F488348
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1019 | 297 | 2038 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0480649|Ga0373937_0480649_173_1120 |
| Length | 315 |
| Sequence | LACWHPDISGLYNEYGWHSCSVPGCLADQFNNPCIGWEFINFKDQTISEQMKPITGIVVVICLFISFPLKAGDEFCGLPNHAFQAGETITYRVYYTLAGVYIAAGEATFTCNLEKLNDKPVYHVTGEGKTFSFYDNFFRVRDKYESFIDTSNLQPLKFLRNVNEGNFKKYENVSFNKIAHTAITNSGVFKTPDCIQDVLSSMYYARNIDFDKMKPDDKIPFSMFLDNQVYNLYIRYLGKETIKTKYGKFRAIKFKPLLIKGTIFEGGEKMTVWVSDDANHIPVRVESPISVGSVKVDMMEFKNSRTPLSSLISRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 176 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 179 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 181 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 186 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 192 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 193 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 194 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 195 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 196 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 197 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 203 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 204 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 205 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 206 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 207 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 208 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 212 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 245 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 258 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 259 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 261 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 262 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 269 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 270 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 277 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 278 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 279 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 280 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 281 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 282 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 283 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 284 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 285 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 287 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 288 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 289 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 290 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 291 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 292 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 296 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 297 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.8 |
| Metatranscriptomes | 0 |
| Isolates | 0.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.65 |
| Nodule | 0 |
| Rhizoplane | 0.79 |
| Rhizosphere | 93.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373937_0480649 | 3300036401 | Bacteria | 1180 |
| 2 | MBSR1b_contig_5340824 | 2162886012 | Unclassified | 1975 |
| 3 | ARcpr5yngRDRAFT_c002723 | 3300000043 | Bacteria | 1810 |
| 4 | rootH1_10053528 | 3300003316 | Bacteria | 4821 |
| 5 | rootH1_10115453 | 3300003316 | Bacteria | 2462 |
| 6 | rootH2_10001899 | 3300003320 | Bacteria | 96630 |
| 7 | rootH2_10124577 | 3300003320 | Bacteria | 4111 |
| 8 | rootH2_10141161 | 3300003320 | Unclassified | 1301 |
| 9 | rootH2_10302688 | 3300003320 | Bacteria | 1437 |
| 10 | rootL2_10075112 | 3300003322 | Bacteria | 2619 |
| 11 | rootL2_10151353 | 3300003322 | Unclassified | 1095 |
| 12 | rootH1_10116033 | 3300003323 | Bacteria | 3355 |
| 13 | rootH1_10180417 | 3300003323 | Bacteria | 3445 |
| 14 | Ga0065704_10137972 | 3300005289 | Bacteria | 1549 |
| 15 | Ga0065712_10004405 | 3300005290 | Bacteria | 3246 |
| 16 | Ga0065712_10088217 | 3300005290 | Bacteria | 2532 |
| 17 | Ga0065712_10088553 | 3300005290 | Bacteria | 2502 |
| 18 | Ga0065707_10095261 | 3300005295 | Bacteria | 3399 |
| 19 | Ga0065707_10187191 | 3300005295 | Unclassified | 1382 |
| 20 | Ga0070658_10004172 | 3300005327 | Bacteria | 11824 |
| 21 | Ga0070658_10012200 | 3300005327 | Bacteria | 6897 |
| 22 | Ga0070658_10037858 | 3300005327 | Bacteria | 3889 |
| 23 | Ga0070658_10118629 | 3300005327 | Bacteria | 2197 |
| 24 | Ga0070658_10318728 | 3300005327 | Bacteria | 1327 |
| 25 | Ga0070676_10002107 | 3300005328 | Bacteria | 10130 |
| 26 | Ga0070676_10002849 | 3300005328 | Bacteria | 8930 |
| 27 | Ga0070676_10004254 | 3300005328 | Bacteria | 7526 |
| 28 | Ga0070676_10056115 | 3300005328 | Unclassified | 2326 |
| 29 | Ga0070676_10229011 | 3300005328 | Bacteria | 1231 |
| 30 | Ga0070676_10293130 | 3300005328 | Unclassified | 1100 |
| 31 | Ga0070683_100000733 | 3300005329 | Bacteria | 23985 |
| 32 | Ga0070683_100006637 | 3300005329 | Bacteria | 9717 |
| 33 | Ga0070683_100186516 | 3300005329 | Bacteria | 1969 |
| 34 | Ga0070683_100199103 | 3300005329 | Bacteria | 1902 |
| 35 | Ga0070683_100337580 | 3300005329 | Bacteria | 1435 |
| 36 | Ga0070690_100001725 | 3300005330 | Bacteria | 11547 |
| 37 | Ga0070690_100220976 | 3300005330 | Bacteria | 1327 |
| 38 | Ga0070670_100085595 | 3300005331 | Bacteria | 2708 |
| 39 | Ga0070670_100095612 | 3300005331 | Bacteria | 2555 |
| 40 | Ga0070670_100140002 | 3300005331 | Bacteria | 2092 |
| 41 | Ga0070670_100631707 | 3300005331 | Bacteria | 960 |
| 42 | Ga0070677_10005153 | 3300005333 | Bacteria | 4295 |
| 43 | Ga0070677_10123988 | 3300005333 | Bacteria | 1170 |
| 44 | Ga0068869_100003072 | 3300005334 | Bacteria | 10157 |
| 45 | Ga0068869_100017669 | 3300005334 | Bacteria | 4840 |
| 46 | Ga0068869_100019157 | 3300005334 | Bacteria | 4671 |
| 47 | Ga0068869_100019973 | 3300005334 | Bacteria | 4588 |
| 48 | Ga0068869_100029763 | 3300005334 | Bacteria | 3829 |
| 49 | Ga0068869_100050549 | 3300005334 | Bacteria | 3013 |
| 50 | Ga0068869_100064003 | 3300005334 | Bacteria | 2704 |
| 51 | Ga0068869_100082904 | 3300005334 | Bacteria | 2397 |
| 52 | Ga0070666_10000019 | 3300005335 | Bacteria | 185877 |
| 53 | Ga0070666_10000431 | 3300005335 | Bacteria | 25787 |
| 54 | Ga0070666_10001320 | 3300005335 | Bacteria | 15031 |
| 55 | Ga0070666_10029058 | 3300005335 | Bacteria | 3632 |
| 56 | Ga0070666_10199921 | 3300005335 | Bacteria | 1406 |
| 57 | Ga0070666_10374338 | 3300005335 | Bacteria | 1022 |
| 58 | Ga0070680_100000107 | 3300005336 | Bacteria | 48364 |
| 59 | Ga0070680_100001923 | 3300005336 | Bacteria | 15262 |
| 60 | Ga0070680_100014332 | 3300005336 | Bacteria | 6192 |
| 61 | Ga0070680_100015370 | 3300005336 | Bacteria | 5999 |
| 62 | Ga0070680_100626699 | 3300005336 | Bacteria | 924 |
| 63 | Ga0070682_100001037 | 3300005337 | Bacteria | 16063 |
| 64 | Ga0070682_100006418 | 3300005337 | Bacteria | 6607 |
| 65 | Ga0068868_100006700 | 3300005338 | Bacteria | 8173 |
| 66 | Ga0068868_100017482 | 3300005338 | Bacteria | 5345 |
| 67 | Ga0068868_100018963 | 3300005338 | Bacteria | 5149 |
| 68 | Ga0068868_100019164 | 3300005338 | Bacteria | 5126 |
| 69 | Ga0068868_100020261 | 3300005338 | Bacteria | 4992 |
| 70 | Ga0068868_100051395 | 3300005338 | Bacteria | 3242 |
| 71 | Ga0068868_100064467 | 3300005338 | Bacteria | 2908 |
| 72 | Ga0068868_100142364 | 3300005338 | Bacteria | 1970 |
| 73 | Ga0068868_100241367 | 3300005338 | Bacteria | 1518 |
| 74 | Ga0070660_100035750 | 3300005339 | Bacteria | 3761 |
| 75 | Ga0070660_100116538 | 3300005339 | Bacteria | 2130 |
| 76 | Ga0070660_100129667 | 3300005339 | Bacteria | 2017 |
| 77 | Ga0070689_100030806 | 3300005340 | Bacteria | 4073 |
| 78 | Ga0070689_100171716 | 3300005340 | Bacteria | 1757 |
| 79 | Ga0070689_100215909 | 3300005340 | Bacteria | 1572 |
| 80 | Ga0070691_10009545 | 3300005341 | Unclassified | 4430 |
| 81 | Ga0070687_100002867 | 3300005343 | Bacteria | 6588 |
| 82 | Ga0070687_100114265 | 3300005343 | Unclassified | 1533 |
| 83 | Ga0070661_100002552 | 3300005344 | Bacteria | 12475 |
| 84 | Ga0070661_100005772 | 3300005344 | Bacteria | 8515 |
| 85 | Ga0070668_100000016 | 3300005347 | Bacteria | 104092 |
| 86 | Ga0070668_100004457 | 3300005347 | Bacteria | 10392 |
| 87 | Ga0070668_100008315 | 3300005347 | Bacteria | 7703 |
| 88 | Ga0070668_100050861 | 3300005347 | Bacteria | 3191 |
| 89 | Ga0070668_100091160 | 3300005347 | Bacteria | 2402 |
| 90 | Ga0070669_100003666 | 3300005353 | Bacteria | 11080 |
| 91 | Ga0070669_100026138 | 3300005353 | Bacteria | 4199 |
| 92 | Ga0070669_100154125 | 3300005353 | Bacteria | 1780 |
| 93 | Ga0070675_100011140 | 3300005354 | Bacteria | 7035 |
| 94 | Ga0070675_100119246 | 3300005354 | Bacteria | 2241 |
| 95 | Ga0070675_100551852 | 3300005354 | Unclassified | 1042 |
| 96 | Ga0070671_100001080 | 3300005355 | Bacteria | 20172 |
| 97 | Ga0070671_100030290 | 3300005355 | Bacteria | 4465 |
| 98 | Ga0070671_100031103 | 3300005355 | Bacteria | 4408 |
| 99 | Ga0070671_100054175 | 3300005355 | Bacteria | 3334 |
| 100 | Ga0070671_100088138 | 3300005355 | Bacteria | 2597 |
| 101 | Ga0070671_100100992 | 3300005355 | Bacteria | 2420 |
| 102 | Ga0070671_100135944 | 3300005355 | Bacteria | 2072 |
| 103 | Ga0070671_100377235 | 3300005355 | Bacteria | 1212 |
| 104 | Ga0070674_100052045 | 3300005356 | Unclassified | 2824 |
| 105 | Ga0070674_100086181 | 3300005356 | Bacteria | 2255 |
| 106 | Ga0070673_100000074 | 3300005364 | Bacteria | 42660 |
| 107 | Ga0070673_100001615 | 3300005364 | Bacteria | 13326 |
| 108 | Ga0070673_100009502 | 3300005364 | Bacteria | 6530 |
| 109 | Ga0070673_100013794 | 3300005364 | Bacteria | 5605 |
| 110 | Ga0070673_100023455 | 3300005364 | Bacteria | 4508 |
| 111 | Ga0070673_100056459 | 3300005364 | Bacteria | 3098 |
| 112 | Ga0070673_100101432 | 3300005364 | Bacteria | 2371 |
| 113 | Ga0070673_100111062 | 3300005364 | Bacteria | 2274 |
| 114 | Ga0070673_100164353 | 3300005364 | Bacteria | 1890 |
| 115 | Ga0070673_100230785 | 3300005364 | Bacteria | 1605 |
| 116 | Ga0070688_100020563 | 3300005365 | Bacteria | 3839 |
| 117 | Ga0070688_100022677 | 3300005365 | Bacteria | 3684 |
| 118 | Ga0070688_100026517 | 3300005365 | Bacteria | 3443 |
| 119 | Ga0070688_100029179 | 3300005365 | Bacteria | 3301 |
| 120 | Ga0070688_100163871 | 3300005365 | Bacteria | 1529 |
| 121 | Ga0070688_100443111 | 3300005365 | Unclassified | 969 |
| 122 | Ga0070659_100016533 | 3300005366 | Bacteria | 5539 |
| 123 | Ga0070659_100040983 | 3300005366 | Bacteria | 3618 |
| 124 | Ga0070659_100186913 | 3300005366 | Unclassified | 1702 |
| 125 | Ga0070659_100639398 | 3300005366 | Bacteria | 917 |
| 126 | Ga0070667_100000031 | 3300005367 | Bacteria | 177447 |
| 127 | Ga0070667_100011157 | 3300005367 | Bacteria | 7432 |
| 128 | Ga0070667_100019874 | 3300005367 | Bacteria | 5573 |
| 129 | Ga0070667_100037664 | 3300005367 | Bacteria | 4054 |
| 130 | Ga0070667_100038956 | 3300005367 | Bacteria | 3985 |
| 131 | Ga0070667_100051045 | 3300005367 | Bacteria | 3486 |
| 132 | Ga0070667_100133115 | 3300005367 | Bacteria | 2172 |
| 133 | Ga0070667_100142987 | 3300005367 | Bacteria | 2096 |
| 134 | Ga0070667_100173510 | 3300005367 | Unclassified | 1904 |
| 135 | Ga0070667_100308232 | 3300005367 | Bacteria | 1427 |
| 136 | Ga0070667_100388944 | 3300005367 | Bacteria | 1268 |
| 137 | Ga0070701_10074045 | 3300005438 | Bacteria | 1828 |
| 138 | Ga0070700_100039021 | 3300005441 | Bacteria | 2898 |
| 139 | Ga0070700_100121349 | 3300005441 | Unclassified | 1752 |
| 140 | Ga0070663_100503931 | 3300005455 | Bacteria | 1006 |
| 141 | Ga0070678_100027233 | 3300005456 | Bacteria | 3879 |
| 142 | Ga0070678_100029345 | 3300005456 | Bacteria | 3765 |
| 143 | Ga0070662_100005977 | 3300005457 | Bacteria | 7807 |
| 144 | Ga0070662_100009556 | 3300005457 | Bacteria | 6346 |
| 145 | Ga0070662_100016955 | 3300005457 | Unclassified | 4898 |
| 146 | Ga0070662_100032379 | 3300005457 | Bacteria | 3674 |
| 147 | Ga0070662_100108208 | 3300005457 | Bacteria | 2114 |
| 148 | Ga0070662_100626545 | 3300005457 | Bacteria | 906 |
| 149 | Ga0070681_10004510 | 3300005458 | Bacteria | 13284 |
| 150 | Ga0070681_10129950 | 3300005458 | Bacteria | 2451 |
| 151 | Ga0070681_10270212 | 3300005458 | Bacteria | 1612 |
| 152 | Ga0070681_10403441 | 3300005458 | Bacteria | 1278 |
| 153 | Ga0068867_100002817 | 3300005459 | Bacteria | 12223 |
| 154 | Ga0068867_100016371 | 3300005459 | Bacteria | 5263 |
| 155 | Ga0068867_100022655 | 3300005459 | Bacteria | 4492 |
| 156 | Ga0068867_100049634 | 3300005459 | Bacteria | 3090 |
| 157 | Ga0068867_100055889 | 3300005459 | Bacteria | 2919 |
| 158 | Ga0068867_100076256 | 3300005459 | Bacteria | 2517 |
| 159 | Ga0068867_100171004 | 3300005459 | Bacteria | 1721 |
| 160 | Ga0068867_100259404 | 3300005459 | Bacteria | 1416 |
| 161 | Ga0068867_100385585 | 3300005459 | Bacteria | 1178 |
| 162 | Ga0070685_10009380 | 3300005466 | Bacteria | 5055 |
| 163 | Ga0070685_10043514 | 3300005466 | Bacteria | 2568 |
| 164 | Ga0070685_10091388 | 3300005466 | Bacteria | 1843 |
| 165 | Ga0070698_100002896 | 3300005471 | Bacteria | 18892 |
| 166 | Ga0070698_100022651 | 3300005471 | Bacteria | 6569 |
| 167 | Ga0070698_100487323 | 3300005471 | Bacteria | 1170 |
| 168 | Ga0070698_100510230 | 3300005471 | Bacteria | 1140 |
| 169 | Ga0070699_100573555 | 3300005518 | Bacteria | 1028 |
| 170 | Ga0070679_100000649 | 3300005530 | Bacteria | 29629 |
| 171 | Ga0070679_100001472 | 3300005530 | Bacteria | 20869 |
| 172 | Ga0070679_100005664 | 3300005530 | Bacteria | 11578 |
| 173 | Ga0070679_100025034 | 3300005530 | Bacteria | 5852 |
| 174 | Ga0070679_100033752 | 3300005530 | Bacteria | 5067 |
| 175 | Ga0070679_100052145 | 3300005530 | Bacteria | 4075 |
| 176 | Ga0070679_100352773 | 3300005530 | Bacteria | 1418 |
| 177 | Ga0070684_100000042 | 3300005535 | Bacteria | 89896 |
| 178 | Ga0070684_100013993 | 3300005535 | Bacteria | 6486 |
| 179 | Ga0070684_100106312 | 3300005535 | Bacteria | 2512 |
| 180 | Ga0070684_100114673 | 3300005535 | Bacteria | 2419 |
| 181 | Ga0068853_100000970 | 3300005539 | Bacteria | 20177 |
| 182 | Ga0068853_100002162 | 3300005539 | Bacteria | 14638 |
| 183 | Ga0068853_100006594 | 3300005539 | Bacteria | 9245 |
| 184 | Ga0068853_100011359 | 3300005539 | Bacteria | 7233 |
| 185 | Ga0068853_100033559 | 3300005539 | Unclassified | 4356 |
| 186 | Ga0068853_100062879 | 3300005539 | Bacteria | 3213 |
| 187 | Ga0068853_100715431 | 3300005539 | Bacteria | 956 |
| 188 | Ga0070672_100000002 | 3300005543 | Bacteria | 159809 |
| 189 | Ga0070672_100034829 | 3300005543 | Bacteria | 3823 |
| 190 | Ga0070672_100056554 | 3300005543 | Bacteria | 3077 |
| 191 | Ga0070672_100357312 | 3300005543 | Bacteria | 1246 |
| 192 | Ga0070686_100185006 | 3300005544 | Bacteria | 1483 |
| 193 | Ga0070686_100254180 | 3300005544 | Bacteria | 1285 |
| 194 | Ga0070693_100005131 | 3300005547 | Bacteria | 6260 |
| 195 | Ga0070693_100071355 | 3300005547 | Bacteria | 2046 |
| 196 | Ga0070693_100103876 | 3300005547 | Bacteria | 1736 |
| 197 | Ga0070665_100000018 | 3300005548 | Bacteria | 434118 |
| 198 | Ga0070665_100000222 | 3300005548 | Bacteria | 94961 |
| 199 | Ga0070665_100099138 | 3300005548 | Bacteria | 2918 |
| 200 | Ga0070665_100175546 | 3300005548 | Bacteria | 2143 |
| 201 | Ga0070665_100491477 | 3300005548 | Unclassified | 1238 |
| 202 | Ga0070704_100186800 | 3300005549 | Bacteria | 1662 |
| 203 | Ga0068855_100001631 | 3300005563 | Bacteria | 28149 |
| 204 | Ga0068855_100002114 | 3300005563 | Bacteria | 24577 |
| 205 | Ga0068855_100004970 | 3300005563 | Bacteria | 16223 |
| 206 | Ga0068855_100010722 | 3300005563 | Bacteria | 11061 |
| 207 | Ga0068855_100015014 | 3300005563 | Bacteria | 9328 |
| 208 | Ga0068855_100032740 | 3300005563 | Bacteria | 6207 |
| 209 | Ga0068855_100043160 | 3300005563 | Bacteria | 5343 |
| 210 | Ga0068855_100086863 | 3300005563 | Bacteria | 3616 |
| 211 | Ga0068855_100096440 | 3300005563 | Bacteria | 3407 |
| 212 | Ga0068855_100104181 | 3300005563 | Unclassified | 3264 |
| 213 | Ga0068855_100928517 | 3300005563 | Bacteria | 918 |
| 214 | Ga0070664_100003309 | 3300005564 | Bacteria | 13021 |
| 215 | Ga0070664_100010019 | 3300005564 | Bacteria | 7680 |
| 216 | Ga0070664_100071498 | 3300005564 | Bacteria | 2973 |
| 217 | Ga0070664_100077722 | 3300005564 | Bacteria | 2854 |
| 218 | Ga0070664_100122803 | 3300005564 | Bacteria | 2275 |
| 219 | Ga0070664_100124396 | 3300005564 | Bacteria | 2261 |
| 220 | Ga0070664_100357277 | 3300005564 | Bacteria | 1330 |
| 221 | Ga0070664_100428081 | 3300005564 | Bacteria | 1213 |
| 222 | Ga0070664_100476909 | 3300005564 | Bacteria | 1148 |
| 223 | Ga0068857_100002170 | 3300005577 | Bacteria | 15950 |
| 224 | Ga0068857_100003554 | 3300005577 | Bacteria | 13041 |
| 225 | Ga0068857_100018861 | 3300005577 | Bacteria | 6052 |
| 226 | Ga0068857_100033149 | 3300005577 | Bacteria | 4567 |
| 227 | Ga0068857_100043159 | 3300005577 | Bacteria | 4000 |
| 228 | Ga0068857_100172730 | 3300005577 | Bacteria | 1965 |
| 229 | Ga0068857_100247378 | 3300005577 | Bacteria | 1634 |
| 230 | Ga0068857_100367034 | 3300005577 | Bacteria | 1335 |
| 231 | Ga0068857_100476081 | 3300005577 | Bacteria | 1170 |
| 232 | Ga0068854_100016365 | 3300005578 | Bacteria | 4943 |
| 233 | Ga0068854_100041815 | 3300005578 | Bacteria | 3240 |
| 234 | Ga0068854_100052918 | 3300005578 | Unclassified | 2913 |
| 235 | Ga0068854_100153882 | 3300005578 | Bacteria | 1775 |
| 236 | Ga0068856_100063602 | 3300005614 | Bacteria | 3646 |
| 237 | Ga0068856_100105150 | 3300005614 | Bacteria | 2817 |
| 238 | Ga0070702_100007334 | 3300005615 | Bacteria | 5274 |
| 239 | Ga0068852_100000454 | 3300005616 | Bacteria | 27039 |
| 240 | Ga0068852_100000897 | 3300005616 | Bacteria | 19694 |
| 241 | Ga0068852_100005402 | 3300005616 | Bacteria | 9140 |
| 242 | Ga0068852_100022105 | 3300005616 | Bacteria | 5094 |
| 243 | Ga0068852_100054691 | 3300005616 | Unclassified | 3442 |
| 244 | Ga0068852_100059036 | 3300005616 | Bacteria | 3326 |
| 245 | Ga0068852_100084720 | 3300005616 | Unclassified | 2822 |
| 246 | Ga0068852_100295253 | 3300005616 | Bacteria | 1567 |
| 247 | Ga0068859_100000013 | 3300005617 | Bacteria | 291126 |
| 248 | Ga0068859_100012739 | 3300005617 | Bacteria | 8451 |
| 249 | Ga0068859_100048089 | 3300005617 | Bacteria | 4285 |
| 250 | Ga0068859_100124653 | 3300005617 | Bacteria | 2644 |
| 251 | Ga0068859_100125542 | 3300005617 | Bacteria | 2635 |
| 252 | Ga0068859_100170477 | 3300005617 | Bacteria | 2257 |
| 253 | Ga0068859_100218710 | 3300005617 | Bacteria | 1992 |
| 254 | Ga0068864_100002308 | 3300005618 | Bacteria | 15782 |
| 255 | Ga0068864_100006247 | 3300005618 | Bacteria | 9773 |
| 256 | Ga0068864_100019202 | 3300005618 | Bacteria | 5712 |
| 257 | Ga0068864_100022125 | 3300005618 | Bacteria | 5330 |
| 258 | Ga0068864_100069185 | 3300005618 | Unclassified | 3069 |
| 259 | Ga0068864_100102858 | 3300005618 | Bacteria | 2536 |
| 260 | Ga0068864_100211011 | 3300005618 | Bacteria | 1788 |
| 261 | Ga0068864_100357185 | 3300005618 | Bacteria | 1380 |
| 262 | Ga0068866_10063215 | 3300005718 | Unclassified | 1929 |
| 263 | Ga0068866_10070892 | 3300005718 | Bacteria | 1841 |
| 264 | Ga0068861_100000263 | 3300005719 | Bacteria | 29301 |
| 265 | Ga0068861_100007396 | 3300005719 | Bacteria | 7525 |
| 266 | Ga0068861_100022693 | 3300005719 | Bacteria | 4525 |
| 267 | Ga0068861_100135312 | 3300005719 | Bacteria | 2005 |
| 268 | Ga0068851_10000266 | 3300005834 | Bacteria | 24602 |
| 269 | Ga0068851_10073359 | 3300005834 | Bacteria | 1775 |
| 270 | Ga0068851_10235095 | 3300005834 | Bacteria | 1034 |
| 271 | Ga0068870_10003801 | 3300005840 | Bacteria | 6426 |
| 272 | Ga0068863_100006676 | 3300005841 | Bacteria | 11327 |
| 273 | Ga0068863_100021150 | 3300005841 | Bacteria | 6213 |
| 274 | Ga0068863_100043437 | 3300005841 | Bacteria | 4267 |
| 275 | Ga0068863_100127555 | 3300005841 | Bacteria | 2428 |
| 276 | Ga0068858_100001512 | 3300005842 | Bacteria | 23886 |
| 277 | Ga0068858_100032009 | 3300005842 | Bacteria | 4885 |
| 278 | Ga0068858_100033804 | 3300005842 | Bacteria | 4742 |
| 279 | Ga0068858_100055209 | 3300005842 | Bacteria | 3672 |
| 280 | Ga0068858_100139932 | 3300005842 | Bacteria | 2272 |
| 281 | Ga0068860_100000040 | 3300005843 | Bacteria | 231652 |
| 282 | Ga0068860_100003779 | 3300005843 | Bacteria | 15578 |
| 283 | Ga0068860_100006979 | 3300005843 | Bacteria | 11315 |
| 284 | Ga0068860_100008512 | 3300005843 | Bacteria | 10220 |
| 285 | Ga0068860_100014542 | 3300005843 | Bacteria | 7701 |
| 286 | Ga0068860_100248586 | 3300005843 | Unclassified | 1731 |
| 287 | Ga0068860_100348428 | 3300005843 | Unclassified | 1457 |
| 288 | Ga0068860_100351029 | 3300005843 | Bacteria | 1452 |
| 289 | Ga0068862_100001322 | 3300005844 | Bacteria | 23026 |
| 290 | Ga0068862_100051379 | 3300005844 | Bacteria | 3525 |
| 291 | Ga0068862_100067053 | 3300005844 | Bacteria | 3093 |
| 292 | Ga0068862_100097507 | 3300005844 | Bacteria | 2567 |
| 293 | Ga0081539_10001855 | 3300005985 | Bacteria | 33303 |
| 294 | Ga0070715_10020003 | 3300006163 | Bacteria | 2575 |
| 295 | Ga0075366_10021978 | 3300006195 | Bacteria | 3709 |
| 296 | Ga0097621_100000129 | 3300006237 | Bacteria | 44253 |
| 297 | Ga0097621_100000265 | 3300006237 | Bacteria | 35445 |
| 298 | Ga0097621_100000691 | 3300006237 | Bacteria | 23650 |
| 299 | Ga0097621_100038342 | 3300006237 | Unclassified | 3845 |
| 300 | Ga0097621_100064650 | 3300006237 | Bacteria | 3009 |
| 301 | Ga0097621_100080649 | 3300006237 | Bacteria | 2707 |
| 302 | Ga0097621_100222161 | 3300006237 | Bacteria | 1646 |
| 303 | Ga0068871_100000075 | 3300006358 | Bacteria | 55346 |
| 304 | Ga0068871_100002241 | 3300006358 | Bacteria | 13141 |
| 305 | Ga0068871_100038242 | 3300006358 | Bacteria | 3830 |
| 306 | Ga0068871_100076090 | 3300006358 | Bacteria | 2772 |
| 307 | Ga0068871_100076857 | 3300006358 | Bacteria | 2758 |
| 308 | Ga0068871_100087143 | 3300006358 | Bacteria | 2595 |
| 309 | Ga0068871_100099179 | 3300006358 | Bacteria | 2438 |
| 310 | Ga0068871_100121128 | 3300006358 | Bacteria | 2210 |
| 311 | Ga0068871_100287158 | 3300006358 | Bacteria | 1441 |
| 312 | Ga0068871_100851539 | 3300006358 | Bacteria | 843 |
| 313 | Ga0075428_100018150 | 3300006844 | Bacteria | 7773 |
| 314 | Ga0075428_100081003 | 3300006844 | Bacteria | 3544 |
| 315 | Ga0075428_100148594 | 3300006844 | Bacteria | 2546 |
| 316 | Ga0075431_100017541 | 3300006847 | Bacteria | 7278 |
| 317 | Ga0075431_100122089 | 3300006847 | Unclassified | 2688 |
| 318 | Ga0075433_10171972 | 3300006852 | Unclassified | 1928 |
| 319 | Ga0075429_100002510 | 3300006880 | Bacteria | 15442 |
| 320 | Ga0075429_100006828 | 3300006880 | Bacteria | 9905 |
| 321 | Ga0075429_100240176 | 3300006880 | Bacteria | 1587 |
| 322 | Ga0075429_100428022 | 3300006880 | Unclassified | 1159 |
| 323 | Ga0068865_100001410 | 3300006881 | Bacteria | 14005 |
| 324 | Ga0068865_100027382 | 3300006881 | Bacteria | 3765 |
| 325 | Ga0068865_100052708 | 3300006881 | Bacteria | 2821 |
| 326 | Ga0068865_100097945 | 3300006881 | Bacteria | 2142 |
| 327 | Ga0068865_100131817 | 3300006881 | Bacteria | 1873 |
| 328 | Ga0068865_100150684 | 3300006881 | Bacteria | 1764 |
| 329 | Ga0097620_100000013 | 3300006931 | Bacteria | 291126 |
| 330 | Ga0097620_100012739 | 3300006931 | Bacteria | 8451 |
| 331 | Ga0097620_100048089 | 3300006931 | Bacteria | 4285 |
| 332 | Ga0097620_100124658 | 3300006931 | Bacteria | 2644 |
| 333 | Ga0097620_100125542 | 3300006931 | Bacteria | 2635 |
| 334 | Ga0097620_100170467 | 3300006931 | Bacteria | 2257 |
| 335 | Ga0097620_100218715 | 3300006931 | Bacteria | 1992 |
| 336 | Ga0105251_10122727 | 3300009011 | Unclassified | 1179 |
| 337 | Ga0105240_10000764 | 3300009093 | Bacteria | 58488 |
| 338 | Ga0105240_10002342 | 3300009093 | Bacteria | 30599 |
| 339 | Ga0105240_10002370 | 3300009093 | Bacteria | 30393 |
| 340 | Ga0105240_10002578 | 3300009093 | Bacteria | 29041 |
| 341 | Ga0105240_10010140 | 3300009093 | Bacteria | 13265 |
| 342 | Ga0105240_10055426 | 3300009093 | Bacteria | 4963 |
| 343 | Ga0105240_10056515 | 3300009093 | Bacteria | 4910 |
| 344 | Ga0105240_10067888 | 3300009093 | Bacteria | 4418 |
| 345 | Ga0105240_10488698 | 3300009093 | Bacteria | 1371 |
| 346 | Ga0105240_10489312 | 3300009093 | Bacteria | 1370 |
| 347 | Ga0105240_10737823 | 3300009093 | Bacteria | 1072 |
| 348 | Ga0105240_10825637 | 3300009093 | Unclassified | 1002 |
| 349 | Ga0111539_10004492 | 3300009094 | Bacteria | 18241 |
| 350 | Ga0111539_10035513 | 3300009094 | Bacteria | 6034 |
| 351 | Ga0111539_10187310 | 3300009094 | Bacteria | 2416 |
| 352 | Ga0105245_10081287 | 3300009098 | Bacteria | 2962 |
| 353 | Ga0105245_10167360 | 3300009098 | Bacteria | 2091 |
| 354 | Ga0105247_10002182 | 3300009101 | Bacteria | 13491 |
| 355 | Ga0105247_10017033 | 3300009101 | Bacteria | 4361 |
| 356 | Ga0105247_10066726 | 3300009101 | Bacteria | 2241 |
| 357 | Ga0114129_10040732 | 3300009147 | Bacteria | 6548 |
| 358 | Ga0114129_10448929 | 3300009147 | Bacteria | 1691 |
| 359 | Ga0105243_10618554 | 3300009148 | Bacteria | 1045 |
| 360 | Ga0105241_10000332 | 3300009174 | Bacteria | 35868 |
| 361 | Ga0105241_10000732 | 3300009174 | Bacteria | 24909 |
| 362 | Ga0105241_10004448 | 3300009174 | Bacteria | 10363 |
| 363 | Ga0105241_10007660 | 3300009174 | Bacteria | 7940 |
| 364 | Ga0105241_10019442 | 3300009174 | Bacteria | 5008 |
| 365 | Ga0105241_10036623 | 3300009174 | Bacteria | 3693 |
| 366 | Ga0105241_10041888 | 3300009174 | Bacteria | 3461 |
| 367 | Ga0105241_10264052 | 3300009174 | Bacteria | 1464 |
| 368 | Ga0105241_10575932 | 3300009174 | Bacteria | 1014 |
| 369 | Ga0105242_10042295 | 3300009176 | Bacteria | 3678 |
| 370 | Ga0105242_10046969 | 3300009176 | Bacteria | 3505 |
| 371 | Ga0105242_10047012 | 3300009176 | Bacteria | 3503 |
| 372 | Ga0105242_10063975 | 3300009176 | Bacteria | 3030 |
| 373 | Ga0105242_10116300 | 3300009176 | Bacteria | 2288 |
| 374 | Ga0105242_10588273 | 3300009176 | Unclassified | 1073 |
| 375 | Ga0105248_10044098 | 3300009177 | Bacteria | 5002 |
| 376 | Ga0105248_10046187 | 3300009177 | Bacteria | 4881 |
| 377 | Ga0105248_10063473 | 3300009177 | Bacteria | 4146 |
| 378 | Ga0105248_10168772 | 3300009177 | Unclassified | 2466 |
| 379 | Ga0105248_10268880 | 3300009177 | Bacteria | 1919 |
| 380 | Ga0105237_10000186 | 3300009545 | Bacteria | 87958 |
| 381 | Ga0105237_10003399 | 3300009545 | Bacteria | 18931 |
| 382 | Ga0105237_10006995 | 3300009545 | Bacteria | 12431 |
| 383 | Ga0105237_10007035 | 3300009545 | Bacteria | 12386 |
| 384 | Ga0105237_10010817 | 3300009545 | Bacteria | 9684 |
| 385 | Ga0105237_10101699 | 3300009545 | Unclassified | 2866 |
| 386 | Ga0105237_10132499 | 3300009545 | Bacteria | 2487 |
| 387 | Ga0105237_10207160 | 3300009545 | Bacteria | 1961 |
| 388 | Ga0105238_10000643 | 3300009551 | Bacteria | 36757 |
| 389 | Ga0105238_10027176 | 3300009551 | Bacteria | 5831 |
| 390 | Ga0105238_10720570 | 3300009551 | Bacteria | 1010 |
| 391 | Ga0105249_10000769 | 3300009553 | Bacteria | 28707 |
| 392 | Ga0105249_10027071 | 3300009553 | Bacteria | 5172 |
| 393 | Ga0105249_10037188 | 3300009553 | Bacteria | 4418 |
| 394 | Ga0105249_10207614 | 3300009553 | Bacteria | 1920 |
| 395 | Ga0105249_10321973 | 3300009553 | Bacteria | 1557 |
| 396 | Ga0105249_10460955 | 3300009553 | Bacteria | 1311 |
| 397 | Ga0105249_10718177 | 3300009553 | Unclassified | 1060 |
| 398 | Ga0105239_10000383 | 3300010375 | Bacteria | 64504 |
| 399 | Ga0105239_10000998 | 3300010375 | Bacteria | 39651 |
| 400 | Ga0105239_10001030 | 3300010375 | Bacteria | 38874 |
| 401 | Ga0105239_10001834 | 3300010375 | Bacteria | 27813 |
| 402 | Ga0105239_10015572 | 3300010375 | Bacteria | 8422 |
| 403 | Ga0105239_10080681 | 3300010375 | Bacteria | 3580 |
| 404 | Ga0105239_10166006 | 3300010375 | Bacteria | 2468 |
| 405 | Ga0105239_10191818 | 3300010375 | Bacteria | 2287 |
| 406 | Ga0105239_10338862 | 3300010375 | Bacteria | 1697 |
| 407 | Ga0105239_10579804 | 3300010375 | Bacteria | 1279 |
| 408 | Ga0105246_10122390 | 3300011119 | Bacteria | 1930 |
| 409 | Ga0105246_10165767 | 3300011119 | Bacteria | 1687 |
| 410 | Ga0105246_10203064 | 3300011119 | Bacteria | 1542 |
| 411 | Ga0105246_10387600 | 3300011119 | Bacteria | 1157 |
| 412 | Ga0157373_10000592 | 3300013100 | Bacteria | 28163 |
| 413 | Ga0157373_10015279 | 3300013100 | Bacteria | 5611 |
| 414 | Ga0157373_10048226 | 3300013100 | Bacteria | 3037 |
| 415 | Ga0157373_10075089 | 3300013100 | Bacteria | 2385 |
| 416 | Ga0157373_10131244 | 3300013100 | Bacteria | 1762 |
| 417 | Ga0157373_10136246 | 3300013100 | Bacteria | 1726 |
| 418 | Ga0157371_10000871 | 3300013102 | Bacteria | 34241 |
| 419 | Ga0157371_10002782 | 3300013102 | Bacteria | 16415 |
| 420 | Ga0157371_10005842 | 3300013102 | Bacteria | 10294 |
| 421 | Ga0157371_10010900 | 3300013102 | Bacteria | 7049 |
| 422 | Ga0157371_10015265 | 3300013102 | Bacteria | 5768 |
| 423 | Ga0157371_10023766 | 3300013102 | Bacteria | 4480 |
| 424 | Ga0157371_10027518 | 3300013102 | Bacteria | 4124 |
| 425 | Ga0157371_10070004 | 3300013102 | Bacteria | 2484 |
| 426 | Ga0157371_10160951 | 3300013102 | Bacteria | 1603 |
| 427 | Ga0157371_10275132 | 3300013102 | Bacteria | 1215 |
| 428 | Ga0157370_10001420 | 3300013104 | Bacteria | 29745 |
| 429 | Ga0157370_10001901 | 3300013104 | Bacteria | 25708 |
| 430 | Ga0157370_10002379 | 3300013104 | Bacteria | 22682 |
| 431 | Ga0157370_10014087 | 3300013104 | Bacteria | 8203 |
| 432 | Ga0157370_10042144 | 3300013104 | Bacteria | 4401 |
| 433 | Ga0157370_10205534 | 3300013104 | Bacteria | 1826 |
| 434 | Ga0157370_10263464 | 3300013104 | Bacteria | 1593 |
| 435 | Ga0157370_10344234 | 3300013104 | Bacteria | 1374 |
| 436 | Ga0157370_10413741 | 3300013104 | Bacteria | 1241 |
| 437 | Ga0157370_10461107 | 3300013104 | Bacteria | 1168 |
| 438 | Ga0157369_10004162 | 3300013105 | Bacteria | 17136 |
| 439 | Ga0157369_10019866 | 3300013105 | Bacteria | 7515 |
| 440 | Ga0157369_10026644 | 3300013105 | Bacteria | 6410 |
| 441 | Ga0157369_10061895 | 3300013105 | Bacteria | 4033 |
| 442 | Ga0157369_10069571 | 3300013105 | Bacteria | 3781 |
| 443 | Ga0157369_10072358 | 3300013105 | Bacteria | 3700 |
| 444 | Ga0157369_10079761 | 3300013105 | Bacteria | 3505 |
| 445 | Ga0157369_10151309 | 3300013105 | Unclassified | 2452 |
| 446 | Ga0157369_10178264 | 3300013105 | Bacteria | 2237 |
| 447 | Ga0157369_10313600 | 3300013105 | Bacteria | 1631 |
| 448 | Ga0157369_10461348 | 3300013105 | Bacteria | 1315 |
| 449 | Ga0157369_10548927 | 3300013105 | Bacteria | 1194 |
| 450 | Ga0157374_10000074 | 3300013296 | Bacteria | 99947 |
| 451 | Ga0157374_10000485 | 3300013296 | Bacteria | 36006 |
| 452 | Ga0157374_10001889 | 3300013296 | Bacteria | 17565 |
| 453 | Ga0157374_10002204 | 3300013296 | Bacteria | 16428 |
| 454 | Ga0157374_10110336 | 3300013296 | Bacteria | 2645 |
| 455 | Ga0157374_10384332 | 3300013296 | Bacteria | 1399 |
| 456 | Ga0157378_10002516 | 3300013297 | Bacteria | 16315 |
| 457 | Ga0157378_10003959 | 3300013297 | Bacteria | 13087 |
| 458 | Ga0157378_10009583 | 3300013297 | Bacteria | 8433 |
| 459 | Ga0157378_10036718 | 3300013297 | Bacteria | 4336 |
| 460 | Ga0157378_10055535 | 3300013297 | Bacteria | 3528 |
| 461 | Ga0157378_10078001 | 3300013297 | Unclassified | 2987 |
| 462 | Ga0157378_10155311 | 3300013297 | Bacteria | 2135 |
| 463 | Ga0157378_10189659 | 3300013297 | Bacteria | 1938 |
| 464 | Ga0157378_10317393 | 3300013297 | Bacteria | 1513 |
| 465 | Ga0157378_10486718 | 3300013297 | Bacteria | 1230 |
| 466 | Ga0163162_10000029 | 3300013306 | Bacteria | 168510 |
| 467 | Ga0163162_10000722 | 3300013306 | Bacteria | 30672 |
| 468 | Ga0163162_10001415 | 3300013306 | Bacteria | 22313 |
| 469 | Ga0163162_10001629 | 3300013306 | Bacteria | 21029 |
| 470 | Ga0163162_10003780 | 3300013306 | Bacteria | 14510 |
| 471 | Ga0163162_10004434 | 3300013306 | Bacteria | 13515 |
| 472 | Ga0163162_10011885 | 3300013306 | Bacteria | 8493 |
| 473 | Ga0163162_10140782 | 3300013306 | Bacteria | 2526 |
| 474 | Ga0163162_10154130 | 3300013306 | Bacteria | 2417 |
| 475 | Ga0163162_10229749 | 3300013306 | Bacteria | 1985 |
| 476 | Ga0163162_10764644 | 3300013306 | Unclassified | 1085 |
| 477 | Ga0157372_10001369 | 3300013307 | Bacteria | 26379 |
| 478 | Ga0157372_10011361 | 3300013307 | Bacteria | 9472 |
| 479 | Ga0157372_10015406 | 3300013307 | Bacteria | 8194 |
| 480 | Ga0157372_10018095 | 3300013307 | Bacteria | 7574 |
| 481 | Ga0157372_10029230 | 3300013307 | Bacteria | 6016 |
| 482 | Ga0157372_10033207 | 3300013307 | Bacteria | 5666 |
| 483 | Ga0157372_10049933 | 3300013307 | Bacteria | 4654 |
| 484 | Ga0157372_10073071 | 3300013307 | Bacteria | 3865 |
| 485 | Ga0157372_10073148 | 3300013307 | Bacteria | 3863 |
| 486 | Ga0157372_10096195 | 3300013307 | Bacteria | 3374 |
| 487 | Ga0157372_10151514 | 3300013307 | Bacteria | 2677 |
| 488 | Ga0157372_10240712 | 3300013307 | Unclassified | 2100 |
| 489 | Ga0157372_10248148 | 3300013307 | Bacteria | 2066 |
| 490 | Ga0157372_10308336 | 3300013307 | Bacteria | 1842 |
| 491 | Ga0157372_10354104 | 3300013307 | Bacteria | 1711 |
| 492 | Ga0157372_10380717 | 3300013307 | Bacteria | 1644 |
| 493 | Ga0157372_10389684 | 3300013307 | Unclassified | 1623 |
| 494 | Ga0157372_10451363 | 3300013307 | Bacteria | 1498 |
| 495 | Ga0157372_10504347 | 3300013307 | Bacteria | 1411 |
| 496 | Ga0157372_11072301 | 3300013307 | Bacteria | 932 |
| 497 | Ga0157375_10000042 | 3300013308 | Bacteria | 160008 |
| 498 | Ga0157375_10000327 | 3300013308 | Bacteria | 42691 |
| 499 | Ga0157375_10004733 | 3300013308 | Bacteria | 11826 |
| 500 | Ga0157375_10021850 | 3300013308 | Bacteria | 5879 |
| 501 | Ga0157375_10025947 | 3300013308 | Bacteria | 5454 |
| 502 | Ga0157375_10031233 | 3300013308 | Bacteria | 5031 |
| 503 | Ga0157375_10032852 | 3300013308 | Bacteria | 4925 |
| 504 | Ga0157375_10041944 | 3300013308 | Bacteria | 4424 |
| 505 | Ga0157375_10085466 | 3300013308 | Bacteria | 3204 |
| 506 | Ga0157375_10180003 | 3300013308 | Bacteria | 2265 |
| 507 | Ga0157375_10293033 | 3300013308 | Bacteria | 1790 |
| 508 | Ga0157375_10321422 | 3300013308 | Bacteria | 1712 |
| 509 | Ga0157375_10490441 | 3300013308 | Bacteria | 1393 |
| 510 | Ga0163163_10000057 | 3300014325 | Bacteria | 124939 |
| 511 | Ga0163163_10000076 | 3300014325 | Bacteria | 108784 |
| 512 | Ga0163163_10000191 | 3300014325 | Bacteria | 63102 |
| 513 | Ga0163163_10051637 | 3300014325 | Bacteria | 4054 |
| 514 | Ga0163163_10200349 | 3300014325 | Bacteria | 2045 |
| 515 | Ga0163163_10283262 | 3300014325 | Bacteria | 1709 |
| 516 | Ga0163163_10451538 | 3300014325 | Bacteria | 1346 |
| 517 | Ga0163163_10463143 | 3300014325 | Bacteria | 1328 |
| 518 | Ga0163163_10922184 | 3300014325 | Unclassified | 937 |
| 519 | Ga0157380_10001582 | 3300014326 | Bacteria | 14990 |
| 520 | Ga0157380_10036439 | 3300014326 | Bacteria | 3806 |
| 521 | Ga0157380_10075295 | 3300014326 | Bacteria | 2743 |
| 522 | Ga0157380_10082886 | 3300014326 | Bacteria | 2626 |
| 523 | Ga0157380_10133278 | 3300014326 | Bacteria | 2123 |
| 524 | Ga0157380_10230726 | 3300014326 | Unclassified | 1662 |
| 525 | Ga0157380_10356740 | 3300014326 | Bacteria | 1370 |
| 526 | Ga0157380_10383958 | 3300014326 | Bacteria | 1327 |
| 527 | Ga0157377_10003530 | 3300014745 | Bacteria | 7081 |
| 528 | Ga0157377_10054229 | 3300014745 | Bacteria | 2269 |
| 529 | Ga0157377_10079328 | 3300014745 | Unclassified | 1915 |
| 530 | Ga0157377_10105420 | 3300014745 | Bacteria | 1687 |
| 531 | Ga0157379_10000016 | 3300014968 | Bacteria | 103230 |
| 532 | Ga0157379_10019210 | 3300014968 | Bacteria | 6035 |
| 533 | Ga0157379_10019690 | 3300014968 | Bacteria | 5962 |
| 534 | Ga0157379_10026182 | 3300014968 | Bacteria | 5190 |
| 535 | Ga0157379_10054972 | 3300014968 | Bacteria | 3557 |
| 536 | Ga0157379_10064395 | 3300014968 | Bacteria | 3276 |
| 537 | Ga0157379_10132025 | 3300014968 | Unclassified | 2248 |
| 538 | Ga0157379_10301242 | 3300014968 | Bacteria | 1461 |
| 539 | Ga0157379_10333534 | 3300014968 | Unclassified | 1386 |
| 540 | Ga0157379_10399688 | 3300014968 | Bacteria | 1263 |
| 541 | Ga0157379_10452354 | 3300014968 | Bacteria | 1186 |
| 542 | Ga0157376_10000067 | 3300014969 | Bacteria | 83894 |
| 543 | Ga0157376_10000750 | 3300014969 | Bacteria | 21100 |
| 544 | Ga0157376_10002602 | 3300014969 | Bacteria | 12255 |
| 545 | Ga0157376_10007686 | 3300014969 | Bacteria | 7721 |
| 546 | Ga0157376_10038039 | 3300014969 | Bacteria | 3912 |
| 547 | Ga0157376_10080456 | 3300014969 | Bacteria | 2795 |
| 548 | Ga0157376_10140677 | 3300014969 | Bacteria | 2164 |
| 549 | Ga0157376_10190081 | 3300014969 | Bacteria | 1882 |
| 550 | Ga0157376_10324834 | 3300014969 | Unclassified | 1464 |
| 551 | Ga0157376_10722136 | 3300014969 | Bacteria | 1003 |
| 552 | Ga0163161_10001316 | 3300017792 | Bacteria | 18501 |
| 553 | Ga0163161_10003300 | 3300017792 | Bacteria | 11334 |
| 554 | Ga0163161_10010526 | 3300017792 | Bacteria | 6407 |
| 555 | Ga0163161_10026135 | 3300017792 | Bacteria | 4135 |
| 556 | Ga0163161_10042637 | 3300017792 | Bacteria | 3265 |
| 557 | Ga0163161_10087585 | 3300017792 | Bacteria | 2300 |
| 558 | Ga0163161_10125757 | 3300017792 | Bacteria | 1930 |
| 559 | Ga0163161_10149206 | 3300017792 | Bacteria | 1776 |
| 560 | Ga0163161_10326908 | 3300017792 | Bacteria | 1214 |
| 561 | Ga0213876_10000744 | 3300021384 | Bacteria | 22584 |
| 562 | Ga0213876_10190109 | 3300021384 | Bacteria | 1092 |
| 563 | Ga0209646_1003841 | 3300025246 | Bacteria | 2868 |
| 564 | Ga0207697_10102315 | 3300025315 | Bacteria | 1222 |
| 565 | Ga0207656_10002125 | 3300025321 | Bacteria | 6622 |
| 566 | Ga0207656_10011530 | 3300025321 | Bacteria | 3340 |
| 567 | Ga0207656_10062951 | 3300025321 | Bacteria | 1632 |
| 568 | Ga0207682_10019896 | 3300025893 | Bacteria | 2632 |
| 569 | Ga0207642_10064781 | 3300025899 | Unclassified | 1714 |
| 570 | Ga0207710_10000509 | 3300025900 | Bacteria | 24244 |
| 571 | Ga0207710_10014674 | 3300025900 | Bacteria | 3307 |
| 572 | Ga0207688_10009016 | 3300025901 | Bacteria | 5431 |
| 573 | Ga0207680_10000113 | 3300025903 | Bacteria | 37153 |
| 574 | Ga0207680_10004520 | 3300025903 | Bacteria | 6599 |
| 575 | Ga0207680_10041720 | 3300025903 | Bacteria | 2680 |
| 576 | Ga0207680_10084126 | 3300025903 | Bacteria | 2007 |
| 577 | Ga0207680_10186426 | 3300025903 | Bacteria | 1406 |
| 578 | Ga0207680_10213250 | 3300025903 | Bacteria | 1321 |
| 579 | Ga0207647_10012210 | 3300025904 | Bacteria | 5987 |
| 580 | Ga0207647_10034068 | 3300025904 | Bacteria | 3254 |
| 581 | Ga0207647_10063404 | 3300025904 | Bacteria | 2248 |
| 582 | Ga0207647_10065168 | 3300025904 | Unclassified | 2212 |
| 583 | Ga0207645_10002261 | 3300025907 | Bacteria | 15307 |
| 584 | Ga0207645_10003999 | 3300025907 | Bacteria | 10993 |
| 585 | Ga0207645_10004232 | 3300025907 | Bacteria | 10655 |
| 586 | Ga0207645_10009532 | 3300025907 | Bacteria | 6710 |
| 587 | Ga0207645_10098015 | 3300025907 | Bacteria | 1889 |
| 588 | Ga0207645_10301678 | 3300025907 | Unclassified | 1066 |
| 589 | Ga0207643_10003464 | 3300025908 | Bacteria | 8493 |
| 590 | Ga0207643_10004044 | 3300025908 | Bacteria | 7896 |
| 591 | Ga0207643_10068286 | 3300025908 | Bacteria | 2042 |
| 592 | Ga0207705_10003723 | 3300025909 | Bacteria | 11605 |
| 593 | Ga0207705_10010378 | 3300025909 | Bacteria | 6773 |
| 594 | Ga0207705_10024243 | 3300025909 | Bacteria | 4330 |
| 595 | Ga0207705_10027502 | 3300025909 | Bacteria | 4056 |
| 596 | Ga0207705_10113402 | 3300025909 | Bacteria | 2005 |
| 597 | Ga0207705_10133542 | 3300025909 | Bacteria | 1848 |
| 598 | Ga0207654_10001764 | 3300025911 | Bacteria | 11236 |
| 599 | Ga0207654_10011564 | 3300025911 | Unclassified | 4503 |
| 600 | Ga0207654_10117616 | 3300025911 | Bacteria | 1664 |
| 601 | Ga0207654_10202818 | 3300025911 | Bacteria | 1307 |
| 602 | Ga0207707_10002252 | 3300025912 | Bacteria | 17452 |
| 603 | Ga0207707_10057337 | 3300025912 | Bacteria | 3390 |
| 604 | Ga0207707_10427807 | 3300025912 | Bacteria | 1134 |
| 605 | Ga0207695_10000146 | 3300025913 | Bacteria | 209416 |
| 606 | Ga0207695_10000248 | 3300025913 | Bacteria | 140288 |
| 607 | Ga0207695_10000260 | 3300025913 | Bacteria | 133317 |
| 608 | Ga0207695_10000710 | 3300025913 | Bacteria | 64886 |
| 609 | Ga0207695_10016758 | 3300025913 | Bacteria | 8556 |
| 610 | Ga0207695_10026531 | 3300025913 | Bacteria | 6466 |
| 611 | Ga0207695_10040192 | 3300025913 | Bacteria | 5019 |
| 612 | Ga0207695_10056419 | 3300025913 | Unclassified | 4087 |
| 613 | Ga0207695_10060927 | 3300025913 | Bacteria | 3903 |
| 614 | Ga0207695_10099349 | 3300025913 | Bacteria | 2908 |
| 615 | Ga0207695_10208239 | 3300025913 | Bacteria | 1868 |
| 616 | Ga0207695_10350354 | 3300025913 | Bacteria | 1364 |
| 617 | Ga0207671_10000521 | 3300025914 | Bacteria | 51898 |
| 618 | Ga0207671_10000965 | 3300025914 | Bacteria | 35673 |
| 619 | Ga0207671_10002094 | 3300025914 | Bacteria | 21819 |
| 620 | Ga0207671_10003532 | 3300025914 | Bacteria | 15500 |
| 621 | Ga0207671_10003806 | 3300025914 | Bacteria | 14790 |
| 622 | Ga0207671_10040761 | 3300025914 | Bacteria | 3436 |
| 623 | Ga0207660_10006176 | 3300025917 | Bacteria | 7781 |
| 624 | Ga0207660_10025200 | 3300025917 | Bacteria | 4035 |
| 625 | Ga0207660_10053300 | 3300025917 | Bacteria | 2883 |
| 626 | Ga0207662_10025239 | 3300025918 | Bacteria | 3423 |
| 627 | Ga0207662_10035660 | 3300025918 | Bacteria | 2906 |
| 628 | Ga0207657_10013299 | 3300025919 | Bacteria | 8074 |
| 629 | Ga0207657_10070202 | 3300025919 | Bacteria | 2970 |
| 630 | Ga0207657_10158828 | 3300025919 | Bacteria | 1837 |
| 631 | Ga0207657_10432351 | 3300025919 | Bacteria | 1034 |
| 632 | Ga0207657_10516058 | 3300025919 | Unclassified | 935 |
| 633 | Ga0207649_10017071 | 3300025920 | Bacteria | 4109 |
| 634 | Ga0207652_10000010 | 3300025921 | Bacteria | 247079 |
| 635 | Ga0207652_10000614 | 3300025921 | Bacteria | 35439 |
| 636 | Ga0207652_10000915 | 3300025921 | Bacteria | 27843 |
| 637 | Ga0207652_10019149 | 3300025921 | Bacteria | 5625 |
| 638 | Ga0207652_10027606 | 3300025921 | Bacteria | 4730 |
| 639 | Ga0207652_10037463 | 3300025921 | Bacteria | 4104 |
| 640 | Ga0207652_10399999 | 3300025921 | Bacteria | 1239 |
| 641 | Ga0207681_10043809 | 3300025923 | Bacteria | 2997 |
| 642 | Ga0207681_10367934 | 3300025923 | Unclassified | 1154 |
| 643 | Ga0207694_10015681 | 3300025924 | Bacteria | 5716 |
| 644 | Ga0207694_10312328 | 3300025924 | Bacteria | 1296 |
| 645 | Ga0207694_10498773 | 3300025924 | Unclassified | 1019 |
| 646 | Ga0207650_10019198 | 3300025925 | Bacteria | 4802 |
| 647 | Ga0207650_10020013 | 3300025925 | Bacteria | 4713 |
| 648 | Ga0207650_10045051 | 3300025925 | Bacteria | 3245 |
| 649 | Ga0207650_10091698 | 3300025925 | Bacteria | 2322 |
| 650 | Ga0207650_10187749 | 3300025925 | Unclassified | 1650 |
| 651 | Ga0207650_10333321 | 3300025925 | Bacteria | 1245 |
| 652 | Ga0207659_10009504 | 3300025926 | Bacteria | 6080 |
| 653 | Ga0207659_10024619 | 3300025926 | Bacteria | 4036 |
| 654 | Ga0207659_10044936 | 3300025926 | Bacteria | 3111 |
| 655 | Ga0207659_10162948 | 3300025926 | Bacteria | 1753 |
| 656 | Ga0207659_10414719 | 3300025926 | Bacteria | 1128 |
| 657 | Ga0207687_10286967 | 3300025927 | Bacteria | 1321 |
| 658 | Ga0207644_10003988 | 3300025931 | Bacteria | 9588 |
| 659 | Ga0207644_10030573 | 3300025931 | Unclassified | 3747 |
| 660 | Ga0207644_10060722 | 3300025931 | Bacteria | 2736 |
| 661 | Ga0207644_10092630 | 3300025931 | Unclassified | 2255 |
| 662 | Ga0207644_10114048 | 3300025931 | Bacteria | 2047 |
| 663 | Ga0207690_10022415 | 3300025932 | Bacteria | 3929 |
| 664 | Ga0207690_10178449 | 3300025932 | Bacteria | 1597 |
| 665 | Ga0207706_10010077 | 3300025933 | Bacteria | 8655 |
| 666 | Ga0207706_10023314 | 3300025933 | Bacteria | 5559 |
| 667 | Ga0207706_10042504 | 3300025933 | Bacteria | 4028 |
| 668 | Ga0207706_10048402 | 3300025933 | Bacteria | 3760 |
| 669 | Ga0207706_10054278 | 3300025933 | Bacteria | 3537 |
| 670 | Ga0207706_10106743 | 3300025933 | Unclassified | 2464 |
| 671 | Ga0207686_10002335 | 3300025934 | Bacteria | 10371 |
| 672 | Ga0207686_10029738 | 3300025934 | Bacteria | 3227 |
| 673 | Ga0207686_10169268 | 3300025934 | Bacteria | 1539 |
| 674 | Ga0207686_10445986 | 3300025934 | Bacteria | 995 |
| 675 | Ga0207686_10631766 | 3300025934 | Bacteria | 845 |
| 676 | Ga0207670_10014456 | 3300025936 | Bacteria | 4686 |
| 677 | Ga0207670_10024724 | 3300025936 | Bacteria | 3758 |
| 678 | Ga0207670_10029467 | 3300025936 | Bacteria | 3497 |
| 679 | Ga0207670_10397976 | 3300025936 | Bacteria | 1101 |
| 680 | Ga0207669_10192153 | 3300025937 | Unclassified | 1473 |
| 681 | Ga0207704_10001983 | 3300025938 | Bacteria | 9175 |
| 682 | Ga0207704_10032131 | 3300025938 | Bacteria | 2966 |
| 683 | Ga0207704_10041486 | 3300025938 | Bacteria | 2699 |
| 684 | Ga0207704_10114194 | 3300025938 | Bacteria | 1833 |
| 685 | Ga0207704_10183214 | 3300025938 | Unclassified | 1515 |
| 686 | Ga0207691_10000004 | 3300025940 | Bacteria | 168729 |
| 687 | Ga0207691_10003976 | 3300025940 | Bacteria | 14356 |
| 688 | Ga0207691_10004916 | 3300025940 | Bacteria | 12901 |
| 689 | Ga0207691_10040941 | 3300025940 | Unclassified | 4280 |
| 690 | Ga0207691_10185014 | 3300025940 | Bacteria | 1819 |
| 691 | Ga0207711_10093425 | 3300025941 | Bacteria | 2649 |
| 692 | Ga0207711_10573031 | 3300025941 | Bacteria | 1053 |
| 693 | Ga0207689_10000380 | 3300025942 | Bacteria | 41875 |
| 694 | Ga0207689_10007555 | 3300025942 | Bacteria | 9534 |
| 695 | Ga0207689_10012869 | 3300025942 | Bacteria | 7146 |
| 696 | Ga0207689_10016563 | 3300025942 | Bacteria | 6238 |
| 697 | Ga0207689_10040181 | 3300025942 | Bacteria | 3872 |
| 698 | Ga0207689_10044288 | 3300025942 | Bacteria | 3679 |
| 699 | Ga0207689_10051677 | 3300025942 | Bacteria | 3388 |
| 700 | Ga0207689_10089848 | 3300025942 | Unclassified | 2523 |
| 701 | Ga0207689_10309597 | 3300025942 | Unclassified | 1310 |
| 702 | Ga0207661_10002059 | 3300025944 | Bacteria | 13845 |
| 703 | Ga0207661_10006530 | 3300025944 | Bacteria | 8248 |
| 704 | Ga0207661_10029407 | 3300025944 | Bacteria | 4220 |
| 705 | Ga0207661_10122508 | 3300025944 | Bacteria | 2216 |
| 706 | Ga0207661_10387913 | 3300025944 | Bacteria | 1265 |
| 707 | Ga0207679_10003072 | 3300025945 | Bacteria | 10338 |
| 708 | Ga0207679_10014884 | 3300025945 | Bacteria | 5125 |
| 709 | Ga0207679_10035037 | 3300025945 | Bacteria | 3548 |
| 710 | Ga0207679_10058657 | 3300025945 | Bacteria | 2853 |
| 711 | Ga0207679_10202972 | 3300025945 | Bacteria | 1657 |
| 712 | Ga0207679_10321148 | 3300025945 | Bacteria | 1341 |
| 713 | Ga0207679_10365400 | 3300025945 | Bacteria | 1261 |
| 714 | Ga0207667_10000150 | 3300025949 | Bacteria | 104244 |
| 715 | Ga0207667_10000270 | 3300025949 | Bacteria | 71998 |
| 716 | Ga0207667_10001158 | 3300025949 | Bacteria | 33133 |
| 717 | Ga0207667_10015013 | 3300025949 | Bacteria | 8810 |
| 718 | Ga0207667_10038496 | 3300025949 | Bacteria | 5108 |
| 719 | Ga0207667_10070338 | 3300025949 | Bacteria | 3642 |
| 720 | Ga0207667_10106284 | 3300025949 | Unclassified | 2895 |
| 721 | Ga0207667_10189315 | 3300025949 | Bacteria | 2112 |
| 722 | Ga0207667_10292385 | 3300025949 | Bacteria | 1664 |
| 723 | Ga0207667_10819580 | 3300025949 | Bacteria | 926 |
| 724 | Ga0207651_10000456 | 3300025960 | Bacteria | 17226 |
| 725 | Ga0207651_10026173 | 3300025960 | Bacteria | 3639 |
| 726 | Ga0207651_10036940 | 3300025960 | Bacteria | 3195 |
| 727 | Ga0207651_10037364 | 3300025960 | Bacteria | 3181 |
| 728 | Ga0207651_10085796 | 3300025960 | Bacteria | 2286 |
| 729 | Ga0207651_10116198 | 3300025960 | Bacteria | 2019 |
| 730 | Ga0207712_10014473 | 3300025961 | Bacteria | 5077 |
| 731 | Ga0207712_10284077 | 3300025961 | Bacteria | 1351 |
| 732 | Ga0207668_10000112 | 3300025972 | Bacteria | 58202 |
| 733 | Ga0207668_10061993 | 3300025972 | Bacteria | 2632 |
| 734 | Ga0207668_10149608 | 3300025972 | Unclassified | 1806 |
| 735 | Ga0207668_10161832 | 3300025972 | Bacteria | 1745 |
| 736 | Ga0207640_10019401 | 3300025981 | Bacteria | 4017 |
| 737 | Ga0207658_10000059 | 3300025986 | Bacteria | 121530 |
| 738 | Ga0207658_10015422 | 3300025986 | Bacteria | 5242 |
| 739 | Ga0207658_10016684 | 3300025986 | Bacteria | 5054 |
| 740 | Ga0207658_10035939 | 3300025986 | Bacteria | 3551 |
| 741 | Ga0207658_10043113 | 3300025986 | Bacteria | 3278 |
| 742 | Ga0207658_10051982 | 3300025986 | Bacteria | 3022 |
| 743 | Ga0207658_10060213 | 3300025986 | Bacteria | 2832 |
| 744 | Ga0207658_10147397 | 3300025986 | Unclassified | 1913 |
| 745 | Ga0207677_10002071 | 3300026023 | Bacteria | 10560 |
| 746 | Ga0207677_10017440 | 3300026023 | Bacteria | 4280 |
| 747 | Ga0207677_10043168 | 3300026023 | Bacteria | 2996 |
| 748 | Ga0207677_10050170 | 3300026023 | Bacteria | 2821 |
| 749 | Ga0207677_10316039 | 3300026023 | Bacteria | 1296 |
| 750 | Ga0207677_10350930 | 3300026023 | Bacteria | 1236 |
| 751 | Ga0207677_10427851 | 3300026023 | Bacteria | 1129 |
| 752 | Ga0207703_10007561 | 3300026035 | Bacteria | 8615 |
| 753 | Ga0207703_10012809 | 3300026035 | Bacteria | 6538 |
| 754 | Ga0207703_10030505 | 3300026035 | Bacteria | 4262 |
| 755 | Ga0207639_10005754 | 3300026041 | Bacteria | 8393 |
| 756 | Ga0207639_10006511 | 3300026041 | Bacteria | 7942 |
| 757 | Ga0207639_10021961 | 3300026041 | Bacteria | 4591 |
| 758 | Ga0207639_10026251 | 3300026041 | Bacteria | 4232 |
| 759 | Ga0207639_10199330 | 3300026041 | Bacteria | 1716 |
| 760 | Ga0207678_10132020 | 3300026067 | Bacteria | 2131 |
| 761 | Ga0207678_10215060 | 3300026067 | Bacteria | 1645 |
| 762 | Ga0207678_10477381 | 3300026067 | Bacteria | 1086 |
| 763 | Ga0207708_10068998 | 3300026075 | Bacteria | 2706 |
| 764 | Ga0207708_10085510 | 3300026075 | Bacteria | 2426 |
| 765 | Ga0207708_10088429 | 3300026075 | Unclassified | 2386 |
| 766 | Ga0207708_10216894 | 3300026075 | Bacteria | 1531 |
| 767 | Ga0207702_10010599 | 3300026078 | Bacteria | 7703 |
| 768 | Ga0207702_10056253 | 3300026078 | Bacteria | 3339 |
| 769 | Ga0207702_10123476 | 3300026078 | Bacteria | 2321 |
| 770 | Ga0207641_10001801 | 3300026088 | Bacteria | 20610 |
| 771 | Ga0207641_10004380 | 3300026088 | Bacteria | 12240 |
| 772 | Ga0207641_10052245 | 3300026088 | Bacteria | 3461 |
| 773 | Ga0207641_10088556 | 3300026088 | Bacteria | 2703 |
| 774 | Ga0207641_10091540 | 3300026088 | Bacteria | 2661 |
| 775 | Ga0207641_10097787 | 3300026088 | Bacteria | 2580 |
| 776 | Ga0207641_10311954 | 3300026088 | Bacteria | 1489 |
| 777 | Ga0207648_10000860 | 3300026089 | Bacteria | 34249 |
| 778 | Ga0207648_10001923 | 3300026089 | Bacteria | 22701 |
| 779 | Ga0207648_10012454 | 3300026089 | Bacteria | 7962 |
| 780 | Ga0207648_10052241 | 3300026089 | Bacteria | 3573 |
| 781 | Ga0207648_10065308 | 3300026089 | Bacteria | 3173 |
| 782 | Ga0207648_10087386 | 3300026089 | Bacteria | 2721 |
| 783 | Ga0207648_10113835 | 3300026089 | Unclassified | 2376 |
| 784 | Ga0207648_10237880 | 3300026089 | Bacteria | 1621 |
| 785 | Ga0207648_10374060 | 3300026089 | Bacteria | 1287 |
| 786 | Ga0207648_10386905 | 3300026089 | Bacteria | 1265 |
| 787 | Ga0207676_10008702 | 3300026095 | Bacteria | 7218 |
| 788 | Ga0207676_10013797 | 3300026095 | Bacteria | 5801 |
| 789 | Ga0207676_10016787 | 3300026095 | Bacteria | 5300 |
| 790 | Ga0207676_10022542 | 3300026095 | Unclassified | 4631 |
| 791 | Ga0207676_10029792 | 3300026095 | Bacteria | 4090 |
| 792 | Ga0207676_10099027 | 3300026095 | Bacteria | 2412 |
| 793 | Ga0207674_10002283 | 3300026116 | Bacteria | 24310 |
| 794 | Ga0207674_10003937 | 3300026116 | Bacteria | 18071 |
| 795 | Ga0207674_10005172 | 3300026116 | Bacteria | 15548 |
| 796 | Ga0207674_10028290 | 3300026116 | Bacteria | 5917 |
| 797 | Ga0207674_10050319 | 3300026116 | Bacteria | 4257 |
| 798 | Ga0207674_10116151 | 3300026116 | Bacteria | 2647 |
| 799 | Ga0207675_100003567 | 3300026118 | Bacteria | 15155 |
| 800 | Ga0207675_100006377 | 3300026118 | Bacteria | 11183 |
| 801 | Ga0207675_100022057 | 3300026118 | Bacteria | 5928 |
| 802 | Ga0207675_100033665 | 3300026118 | Bacteria | 4774 |
| 803 | Ga0207675_100195803 | 3300026118 | Bacteria | 1940 |
| 804 | Ga0207675_100295478 | 3300026118 | Bacteria | 1576 |
| 805 | Ga0207675_100308272 | 3300026118 | Unclassified | 1543 |
| 806 | Ga0207675_100328074 | 3300026118 | Unclassified | 1495 |
| 807 | Ga0207675_100470526 | 3300026118 | Unclassified | 1248 |
| 808 | Ga0207675_100523979 | 3300026118 | Bacteria | 1182 |
| 809 | Ga0207683_10011079 | 3300026121 | Bacteria | 7683 |
| 810 | Ga0207683_10069428 | 3300026121 | Viruses | 3112 |
| 811 | Ga0207683_10434513 | 3300026121 | Bacteria | 1210 |
| 812 | Ga0207698_10000927 | 3300026142 | Bacteria | 17081 |
| 813 | Ga0207698_10002400 | 3300026142 | Bacteria | 11083 |
| 814 | Ga0207698_10003417 | 3300026142 | Bacteria | 9557 |
| 815 | Ga0207698_10033104 | 3300026142 | Bacteria | 3753 |
| 816 | Ga0207698_10036259 | 3300026142 | Bacteria | 3618 |
| 817 | Ga0207698_10286661 | 3300026142 | Unclassified | 1526 |
| 818 | Ga0207698_10516384 | 3300026142 | Bacteria | 1165 |
| 819 | Ga0209995_1015084 | 3300027471 | Bacteria | 1267 |
| 820 | Ga0207428_10024798 | 3300027907 | Bacteria | 5033 |
| 821 | Ga0268266_10000026 | 3300028379 | Bacteria | 434485 |
| 822 | Ga0268266_10004701 | 3300028379 | Bacteria | 12995 |
| 823 | Ga0268266_10042453 | 3300028379 | Bacteria | 3885 |
| 824 | Ga0268265_10038667 | 3300028380 | Bacteria | 3511 |
| 825 | Ga0268265_10054473 | 3300028380 | Bacteria | 3035 |
| 826 | Ga0268265_10101357 | 3300028380 | Bacteria | 2326 |
| 827 | Ga0268264_10000019 | 3300028381 | Bacteria | 488112 |
| 828 | Ga0268264_10003138 | 3300028381 | Bacteria | 14321 |
| 829 | Ga0268264_10005971 | 3300028381 | Bacteria | 10308 |
| 830 | Ga0268264_10010782 | 3300028381 | Bacteria | 7550 |
| 831 | Ga0268264_10055060 | 3300028381 | Bacteria | 3323 |
| 832 | Ga0268264_10105320 | 3300028381 | Bacteria | 2460 |
| 833 | Ga0268264_10297439 | 3300028381 | Bacteria | 1518 |
| 834 | Ga0268264_10414455 | 3300028381 | Unclassified | 1298 |
| 835 | Ga0307511_10001046 | 3300030521 | Bacteria | 29433 |
| 836 | Ga0307511_10003234 | 3300030521 | Bacteria | 16764 |
| 837 | Ga0265327_10000456 | 3300031251 | Bacteria | 73362 |
| 838 | Ga0307513_10103557 | 3300031456 | Bacteria | 2862 |
| 839 | Ga0307513_10163615 | 3300031456 | Bacteria | 2113 |
| 840 | Ga0307513_10304070 | 3300031456 | Bacteria | 1360 |
| 841 | Ga0307509_10011961 | 3300031507 | Bacteria | 10428 |
| 842 | Ga0307509_10087560 | 3300031507 | Bacteria | 3199 |
| 843 | Ga0307509_10093188 | 3300031507 | Bacteria | 3076 |
| 844 | Ga0265313_10008857 | 3300031595 | Bacteria | 6625 |
| 845 | Ga0307508_10010810 | 3300031616 | Bacteria | 8348 |
| 846 | Ga0307516_10000496 | 3300031730 | Bacteria | 52327 |
| 847 | Ga0307516_10114993 | 3300031730 | Bacteria | 2487 |
| 848 | Ga0307407_10124583 | 3300031903 | Bacteria | 1639 |
| 849 | Ga0307416_100471183 | 3300032002 | Bacteria | 1313 |
| 850 | Ga0307415_100019348 | 3300032126 | Bacteria | 4133 |
| 851 | Ga0307510_10000165 | 3300033180 | Bacteria | 55957 |
| 852 | Ga0373955_0082204 | 3300035172 | Bacteria | 1822 |
| 853 | Ga0373935_0099614 | 3300035692 | Bacteria | 1914 |
| 854 | Ga0373937_0017088 | 3300036401 | Bacteria | 6453 |
| 855 | Ga0373937_0050889 | 3300036401 | Bacteria | 3796 |
| 856 | Ga0373937_0124391 | 3300036401 | Bacteria | 2405 |
| 857 | Ga0395899_0000248 | 3300037312 | Bacteria | 72047 |
| 858 | Ga0395899_0020479 | 3300037312 | Bacteria | 5014 |
| 859 | Ga0395899_0021277 | 3300037312 | Bacteria | 4921 |
| 860 | Ga0395900_0001423 | 3300037418 | Bacteria | 28585 |
| 861 | Ga0395900_0005223 | 3300037418 | Bacteria | 13624 |
| 862 | Ga0395900_0031980 | 3300037418 | Bacteria | 5408 |
| 863 | Ga0395900_0143527 | 3300037418 | Bacteria | 2443 |
| 864 | Ga0395898_0003603 | 3300037466 | Bacteria | 17248 |
| 865 | Ga0395898_0052782 | 3300037466 | Bacteria | 3971 |
| 866 | Ga0395898_0079938 | 3300037466 | Bacteria | 3153 |
| 867 | Ga0395905_0032301 | 3300037471 | Bacteria | 4923 |
| 868 | Ga0395905_0138571 | 3300037471 | Bacteria | 2289 |
| 869 | Ga0395901_0001028 | 3300038443 | Bacteria | 30200 |
| 870 | Ga0395901_0081982 | 3300038443 | Bacteria | 3369 |
| 871 | Ga0395901_0108485 | 3300038443 | Bacteria | 2914 |
| 872 | Ga0395901_0229197 | 3300038443 | Bacteria | 1940 |
| 873 | Ga0395901_0332571 | 3300038443 | Bacteria | 1570 |
| 874 | Ga0436365_0142398 | 3300039437 | Bacteria | 24885 |
| 875 | Ga0436365_0444508 | 3300039437 | Bacteria | 3551 |
| 876 | Ga0436365_0723742 | 3300039437 | Bacteria | 1256 |
| 877 | Ga0439436_0003059 | 3300041404 | Bacteria | 5077 |
| 878 | Ga0439439_0061917 | 3300041406 | Bacteria | 994 |
| 879 | Ga0439453_0018791 | 3300041408 | Bacteria | 1225 |
| 880 | Ga0451798_0221512 | 3300041458 | Bacteria | 863 |
| 881 | Ga0451800_0178396 | 3300041459 | Unclassified | 885 |
| 882 | Ga0451807_1449807 | 3300041486 | Bacteria | 2085 |
| 883 | Ga0451849_0638231 | 3300041505 | Bacteria | 1136 |
| 884 | Ga0451849_1503776 | 3300041505 | Unclassified | 984 |
| 885 | Ga0451853_0933960 | 3300041512 | Bacteria | 3680 |
| 886 | Ga0451853_3246057 | 3300041512 | Bacteria | 941 |
| 887 | Ga0439449_0007345 | 3300042007 | Bacteria | 4187 |
| 888 | Ga0439449_0021941 | 3300042007 | Bacteria | 2390 |
| 889 | Ga0439457_000764 | 3300042014 | Bacteria | 9559 |
| 890 | Ga0439462_0005029 | 3300042015 | Bacteria | 3246 |
| 891 | Ga0439460_0126351 | 3300042461 | Unclassified | 840 |
| 892 | Ga0451577_0081244 | 3300042876 | Bacteria | 2890 |
| 893 | Ga0466969_0000622 | 3300044656 | Bacteria | 19173 |
| 894 | Ga0466969_0047730 | 3300044656 | Unclassified | 2119 |
| 895 | Ga0466972_0000105 | 3300044658 | Bacteria | 73294 |
| 896 | Ga0466972_0001130 | 3300044658 | Bacteria | 12776 |
| 897 | Ga0466966_0000372 | 3300044684 | Bacteria | 29210 |
| 898 | Ga0466966_0191309 | 3300044684 | Bacteria | 1240 |
| 899 | Ga0466961_0010944 | 3300044693 | Bacteria | 5796 |
| 900 | Ga0466964_0023697 | 3300044706 | Bacteria | 2387 |
| 901 | Ga0453684_0169165 | 3300044712 | Bacteria | 2577 |
| 902 | Ga0466968_0039469 | 3300044735 | Bacteria | 1988 |
| 903 | Ga0466970_0060592 | 3300044765 | Bacteria | 2027 |
| 904 | Ga0466957_0008813 | 3300044842 | Bacteria | 5744 |
| 905 | Ga0466957_0023376 | 3300044842 | Bacteria | 3654 |
| 906 | Ga0466957_0266116 | 3300044842 | Bacteria | 1144 |
| 907 | Ga0466959_0000076 | 3300045049 | Bacteria | 62314 |
| 908 | Ga0466959_0025218 | 3300045049 | Bacteria | 4405 |
| 909 | Ga0451576_0139870 | 3300045051 | Bacteria | 2525 |
| 910 | Ga0495629_0070384 | 3300046459 | Bacteria | 2441 |
| 911 | Ga0495638_0031474 | 3300046460 | Bacteria | 3410 |
| 912 | Ga0495651_0433479 | 3300046462 | Unclassified | 852 |
| 913 | Ga0495650_0045083 | 3300046471 | Bacteria | 1859 |
| 914 | Ga0495580_0061968 | 3300046472 | Bacteria | 2625 |
| 915 | Ga0495639_0074884 | 3300046475 | Bacteria | 1569 |
| 916 | Ga0495606_0007121 | 3300046507 | Bacteria | 10109 |
| 917 | Ga0495618_0019559 | 3300046514 | Bacteria | 4168 |
| 918 | Ga0495628_0241340 | 3300046516 | Bacteria | 1351 |
| 919 | Ga0495643_0223848 | 3300046522 | Unclassified | 891 |
| 920 | Ga0495640_0083059 | 3300046533 | Bacteria | 2126 |
| 921 | Ga0495587_0019717 | 3300046536 | Bacteria | 4171 |
| 922 | Ga0495587_0100203 | 3300046536 | Bacteria | 1670 |
| 923 | Ga0495597_0174083 | 3300046542 | Bacteria | 872 |
| 924 | Ga0495645_0108996 | 3300046543 | Bacteria | 1961 |
| 925 | Ga0495668_0002267 | 3300046616 | Bacteria | 16193 |
| 926 | Ga0495634_0016985 | 3300046642 | Bacteria | 5199 |
| 927 | Ga0495611_0000072 | 3300046648 | Bacteria | 70916 |
| 928 | Ga0495625_0017480 | 3300046660 | Bacteria | 5615 |
| 929 | Ga0495658_0078553 | 3300046683 | Bacteria | 1932 |
| 930 | Ga0495624_0148949 | 3300046690 | Bacteria | 1432 |
| 931 | Ga0495649_0150306 | 3300046694 | Bacteria | 1224 |
| 932 | Ga0495604_0127292 | 3300047317 | Unclassified | 1835 |
| 933 | Ga0495674_0214176 | 3300047319 | Bacteria | 1595 |
| 934 | Ga0495680_0418192 | 3300047322 | Bacteria | 923 |
| 935 | Ga0495687_000058 | 3300047443 | Bacteria | 185830 |
| 936 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 937 | Ga0495686_0005189 | 3300047472 | Bacteria | 10374 |
| 938 | Ga0496105_0220073 | 3300048908 | Bacteria | 1546 |
| 939 | Ga0496105_0442255 | 3300048908 | Bacteria | 1027 |
| 940 | Ga0496106_0119134 | 3300048909 | Unclassified | 2062 |
| 941 | Ga0496114_0432538 | 3300048917 | Bacteria | 1166 |
| 942 | Ga0496115_0164274 | 3300048918 | Bacteria | 1836 |
| 943 | Ga0501033_0308469 | 3300049570 | Bacteria | 1113 |
| 944 | Ga0501034_0019518 | 3300049571 | Bacteria | 6932 |
| 945 | Ga0501034_0083686 | 3300049571 | Bacteria | 3192 |
| 946 | Ga0501038_0131943 | 3300049574 | Bacteria | 2050 |
| 947 | Ga0501038_0259277 | 3300049574 | Bacteria | 1375 |
| 948 | Ga0501038_0370172 | 3300049574 | Bacteria | 1113 |
| 949 | Ga0501047_0007598 | 3300049581 | Bacteria | 10201 |
| 950 | Ga0501047_0182034 | 3300049581 | Bacteria | 1968 |
| 951 | Ga0501047_0313383 | 3300049581 | Bacteria | 1409 |
| 952 | Ga0501048_0112510 | 3300049582 | Bacteria | 1922 |
| 953 | Ga0501069_0247088 | 3300049585 | Bacteria | 1040 |
| 954 | Ga0501070_0109692 | 3300049586 | Unclassified | 2280 |
| 955 | Ga0501070_0201676 | 3300049586 | Bacteria | 1634 |
| 956 | Ga0501073_0007827 | 3300049589 | Bacteria | 7934 |
| 957 | Ga0501073_0325880 | 3300049589 | Bacteria | 1060 |
| 958 | Ga0501074_0253851 | 3300049590 | Bacteria | 1250 |
| 959 | Ga0501202_007751 | 3300049652 | Bacteria | 1945 |
| 960 | Ga0501217_037269 | 3300049661 | Unclassified | 1223 |
| 961 | Ga0501227_074655 | 3300049665 | Bacteria | 883 |
| 962 | Ga0501257_022317 | 3300049686 | Bacteria | 1497 |
| 963 | Ga0501221_006987 | 3300049704 | Bacteria | 1924 |
| 964 | Ga0501225_0006210 | 3300049705 | Bacteria | 3490 |
| 965 | Ga0501225_0014295 | 3300049705 | Bacteria | 2218 |
| 966 | Ga0501080_0319646 | 3300049742 | Bacteria | 1405 |
| 967 | Ga0501083_0075938 | 3300049744 | Unclassified | 2230 |
| 968 | Ga0501273_016616 | 3300049770 | Bacteria | 965 |
| 969 | Ga0501273_022449 | 3300049770 | Bacteria | 862 |
| 970 | Ga0501035_0627693 | 3300049822 | Bacteria | 873 |
| 971 | Ga0501044_0053160 | 3300049823 | Bacteria | 4168 |
| 972 | Ga0501044_0067190 | 3300049823 | Unclassified | 3653 |
| 973 | Ga0501044_0229867 | 3300049823 | Bacteria | 1803 |
| 974 | Ga0501044_0275540 | 3300049823 | Bacteria | 1617 |
| 975 | Ga0501212_001996 | 3300049851 | Bacteria | 2405 |
| 976 | nmdc:mga0k408_15371_c1 | 3300050493 | Bacteria | 4232 |
| 977 | nmdc:mga05p37_33239_c1 | 3300050507 | Bacteria | 6316 |
| 978 | nmdc:mga05p37_73456_c1 | 3300050507 | Bacteria | 4209 |
| 979 | nmdc:mga09592_143792_c1 | 3300050508 | Unclassified | 2056 |
| 980 | nmdc:mga09592_14634_c1 | 3300050508 | Bacteria | 6401 |
| 981 | nmdc:mga09592_315840_c1 | 3300050508 | Bacteria | 1354 |
| 982 | nmdc:mga09592_46551_c1 | 3300050508 | Bacteria | 3654 |
| 983 | nmdc:mga0qj67_99097_c1 | 3300050509 | Bacteria | 2348 |
| 984 | nmdc:mga06r32_100736_c1 | 3300050510 | Bacteria | 2834 |
| 985 | nmdc:mga06r32_199984_c1 | 3300050510 | Bacteria | 1986 |
| 986 | nmdc:mga08y16_209144_c1 | 3300050511 | Unclassified | 2021 |
| 987 | nmdc:mga08y16_42668_c1 | 3300050511 | Bacteria | 4750 |
| 988 | nmdc:mga0a205_443891_c1 | 3300050515 | Bacteria | 1158 |
| 989 | Ga0500578_0000100 | 3300053086 | Bacteria | 99827 |
| 990 | Ga0500578_0020799 | 3300053086 | Bacteria | 4219 |
| 991 | Ga0500644_0084177 | 3300053088 | Bacteria | 1176 |
| 992 | Ga0500646_0001225 | 3300053090 | Bacteria | 6886 |
| 993 | Ga0500646_0001639 | 3300053090 | Bacteria | 5916 |
| 994 | Ga0500646_0023628 | 3300053090 | Bacteria | 1650 |
| 995 | Ga0500646_0072766 | 3300053090 | Bacteria | 1034 |
| 996 | Ga0500583_0002450 | 3300053092 | Bacteria | 5579 |
| 997 | Ga0500556_0012781 | 3300053104 | Bacteria | 2519 |
| 998 | Ga0500562_010871 | 3300053108 | Unclassified | 2309 |
| 999 | Ga0500592_016204 | 3300053116 | Bacteria | 1196 |
| 1000 | Ga0500642_0046963 | 3300053130 | Bacteria | 1890 |
| 1001 | Ga0500652_003412 | 3300053131 | Bacteria | 4812 |
| 1002 | Ga0500658_0027417 | 3300053134 | Bacteria | 2203 |
| 1003 | Ga0500568_0000635 | 3300053139 | Bacteria | 25302 |
| 1004 | Ga0500568_0008527 | 3300053139 | Unclassified | 4933 |
| 1005 | Ga0500573_0031239 | 3300053140 | Bacteria | 3074 |
| 1006 | Ga0500588_0007510 | 3300053146 | Bacteria | 2515 |
| 1007 | Ga0500588_0078889 | 3300053146 | Bacteria | 1097 |
| 1008 | Ga0500604_0003261 | 3300053151 | Bacteria | 4363 |
| 1009 | Ga0500616_0019968 | 3300053153 | Bacteria | 3769 |
| 1010 | Ga0500622_0000948 | 3300053156 | Bacteria | 24673 |
| 1011 | Ga0500622_0014393 | 3300053156 | Bacteria | 4249 |
| 1012 | Ga0500645_008756 | 3300053730 | Bacteria | 3432 |
| 1013 | Ga0500645_011912 | 3300053730 | Bacteria | 2824 |
| 1014 | Ga0501084_0001548 | 3300054114 | Bacteria | 18288 |
| 1015 | Ga0501082_0005318 | 3300060353 | Bacteria | 11187 |
| 1016 | Ga0501082_0442477 | 3300060353 | Bacteria | 1135 |
| 1017 | Ga0466962_0007218 | 3300061719 | Bacteria | 5323 |
| 1018 | 2738725946 | 2738541278 | Bacteria | 9755573 |
| 1019 | 2929158657 | 2929154850 | Bacteria | 6753285 |
| 1020 | Ga0373937_0480649 | |||
| 1021 | MBSR1b_contig_5340824 | |||
| 1022 | ARcpr5yngRDRAFT_c002723 | |||
| 1023 | rootH1_10053528 | |||
| 1024 | rootH1_10115453 | |||
| 1025 | rootH2_10001899 | |||
| 1026 | rootH2_10124577 | |||
| 1027 | rootH2_10141161 | |||
| 1028 | rootH2_10302688 | |||
| 1029 | rootL2_10075112 | |||
| 1030 | rootL2_10151353 | |||
| 1031 | rootH1_10116033 | |||
| 1032 | rootH1_10180417 | |||
| 1033 | Ga0065704_10137972 | |||
| 1034 | Ga0065712_10004405 | |||
| 1035 | Ga0065712_10088217 | |||
| 1036 | Ga0065712_10088553 | |||
| 1037 | Ga0065707_10095261 | |||
| 1038 | Ga0065707_10187191 | |||
| 1039 | Ga0070658_10004172 | |||
| 1040 | Ga0070658_10012200 | |||
| 1041 | Ga0070658_10037858 | |||
| 1042 | Ga0070658_10118629 | |||
| 1043 | Ga0070658_10318728 | |||
| 1044 | Ga0070676_10002107 | |||
| 1045 | Ga0070676_10002849 | |||
| 1046 | Ga0070676_10004254 | |||
| 1047 | Ga0070676_10056115 | |||
| 1048 | Ga0070676_10229011 | |||
| 1049 | Ga0070676_10293130 | |||
| 1050 | Ga0070683_100000733 | |||
| 1051 | Ga0070683_100006637 | |||
| 1052 | Ga0070683_100186516 | |||
| 1053 | Ga0070683_100199103 | |||
| 1054 | Ga0070683_100337580 | |||
| 1055 | Ga0070690_100001725 | |||
| 1056 | Ga0070690_100220976 | |||
| 1057 | Ga0070670_100085595 | |||
| 1058 | Ga0070670_100095612 | |||
| 1059 | Ga0070670_100140002 | |||
| 1060 | Ga0070670_100631707 | |||
| 1061 | Ga0070677_10005153 | |||
| 1062 | Ga0070677_10123988 | |||
| 1063 | Ga0068869_100003072 | |||
| 1064 | Ga0068869_100017669 | |||
| 1065 | Ga0068869_100019157 | |||
| 1066 | Ga0068869_100019973 | |||
| 1067 | Ga0068869_100029763 | |||
| 1068 | Ga0068869_100050549 | |||
| 1069 | Ga0068869_100064003 | |||
| 1070 | Ga0068869_100082904 | |||
| 1071 | Ga0070666_10000019 | |||
| 1072 | Ga0070666_10000431 | |||
| 1073 | Ga0070666_10001320 | |||
| 1074 | Ga0070666_10029058 | |||
| 1075 | Ga0070666_10199921 | |||
| 1076 | Ga0070666_10374338 | |||
| 1077 | Ga0070680_100000107 | |||
| 1078 | Ga0070680_100001923 | |||
| 1079 | Ga0070680_100014332 | |||
| 1080 | Ga0070680_100015370 | |||
| 1081 | Ga0070680_100626699 | |||
| 1082 | Ga0070682_100001037 | |||
| 1083 | Ga0070682_100006418 | |||
| 1084 | Ga0068868_100006700 | |||
| 1085 | Ga0068868_100017482 | |||
| 1086 | Ga0068868_100018963 | |||
| 1087 | Ga0068868_100019164 | |||
| 1088 | Ga0068868_100020261 | |||
| 1089 | Ga0068868_100051395 | |||
| 1090 | Ga0068868_100064467 | |||
| 1091 | Ga0068868_100142364 | |||
| 1092 | Ga0068868_100241367 | |||
| 1093 | Ga0070660_100035750 | |||
| 1094 | Ga0070660_100116538 | |||
| 1095 | Ga0070660_100129667 | |||
| 1096 | Ga0070689_100030806 | |||
| 1097 | Ga0070689_100171716 | |||
| 1098 | Ga0070689_100215909 | |||
| 1099 | Ga0070691_10009545 | |||
| 1100 | Ga0070687_100002867 | |||
| 1101 | Ga0070687_100114265 | |||
| 1102 | Ga0070661_100002552 | |||
| 1103 | Ga0070661_100005772 | |||
| 1104 | Ga0070668_100000016 | |||
| 1105 | Ga0070668_100004457 | |||
| 1106 | Ga0070668_100008315 | |||
| 1107 | Ga0070668_100050861 | |||
| 1108 | Ga0070668_100091160 | |||
| 1109 | Ga0070669_100003666 | |||
| 1110 | Ga0070669_100026138 | |||
| 1111 | Ga0070669_100154125 | |||
| 1112 | Ga0070675_100011140 | |||
| 1113 | Ga0070675_100119246 | |||
| 1114 | Ga0070675_100551852 | |||
| 1115 | Ga0070671_100001080 | |||
| 1116 | Ga0070671_100030290 | |||
| 1117 | Ga0070671_100031103 | |||
| 1118 | Ga0070671_100054175 | |||
| 1119 | Ga0070671_100088138 | |||
| 1120 | Ga0070671_100100992 | |||
| 1121 | Ga0070671_100135944 | |||
| 1122 | Ga0070671_100377235 | |||
| 1123 | Ga0070674_100052045 | |||
| 1124 | Ga0070674_100086181 | |||
| 1125 | Ga0070673_100000074 | |||
| 1126 | Ga0070673_100001615 | |||
| 1127 | Ga0070673_100009502 | |||
| 1128 | Ga0070673_100013794 | |||
| 1129 | Ga0070673_100023455 | |||
| 1130 | Ga0070673_100056459 | |||
| 1131 | Ga0070673_100101432 | |||
| 1132 | Ga0070673_100111062 | |||
| 1133 | Ga0070673_100164353 | |||
| 1134 | Ga0070673_100230785 | |||
| 1135 | Ga0070688_100020563 | |||
| 1136 | Ga0070688_100022677 | |||
| 1137 | Ga0070688_100026517 | |||
| 1138 | Ga0070688_100029179 | |||
| 1139 | Ga0070688_100163871 | |||
| 1140 | Ga0070688_100443111 | |||
| 1141 | Ga0070659_100016533 | |||
| 1142 | Ga0070659_100040983 | |||
| 1143 | Ga0070659_100186913 | |||
| 1144 | Ga0070659_100639398 | |||
| 1145 | Ga0070667_100000031 | |||
| 1146 | Ga0070667_100011157 | |||
| 1147 | Ga0070667_100019874 | |||
| 1148 | Ga0070667_100037664 | |||
| 1149 | Ga0070667_100038956 | |||
| 1150 | Ga0070667_100051045 | |||
| 1151 | Ga0070667_100133115 | |||
| 1152 | Ga0070667_100142987 | |||
| 1153 | Ga0070667_100173510 | |||
| 1154 | Ga0070667_100308232 | |||
| 1155 | Ga0070667_100388944 | |||
| 1156 | Ga0070701_10074045 | |||
| 1157 | Ga0070700_100039021 | |||
| 1158 | Ga0070700_100121349 | |||
| 1159 | Ga0070663_100503931 | |||
| 1160 | Ga0070678_100027233 | |||
| 1161 | Ga0070678_100029345 | |||
| 1162 | Ga0070662_100005977 | |||
| 1163 | Ga0070662_100009556 | |||
| 1164 | Ga0070662_100016955 | |||
| 1165 | Ga0070662_100032379 | |||
| 1166 | Ga0070662_100108208 | |||
| 1167 | Ga0070662_100626545 | |||
| 1168 | Ga0070681_10004510 | |||
| 1169 | Ga0070681_10129950 | |||
| 1170 | Ga0070681_10270212 | |||
| 1171 | Ga0070681_10403441 | |||
| 1172 | Ga0068867_100002817 | |||
| 1173 | Ga0068867_100016371 | |||
| 1174 | Ga0068867_100022655 | |||
| 1175 | Ga0068867_100049634 | |||
| 1176 | Ga0068867_100055889 | |||
| 1177 | Ga0068867_100076256 | |||
| 1178 | Ga0068867_100171004 | |||
| 1179 | Ga0068867_100259404 | |||
| 1180 | Ga0068867_100385585 | |||
| 1181 | Ga0070685_10009380 | |||
| 1182 | Ga0070685_10043514 | |||
| 1183 | Ga0070685_10091388 | |||
| 1184 | Ga0070698_100002896 | |||
| 1185 | Ga0070698_100022651 | |||
| 1186 | Ga0070698_100487323 | |||
| 1187 | Ga0070698_100510230 | |||
| 1188 | Ga0070699_100573555 | |||
| 1189 | Ga0070679_100000649 | |||
| 1190 | Ga0070679_100001472 | |||
| 1191 | Ga0070679_100005664 | |||
| 1192 | Ga0070679_100025034 | |||
| 1193 | Ga0070679_100033752 | |||
| 1194 | Ga0070679_100052145 | |||
| 1195 | Ga0070679_100352773 | |||
| 1196 | Ga0070684_100000042 | |||
| 1197 | Ga0070684_100013993 | |||
| 1198 | Ga0070684_100106312 | |||
| 1199 | Ga0070684_100114673 | |||
| 1200 | Ga0068853_100000970 | |||
| 1201 | Ga0068853_100002162 | |||
| 1202 | Ga0068853_100006594 | |||
| 1203 | Ga0068853_100011359 | |||
| 1204 | Ga0068853_100033559 | |||
| 1205 | Ga0068853_100062879 | |||
| 1206 | Ga0068853_100715431 | |||
| 1207 | Ga0070672_100000002 | |||
| 1208 | Ga0070672_100034829 | |||
| 1209 | Ga0070672_100056554 | |||
| 1210 | Ga0070672_100357312 | |||
| 1211 | Ga0070686_100185006 | |||
| 1212 | Ga0070686_100254180 | |||
| 1213 | Ga0070693_100005131 | |||
| 1214 | Ga0070693_100071355 | |||
| 1215 | Ga0070693_100103876 | |||
| 1216 | Ga0070665_100000018 | |||
| 1217 | Ga0070665_100000222 | |||
| 1218 | Ga0070665_100099138 | |||
| 1219 | Ga0070665_100175546 | |||
| 1220 | Ga0070665_100491477 | |||
| 1221 | Ga0070704_100186800 | |||
| 1222 | Ga0068855_100001631 | |||
| 1223 | Ga0068855_100002114 | |||
| 1224 | Ga0068855_100004970 | |||
| 1225 | Ga0068855_100010722 | |||
| 1226 | Ga0068855_100015014 | |||
| 1227 | Ga0068855_100032740 | |||
| 1228 | Ga0068855_100043160 | |||
| 1229 | Ga0068855_100086863 | |||
| 1230 | Ga0068855_100096440 | |||
| 1231 | Ga0068855_100104181 | |||
| 1232 | Ga0068855_100928517 | |||
| 1233 | Ga0070664_100003309 | |||
| 1234 | Ga0070664_100010019 | |||
| 1235 | Ga0070664_100071498 | |||
| 1236 | Ga0070664_100077722 | |||
| 1237 | Ga0070664_100122803 | |||
| 1238 | Ga0070664_100124396 | |||
| 1239 | Ga0070664_100357277 | |||
| 1240 | Ga0070664_100428081 | |||
| 1241 | Ga0070664_100476909 | |||
| 1242 | Ga0068857_100002170 | |||
| 1243 | Ga0068857_100003554 | |||
| 1244 | Ga0068857_100018861 | |||
| 1245 | Ga0068857_100033149 | |||
| 1246 | Ga0068857_100043159 | |||
| 1247 | Ga0068857_100172730 | |||
| 1248 | Ga0068857_100247378 | |||
| 1249 | Ga0068857_100367034 | |||
| 1250 | Ga0068857_100476081 | |||
| 1251 | Ga0068854_100016365 | |||
| 1252 | Ga0068854_100041815 | |||
| 1253 | Ga0068854_100052918 | |||
| 1254 | Ga0068854_100153882 | |||
| 1255 | Ga0068856_100063602 | |||
| 1256 | Ga0068856_100105150 | |||
| 1257 | Ga0070702_100007334 | |||
| 1258 | Ga0068852_100000454 | |||
| 1259 | Ga0068852_100000897 | |||
| 1260 | Ga0068852_100005402 | |||
| 1261 | Ga0068852_100022105 | |||
| 1262 | Ga0068852_100054691 | |||
| 1263 | Ga0068852_100059036 | |||
| 1264 | Ga0068852_100084720 | |||
| 1265 | Ga0068852_100295253 | |||
| 1266 | Ga0068859_100000013 | |||
| 1267 | Ga0068859_100012739 | |||
| 1268 | Ga0068859_100048089 | |||
| 1269 | Ga0068859_100124653 | |||
| 1270 | Ga0068859_100125542 | |||
| 1271 | Ga0068859_100170477 | |||
| 1272 | Ga0068859_100218710 | |||
| 1273 | Ga0068864_100002308 | |||
| 1274 | Ga0068864_100006247 | |||
| 1275 | Ga0068864_100019202 | |||
| 1276 | Ga0068864_100022125 | |||
| 1277 | Ga0068864_100069185 | |||
| 1278 | Ga0068864_100102858 | |||
| 1279 | Ga0068864_100211011 | |||
| 1280 | Ga0068864_100357185 | |||
| 1281 | Ga0068866_10063215 | |||
| 1282 | Ga0068866_10070892 | |||
| 1283 | Ga0068861_100000263 | |||
| 1284 | Ga0068861_100007396 | |||
| 1285 | Ga0068861_100022693 | |||
| 1286 | Ga0068861_100135312 | |||
| 1287 | Ga0068851_10000266 | |||
| 1288 | Ga0068851_10073359 | |||
| 1289 | Ga0068851_10235095 | |||
| 1290 | Ga0068870_10003801 | |||
| 1291 | Ga0068863_100006676 | |||
| 1292 | Ga0068863_100021150 | |||
| 1293 | Ga0068863_100043437 | |||
| 1294 | Ga0068863_100127555 | |||
| 1295 | Ga0068858_100001512 | |||
| 1296 | Ga0068858_100032009 | |||
| 1297 | Ga0068858_100033804 | |||
| 1298 | Ga0068858_100055209 | |||
| 1299 | Ga0068858_100139932 | |||
| 1300 | Ga0068860_100000040 | |||
| 1301 | Ga0068860_100003779 | |||
| 1302 | Ga0068860_100006979 | |||
| 1303 | Ga0068860_100008512 | |||
| 1304 | Ga0068860_100014542 | |||
| 1305 | Ga0068860_100248586 | |||
| 1306 | Ga0068860_100348428 | |||
| 1307 | Ga0068860_100351029 | |||
| 1308 | Ga0068862_100001322 | |||
| 1309 | Ga0068862_100051379 | |||
| 1310 | Ga0068862_100067053 | |||
| 1311 | Ga0068862_100097507 | |||
| 1312 | Ga0081539_10001855 | |||
| 1313 | Ga0070715_10020003 | |||
| 1314 | Ga0075366_10021978 | |||
| 1315 | Ga0097621_100000129 | |||
| 1316 | Ga0097621_100000265 | |||
| 1317 | Ga0097621_100000691 | |||
| 1318 | Ga0097621_100038342 | |||
| 1319 | Ga0097621_100064650 | |||
| 1320 | Ga0097621_100080649 | |||
| 1321 | Ga0097621_100222161 | |||
| 1322 | Ga0068871_100000075 | |||
| 1323 | Ga0068871_100002241 | |||
| 1324 | Ga0068871_100038242 | |||
| 1325 | Ga0068871_100076090 | |||
| 1326 | Ga0068871_100076857 | |||
| 1327 | Ga0068871_100087143 | |||
| 1328 | Ga0068871_100099179 | |||
| 1329 | Ga0068871_100121128 | |||
| 1330 | Ga0068871_100287158 | |||
| 1331 | Ga0068871_100851539 | |||
| 1332 | Ga0075428_100018150 | |||
| 1333 | Ga0075428_100081003 | |||
| 1334 | Ga0075428_100148594 | |||
| 1335 | Ga0075431_100017541 | |||
| 1336 | Ga0075431_100122089 | |||
| 1337 | Ga0075433_10171972 | |||
| 1338 | Ga0075429_100002510 | |||
| 1339 | Ga0075429_100006828 | |||
| 1340 | Ga0075429_100240176 | |||
| 1341 | Ga0075429_100428022 | |||
| 1342 | Ga0068865_100001410 | |||
| 1343 | Ga0068865_100027382 | |||
| 1344 | Ga0068865_100052708 | |||
| 1345 | Ga0068865_100097945 | |||
| 1346 | Ga0068865_100131817 | |||
| 1347 | Ga0068865_100150684 | |||
| 1348 | Ga0097620_100000013 | |||
| 1349 | Ga0097620_100012739 | |||
| 1350 | Ga0097620_100048089 | |||
| 1351 | Ga0097620_100124658 | |||
| 1352 | Ga0097620_100125542 | |||
| 1353 | Ga0097620_100170467 | |||
| 1354 | Ga0097620_100218715 | |||
| 1355 | Ga0105251_10122727 | |||
| 1356 | Ga0105240_10000764 | |||
| 1357 | Ga0105240_10002342 | |||
| 1358 | Ga0105240_10002370 | |||
| 1359 | Ga0105240_10002578 | |||
| 1360 | Ga0105240_10010140 | |||
| 1361 | Ga0105240_10055426 | |||
| 1362 | Ga0105240_10056515 | |||
| 1363 | Ga0105240_10067888 | |||
| 1364 | Ga0105240_10488698 | |||
| 1365 | Ga0105240_10489312 | |||
| 1366 | Ga0105240_10737823 | |||
| 1367 | Ga0105240_10825637 | |||
| 1368 | Ga0111539_10004492 | |||
| 1369 | Ga0111539_10035513 | |||
| 1370 | Ga0111539_10187310 | |||
| 1371 | Ga0105245_10081287 | |||
| 1372 | Ga0105245_10167360 | |||
| 1373 | Ga0105247_10002182 | |||
| 1374 | Ga0105247_10017033 | |||
| 1375 | Ga0105247_10066726 | |||
| 1376 | Ga0114129_10040732 | |||
| 1377 | Ga0114129_10448929 | |||
| 1378 | Ga0105243_10618554 | |||
| 1379 | Ga0105241_10000332 | |||
| 1380 | Ga0105241_10000732 | |||
| 1381 | Ga0105241_10004448 | |||
| 1382 | Ga0105241_10007660 | |||
| 1383 | Ga0105241_10019442 | |||
| 1384 | Ga0105241_10036623 | |||
| 1385 | Ga0105241_10041888 | |||
| 1386 | Ga0105241_10264052 | |||
| 1387 | Ga0105241_10575932 | |||
| 1388 | Ga0105242_10042295 | |||
| 1389 | Ga0105242_10046969 | |||
| 1390 | Ga0105242_10047012 | |||
| 1391 | Ga0105242_10063975 | |||
| 1392 | Ga0105242_10116300 | |||
| 1393 | Ga0105242_10588273 | |||
| 1394 | Ga0105248_10044098 | |||
| 1395 | Ga0105248_10046187 | |||
| 1396 | Ga0105248_10063473 | |||
| 1397 | Ga0105248_10168772 | |||
| 1398 | Ga0105248_10268880 | |||
| 1399 | Ga0105237_10000186 | |||
| 1400 | Ga0105237_10003399 | |||
| 1401 | Ga0105237_10006995 | |||
| 1402 | Ga0105237_10007035 | |||
| 1403 | Ga0105237_10010817 | |||
| 1404 | Ga0105237_10101699 | |||
| 1405 | Ga0105237_10132499 | |||
| 1406 | Ga0105237_10207160 | |||
| 1407 | Ga0105238_10000643 | |||
| 1408 | Ga0105238_10027176 | |||
| 1409 | Ga0105238_10720570 | |||
| 1410 | Ga0105249_10000769 | |||
| 1411 | Ga0105249_10027071 | |||
| 1412 | Ga0105249_10037188 | |||
| 1413 | Ga0105249_10207614 | |||
| 1414 | Ga0105249_10321973 | |||
| 1415 | Ga0105249_10460955 | |||
| 1416 | Ga0105249_10718177 | |||
| 1417 | Ga0105239_10000383 | |||
| 1418 | Ga0105239_10000998 | |||
| 1419 | Ga0105239_10001030 | |||
| 1420 | Ga0105239_10001834 | |||
| 1421 | Ga0105239_10015572 | |||
| 1422 | Ga0105239_10080681 | |||
| 1423 | Ga0105239_10166006 | |||
| 1424 | Ga0105239_10191818 | |||
| 1425 | Ga0105239_10338862 | |||
| 1426 | Ga0105239_10579804 | |||
| 1427 | Ga0105246_10122390 | |||
| 1428 | Ga0105246_10165767 | |||
| 1429 | Ga0105246_10203064 | |||
| 1430 | Ga0105246_10387600 | |||
| 1431 | Ga0157373_10000592 | |||
| 1432 | Ga0157373_10015279 | |||
| 1433 | Ga0157373_10048226 | |||
| 1434 | Ga0157373_10075089 | |||
| 1435 | Ga0157373_10131244 | |||
| 1436 | Ga0157373_10136246 | |||
| 1437 | Ga0157371_10000871 | |||
| 1438 | Ga0157371_10002782 | |||
| 1439 | Ga0157371_10005842 | |||
| 1440 | Ga0157371_10010900 | |||
| 1441 | Ga0157371_10015265 | |||
| 1442 | Ga0157371_10023766 | |||
| 1443 | Ga0157371_10027518 | |||
| 1444 | Ga0157371_10070004 | |||
| 1445 | Ga0157371_10160951 | |||
| 1446 | Ga0157371_10275132 | |||
| 1447 | Ga0157370_10001420 | |||
| 1448 | Ga0157370_10001901 | |||
| 1449 | Ga0157370_10002379 | |||
| 1450 | Ga0157370_10014087 | |||
| 1451 | Ga0157370_10042144 | |||
| 1452 | Ga0157370_10205534 | |||
| 1453 | Ga0157370_10263464 | |||
| 1454 | Ga0157370_10344234 | |||
| 1455 | Ga0157370_10413741 | |||
| 1456 | Ga0157370_10461107 | |||
| 1457 | Ga0157369_10004162 | |||
| 1458 | Ga0157369_10019866 | |||
| 1459 | Ga0157369_10026644 | |||
| 1460 | Ga0157369_10061895 | |||
| 1461 | Ga0157369_10069571 | |||
| 1462 | Ga0157369_10072358 | |||
| 1463 | Ga0157369_10079761 | |||
| 1464 | Ga0157369_10151309 | |||
| 1465 | Ga0157369_10178264 | |||
| 1466 | Ga0157369_10313600 | |||
| 1467 | Ga0157369_10461348 | |||
| 1468 | Ga0157369_10548927 | |||
| 1469 | Ga0157374_10000074 | |||
| 1470 | Ga0157374_10000485 | |||
| 1471 | Ga0157374_10001889 | |||
| 1472 | Ga0157374_10002204 | |||
| 1473 | Ga0157374_10110336 | |||
| 1474 | Ga0157374_10384332 | |||
| 1475 | Ga0157378_10002516 | |||
| 1476 | Ga0157378_10003959 | |||
| 1477 | Ga0157378_10009583 | |||
| 1478 | Ga0157378_10036718 | |||
| 1479 | Ga0157378_10055535 | |||
| 1480 | Ga0157378_10078001 | |||
| 1481 | Ga0157378_10155311 | |||
| 1482 | Ga0157378_10189659 | |||
| 1483 | Ga0157378_10317393 | |||
| 1484 | Ga0157378_10486718 | |||
| 1485 | Ga0163162_10000029 | |||
| 1486 | Ga0163162_10000722 | |||
| 1487 | Ga0163162_10001415 | |||
| 1488 | Ga0163162_10001629 | |||
| 1489 | Ga0163162_10003780 | |||
| 1490 | Ga0163162_10004434 | |||
| 1491 | Ga0163162_10011885 | |||
| 1492 | Ga0163162_10140782 | |||
| 1493 | Ga0163162_10154130 | |||
| 1494 | Ga0163162_10229749 | |||
| 1495 | Ga0163162_10764644 | |||
| 1496 | Ga0157372_10001369 | |||
| 1497 | Ga0157372_10011361 | |||
| 1498 | Ga0157372_10015406 | |||
| 1499 | Ga0157372_10018095 | |||
| 1500 | Ga0157372_10029230 | |||
| 1501 | Ga0157372_10033207 | |||
| 1502 | Ga0157372_10049933 | |||
| 1503 | Ga0157372_10073071 | |||
| 1504 | Ga0157372_10073148 | |||
| 1505 | Ga0157372_10096195 | |||
| 1506 | Ga0157372_10151514 | |||
| 1507 | Ga0157372_10240712 | |||
| 1508 | Ga0157372_10248148 | |||
| 1509 | Ga0157372_10308336 | |||
| 1510 | Ga0157372_10354104 | |||
| 1511 | Ga0157372_10380717 | |||
| 1512 | Ga0157372_10389684 | |||
| 1513 | Ga0157372_10451363 | |||
| 1514 | Ga0157372_10504347 | |||
| 1515 | Ga0157372_11072301 | |||
| 1516 | Ga0157375_10000042 | |||
| 1517 | Ga0157375_10000327 | |||
| 1518 | Ga0157375_10004733 | |||
| 1519 | Ga0157375_10021850 | |||
| 1520 | Ga0157375_10025947 | |||
| 1521 | Ga0157375_10031233 | |||
| 1522 | Ga0157375_10032852 | |||
| 1523 | Ga0157375_10041944 | |||
| 1524 | Ga0157375_10085466 | |||
| 1525 | Ga0157375_10180003 | |||
| 1526 | Ga0157375_10293033 | |||
| 1527 | Ga0157375_10321422 | |||
| 1528 | Ga0157375_10490441 | |||
| 1529 | Ga0163163_10000057 | |||
| 1530 | Ga0163163_10000076 | |||
| 1531 | Ga0163163_10000191 | |||
| 1532 | Ga0163163_10051637 | |||
| 1533 | Ga0163163_10200349 | |||
| 1534 | Ga0163163_10283262 | |||
| 1535 | Ga0163163_10451538 | |||
| 1536 | Ga0163163_10463143 | |||
| 1537 | Ga0163163_10922184 | |||
| 1538 | Ga0157380_10001582 | |||
| 1539 | Ga0157380_10036439 | |||
| 1540 | Ga0157380_10075295 | |||
| 1541 | Ga0157380_10082886 | |||
| 1542 | Ga0157380_10133278 | |||
| 1543 | Ga0157380_10230726 | |||
| 1544 | Ga0157380_10356740 | |||
| 1545 | Ga0157380_10383958 | |||
| 1546 | Ga0157377_10003530 | |||
| 1547 | Ga0157377_10054229 | |||
| 1548 | Ga0157377_10079328 | |||
| 1549 | Ga0157377_10105420 | |||
| 1550 | Ga0157379_10000016 | |||
| 1551 | Ga0157379_10019210 | |||
| 1552 | Ga0157379_10019690 | |||
| 1553 | Ga0157379_10026182 | |||
| 1554 | Ga0157379_10054972 | |||
| 1555 | Ga0157379_10064395 | |||
| 1556 | Ga0157379_10132025 | |||
| 1557 | Ga0157379_10301242 | |||
| 1558 | Ga0157379_10333534 | |||
| 1559 | Ga0157379_10399688 | |||
| 1560 | Ga0157379_10452354 | |||
| 1561 | Ga0157376_10000067 | |||
| 1562 | Ga0157376_10000750 | |||
| 1563 | Ga0157376_10002602 | |||
| 1564 | Ga0157376_10007686 | |||
| 1565 | Ga0157376_10038039 | |||
| 1566 | Ga0157376_10080456 | |||
| 1567 | Ga0157376_10140677 | |||
| 1568 | Ga0157376_10190081 | |||
| 1569 | Ga0157376_10324834 | |||
| 1570 | Ga0157376_10722136 | |||
| 1571 | Ga0163161_10001316 | |||
| 1572 | Ga0163161_10003300 | |||
| 1573 | Ga0163161_10010526 | |||
| 1574 | Ga0163161_10026135 | |||
| 1575 | Ga0163161_10042637 | |||
| 1576 | Ga0163161_10087585 | |||
| 1577 | Ga0163161_10125757 | |||
| 1578 | Ga0163161_10149206 | |||
| 1579 | Ga0163161_10326908 | |||
| 1580 | Ga0213876_10000744 | |||
| 1581 | Ga0213876_10190109 | |||
| 1582 | Ga0209646_1003841 | |||
| 1583 | Ga0207697_10102315 | |||
| 1584 | Ga0207656_10002125 | |||
| 1585 | Ga0207656_10011530 | |||
| 1586 | Ga0207656_10062951 | |||
| 1587 | Ga0207682_10019896 | |||
| 1588 | Ga0207642_10064781 | |||
| 1589 | Ga0207710_10000509 | |||
| 1590 | Ga0207710_10014674 | |||
| 1591 | Ga0207688_10009016 | |||
| 1592 | Ga0207680_10000113 | |||
| 1593 | Ga0207680_10004520 | |||
| 1594 | Ga0207680_10041720 | |||
| 1595 | Ga0207680_10084126 | |||
| 1596 | Ga0207680_10186426 | |||
| 1597 | Ga0207680_10213250 | |||
| 1598 | Ga0207647_10012210 | |||
| 1599 | Ga0207647_10034068 | |||
| 1600 | Ga0207647_10063404 | |||
| 1601 | Ga0207647_10065168 | |||
| 1602 | Ga0207645_10002261 | |||
| 1603 | Ga0207645_10003999 | |||
| 1604 | Ga0207645_10004232 | |||
| 1605 | Ga0207645_10009532 | |||
| 1606 | Ga0207645_10098015 | |||
| 1607 | Ga0207645_10301678 | |||
| 1608 | Ga0207643_10003464 | |||
| 1609 | Ga0207643_10004044 | |||
| 1610 | Ga0207643_10068286 | |||
| 1611 | Ga0207705_10003723 | |||
| 1612 | Ga0207705_10010378 | |||
| 1613 | Ga0207705_10024243 | |||
| 1614 | Ga0207705_10027502 | |||
| 1615 | Ga0207705_10113402 | |||
| 1616 | Ga0207705_10133542 | |||
| 1617 | Ga0207654_10001764 | |||
| 1618 | Ga0207654_10011564 | |||
| 1619 | Ga0207654_10117616 | |||
| 1620 | Ga0207654_10202818 | |||
| 1621 | Ga0207707_10002252 | |||
| 1622 | Ga0207707_10057337 | |||
| 1623 | Ga0207707_10427807 | |||
| 1624 | Ga0207695_10000146 | |||
| 1625 | Ga0207695_10000248 | |||
| 1626 | Ga0207695_10000260 | |||
| 1627 | Ga0207695_10000710 | |||
| 1628 | Ga0207695_10016758 | |||
| 1629 | Ga0207695_10026531 | |||
| 1630 | Ga0207695_10040192 | |||
| 1631 | Ga0207695_10056419 | |||
| 1632 | Ga0207695_10060927 | |||
| 1633 | Ga0207695_10099349 | |||
| 1634 | Ga0207695_10208239 | |||
| 1635 | Ga0207695_10350354 | |||
| 1636 | Ga0207671_10000521 | |||
| 1637 | Ga0207671_10000965 | |||
| 1638 | Ga0207671_10002094 | |||
| 1639 | Ga0207671_10003532 | |||
| 1640 | Ga0207671_10003806 | |||
| 1641 | Ga0207671_10040761 | |||
| 1642 | Ga0207660_10006176 | |||
| 1643 | Ga0207660_10025200 | |||
| 1644 | Ga0207660_10053300 | |||
| 1645 | Ga0207662_10025239 | |||
| 1646 | Ga0207662_10035660 | |||
| 1647 | Ga0207657_10013299 | |||
| 1648 | Ga0207657_10070202 | |||
| 1649 | Ga0207657_10158828 | |||
| 1650 | Ga0207657_10432351 | |||
| 1651 | Ga0207657_10516058 | |||
| 1652 | Ga0207649_10017071 | |||
| 1653 | Ga0207652_10000010 | |||
| 1654 | Ga0207652_10000614 | |||
| 1655 | Ga0207652_10000915 | |||
| 1656 | Ga0207652_10019149 | |||
| 1657 | Ga0207652_10027606 | |||
| 1658 | Ga0207652_10037463 | |||
| 1659 | Ga0207652_10399999 | |||
| 1660 | Ga0207681_10043809 | |||
| 1661 | Ga0207681_10367934 | |||
| 1662 | Ga0207694_10015681 | |||
| 1663 | Ga0207694_10312328 | |||
| 1664 | Ga0207694_10498773 | |||
| 1665 | Ga0207650_10019198 | |||
| 1666 | Ga0207650_10020013 | |||
| 1667 | Ga0207650_10045051 | |||
| 1668 | Ga0207650_10091698 | |||
| 1669 | Ga0207650_10187749 | |||
| 1670 | Ga0207650_10333321 | |||
| 1671 | Ga0207659_10009504 | |||
| 1672 | Ga0207659_10024619 | |||
| 1673 | Ga0207659_10044936 | |||
| 1674 | Ga0207659_10162948 | |||
| 1675 | Ga0207659_10414719 | |||
| 1676 | Ga0207687_10286967 | |||
| 1677 | Ga0207644_10003988 | |||
| 1678 | Ga0207644_10030573 | |||
| 1679 | Ga0207644_10060722 | |||
| 1680 | Ga0207644_10092630 | |||
| 1681 | Ga0207644_10114048 | |||
| 1682 | Ga0207690_10022415 | |||
| 1683 | Ga0207690_10178449 | |||
| 1684 | Ga0207706_10010077 | |||
| 1685 | Ga0207706_10023314 | |||
| 1686 | Ga0207706_10042504 | |||
| 1687 | Ga0207706_10048402 | |||
| 1688 | Ga0207706_10054278 | |||
| 1689 | Ga0207706_10106743 | |||
| 1690 | Ga0207686_10002335 | |||
| 1691 | Ga0207686_10029738 | |||
| 1692 | Ga0207686_10169268 | |||
| 1693 | Ga0207686_10445986 | |||
| 1694 | Ga0207686_10631766 | |||
| 1695 | Ga0207670_10014456 | |||
| 1696 | Ga0207670_10024724 | |||
| 1697 | Ga0207670_10029467 | |||
| 1698 | Ga0207670_10397976 | |||
| 1699 | Ga0207669_10192153 | |||
| 1700 | Ga0207704_10001983 | |||
| 1701 | Ga0207704_10032131 | |||
| 1702 | Ga0207704_10041486 | |||
| 1703 | Ga0207704_10114194 | |||
| 1704 | Ga0207704_10183214 | |||
| 1705 | Ga0207691_10000004 | |||
| 1706 | Ga0207691_10003976 | |||
| 1707 | Ga0207691_10004916 | |||
| 1708 | Ga0207691_10040941 | |||
| 1709 | Ga0207691_10185014 | |||
| 1710 | Ga0207711_10093425 | |||
| 1711 | Ga0207711_10573031 | |||
| 1712 | Ga0207689_10000380 | |||
| 1713 | Ga0207689_10007555 | |||
| 1714 | Ga0207689_10012869 | |||
| 1715 | Ga0207689_10016563 | |||
| 1716 | Ga0207689_10040181 | |||
| 1717 | Ga0207689_10044288 | |||
| 1718 | Ga0207689_10051677 | |||
| 1719 | Ga0207689_10089848 | |||
| 1720 | Ga0207689_10309597 | |||
| 1721 | Ga0207661_10002059 | |||
| 1722 | Ga0207661_10006530 | |||
| 1723 | Ga0207661_10029407 | |||
| 1724 | Ga0207661_10122508 | |||
| 1725 | Ga0207661_10387913 | |||
| 1726 | Ga0207679_10003072 | |||
| 1727 | Ga0207679_10014884 | |||
| 1728 | Ga0207679_10035037 | |||
| 1729 | Ga0207679_10058657 | |||
| 1730 | Ga0207679_10202972 | |||
| 1731 | Ga0207679_10321148 | |||
| 1732 | Ga0207679_10365400 | |||
| 1733 | Ga0207667_10000150 | |||
| 1734 | Ga0207667_10000270 | |||
| 1735 | Ga0207667_10001158 | |||
| 1736 | Ga0207667_10015013 | |||
| 1737 | Ga0207667_10038496 | |||
| 1738 | Ga0207667_10070338 | |||
| 1739 | Ga0207667_10106284 | |||
| 1740 | Ga0207667_10189315 | |||
| 1741 | Ga0207667_10292385 | |||
| 1742 | Ga0207667_10819580 | |||
| 1743 | Ga0207651_10000456 | |||
| 1744 | Ga0207651_10026173 | |||
| 1745 | Ga0207651_10036940 | |||
| 1746 | Ga0207651_10037364 | |||
| 1747 | Ga0207651_10085796 | |||
| 1748 | Ga0207651_10116198 | |||
| 1749 | Ga0207712_10014473 | |||
| 1750 | Ga0207712_10284077 | |||
| 1751 | Ga0207668_10000112 | |||
| 1752 | Ga0207668_10061993 | |||
| 1753 | Ga0207668_10149608 | |||
| 1754 | Ga0207668_10161832 | |||
| 1755 | Ga0207640_10019401 | |||
| 1756 | Ga0207658_10000059 | |||
| 1757 | Ga0207658_10015422 | |||
| 1758 | Ga0207658_10016684 | |||
| 1759 | Ga0207658_10035939 | |||
| 1760 | Ga0207658_10043113 | |||
| 1761 | Ga0207658_10051982 | |||
| 1762 | Ga0207658_10060213 | |||
| 1763 | Ga0207658_10147397 | |||
| 1764 | Ga0207677_10002071 | |||
| 1765 | Ga0207677_10017440 | |||
| 1766 | Ga0207677_10043168 | |||
| 1767 | Ga0207677_10050170 | |||
| 1768 | Ga0207677_10316039 | |||
| 1769 | Ga0207677_10350930 | |||
| 1770 | Ga0207677_10427851 | |||
| 1771 | Ga0207703_10007561 | |||
| 1772 | Ga0207703_10012809 | |||
| 1773 | Ga0207703_10030505 | |||
| 1774 | Ga0207639_10005754 | |||
| 1775 | Ga0207639_10006511 | |||
| 1776 | Ga0207639_10021961 | |||
| 1777 | Ga0207639_10026251 | |||
| 1778 | Ga0207639_10199330 | |||
| 1779 | Ga0207678_10132020 | |||
| 1780 | Ga0207678_10215060 | |||
| 1781 | Ga0207678_10477381 | |||
| 1782 | Ga0207708_10068998 | |||
| 1783 | Ga0207708_10085510 | |||
| 1784 | Ga0207708_10088429 | |||
| 1785 | Ga0207708_10216894 | |||
| 1786 | Ga0207702_10010599 | |||
| 1787 | Ga0207702_10056253 | |||
| 1788 | Ga0207702_10123476 | |||
| 1789 | Ga0207641_10001801 | |||
| 1790 | Ga0207641_10004380 | |||
| 1791 | Ga0207641_10052245 | |||
| 1792 | Ga0207641_10088556 | |||
| 1793 | Ga0207641_10091540 | |||
| 1794 | Ga0207641_10097787 | |||
| 1795 | Ga0207641_10311954 | |||
| 1796 | Ga0207648_10000860 | |||
| 1797 | Ga0207648_10001923 | |||
| 1798 | Ga0207648_10012454 | |||
| 1799 | Ga0207648_10052241 | |||
| 1800 | Ga0207648_10065308 | |||
| 1801 | Ga0207648_10087386 | |||
| 1802 | Ga0207648_10113835 | |||
| 1803 | Ga0207648_10237880 | |||
| 1804 | Ga0207648_10374060 | |||
| 1805 | Ga0207648_10386905 | |||
| 1806 | Ga0207676_10008702 | |||
| 1807 | Ga0207676_10013797 | |||
| 1808 | Ga0207676_10016787 | |||
| 1809 | Ga0207676_10022542 | |||
| 1810 | Ga0207676_10029792 | |||
| 1811 | Ga0207676_10099027 | |||
| 1812 | Ga0207674_10002283 | |||
| 1813 | Ga0207674_10003937 | |||
| 1814 | Ga0207674_10005172 | |||
| 1815 | Ga0207674_10028290 | |||
| 1816 | Ga0207674_10050319 | |||
| 1817 | Ga0207674_10116151 | |||
| 1818 | Ga0207675_100003567 | |||
| 1819 | Ga0207675_100006377 | |||
| 1820 | Ga0207675_100022057 | |||
| 1821 | Ga0207675_100033665 | |||
| 1822 | Ga0207675_100195803 | |||
| 1823 | Ga0207675_100295478 | |||
| 1824 | Ga0207675_100308272 | |||
| 1825 | Ga0207675_100328074 | |||
| 1826 | Ga0207675_100470526 | |||
| 1827 | Ga0207675_100523979 | |||
| 1828 | Ga0207683_10011079 | |||
| 1829 | Ga0207683_10069428 | |||
| 1830 | Ga0207683_10434513 | |||
| 1831 | Ga0207698_10000927 | |||
| 1832 | Ga0207698_10002400 | |||
| 1833 | Ga0207698_10003417 | |||
| 1834 | Ga0207698_10033104 | |||
| 1835 | Ga0207698_10036259 | |||
| 1836 | Ga0207698_10286661 | |||
| 1837 | Ga0207698_10516384 | |||
| 1838 | Ga0209995_1015084 | |||
| 1839 | Ga0207428_10024798 | |||
| 1840 | Ga0268266_10000026 | |||
| 1841 | Ga0268266_10004701 | |||
| 1842 | Ga0268266_10042453 | |||
| 1843 | Ga0268265_10038667 | |||
| 1844 | Ga0268265_10054473 | |||
| 1845 | Ga0268265_10101357 | |||
| 1846 | Ga0268264_10000019 | |||
| 1847 | Ga0268264_10003138 | |||
| 1848 | Ga0268264_10005971 | |||
| 1849 | Ga0268264_10010782 | |||
| 1850 | Ga0268264_10055060 | |||
| 1851 | Ga0268264_10105320 | |||
| 1852 | Ga0268264_10297439 | |||
| 1853 | Ga0268264_10414455 | |||
| 1854 | Ga0307511_10001046 | |||
| 1855 | Ga0307511_10003234 | |||
| 1856 | Ga0265327_10000456 | |||
| 1857 | Ga0307513_10103557 | |||
| 1858 | Ga0307513_10163615 | |||
| 1859 | Ga0307513_10304070 | |||
| 1860 | Ga0307509_10011961 | |||
| 1861 | Ga0307509_10087560 | |||
| 1862 | Ga0307509_10093188 | |||
| 1863 | Ga0265313_10008857 | |||
| 1864 | Ga0307508_10010810 | |||
| 1865 | Ga0307516_10000496 | |||
| 1866 | Ga0307516_10114993 | |||
| 1867 | Ga0307407_10124583 | |||
| 1868 | Ga0307416_100471183 | |||
| 1869 | Ga0307415_100019348 | |||
| 1870 | Ga0307510_10000165 | |||
| 1871 | Ga0373955_0082204 | |||
| 1872 | Ga0373935_0099614 | |||
| 1873 | Ga0373937_0017088 | |||
| 1874 | Ga0373937_0050889 | |||
| 1875 | Ga0373937_0124391 | |||
| 1876 | Ga0395899_0000248 | |||
| 1877 | Ga0395899_0020479 | |||
| 1878 | Ga0395899_0021277 | |||
| 1879 | Ga0395900_0001423 | |||
| 1880 | Ga0395900_0005223 | |||
| 1881 | Ga0395900_0031980 | |||
| 1882 | Ga0395900_0143527 | |||
| 1883 | Ga0395898_0003603 | |||
| 1884 | Ga0395898_0052782 | |||
| 1885 | Ga0395898_0079938 | |||
| 1886 | Ga0395905_0032301 | |||
| 1887 | Ga0395905_0138571 | |||
| 1888 | Ga0395901_0001028 | |||
| 1889 | Ga0395901_0081982 | |||
| 1890 | Ga0395901_0108485 | |||
| 1891 | Ga0395901_0229197 | |||
| 1892 | Ga0395901_0332571 | |||
| 1893 | Ga0436365_0142398 | |||
| 1894 | Ga0436365_0444508 | |||
| 1895 | Ga0436365_0723742 | |||
| 1896 | Ga0439436_0003059 | |||
| 1897 | Ga0439439_0061917 | |||
| 1898 | Ga0439453_0018791 | |||
| 1899 | Ga0451798_0221512 | |||
| 1900 | Ga0451800_0178396 | |||
| 1901 | Ga0451807_1449807 | |||
| 1902 | Ga0451849_0638231 | |||
| 1903 | Ga0451849_1503776 | |||
| 1904 | Ga0451853_0933960 | |||
| 1905 | Ga0451853_3246057 | |||
| 1906 | Ga0439449_0007345 | |||
| 1907 | Ga0439449_0021941 | |||
| 1908 | Ga0439457_000764 | |||
| 1909 | Ga0439462_0005029 | |||
| 1910 | Ga0439460_0126351 | |||
| 1911 | Ga0451577_0081244 | |||
| 1912 | Ga0466969_0000622 | |||
| 1913 | Ga0466969_0047730 | |||
| 1914 | Ga0466972_0000105 | |||
| 1915 | Ga0466972_0001130 | |||
| 1916 | Ga0466966_0000372 | |||
| 1917 | Ga0466966_0191309 | |||
| 1918 | Ga0466961_0010944 | |||
| 1919 | Ga0466964_0023697 | |||
| 1920 | Ga0453684_0169165 | |||
| 1921 | Ga0466968_0039469 | |||
| 1922 | Ga0466970_0060592 | |||
| 1923 | Ga0466957_0008813 | |||
| 1924 | Ga0466957_0023376 | |||
| 1925 | Ga0466957_0266116 | |||
| 1926 | Ga0466959_0000076 | |||
| 1927 | Ga0466959_0025218 | |||
| 1928 | Ga0451576_0139870 | |||
| 1929 | Ga0495629_0070384 | |||
| 1930 | Ga0495638_0031474 | |||
| 1931 | Ga0495651_0433479 | |||
| 1932 | Ga0495650_0045083 | |||
| 1933 | Ga0495580_0061968 | |||
| 1934 | Ga0495639_0074884 | |||
| 1935 | Ga0495606_0007121 | |||
| 1936 | Ga0495618_0019559 | |||
| 1937 | Ga0495628_0241340 | |||
| 1938 | Ga0495643_0223848 | |||
| 1939 | Ga0495640_0083059 | |||
| 1940 | Ga0495587_0019717 | |||
| 1941 | Ga0495587_0100203 | |||
| 1942 | Ga0495597_0174083 | |||
| 1943 | Ga0495645_0108996 | |||
| 1944 | Ga0495668_0002267 | |||
| 1945 | Ga0495634_0016985 | |||
| 1946 | Ga0495611_0000072 | |||
| 1947 | Ga0495625_0017480 | |||
| 1948 | Ga0495658_0078553 | |||
| 1949 | Ga0495624_0148949 | |||
| 1950 | Ga0495649_0150306 | |||
| 1951 | Ga0495604_0127292 | |||
| 1952 | Ga0495674_0214176 | |||
| 1953 | Ga0495680_0418192 | |||
| 1954 | Ga0495687_000058 | |||
| 1955 | Ga0495686_0000005 | |||
| 1956 | Ga0495686_0005189 | |||
| 1957 | Ga0496105_0220073 | |||
| 1958 | Ga0496105_0442255 | |||
| 1959 | Ga0496106_0119134 | |||
| 1960 | Ga0496114_0432538 | |||
| 1961 | Ga0496115_0164274 | |||
| 1962 | Ga0501033_0308469 | |||
| 1963 | Ga0501034_0019518 | |||
| 1964 | Ga0501034_0083686 | |||
| 1965 | Ga0501038_0131943 | |||
| 1966 | Ga0501038_0259277 | |||
| 1967 | Ga0501038_0370172 | |||
| 1968 | Ga0501047_0007598 | |||
| 1969 | Ga0501047_0182034 | |||
| 1970 | Ga0501047_0313383 | |||
| 1971 | Ga0501048_0112510 | |||
| 1972 | Ga0501069_0247088 | |||
| 1973 | Ga0501070_0109692 | |||
| 1974 | Ga0501070_0201676 | |||
| 1975 | Ga0501073_0007827 | |||
| 1976 | Ga0501073_0325880 | |||
| 1977 | Ga0501074_0253851 | |||
| 1978 | Ga0501202_007751 | |||
| 1979 | Ga0501217_037269 | |||
| 1980 | Ga0501227_074655 | |||
| 1981 | Ga0501257_022317 | |||
| 1982 | Ga0501221_006987 | |||
| 1983 | Ga0501225_0006210 | |||
| 1984 | Ga0501225_0014295 | |||
| 1985 | Ga0501080_0319646 | |||
| 1986 | Ga0501083_0075938 | |||
| 1987 | Ga0501273_016616 | |||
| 1988 | Ga0501273_022449 | |||
| 1989 | Ga0501035_0627693 | |||
| 1990 | Ga0501044_0053160 | |||
| 1991 | Ga0501044_0067190 | |||
| 1992 | Ga0501044_0229867 | |||
| 1993 | Ga0501044_0275540 | |||
| 1994 | Ga0501212_001996 | |||
| 1995 | nmdc:mga0k408_15371_c1 | |||
| 1996 | nmdc:mga05p37_33239_c1 | |||
| 1997 | nmdc:mga05p37_73456_c1 | |||
| 1998 | nmdc:mga09592_143792_c1 | |||
| 1999 | nmdc:mga09592_14634_c1 | |||
| 2000 | nmdc:mga09592_315840_c1 | |||
| 2001 | nmdc:mga09592_46551_c1 | |||
| 2002 | nmdc:mga0qj67_99097_c1 | |||
| 2003 | nmdc:mga06r32_100736_c1 | |||
| 2004 | nmdc:mga06r32_199984_c1 | |||
| 2005 | nmdc:mga08y16_209144_c1 | |||
| 2006 | nmdc:mga08y16_42668_c1 | |||
| 2007 | nmdc:mga0a205_443891_c1 | |||
| 2008 | Ga0500578_0000100 | |||
| 2009 | Ga0500578_0020799 | |||
| 2010 | Ga0500644_0084177 | |||
| 2011 | Ga0500646_0001225 | |||
| 2012 | Ga0500646_0001639 | |||
| 2013 | Ga0500646_0023628 | |||
| 2014 | Ga0500646_0072766 | |||
| 2015 | Ga0500583_0002450 | |||
| 2016 | Ga0500556_0012781 | |||
| 2017 | Ga0500562_010871 | |||
| 2018 | Ga0500592_016204 | |||
| 2019 | Ga0500642_0046963 | |||
| 2020 | Ga0500652_003412 | |||
| 2021 | Ga0500658_0027417 | |||
| 2022 | Ga0500568_0000635 | |||
| 2023 | Ga0500568_0008527 | |||
| 2024 | Ga0500573_0031239 | |||
| 2025 | Ga0500588_0007510 | |||
| 2026 | Ga0500588_0078889 | |||
| 2027 | Ga0500604_0003261 | |||
| 2028 | Ga0500616_0019968 | |||
| 2029 | Ga0500622_0000948 | |||
| 2030 | Ga0500622_0014393 | |||
| 2031 | Ga0500645_008756 | |||
| 2032 | Ga0500645_011912 | |||
| 2033 | Ga0501084_0001548 | |||
| 2034 | Ga0501082_0005318 | |||
| 2035 | Ga0501082_0442477 | |||
| 2036 | Ga0466962_0007218 | |||
| 2037 | 2738725946 | |||
| 2038 | 2929158657 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ntr-assembly4.cif.gz_D | crystal structure of beta-barrel-like protein of domain of unknown function duf1849 from brucella abortus | 0.621 | 36 | 260 |
| 6ntr-assembly4.cif.gz_D | crystal structure of beta-barrel-like protein of domain of unknown function duf1849 from brucella abortus | 0.5961 | 36 | 260 |
| 6ntr-assembly1.cif.gz_A | crystal structure of beta-barrel-like protein of domain of unknown function duf1849 from brucella abortus | 0.5636 | 36 | 255 |
| 3lk3-assembly1.cif.gz_A | crystal structure of capz bound to the cpi and csi uncapping motifs from carmil | 0.5373 | 61 | 130 |
| 8do8-assembly1.cif.gz_D | crystal structure atg9 hdir in complex with the atg13:atg101 horma dimer | 0.5328 | 40 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SQQ7_353_510_3.40.1380.20 | Alpha Beta;3-Layer(aba) Sandwich;Pyruvate Kinase; Chain: A, domain 1;Pyruvate kinase, C-terminal domain | 0.5808 | 152 | 189 | 3.40.1380.20 |
| 1iznA02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;F-actin capping protein, beta subunit | 0.5743 | 61 | 130 | 3.90.1150.210 |
| af_I1NGY5_1_141_1.10.520.10 | Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; | 0.5388 | 43 | 104 | 1.10.520.10 |
| af_X2JDH0_779_875_3.30.1120.160 | Alpha Beta;2-Layer Sandwich;Arylsulfatase, C-terminal domain; | 0.5355 | 46 | 103 | 3.30.1120.160 |
| af_Q7EYF5_51_166_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.5293 | 45 | 88 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3WTE9-F1-model_v4 | DUF3108 domain-containing protein | 0.9951 | 31 | 269 |
|
| AF-A0A5B8VIR8-F1-model_v4 | DUF3108 domain-containing protein | 0.9947 | 32 | 269 |
|
| AF-A0A521P2Q0-F1-model_v4 | DUF3108 domain-containing protein | 0.9921 | 27 | 269 |
|
| AF-A0A5B8VIR8-F1-model_v4 | DUF3108 domain-containing protein | 0.9906 | 32 | 269 |
|
| AF-A0A4Q5U7Z7-F1-model_v4 | deleted | 0.987 | 145 | 269 |
|