 |
| 859 | Ga0501207_000851 | 3300049654 | Bacteria | 3634 |
| 860 | Ga0501208_004664 | 3300049655 | Bacteria | 1632 |
| 861 | Ga0501216_001408 | 3300049660 | Bacteria | 3242 |
| 862 | Ga0501217_000325 | 3300049661 | Bacteria | 7599 |
| 863 | Ga0501222_000182 | 3300049662 | Bacteria | 11323 |
| 864 | Ga0501223_000751 | 3300049663 | Bacteria | 7717 |
| 865 | Ga0501223_009084 | 3300049663 | Bacteria | 2018 |
| 866 | Ga0501233_003367 | 3300049668 | Bacteria | 2873 |
| 867 | Ga0501235_009289 | 3300049669 | Bacteria | 2148 |
| 868 | Ga0501238_002406 | 3300049671 | Bacteria | 2235 |
| 869 | Ga0501242_004215 | 3300049674 | Bacteria | 1591 |
| 870 | Ga0501243_000074 | 3300049675 | Bacteria | 10068 |
| 871 | Ga0501243_006226 | 3300049675 | Bacteria | 1807 |
| 872 | Ga0501249_000002 | 3300049679 | Bacteria | 262756 |
| 873 | Ga0501249_002827 | 3300049679 | Bacteria | 3495 |
| 874 | Ga0501252_000534 | 3300049682 | Bacteria | 2967 |
| 875 | Ga0501257_016825 | 3300049686 | Bacteria | 1698 |
| 876 | Ga0501259_000075 | 3300049688 | Bacteria | 13606 |
| 877 | Ga0501259_005676 | 3300049688 | Bacteria | 1982 |
| 878 | Ga0501261_000902 | 3300049690 | Bacteria | 3674 |
| 879 | Ga0501221_000128 | 3300049704 | Bacteria | 9662 |
| 880 | Ga0501225_0001304 | 3300049705 | Bacteria | 7731 |
| 881 | Ga0501234_003950 | 3300049707 | Bacteria | 2328 |
| 882 | Ga0501245_000976 | 3300049708 | Bacteria | 3666 |
| 883 | Ga0501079_0169872 | 3300049741 | Bacteria | 1700 |
| 884 | Ga0501080_0064882 | 3300049742 | Bacteria | 3396 |
| 885 | Ga0501083_0002163 | 3300049744 | Bacteria | 13478 |
| 886 | Ga0501241_000003 | 3300049758 | Bacteria | 178857 |
| 887 | Ga0501241_000260 | 3300049758 | Bacteria | 11730 |
| 888 | Ga0501266_000003 | 3300049763 | Bacteria | 388836 |
| 889 | Ga0501266_005058 | 3300049763 | Bacteria | 1641 |
| 890 | Ga0501266_010532 | 3300049763 | Bacteria | 1178 |
| 891 | Ga0501268_001347 | 3300049765 | Bacteria | 3048 |
| 892 | Ga0501269_000407 | 3300049766 | Bacteria | 9932 |
| 893 | Ga0501269_001345 | 3300049766 | Bacteria | 3243 |
| 894 | Ga0501279_001305 | 3300049775 | Bacteria | 3276 |
| 895 | Ga0501035_0011149 | 3300049822 | Bacteria | 8324 |
| 896 | Ga0501035_0021889 | 3300049822 | Bacteria | 5872 |
| 897 | Ga0501035_0042406 | 3300049822 | Bacteria | 4104 |
| 898 | Ga0501035_0081067 | 3300049822 | Bacteria | 2864 |
| 899 | Ga0501044_0006596 | 3300049823 | Bacteria | 12806 |
| 900 | Ga0501044_0009390 | 3300049823 | Bacteria | 10656 |
| 901 | Ga0501044_0015667 | 3300049823 | Bacteria | 8165 |
| 902 | Ga0501044_0110416 | 3300049823 | Bacteria | 2759 |
| 903 | Ga0501045_0185999 | 3300049824 | Bacteria | 1548 |
| 904 | Ga0501212_000118 | 3300049851 | Bacteria | 6342 |
| 905 | nmdc:mga0k408_16132_c1 | 3300050493 | Bacteria | 2386 |
| 906 | nmdc:mga09592_164823_c1 | 3300050508 | Bacteria | 1915 |
| 907 | nmdc:mga09592_177938_c1 | 3300050508 | Bacteria | 1840 |
| 908 | nmdc:mga09592_18052_c1 | 3300050508 | Bacteria | 5784 |
| 909 | nmdc:mga09592_215515_c1 | 3300050508 | Bacteria | 1664 |
| 910 | nmdc:mga0qj67_4627_c1 | 3300050509 | Bacteria | 9984 |
| 911 | nmdc:mga0n895_85610_c1 | 3300050512 | Bacteria | 3147 |
| 912 | Ga0500578_0000144 | 3300053086 | Bacteria | 85335 |
| 913 | Ga0500646_0001397 | 3300053090 | Bacteria | 6401 |
| 914 | Ga0500651_0176972 | 3300053093 | Bacteria | 1269 |
| 915 | Ga0500641_0000005 | 3300053096 | Bacteria | 226810 |
| 916 | Ga0500641_0000077 | 3300053096 | Bacteria | 40051 |
| 917 | Ga0500641_0010652 | 3300053096 | Bacteria | 3327 |
| 918 | Ga0500641_0011045 | 3300053096 | Bacteria | 3274 |
| 919 | Ga0500562_000013 | 3300053108 | Bacteria | 150003 |
| 920 | Ga0500592_005291 | 3300053116 | Bacteria | 2053 |
| 921 | Ga0500594_0008302 | 3300053118 | Bacteria | 2364 |
| 922 | Ga0500652_025391 | 3300053131 | Bacteria | 2270 |
| 923 | Ga0500658_0000015 | 3300053134 | Bacteria | 151134 |
| 924 | Ga0500559_0027776 | 3300053136 | Bacteria | 2415 |
| 925 | Ga0500568_0004540 | 3300053139 | Bacteria | 7403 |
| 926 | Ga0500590_118540 | 3300053148 | Bacteria | 1244 |
| 927 | Ga0500616_0024488 | 3300053153 | Bacteria | 3353 |
| 928 | Ga0500616_0032999 | 3300053153 | Bacteria | 2827 |
| 929 | Ga0500622_0000242 | 3300053156 | Bacteria | 56575 |
| 930 | Ga0500636_0023141 | 3300053177 | Bacteria | 3672 |
| 931 | Ga0500636_0118204 | 3300053177 | Bacteria | 1490 |
| 932 | Ga0500637_0055291 | 3300053178 | Bacteria | 2267 |
| 933 | Ga0500584_040685 | 3300053726 | Bacteria | 2132 |
| 934 | Ga0500611_000060 | 3300053727 | Bacteria | 47744 |
| 935 | Ga0501082_0237970 | 3300060353 | Bacteria | 1584 |
| 936 | 2511232900 | 2511231000 | Bacteria | 4488346 |
| 937 | 2513234718 | 2513020052 | Bacteria | 5120511 |
| 938 | 2520880479 | 2519899754 | Bacteria | 5336938 |
| 939 | 2524004949 | 2523533629 | Bacteria | 2982326 |
| 940 | 2585143701 | 2582581278 | Bacteria | 5296881 |
| 941 | 2585157624 | 2582581281 | Bacteria | 4487904 |
| 942 | 2585162022 | 2582581282 | Bacteria | 4495830 |
| 943 | 2585425748 | 2582581873 | Bacteria | 3032664 |
| 944 | 2587679352 | 2585428045 | Bacteria | 5203023 |
| 945 | 2587747215 | 2585428060 | Bacteria | 5304711 |
| 946 | 2587753500 | 2585428061 | Bacteria | 3939663 |
| 947 | 2587867182 | 2585428095 | Bacteria | 3789702 |
| 948 | 2587945151 | 2585428115 | Bacteria | 4420269 |
| 949 | 2588210467 | 2585428182 | Bacteria | 5007281 |
| 950 | 2588214296 | 2585428183 | Bacteria | 5166119 |
| 951 | 2588217060 | 2585428184 | Bacteria | 4978681 |
| 952 | 2588223261 | 2585428185 | Bacteria | 4969476 |
| 953 | 2588232766 | 2585428187 | Bacteria | 4629388 |
| 954 | 2588443851 | 2588253712 | Bacteria | 5403181 |
| 955 | 2590601728 | 2588254255 | Bacteria | 5014294 |
| 956 | 2590613564 | 2588254257 | Bacteria | 5436094 |
| 957 | 2644012120 | 2643221600 | Bacteria | 5530138 |
| 958 | 2644371299 | 2643221667 | Bacteria | 5627472 |
| 959 | 2644641396 | 2643221716 | Bacteria | 4986332 |
| 960 | 2644682486 | 2643221725 | Bacteria | 5087956 |
| 961 | 2729200243 | 2728369107 | Bacteria | 5082720 |
| 962 | 2738699916 | 2738541273 | Bacteria | 4048577 |
| 963 | 2738733901 | 2738541279 | Bacteria | 6149495 |
| 964 | 2738766142 | 2738541285 | Bacteria | 6150075 |
| 965 | 2739215482 | 2738543007 | Bacteria | 6149845 |
| 966 | 2739253665 | 2738543014 | Bacteria | 4048139 |
| 967 | 2740000342 | 2739367857 | Bacteria | 5433684 |
| 968 | 2740005158 | 2739367858 | Bacteria | 5432813 |
| 969 | 2740059231 | 2739367874 | Bacteria | 4872888 |
| 970 | 2753673292 | 2751185877 | Bacteria | 4921427 |
| 971 | 2765574396 | 2765235839 | Bacteria | 5314748 |
| 972 | 2772607470 | 2772190705 | Bacteria | 4666226 |
| 973 | 2775671793 | 2775506739 | Bacteria | 3855222 |
| 974 | 2802651258 | 2802428842 | Bacteria | 4926114 |
| 975 | 2816874620 | 2816332188 | Bacteria | 5133218 |
| 976 | 2817414143 | 2816332280 | Bacteria | 5109718 |
| 977 | 2819575417 | 2818991442 | Bacteria | 8318214 |
| 978 | 2819585659 | 2818991444 | Bacteria | 6968812 |
| 979 | 2821137961 | 2821136567 | Bacteria | 8080116 |
| 980 | 2842085172 | 2842083920 | Bacteria | 4857652 |
| 981 | 2857617782 | 2857613821 | Bacteria | 4917088 |
| 982 | 2857621402 | 2857618242 | Bacteria | 5635925 |
| 983 | 2871722145 | 2871720351 | Bacteria | 4862476 |
| 984 | 2881250401 | 2881247448 | Bacteria | 3717788 |
| 985 | 2881361446 | 2881359912 | Bacteria | 4935907 |
| 986 | 2889295088 | 2889290771 | Bacteria | 5530962 |
| 987 | 2903895221 | 2903895155 | Bacteria | 5258610 |
| 988 | 2904420382 | 2904419702 | Bacteria | 5166287 |
| 989 | 2904468753 | 2904467357 | Bacteria | 8057758 |
| 990 | 2904557772 | 2904555929 | Bacteria | 5218588 |
| 991 | 2906001963 | 2905999023 | Bacteria | 4591259 |
| 992 | 2914762945 | 2914759650 | Bacteria | 4701441 |
| 993 | 2919098768 | 2919097161 | Bacteria | 3860339 |
| 994 | 2919192414 | 2919191525 | Bacteria | 5765973 |
| 995 | 2919402226 | 2919399522 | Bacteria | 5164947 |
| 996 | 2919512999 | 2919509842 | Bacteria | 4104664 |
| 997 | 2919684179 | 2919683626 | Bacteria | 5534354 |
| 998 | 2929151297 | 2929150217 | Bacteria | 5462483 |
| 999 | 2929159616 | 2929154850 | Bacteria | 6753285 |
| 1000 | 2929240017 | 2929239360 | Bacteria | 7745570 |
| 1001 | 2929921725 | 2929921140 | Bacteria | 8649150 |
| 1002 | 2929927857 | 2929921140 | Bacteria | 8649150 |
| 1003 | 2945925871 | 2945924605 | Bacteria | 4296724 |
| 1004 | 2946022859 | 2946019816 | Bacteria | 4621265 |
| 1005 | 2958459568 | 2958458903 | Bacteria | 5301041 |
| 1006 | 2958515494 | 2958512119 | Bacteria | 4528530 |
| 1007 | 2965322537 | 2965320100 | Bacteria | 3975600 |
| 1008 | 2977244793 | 2977243572 | Bacteria | 4374394 |
| 1009 | 2977272672 | 2977268062 | Bacteria | 5243061 |
| 1010 | 2984573301 | 2984572630 | Bacteria | 4186940 |
| 1011 | 2984606736 | 2984606641 | Bacteria | 4186971 |
| 1012 | 2993376218 | 2993372514 | Bacteria | 4214139 |
| 1013 | 2993483032 | 2993480792 | Bacteria | 4022225 |
| 1014 | 8003154272 | 8003151029 | Bacteria | 8187759 |
| 1015 | 8036737282 | 8036736890 | Bacteria | 2944828 |
| 1016 | 8054310857 | 8054307821 | Bacteria | 5212224 |
| 1017 | 8055420109 | 8055419101 | Bacteria | 5289643 |
| 1018 | 8055596998 | 8055592153 | Bacteria | 5961247 |
| 1019 | 8056440908 | 8056440228 | Bacteria | 4946504 |
| 1020 | Ga0163162_10431565 | |||
| 1021 | SwRhRL2b_contig_1762647 | |||
| 1022 | SwRhRL2b_contig_2146348 | |||
| 1023 | SwRhRL2b_contig_3089144 | |||
| 1024 | SwRhRL2b_contig_3744328 | |||
| 1025 | ARcpr5yngRDRAFT_c004404 | |||
| 1026 | JGI24741J21665_1001247 | |||
| 1027 | JGI24740J21852_10006855 | |||
| 1028 | JGI24740J21852_10012210 | |||
| 1029 | JGI24739J22299_10000030 | |||
| 1030 | JGI24739J22299_10004900 | |||
| 1031 | JGI25406J46586_10002360 | |||
| 1032 | rootH1_10179098 | |||
| 1033 | rootH2_10001614 | |||
| 1034 | rootH2_10041791 | |||
| 1035 | rootH2_10174439 | |||
| 1036 | rootL2_10044922 | |||
| 1037 | rootL2_10172144 | |||
| 1038 | rootL2_10210758 | |||
| 1039 | rootH1_10047353 | |||
| 1040 | rootH1_10271838 | |||
| 1041 | JGI25160J50197_1001552 | |||
| 1042 | JGI25160J50197_1002016 | |||
| 1043 | JGI25160J50197_1010570 | |||
| 1044 | Ga0055528_1001162 | |||
| 1045 | Ga0055528_1004225 | |||
| 1046 | Ga0055530_10000185 | |||
| 1047 | Ga0055530_10007526 | |||
| 1048 | Ga0065165_1000022 | |||
| 1049 | Ga0065165_1000658 | |||
| 1050 | Ga0065714_10008309 | |||
| 1051 | Ga0065714_10017333 | |||
| 1052 | Ga0065714_10064676 | |||
| 1053 | Ga0065714_10071468 | |||
| 1054 | Ga0065714_10080303 | |||
| 1055 | Ga0065714_10120467 | |||
| 1056 | Ga0065704_10070151 | |||
| 1057 | Ga0065704_10070973 | |||
| 1058 | Ga0065704_10071864 | |||
| 1059 | Ga0065704_10076791 | |||
| 1060 | Ga0065704_10132245 | |||
| 1061 | Ga0065707_10094266 | |||
| 1062 | Ga0070658_10006593 | |||
| 1063 | Ga0070658_10053620 | |||
| 1064 | Ga0070676_10021589 | |||
| 1065 | Ga0070676_10087849 | |||
| 1066 | Ga0070676_10131609 | |||
| 1067 | Ga0070676_10195526 | |||
| 1068 | Ga0070683_100002289 | |||
| 1069 | Ga0070683_100002723 | |||
| 1070 | Ga0070683_100011531 | |||
| 1071 | Ga0070683_100067799 | |||
| 1072 | Ga0070683_100143582 | |||
| 1073 | Ga0070690_100077925 | |||
| 1074 | Ga0070690_100081965 | |||
| 1075 | Ga0070690_100262372 | |||
| 1076 | Ga0070670_100015571 | |||
| 1077 | Ga0070670_100080556 | |||
| 1078 | Ga0070670_100085579 | |||
| 1079 | Ga0070670_100123527 | |||
| 1080 | Ga0070670_100174562 | |||
| 1081 | Ga0070670_100434362 | |||
| 1082 | Ga0070677_10013222 | |||
| 1083 | Ga0070677_10017217 | |||
| 1084 | Ga0068869_100005447 | |||
| 1085 | Ga0068869_100023797 | |||
| 1086 | Ga0068869_100028069 | |||
| 1087 | Ga0068869_100104461 | |||
| 1088 | Ga0068869_100117754 | |||
| 1089 | Ga0068869_100118507 | |||
| 1090 | Ga0070666_10000072 | |||
| 1091 | Ga0070666_10028673 | |||
| 1092 | Ga0070666_10071337 | |||
| 1093 | Ga0070666_10253139 | |||
| 1094 | Ga0070680_100000802 | |||
| 1095 | Ga0070680_100024400 | |||
| 1096 | Ga0070682_100000019 | |||
| 1097 | Ga0070682_100000092 | |||
| 1098 | Ga0070682_100011862 | |||
| 1099 | Ga0070682_100018150 | |||
| 1100 | Ga0070682_100318101 | |||
| 1101 | Ga0068868_100060814 | |||
| 1102 | Ga0068868_100106001 | |||
| 1103 | Ga0068868_100139272 | |||
| 1104 | Ga0068868_100171027 | |||
| 1105 | Ga0070660_100010460 | |||
| 1106 | Ga0070660_100016382 | |||
| 1107 | Ga0070660_100067822 | |||
| 1108 | Ga0070689_100030159 | |||
| 1109 | Ga0070689_100069854 | |||
| 1110 | Ga0070689_100094432 | |||
| 1111 | Ga0070689_100097967 | |||
| 1112 | Ga0070687_100123049 | |||
| 1113 | Ga0070661_100014526 | |||
| 1114 | Ga0070661_100023078 | |||
| 1115 | Ga0070661_100104773 | |||
| 1116 | Ga0070661_100243935 | |||
| 1117 | Ga0070668_100020552 | |||
| 1118 | Ga0070668_100030775 | |||
| 1119 | Ga0070668_100059635 | |||
| 1120 | Ga0070668_100136802 | |||
| 1121 | Ga0070669_100001473 | |||
| 1122 | Ga0070669_100002379 | |||
| 1123 | Ga0070669_100082829 | |||
| 1124 | Ga0070675_100009851 | |||
| 1125 | Ga0070675_100034520 | |||
| 1126 | Ga0070675_100107513 | |||
| 1127 | Ga0070675_100115895 | |||
| 1128 | Ga0070675_100247316 | |||
| 1129 | Ga0070675_100375629 | |||
| 1130 | Ga0070671_100020969 | |||
| 1131 | Ga0070671_100040806 | |||
| 1132 | Ga0070671_100065988 | |||
| 1133 | Ga0070671_100090383 | |||
| 1134 | Ga0070673_100031329 | |||
| 1135 | Ga0070673_100044898 | |||
| 1136 | Ga0070673_100050796 | |||
| 1137 | Ga0070673_100072585 | |||
| 1138 | Ga0070673_100089978 | |||
| 1139 | Ga0070688_100002343 | |||
| 1140 | Ga0070688_100057986 | |||
| 1141 | Ga0070659_100010768 | |||
| 1142 | Ga0070659_100018911 | |||
| 1143 | Ga0070667_100077551 | |||
| 1144 | Ga0070667_100119808 | |||
| 1145 | Ga0070667_100124886 | |||
| 1146 | Ga0070700_100033053 | |||
| 1147 | Ga0070663_100370844 | |||
| 1148 | Ga0070678_100041667 | |||
| 1149 | Ga0070678_100045184 | |||
| 1150 | Ga0070662_100018727 | |||
| 1151 | Ga0070662_100066850 | |||
| 1152 | Ga0070662_100194735 | |||
| 1153 | Ga0070681_10032352 | |||
| 1154 | Ga0070681_10105005 | |||
| 1155 | Ga0070681_10339475 | |||
| 1156 | Ga0068867_100003996 | |||
| 1157 | Ga0068867_100040969 | |||
| 1158 | Ga0068867_100042323 | |||
| 1159 | Ga0070685_10071541 | |||
| 1160 | Ga0070685_10104902 | |||
| 1161 | Ga0070698_100007114 | |||
| 1162 | Ga0070698_100013253 | |||
| 1163 | Ga0070679_100000158 | |||
| 1164 | Ga0070679_100006985 | |||
| 1165 | Ga0070679_100104012 | |||
| 1166 | Ga0070684_100002319 | |||
| 1167 | Ga0070684_100018695 | |||
| 1168 | Ga0070684_100023156 | |||
| 1169 | Ga0070684_100024714 | |||
| 1170 | Ga0070684_100043825 | |||
| 1171 | Ga0068853_100007045 | |||
| 1172 | Ga0068853_100020379 | |||
| 1173 | Ga0068853_100031963 | |||
| 1174 | Ga0068853_100055184 | |||
| 1175 | Ga0068853_100071844 | |||
| 1176 | Ga0068853_100093472 | |||
| 1177 | Ga0070672_100004510 | |||
| 1178 | Ga0070672_100096625 | |||
| 1179 | Ga0070686_100038536 | |||
| 1180 | Ga0070693_100022765 | |||
| 1181 | Ga0070665_100017638 | |||
| 1182 | Ga0070665_100115341 | |||
| 1183 | Ga0068855_100001027 | |||
| 1184 | Ga0068855_100010998 | |||
| 1185 | Ga0068855_100066421 | |||
| 1186 | Ga0068855_100155975 | |||
| 1187 | Ga0068855_100239327 | |||
| 1188 | Ga0068855_100248675 | |||
| 1189 | Ga0070664_100009600 | |||
| 1190 | Ga0070664_100014826 | |||
| 1191 | Ga0070664_100019613 | |||
| 1192 | Ga0070664_100120393 | |||
| 1193 | Ga0070664_100126604 | |||
| 1194 | Ga0070664_100174179 | |||
| 1195 | Ga0070664_100468832 | |||
| 1196 | Ga0068857_100004302 | |||
| 1197 | Ga0068857_100088934 | |||
| 1198 | Ga0068857_100096888 | |||
| 1199 | Ga0068857_100100130 | |||
| 1200 | Ga0068857_100183656 | |||
| 1201 | Ga0068857_100333384 | |||
| 1202 | Ga0068857_100353539 | |||
| 1203 | Ga0068854_100016936 | |||
| 1204 | Ga0068854_100064535 | |||
| 1205 | Ga0068854_100081578 | |||
| 1206 | Ga0068854_100264763 | |||
| 1207 | Ga0068856_100032446 | |||
| 1208 | Ga0070702_100245648 | |||
| 1209 | Ga0068852_100000989 | |||
| 1210 | Ga0068852_100005736 | |||
| 1211 | Ga0068852_100013321 | |||
| 1212 | Ga0068852_100028296 | |||
| 1213 | Ga0068852_100211770 | |||
| 1214 | Ga0068859_100000006 | |||
| 1215 | Ga0068859_100007990 | |||
| 1216 | Ga0068859_100011125 | |||
| 1217 | Ga0068859_100031496 | |||
| 1218 | Ga0068859_100175683 | |||
| 1219 | Ga0068859_100316494 | |||
| 1220 | Ga0068859_100363917 | |||
| 1221 | Ga0068864_100012944 | |||
| 1222 | Ga0068864_100017013 | |||
| 1223 | Ga0068864_100035108 | |||
| 1224 | Ga0068864_100059981 | |||
| 1225 | Ga0068866_10042032 | |||
| 1226 | Ga0068861_100039435 | |||
| 1227 | Ga0068861_100102518 | |||
| 1228 | Ga0068861_100313605 | |||
| 1229 | Ga0068861_100388585 | |||
| 1230 | Ga0068851_10111325 | |||
| 1231 | Ga0068870_10012058 | |||
| 1232 | Ga0068870_10015090 | |||
| 1233 | Ga0068863_100055268 | |||
| 1234 | Ga0068863_100059836 | |||
| 1235 | Ga0068863_100144604 | |||
| 1236 | Ga0068863_100150025 | |||
| 1237 | Ga0068863_100490368 | |||
| 1238 | Ga0068858_100070848 | |||
| 1239 | Ga0068858_100332303 | |||
| 1240 | Ga0068860_100000061 | |||
| 1241 | Ga0068860_100001096 | |||
| 1242 | Ga0068860_100005681 | |||
| 1243 | Ga0068860_100028006 | |||
| 1244 | Ga0068860_100136937 | |||
| 1245 | Ga0068860_100144733 | |||
| 1246 | Ga0068860_100498108 | |||
| 1247 | Ga0081539_10000338 | |||
| 1248 | Ga0070715_10061328 | |||
| 1249 | Ga0075366_10011421 | |||
| 1250 | Ga0075366_10018211 | |||
| 1251 | Ga0075366_10051273 | |||
| 1252 | Ga0097621_100000448 | |||
| 1253 | Ga0097621_100014754 | |||
| 1254 | Ga0097621_100072683 | |||
| 1255 | Ga0097621_100088492 | |||
| 1256 | Ga0068871_100001237 | |||
| 1257 | Ga0068871_100018019 | |||
| 1258 | Ga0068871_100228938 | |||
| 1259 | Ga0068871_100259362 | |||
| 1260 | Ga0075428_100010088 | |||
| 1261 | Ga0075428_100011391 | |||
| 1262 | Ga0075428_100071436 | |||
| 1263 | Ga0075430_100002480 | |||
| 1264 | Ga0075430_100030429 | |||
| 1265 | Ga0075429_100040575 | |||
| 1266 | Ga0068865_100016555 | |||
| 1267 | Ga0068865_100097245 | |||
| 1268 | Ga0097620_100000006 | |||
| 1269 | Ga0097620_100001537 | |||
| 1270 | Ga0097620_100007990 | |||
| 1271 | Ga0097620_100011125 | |||
| 1272 | Ga0097620_100031496 | |||
| 1273 | Ga0097620_100175687 | |||
| 1274 | Ga0097620_100316508 | |||
| 1275 | Ga0097620_100363926 | |||
| 1276 | Ga0099824_1000500 | |||
| 1277 | Ga0079104_1000079 | |||
| 1278 | Ga0099826_10000143 | |||
| 1279 | Ga0105251_10035505 | |||
| 1280 | Ga0105244_10000001 | |||
| 1281 | Ga0105244_10000054 | |||
| 1282 | Ga0105250_10006702 | |||
| 1283 | Ga0105240_10001787 | |||
| 1284 | Ga0105240_10001808 | |||
| 1285 | Ga0105240_10003852 | |||
| 1286 | Ga0105240_10004358 | |||
| 1287 | Ga0105240_10006347 | |||
| 1288 | Ga0105240_10013595 | |||
| 1289 | Ga0105240_10034582 | |||
| 1290 | Ga0105240_10061820 | |||
| 1291 | Ga0111539_10001303 | |||
| 1292 | Ga0111539_10094577 | |||
| 1293 | Ga0111539_10321138 | |||
| 1294 | Ga0111539_10588248 | |||
| 1295 | Ga0105247_10018425 | |||
| 1296 | Ga0105247_10213756 | |||
| 1297 | Ga0114129_10020886 | |||
| 1298 | Ga0114129_10465245 | |||
| 1299 | Ga0105243_10001053 | |||
| 1300 | Ga0105243_10450247 | |||
| 1301 | Ga0105241_10000886 | |||
| 1302 | Ga0105241_10007561 | |||
| 1303 | Ga0105241_10008379 | |||
| 1304 | Ga0105241_10230277 | |||
| 1305 | Ga0105242_10007715 | |||
| 1306 | Ga0105242_10022259 | |||
| 1307 | Ga0105242_10031614 | |||
| 1308 | Ga0105242_10083440 | |||
| 1309 | Ga0105248_10044227 | |||
| 1310 | Ga0105237_10007301 | |||
| 1311 | Ga0105237_10013605 | |||
| 1312 | Ga0105237_10127578 | |||
| 1313 | Ga0105237_10210708 | |||
| 1314 | Ga0105237_10211779 | |||
| 1315 | Ga0105238_10000592 | |||
| 1316 | Ga0105238_10381080 | |||
| 1317 | Ga0105249_10000623 | |||
| 1318 | Ga0105249_10019091 | |||
| 1319 | Ga0105249_10052792 | |||
| 1320 | Ga0105249_10068255 | |||
| 1321 | Ga0105249_10081133 | |||
| 1322 | Ga0105249_10155163 | |||
| 1323 | Ga0105249_10209496 | |||
| 1324 | Ga0105239_10000019 | |||
| 1325 | Ga0105239_10001405 | |||
| 1326 | Ga0105239_10039800 | |||
| 1327 | Ga0105239_10045372 | |||
| 1328 | Ga0105246_10063689 | |||
| 1329 | Ga0105246_10075370 | |||
| 1330 | Ga0157373_10000035 | |||
| 1331 | Ga0157373_10000056 | |||
| 1332 | Ga0157373_10010363 | |||
| 1333 | Ga0157373_10010705 | |||
| 1334 | Ga0157373_10023444 | |||
| 1335 | Ga0157373_10051295 | |||
| 1336 | Ga0157373_10054280 | |||
| 1337 | Ga0157371_10000081 | |||
| 1338 | Ga0157371_10000218 | |||
| 1339 | Ga0157371_10001629 | |||
| 1340 | Ga0157371_10003874 | |||
| 1341 | Ga0157371_10007353 | |||
| 1342 | Ga0157371_10014811 | |||
| 1343 | Ga0157371_10050257 | |||
| 1344 | Ga0157370_10001029 | |||
| 1345 | Ga0157370_10001171 | |||
| 1346 | Ga0157370_10001492 | |||
| 1347 | Ga0157370_10004094 | |||
| 1348 | Ga0157370_10005329 | |||
| 1349 | Ga0157370_10007679 | |||
| 1350 | Ga0157370_10008275 | |||
| 1351 | Ga0157370_10015550 | |||
| 1352 | Ga0157370_10017727 | |||
| 1353 | Ga0157370_10022533 | |||
| 1354 | Ga0157370_10066766 | |||
| 1355 | Ga0157370_10103574 | |||
| 1356 | Ga0157369_10000474 | |||
| 1357 | Ga0157369_10002049 | |||
| 1358 | Ga0157369_10048167 | |||
| 1359 | Ga0157369_10092452 | |||
| 1360 | Ga0157369_10132396 | |||
| 1361 | Ga0157369_10202875 | |||
| 1362 | Ga0157369_10211675 | |||
| 1363 | Ga0157369_10301870 | |||
| 1364 | Ga0157369_10382259 | |||
| 1365 | Ga0157369_10532889 | |||
| 1366 | Ga0157369_10537215 | |||
| 1367 | Ga0157374_10003783 | |||
| 1368 | Ga0157374_10008939 | |||
| 1369 | Ga0157374_10021996 | |||
| 1370 | Ga0157374_10039978 | |||
| 1371 | Ga0157374_10045758 | |||
| 1372 | Ga0157374_10339748 | |||
| 1373 | Ga0157374_10345671 | |||
| 1374 | Ga0157378_10003090 | |||
| 1375 | Ga0157378_10016578 | |||
| 1376 | Ga0157378_10017446 | |||
| 1377 | Ga0157378_10019626 | |||
| 1378 | Ga0157378_10024744 | |||
| 1379 | Ga0157378_10033297 | |||
| 1380 | Ga0157378_10069352 | |||
| 1381 | Ga0157378_10099924 | |||
| 1382 | Ga0163162_10000131 | |||
| 1383 | Ga0163162_10002714 | |||
| 1384 | Ga0163162_10023335 | |||
| 1385 | Ga0163162_10031303 | |||
| 1386 | Ga0163162_10044775 | |||
| 1387 | Ga0163162_10081880 | |||
| 1388 | Ga0163162_10084128 | |||
| 1389 | Ga0163162_10179002 | |||
| 1390 | Ga0163162_10183242 | |||
| 1391 | Ga0157372_10003581 | |||
| 1392 | Ga0157372_10013617 | |||
| 1393 | Ga0157372_10019373 | |||
| 1394 | Ga0157372_10038889 | |||
| 1395 | Ga0157372_10061028 | |||
| 1396 | Ga0157372_10103820 | |||
| 1397 | Ga0157372_10114245 | |||
| 1398 | Ga0157372_10129714 | |||
| 1399 | Ga0157372_10193417 | |||
| 1400 | Ga0157372_10391584 | |||
| 1401 | Ga0157372_10577083 | |||
| 1402 | Ga0157375_10000280 | |||
| 1403 | Ga0157375_10004666 | |||
| 1404 | Ga0157375_10016191 | |||
| 1405 | Ga0157375_10116256 | |||
| 1406 | Ga0157375_10180596 | |||
| 1407 | Ga0163163_10000591 | |||
| 1408 | Ga0163163_10007372 | |||
| 1409 | Ga0163163_10066601 | |||
| 1410 | Ga0163163_10163969 | |||
| 1411 | Ga0157380_10000026 | |||
| 1412 | Ga0157380_10004078 | |||
| 1413 | Ga0157380_10004118 | |||
| 1414 | Ga0157380_10020610 | |||
| 1415 | Ga0157380_10044775 | |||
| 1416 | Ga0157380_10146262 | |||
| 1417 | Ga0182008_10000007 | |||
| 1418 | Ga0157377_10000583 | |||
| 1419 | Ga0157377_10008618 | |||
| 1420 | Ga0157377_10059269 | |||
| 1421 | Ga0157379_10090934 | |||
| 1422 | Ga0157379_10144775 | |||
| 1423 | Ga0157379_10168514 | |||
| 1424 | Ga0157379_10306013 | |||
| 1425 | Ga0157376_10002332 | |||
| 1426 | Ga0157376_10044790 | |||
| 1427 | Ga0157376_10053620 | |||
| 1428 | Ga0157376_10123046 | |||
| 1429 | Ga0157376_10124326 | |||
| 1430 | Ga0182006_1000003 | |||
| 1431 | Ga0182006_1001274 | |||
| 1432 | Ga0182006_1005678 | |||
| 1433 | Ga0182006_1020701 | |||
| 1434 | Ga0182007_10031544 | |||
| 1435 | Ga0182005_1000189 | |||
| 1436 | Ga0163161_10000091 | |||
| 1437 | Ga0163161_10002598 | |||
| 1438 | Ga0163161_10004744 | |||
| 1439 | Ga0163161_10004838 | |||
| 1440 | Ga0163161_10013026 | |||
| 1441 | Ga0163161_10038918 | |||
| 1442 | Ga0163161_10041186 | |||
| 1443 | Ga0163161_10073007 | |||
| 1444 | Ga0213876_10003238 | |||
| 1445 | Ga0213876_10126200 | |||
| 1446 | Ga0209673_1000519 | |||
| 1447 | Ga0209675_1000323 | |||
| 1448 | Ga0209050_1000129 | |||
| 1449 | Ga0209050_1000276 | |||
| 1450 | Ga0207426_1000019 | |||
| 1451 | Ga0207426_1000059 | |||
| 1452 | Ga0207426_1002756 | |||
| 1453 | Ga0207426_1003233 | |||
| 1454 | Ga0207426_1008034 | |||
| 1455 | Ga0209051_1027692 | |||
| 1456 | Ga0209257_1000736 | |||
| 1457 | Ga0209257_1001011 | |||
| 1458 | Ga0207656_10000237 | |||
| 1459 | Ga0207655_1000003 | |||
| 1460 | Ga0207655_1000018 | |||
| 1461 | Ga0207710_10017235 | |||
| 1462 | Ga0207688_10006044 | |||
| 1463 | Ga0207680_10000137 | |||
| 1464 | Ga0207680_10067238 | |||
| 1465 | Ga0207680_10125416 | |||
| 1466 | Ga0207680_10133167 | |||
| 1467 | Ga0207680_10139605 | |||
| 1468 | Ga0207680_10161834 | |||
| 1469 | Ga0207647_10000025 | |||
| 1470 | Ga0207647_10015704 | |||
| 1471 | Ga0207647_10029562 | |||
| 1472 | Ga0207647_10058866 | |||
| 1473 | Ga0207647_10134471 | |||
| 1474 | Ga0207645_10001948 | |||
| 1475 | Ga0207645_10002012 | |||
| 1476 | Ga0207645_10031229 | |||
| 1477 | Ga0207643_10015283 | |||
| 1478 | Ga0207643_10105415 | |||
| 1479 | Ga0207705_10050927 | |||
| 1480 | Ga0207705_10286764 | |||
| 1481 | Ga0207654_10003375 | |||
| 1482 | Ga0207654_10005844 | |||
| 1483 | Ga0207707_10000238 | |||
| 1484 | Ga0207707_10018897 | |||
| 1485 | Ga0207707_10025973 | |||
| 1486 | Ga0207695_10000087 | |||
| 1487 | Ga0207695_10000863 | |||
| 1488 | Ga0207695_10001230 | |||
| 1489 | Ga0207695_10028221 | |||
| 1490 | Ga0207695_10034544 | |||
| 1491 | Ga0207695_10100032 | |||
| 1492 | Ga0207671_10000453 | |||
| 1493 | Ga0207671_10000931 | |||
| 1494 | Ga0207671_10002781 | |||
| 1495 | Ga0207671_10004520 | |||
| 1496 | Ga0207671_10043217 | |||
| 1497 | Ga0207671_10139128 | |||
| 1498 | Ga0207660_10013800 | |||
| 1499 | Ga0207660_10129301 | |||
| 1500 | Ga0207660_10144183 | |||
| 1501 | Ga0207657_10004391 | |||
| 1502 | Ga0207657_10064911 | |||
| 1503 | Ga0207657_10076939 | |||
| 1504 | Ga0207657_10089176 | |||
| 1505 | Ga0207657_10155020 | |||
| 1506 | Ga0207649_10014898 | |||
| 1507 | Ga0207649_10036342 | |||
| 1508 | Ga0207649_10096472 | |||
| 1509 | Ga0207649_10144393 | |||
| 1510 | Ga0207652_10000013 | |||
| 1511 | Ga0207652_10000346 | |||
| 1512 | Ga0207652_10002804 | |||
| 1513 | Ga0207652_10019984 | |||
| 1514 | Ga0207652_10065940 | |||
| 1515 | Ga0207681_10034279 | |||
| 1516 | Ga0207681_10095341 | |||
| 1517 | Ga0207681_10261993 | |||
| 1518 | Ga0207650_10026156 | |||
| 1519 | Ga0207650_10044809 | |||
| 1520 | Ga0207650_10100282 | |||
| 1521 | Ga0207650_10105413 | |||
| 1522 | Ga0207650_10120146 | |||
| 1523 | Ga0207650_10307646 | |||
| 1524 | Ga0207659_10082053 | |||
| 1525 | Ga0207659_10104323 | |||
| 1526 | Ga0207659_10120581 | |||
| 1527 | Ga0207644_10108647 | |||
| 1528 | Ga0207644_10115109 | |||
| 1529 | Ga0207644_10186164 | |||
| 1530 | Ga0207690_10024343 | |||
| 1531 | Ga0207706_10003226 | |||
| 1532 | Ga0207706_10004884 | |||
| 1533 | Ga0207706_10031139 | |||
| 1534 | Ga0207706_10060968 | |||
| 1535 | Ga0207706_10228973 | |||
| 1536 | Ga0207686_10000764 | |||
| 1537 | Ga0207686_10039056 | |||
| 1538 | Ga0207686_10039701 | |||
| 1539 | Ga0207686_10098422 | |||
| 1540 | Ga0207709_10018839 | |||
| 1541 | Ga0207670_10066676 | |||
| 1542 | Ga0207670_10379291 | |||
| 1543 | Ga0207669_10102152 | |||
| 1544 | Ga0207704_10050591 | |||
| 1545 | Ga0207704_10170504 | |||
| 1546 | Ga0207691_10005909 | |||
| 1547 | Ga0207691_10011514 | |||
| 1548 | Ga0207691_10030031 | |||
| 1549 | Ga0207691_10053331 | |||
| 1550 | Ga0207691_10234383 | |||
| 1551 | Ga0207691_10316332 | |||
| 1552 | Ga0207689_10005782 | |||
| 1553 | Ga0207689_10011456 | |||
| 1554 | Ga0207689_10024448 | |||
| 1555 | Ga0207689_10044372 | |||
| 1556 | Ga0207689_10045457 | |||
| 1557 | Ga0207689_10049261 | |||
| 1558 | Ga0207689_10067587 | |||
| 1559 | Ga0207689_10073106 | |||
| 1560 | Ga0207689_10106592 | |||
| 1561 | Ga0207689_10112809 | |||
| 1562 | Ga0207689_10153764 | |||
| 1563 | Ga0207689_10286726 | |||
| 1564 | Ga0207661_10010032 | |||
| 1565 | Ga0207661_10013439 | |||
| 1566 | Ga0207661_10014911 | |||
| 1567 | Ga0207661_10045858 | |||
| 1568 | Ga0207661_10136717 | |||
| 1569 | Ga0207679_10005881 | |||
| 1570 | Ga0207679_10067158 | |||
| 1571 | Ga0207679_10080716 | |||
| 1572 | Ga0207679_10125104 | |||
| 1573 | Ga0207679_10341674 | |||
| 1574 | Ga0207667_10000098 | |||
| 1575 | Ga0207667_10000279 | |||
| 1576 | Ga0207667_10004703 | |||
| 1577 | Ga0207667_10017739 | |||
| 1578 | Ga0207667_10094333 | |||
| 1579 | Ga0207667_10139609 | |||
| 1580 | Ga0207667_10402029 | |||
| 1581 | Ga0207651_10036784 | |||
| 1582 | Ga0207651_10226625 | |||
| 1583 | Ga0207712_10001013 | |||
| 1584 | Ga0207712_10006008 | |||
| 1585 | Ga0207712_10011002 | |||
| 1586 | Ga0207712_10050698 | |||
| 1587 | Ga0207712_10058121 | |||
| 1588 | Ga0207668_10038802 | |||
| 1589 | Ga0207668_10062514 | |||
| 1590 | Ga0207668_10111780 | |||
| 1591 | Ga0207668_10129220 | |||
| 1592 | Ga0207640_10064742 | |||
| 1593 | Ga0207640_10067157 | |||
| 1594 | Ga0207640_10089030 | |||
| 1595 | Ga0207658_10078470 | |||
| 1596 | Ga0207658_10119552 | |||
| 1597 | Ga0207658_10364932 | |||
| 1598 | Ga0207677_10022316 | |||
| 1599 | Ga0207677_10040671 | |||
| 1600 | Ga0207703_10035603 | |||
| 1601 | Ga0207639_10009075 | |||
| 1602 | Ga0207639_10015542 | |||
| 1603 | Ga0207639_10034582 | |||
| 1604 | Ga0207639_10062045 | |||
| 1605 | Ga0207639_10067739 | |||
| 1606 | Ga0207678_10006330 | |||
| 1607 | Ga0207678_10026007 | |||
| 1608 | Ga0207678_10074008 | |||
| 1609 | Ga0207708_10152859 | |||
| 1610 | Ga0207702_10409025 | |||
| 1611 | Ga0207702_10475984 | |||
| 1612 | Ga0207641_10000058 | |||
| 1613 | Ga0207641_10024998 | |||
| 1614 | Ga0207641_10085922 | |||
| 1615 | Ga0207641_10186361 | |||
| 1616 | Ga0207641_10354235 | |||
| 1617 | Ga0207641_10389677 | |||
| 1618 | Ga0207648_10003197 | |||
| 1619 | Ga0207648_10003482 | |||
| 1620 | Ga0207648_10026917 | |||
| 1621 | Ga0207648_10036267 | |||
| 1622 | Ga0207648_10188745 | |||
| 1623 | Ga0207676_10010326 | |||
| 1624 | Ga0207676_10028711 | |||
| 1625 | Ga0207674_10000969 | |||
| 1626 | Ga0207674_10005452 | |||
| 1627 | Ga0207674_10021460 | |||
| 1628 | Ga0207674_10023895 | |||
| 1629 | Ga0207674_10053972 | |||
| 1630 | Ga0207674_10324755 | |||
| 1631 | Ga0207675_100000654 | |||
| 1632 | Ga0207675_100022585 | |||
| 1633 | Ga0207675_100054133 | |||
| 1634 | Ga0207675_100062593 | |||
| 1635 | Ga0207675_100122687 | |||
| 1636 | Ga0207675_100156470 | |||
| 1637 | Ga0207675_100257898 | |||
| 1638 | Ga0207675_100377666 | |||
| 1639 | Ga0207683_10035923 | |||
| 1640 | Ga0207698_10000937 | |||
| 1641 | Ga0207698_10017486 | |||
| 1642 | Ga0207698_10023447 | |||
| 1643 | Ga0207698_10038320 | |||
| 1644 | Ga0207698_10090624 | |||
| 1645 | Ga0207698_10260174 | |||
| 1646 | Ga0207698_10335523 | |||
| 1647 | Ga0209281_1000045 | |||
| 1648 | Ga0209489_108596 | |||
| 1649 | Ga0210002_1001089 | |||
| 1650 | Ga0268266_10000068 | |||
| 1651 | Ga0268266_10090840 | |||
| 1652 | Ga0268264_10000079 | |||
| 1653 | Ga0268264_10002043 | |||
| 1654 | Ga0268264_10003074 | |||
| 1655 | Ga0268264_10006028 | |||
| 1656 | Ga0268264_10010056 | |||
| 1657 | Ga0268264_10013025 | |||
| 1658 | Ga0268264_10081602 | |||
| 1659 | Ga0268264_10109398 | |||
| 1660 | Ga0265334_10013415 | |||
| 1661 | Ga0307517_10001481 | |||
| 1662 | Ga0307515_10000001 | |||
| 1663 | Ga0307515_10000059 | |||
| 1664 | Ga0265324_10028844 | |||
| 1665 | Ga0307511_10000201 | |||
| 1666 | Ga0265327_10000009 | |||
| 1667 | Ga0265327_10000013 | |||
| 1668 | Ga0265327_10000031 | |||
| 1669 | Ga0265327_10004168 | |||
| 1670 | Ga0265327_10028535 | |||
| 1671 | Ga0307509_10029227 | |||
| 1672 | Ga0307509_10090993 | |||
| 1673 | Ga0307509_10326538 | |||
| 1674 | Ga0307408_100000375 | |||
| 1675 | Ga0307408_100000600 | |||
| 1676 | Ga0307408_100209884 | |||
| 1677 | Ga0307508_10001083 | |||
| 1678 | Ga0307508_10055089 | |||
| 1679 | Ga0265314_10105638 | |||
| 1680 | Ga0307516_10090526 | |||
| 1681 | Ga0307405_10000001 | |||
| 1682 | Ga0307413_10000001 | |||
| 1683 | Ga0307413_10251205 | |||
| 1684 | Ga0307410_10000024 | |||
| 1685 | Ga0307410_10114427 | |||
| 1686 | Ga0307410_10177734 | |||
| 1687 | Ga0307406_10000028 | |||
| 1688 | Ga0307406_10003873 | |||
| 1689 | Ga0307406_10060682 | |||
| 1690 | Ga0307407_10000286 | |||
| 1691 | Ga0307412_10000062 | |||
| 1692 | Ga0307412_10000155 | |||
| 1693 | Ga0307412_10116424 | |||
| 1694 | Ga0307412_10192377 | |||
| 1695 | Ga0307416_100000013 | |||
| 1696 | Ga0307416_100000066 | |||
| 1697 | Ga0307416_100048785 | |||
| 1698 | Ga0307414_10000022 | |||
| 1699 | Ga0307414_10000041 | |||
| 1700 | Ga0307414_10000241 | |||
| 1701 | Ga0307414_10006659 | |||
| 1702 | Ga0307414_10019595 | |||
| 1703 | Ga0307414_10025485 | |||
| 1704 | Ga0307414_10031050 | |||
| 1705 | Ga0307414_10034030 | |||
| 1706 | Ga0307414_10047614 | |||
| 1707 | Ga0307414_10093659 | |||
| 1708 | Ga0307414_10144565 | |||
| 1709 | Ga0307414_10162064 | |||
| 1710 | Ga0307411_10000003 | |||
| 1711 | Ga0307411_10151934 | |||
| 1712 | Ga0307510_10009446 | |||
| 1713 | Ga0373934_0015585 | |||
| 1714 | Ga0373943_0071141 | |||
| 1715 | Ga0373955_0040882 | |||
| 1716 | Ga0373933_0040967 | |||
| 1717 | Ga0395899_0000025 | |||
| 1718 | Ga0395899_0000528 | |||
| 1719 | Ga0395899_0057783 | |||
| 1720 | Ga0395899_0225469 | |||
| 1721 | Ga0395899_0250777 | |||
| 1722 | Ga0395900_0008628 | |||
| 1723 | Ga0395900_0011009 | |||
| 1724 | Ga0395900_0014908 | |||
| 1725 | Ga0395898_0000595 | |||
| 1726 | Ga0395898_0017447 | |||
| 1727 | Ga0395905_0004944 | |||
| 1728 | Ga0395905_0011815 | |||
| 1729 | Ga0395905_0255495 | |||
| 1730 | Ga0395905_0385700 | |||
| 1731 | Ga0395901_0001672 | |||
| 1732 | Ga0395901_0007597 | |||
| 1733 | Ga0395901_0007671 | |||
| 1734 | Ga0395901_0237157 | |||
| 1735 | Ga0436365_0022529 | |||
| 1736 | Ga0436365_1412273 | |||
| 1737 | Ga0439439_0049448 | |||
| 1738 | Ga0439447_000106 | |||
| 1739 | Ga0439466_0000940 | |||
| 1740 | Ga0439466_0042247 | |||
| 1741 | Ga0439465_0000262 | |||
| 1742 | Ga0439431_0003814 | |||
| 1743 | Ga0439445_0000338 | |||
| 1744 | Ga0439445_0062334 | |||
| 1745 | Ga0439449_0066059 | |||
| 1746 | Ga0439449_0068842 | |||
| 1747 | Ga0450923_001224 | |||
| 1748 | Ga0451577_0004359 | |||
| 1749 | Ga0451577_0281484 | |||
| 1750 | Ga0466969_0017149 | |||
| 1751 | Ga0466972_0000057 | |||
| 1752 | Ga0466972_0001286 | |||
| 1753 | Ga0466972_0008805 | |||
| 1754 | Ga0466972_0097797 | |||
| 1755 | Ga0453683_0030268 | |||
| 1756 | Ga0466965_0086049 | |||
| 1757 | Ga0466961_0009575 | |||
| 1758 | Ga0453684_0002754 | |||
| 1759 | Ga0453684_0124591 | |||
| 1760 | Ga0466971_0050848 | |||
| 1761 | Ga0466968_0040610 | |||
| 1762 | Ga0466970_0021478 | |||
| 1763 | Ga0466970_0053550 | |||
| 1764 | Ga0466957_0035214 | |||
| 1765 | Ga0466959_0110634 | |||
| 1766 | Ga0451576_0022638 | |||
| 1767 | Ga0495627_000068 | |||
| 1768 | Ga0495627_000603 | |||
| 1769 | Ga0495627_016911 | |||
| 1770 | Ga0495638_0000232 | |||
| 1771 | Ga0495638_0143017 | |||
| 1772 | Ga0495653_0207807 | |||
| 1773 | Ga0495650_0028739 | |||
| 1774 | Ga0495596_0031846 | |||
| 1775 | Ga0495607_0018038 | |||
| 1776 | Ga0495606_0006163 | |||
| 1777 | Ga0495606_0007463 | |||
| 1778 | Ga0495606_0009602 | |||
| 1779 | Ga0495606_0035609 | |||
| 1780 | Ga0495610_0000006 | |||
| 1781 | Ga0495616_0034144 | |||
| 1782 | Ga0495628_0062222 | |||
| 1783 | Ga0495630_0300517 | |||
| 1784 | Ga0495632_0002092 | |||
| 1785 | Ga0495643_0007483 | |||
| 1786 | Ga0495643_0075879 | |||
| 1787 | Ga0495643_0115736 | |||
| 1788 | Ga0495663_0000044 | |||
| 1789 | Ga0495663_0003868 | |||
| 1790 | Ga0495654_0000017 | |||
| 1791 | Ga0495609_0000017 | |||
| 1792 | Ga0495633_0000037 | |||
| 1793 | Ga0495633_0000152 | |||
| 1794 | Ga0495633_0002058 | |||
| 1795 | Ga0495634_0035114 | |||
| 1796 | Ga0495611_0001026 | |||
| 1797 | Ga0495625_0000501 | |||
| 1798 | Ga0495625_0022817 | |||
| 1799 | Ga0495625_0062229 | |||
| 1800 | Ga0495657_0102592 | |||
| 1801 | Ga0495658_0156079 | |||
| 1802 | Ga0495600_0050484 | |||
| 1803 | Ga0495674_0244498 | |||
| 1804 | Ga0495672_0061739 | |||
| 1805 | Ga0495686_0000005 | |||
| 1806 | Ga0495686_0002112 | |||
| 1807 | Ga0495686_0006110 | |||
| 1808 | Ga0495686_0029992 | |||
| 1809 | Ga0496108_0144112 | |||
| 1810 | Ga0496109_0342993 | |||
| 1811 | Ga0496110_0019668 | |||
| 1812 | Ga0496110_0093365 | |||
| 1813 | Ga0496110_0229900 | |||
| 1814 | Ga0496113_0147693 | |||
| 1815 | Ga0496114_0000243 | |||
| 1816 | Ga0496115_0117601 | |||
| 1817 | Ga0496116_0000002 | |||
| 1818 | Ga0496116_0000052 | |||
| 1819 | Ga0496117_0000082 | |||
| 1820 | Ga0496118_0000321 | |||
| 1821 | Ga0496119_0000006 | |||
| 1822 | Ga0496122_0000230 | |||
| 1823 | Ga0496122_0001851 | |||
| 1824 | Ga0496122_0001875 | |||
| 1825 | Ga0496122_0002049 | |||
| 1826 | Ga0496123_0000476 | |||
| 1827 | Ga0496124_0003570 | |||
| 1828 | Ga0496124_0086776 | |||
| 1829 | Ga0496125_0000024 | |||
| 1830 | Ga0496125_0000108 | |||
| 1831 | Ga0496125_0001315 | |||
| 1832 | Ga0496125_0003723 | |||
| 1833 | Ga0496125_0104940 | |||
| 1834 | Ga0496126_0002224 | |||
| 1835 | Ga0496126_0002542 | |||
| 1836 | Ga0496126_0161957 | |||
| 1837 | Ga0501314_002013 | |||
| 1838 | Ga0501031_0009537 | |||
| 1839 | Ga0501032_0011337 | |||
| 1840 | Ga0501032_0081454 | |||
| 1841 | Ga0501033_0008636 | |||
| 1842 | Ga0501033_0159822 | |||
| 1843 | Ga0501034_0000004 | |||
| 1844 | Ga0501034_0005186 | |||
| 1845 | Ga0501034_0006447 | |||
| 1846 | Ga0501034_0014518 | |||
| 1847 | Ga0501034_0021095 | |||
| 1848 | Ga0501034_0023070 | |||
| 1849 | Ga0501034_0284455 | |||
| 1850 | Ga0501036_0005238 | |||
| 1851 | Ga0501036_0034412 | |||
| 1852 | Ga0501036_0043744 | |||
| 1853 | Ga0501037_0011972 | |||
| 1854 | Ga0501037_0094518 | |||
| 1855 | Ga0501037_0107272 | |||
| 1856 | Ga0501038_0009087 | |||
| 1857 | Ga0501038_0273111 | |||
| 1858 | Ga0501039_0048454 | |||
| 1859 | Ga0501039_0075619 | |||
| 1860 | Ga0501043_0027568 | |||
| 1861 | Ga0501043_0028125 | |||
| 1862 | Ga0501043_0048474 | |||
| 1863 | Ga0501043_0070852 | |||
| 1864 | Ga0501043_0220619 | |||
| 1865 | Ga0501043_0330112 | |||
| 1866 | Ga0501046_0071552 | |||
| 1867 | Ga0501047_0011756 | |||
| 1868 | Ga0501047_0088188 | |||
| 1869 | Ga0501047_0110018 | |||
| 1870 | Ga0501070_0004592 | |||
| 1871 | Ga0501073_0009930 | |||
| 1872 | Ga0501073_0280474 | |||
| 1873 | Ga0501074_0000494 | |||
| 1874 | Ga0501198_000130 | |||
| 1875 | Ga0501201_000295 | |||
| 1876 | Ga0501202_009961 | |||
| 1877 | Ga0501206_001400 | |||
| 1878 | Ga0501207_000851 | |||
| 1879 | Ga0501208_004664 | |||
| 1880 | Ga0501216_001408 | |||
| 1881 | Ga0501217_000325 | |||
| 1882 | Ga0501222_000182 | |||
| 1883 | Ga0501223_000751 | |||
| 1884 | Ga0501223_009084 | |||
| 1885 | Ga0501233_003367 | |||
| 1886 | Ga0501235_009289 | |||
| 1887 | Ga0501238_002406 | |||
| 1888 | Ga0501242_004215 | |||
| 1889 | Ga0501243_000074 | |||
| 1890 | Ga0501243_006226 | |||
| 1891 | Ga0501249_000002 | |||
| 1892 | Ga0501249_002827 | |||
| 1893 | Ga0501252_000534 | |||
| 1894 | Ga0501257_016825 | |||
| 1895 | Ga0501259_000075 | |||
| 1896 | Ga0501259_005676 | |||
| 1897 | Ga0501261_000902 | |||
| 1898 | Ga0501221_000128 | |||
| 1899 | Ga0501225_0001304 | |||
| 1900 | Ga0501234_003950 | |||
| 1901 | Ga0501245_000976 | |||
| 1902 | Ga0501079_0169872 | |||
| 1903 | Ga0501080_0064882 | |||
| 1904 | Ga0501083_0002163 | |||
| 1905 | Ga0501241_000003 | |||
| 1906 | Ga0501241_000260 | |||
| 1907 | Ga0501266_000003 | |||
| 1908 | Ga0501266_005058 | |||
| 1909 | Ga0501266_010532 | |||
| 1910 | Ga0501268_001347 | |||
| 1911 | Ga0501269_000407 | |||
| 1912 | Ga0501269_001345 | |||
| 1913 | Ga0501279_001305 | |||
| 1914 | Ga0501035_0011149 | |||
| 1915 | Ga0501035_0021889 | |||
| 1916 | Ga0501035_0042406 | |||
| 1917 | Ga0501035_0081067 | |||
| 1918 | Ga0501044_0006596 | |||
| 1919 | Ga0501044_0009390 | |||
| 1920 | Ga0501044_0015667 | |||
| 1921 | Ga0501044_0110416 | |||
| 1922 | Ga0501045_0185999 | |||
| 1923 | Ga0501212_000118 | |||
| 1924 | nmdc:mga0k408_16132_c1 | |||
| 1925 | nmdc:mga09592_164823_c1 | |||
| 1926 | nmdc:mga09592_177938_c1 | |||
| 1927 | nmdc:mga09592_18052_c1 | |||
| 1928 | nmdc:mga09592_215515_c1 | |||
| 1929 | nmdc:mga0qj67_4627_c1 | |||
| 1930 | nmdc:mga0n895_85610_c1 | |||
| 1931 | Ga0500578_0000144 | |||
| 1932 | Ga0500646_0001397 | |||
| 1933 | Ga0500651_0176972 | |||
| 1934 | Ga0500641_0000005 | |||
| 1935 | Ga0500641_0000077 | |||
| 1936 | Ga0500641_0010652 | |||
| 1937 | Ga0500641_0011045 | |||
| 1938 | Ga0500562_000013 | |||
| 1939 | Ga0500592_005291 | |||
| 1940 | Ga0500594_0008302 | |||
| 1941 | Ga0500652_025391 | |||
| 1942 | Ga0500658_0000015 | |||
| 1943 | Ga0500559_0027776 | |||
| 1944 | Ga0500568_0004540 | |||
| 1945 | Ga0500590_118540 | |||
| 1946 | Ga0500616_0024488 | |||
| 1947 | Ga0500616_0032999 | |||
| 1948 | Ga0500622_0000242 | |||
| 1949 | Ga0500636_0023141 | |||
| 1950 | Ga0500636_0118204 | |||
| 1951 | Ga0500637_0055291 | |||
| 1952 | Ga0500584_040685 | |||
| 1953 | Ga0500611_000060 | |||
| 1954 | Ga0501082_0237970 | |||
| 1955 | 2511232900 | |||
| 1956 | 2513234718 | |||
| 1957 | 2520880479 | |||
| 1958 | 2524004949 | |||
| 1959 | 2585143701 | |||
| 1960 | 2585157624 | |||
| 1961 | 2585162022 | |||
| 1962 | 2585425748 | |||
| 1963 | 2587679352 | |||
| 1964 | 2587747215 | |||
| 1965 | 2587753500 | |||
| 1966 | 2587867182 | |||
| 1967 | 2587945151 | |||
| 1968 | 2588210467 | |||
| 1969 | 2588214296 | |||
| 1970 | 2588217060 | |||
| 1971 | 2588223261 | |||
| 1972 | 2588232766 | |||
| 1973 | 2588443851 | |||
| 1974 | 2590601728 | |||
| 1975 | 2590613564 | |||
| 1976 | 2644012120 | |||
| 1977 | 2644371299 | |||
| 1978 | 2644641396 | |||
| 1979 | 2644682486 | |||
| 1980 | 2729200243 | |||
| 1981 | 2738699916 | |||
| 1982 | 2738733901 | |||
| 1983 | 2738766142 | |||
| 1984 | 2739215482 | |||
| 1985 | 2739253665 | |||
| 1986 | 2740000342 | |||
| 1987 | 2740005158 | |||
| 1988 | 2740059231 | |||
| 1989 | 2753673292 | |||
| 1990 | 2765574396 | |||
| 1991 | 2772607470 | |||
| 1992 | 2775671793 | |||
| 1993 | 2802651258 | |||
| 1994 | 2816874620 | |||
| 1995 | 2817414143 | |||
| 1996 | 2819575417 | |||
| 1997 | 2819585659 | |||
| 1998 | 2821137961 | |||
| 1999 | 2842085172 | |||
| 2000 | 2857617782 | |||
| 2001 | 2857621402 | |||
| 2002 | 2871722145 | |||
| 2003 | 2881250401 | |||
| 2004 | 2881361446 | |||
| 2005 | 2889295088 | |||
| 2006 | 2903895221 | |||
| 2007 | 2904420382 | |||
| 2008 | 2904468753 | |||
| 2009 | 2904557772 | |||
| 2010 | 2906001963 | |||
| 2011 | 2914762945 | |||
| 2012 | 2919098768 | |||
| 2013 | 2919192414 | |||
| 2014 | 2919402226 | |||
| 2015 | 2919512999 | |||
| 2016 | 2919684179 | |||
| 2017 | 2929151297 | |||
| 2018 | 2929159616 | |||
| 2019 | 2929240017 | |||
| 2020 | 2929921725 | |||
| 2021 | 2929927857 | |||
| 2022 | 2945925871 | |||
| 2023 | 2946022859 | |||
| 2024 | 2958459568 | |||
| 2025 | 2958515494 | |||
| 2026 | 2965322537 | |||
| 2027 | 2977244793 | |||
| 2028 | 2977272672 | |||
| 2029 | 2984573301 | |||
| 2030 | 2984606736 | |||
| 2031 | 2993376218 | |||
| 2032 | 2993483032 | |||
| 2033 | 8003154272 | |||
| 2034 | 8036737282 | |||
| 2035 | 8054310857 | |||
| 2036 | 8055420109 | |||
| 2037 | 8055596998 | |||
| 2038 | 8056440908 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vhn-assembly1.cif.gz_A | crystal structure of a putative flavin oxidoreductase with flavin | 0.9469 | 13 | 323 |
| 1vhn-assembly1.cif.gz_A | crystal structure of a putative flavin oxidoreductase with flavin | 0.9349 | 13 | 323 |
| 6ei9-assembly2.cif.gz_B | crystal structure of e. coli trna-dihydrouridine synthase b (dusb) | 0.9296 | 2 | 322 |
| 6ei9-assembly2.cif.gz_B | crystal structure of e. coli trna-dihydrouridine synthase b (dusb) | 0.9063 | 2 | 322 |
| 3b0p-assembly1.cif.gz_A | trna-dihydrouridine synthase from thermus thermophilus | 0.8515 | 10 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ABT5_6_247_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9672 | 14 | 251 | 3.20.20.70 |
| af_Q9VIS4_253_495_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9526 | 13 | 243 | 3.20.20.70 |
| 1vhnA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9515 | 13 | 253 | 3.20.20.70 |
| af_Q54ES7_56_285_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9466 | 15 | 239 | 3.20.20.70 |
| 1vhnA01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9435 | 13 | 253 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3W6G6-F1-model_v4 | tRNA-dihydrouridine synthase family protein | 0.9919 | 1 | 224 |
GO:0003723
GO:0017150 GO:0050660 |
| AF-A0A090WNH1-F1-model_v4 | tRNA-dihydrouridine synthase (EC 1.3.1.-) | 0.9887 | 1 | 279 |
GO:0003723
GO:0017150 GO:0050660 |
| AF-A0A3C0ZCP8-F1-model_v4 | tRNA dihydrouridine synthase DusB | 0.9877 | 2 | 146 |
GO:0003723
GO:0017150 GO:0050660 |
| AF-A0A4Q3W6G6-F1-model_v4 | tRNA-dihydrouridine synthase family protein | 0.9875 | 1 | 224 |
GO:0003723
GO:0017150 GO:0050660 |
| AF-A0A3D6B101-F1-model_v4 | tRNA dihydrouridine synthase DusB | 0.9871 | 3 | 235 |
GO:0003723
GO:0017150 GO:0050660 |