F488359
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1019 | 462 | 2038 | 438 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2546825537|2546948877 |
| Length | 490 |
| Sequence | RPTAGAQYTADTPAPSTPPTRRHPTADTANTANTTNTANTANTANTTDTEHRLRPGENHPMSTESWSFETQQIHAGAQPDPATGARAVPIYQTTSYVFRDTDHAAALFALGEPGNIYTRIMNPTQDVFEQRIAALEGGIGALAAASGQAAETLAILNLAEAGDHVVSSASLYGGTYNLFHYTLPKLGIEVSFVGDPDDLEEWRAAVRPTTKAFYGETIGNPRGDVLDTVGISEVAHAHGIPLIVDNTLATPYLYRPLEHGADIVVHSATKFIGGHGTAIGGVIVDGGRFDFGASGRFANFTTPDPSYHGLVYWDALGHGSYIAKARVQLLRDLGPAISPFNSFLLLQGLETLSLRIERHTANARRVAEWLDARDEVSWVAYPGLPSSRWYSRAQKVLPRGAGAILSFGIVGGAEAGKKFVEGVELFSHLANVGDVRSLIIHPATTTHSQLTEAEQTATGVTPDLVRLSVGIEGIDDILADLDAGFRAAKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 187 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 189 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 190 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 194 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 198 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 211 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 212 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 213 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 225 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 235 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 236 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 237 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 238 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 244 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 245 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 246 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 247 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 252 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 253 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 254 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 255 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 256 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 257 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 258 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 259 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 260 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 261 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 262 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 263 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 269 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 270 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 275 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 308 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 309 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 348 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 353 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 354 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 356 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 366 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 368 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 369 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 370 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 371 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 372 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 375 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 378 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 379 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 380 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 381 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 382 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 383 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 384 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 385 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 386 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 387 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 388 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 389 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 390 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 391 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 392 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 393 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 394 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 395 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 396 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 397 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 398 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 399 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 400 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 401 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 402 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 403 | 2684623219 | Planctomyces sp. SH-PL14 | Isolate | Unclassified |
| 404 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 405 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 406 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 407 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 408 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 409 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 410 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 411 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 412 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 413 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 414 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 415 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 416 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 417 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 418 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 419 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 420 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 421 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 422 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 423 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 424 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 425 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 426 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 427 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 428 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 429 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 430 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 431 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 432 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 433 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 434 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 435 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 436 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 437 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 438 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 439 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 440 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 441 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 442 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 443 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 444 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 445 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 446 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 447 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 448 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 449 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 450 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 451 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 452 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 453 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 454 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 455 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 456 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 457 | 8007375930 | Clostridium sp. YIM B02565 | Isolate | Unclassified |
| 458 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 459 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 460 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 461 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 462 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.79 |
| Metatranscriptomes | 1.47 |
| Isolates | 8.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 8.15 |
| Nodule | 2.06 |
| Rhizoplane | 7.26 |
| Rhizosphere | 72.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1002610 | 3300002074 | Bacteria | 2043 |
| 2 | JGI24744J21845_10000374 | 3300002077 | Bacteria | 7622 |
| 3 | JGI24744J21845_10004592 | 3300002077 | Bacteria | 2857 |
| 4 | Ga0007423J48922_100202 | 3300003285 | Bacteria | 5773 |
| 5 | Ga0055532_1000354 | 3300003758 | Bacteria | 24463 |
| 6 | Ga0055540_1000143 | 3300003792 | Bacteria | 71425 |
| 7 | Ga0055540_1001925 | 3300003792 | Bacteria | 11596 |
| 8 | Ga0055540_1002814 | 3300003792 | Bacteria | 8899 |
| 9 | Ga0055540_1016761 | 3300003792 | Bacteria | 2070 |
| 10 | Ga0065712_10079918 | 3300005290 | Bacteria | 3165 |
| 11 | Ga0070658_10000640 | 3300005327 | Bacteria | 30233 |
| 12 | Ga0070683_100014996 | 3300005329 | Bacteria | 6798 |
| 13 | Ga0070683_100120895 | 3300005329 | Bacteria | 2474 |
| 14 | Ga0070690_100074457 | 3300005330 | Bacteria | 2212 |
| 15 | Ga0070670_100235857 | 3300005331 | Bacteria | 1592 |
| 16 | Ga0068869_100008020 | 3300005334 | Bacteria | 6783 |
| 17 | Ga0068869_100024055 | 3300005334 | Bacteria | 4216 |
| 18 | Ga0070666_10050122 | 3300005335 | Bacteria | 2808 |
| 19 | Ga0070666_10057114 | 3300005335 | Bacteria | 2637 |
| 20 | Ga0070680_100000516 | 3300005336 | Bacteria | 26475 |
| 21 | Ga0070682_100057091 | 3300005337 | Bacteria | 2458 |
| 22 | Ga0070682_100077059 | 3300005337 | Bacteria | 2147 |
| 23 | Ga0068868_100001422 | 3300005338 | Bacteria | 16496 |
| 24 | Ga0068868_100180333 | 3300005338 | Bacteria | 1752 |
| 25 | Ga0070660_100050741 | 3300005339 | Bacteria | 3193 |
| 26 | Ga0070689_100036512 | 3300005340 | Bacteria | 3759 |
| 27 | Ga0070687_100070656 | 3300005343 | Bacteria | 1874 |
| 28 | Ga0070692_10015533 | 3300005345 | Bacteria | 3603 |
| 29 | Ga0070692_10053492 | 3300005345 | Bacteria | 2106 |
| 30 | Ga0070668_100000664 | 3300005347 | Bacteria | 23292 |
| 31 | Ga0070668_100002923 | 3300005347 | Bacteria | 12626 |
| 32 | Ga0070669_100001172 | 3300005353 | Bacteria | 19133 |
| 33 | Ga0070669_100083302 | 3300005353 | Bacteria | 2385 |
| 34 | Ga0070675_100196168 | 3300005354 | Bacteria | 1751 |
| 35 | Ga0070671_100041760 | 3300005355 | Bacteria | 3811 |
| 36 | Ga0070671_100053670 | 3300005355 | Bacteria | 3351 |
| 37 | Ga0070674_100000217 | 3300005356 | Bacteria | 27850 |
| 38 | Ga0070674_100008453 | 3300005356 | Bacteria | 6128 |
| 39 | Ga0070688_100001298 | 3300005365 | Bacteria | 12453 |
| 40 | Ga0070688_100064071 | 3300005365 | Bacteria | 2332 |
| 41 | Ga0070659_100071487 | 3300005366 | Bacteria | 2758 |
| 42 | Ga0070667_100000447 | 3300005367 | Bacteria | 42767 |
| 43 | Ga0070667_100000722 | 3300005367 | Bacteria | 31740 |
| 44 | Ga0070667_100004508 | 3300005367 | Bacteria | 11744 |
| 45 | Ga0070667_100125612 | 3300005367 | Bacteria | 2235 |
| 46 | Ga0070703_10016123 | 3300005406 | Bacteria | 2142 |
| 47 | Ga0070703_10036339 | 3300005406 | Bacteria | 1513 |
| 48 | Ga0070714_100043726 | 3300005435 | Bacteria | 3790 |
| 49 | Ga0070714_100063662 | 3300005435 | Bacteria | 3172 |
| 50 | Ga0070714_100128142 | 3300005435 | Bacteria | 2265 |
| 51 | Ga0070714_100162410 | 3300005435 | Bacteria | 2022 |
| 52 | Ga0070713_100022249 | 3300005436 | Bacteria | 4896 |
| 53 | Ga0070710_10000197 | 3300005437 | Bacteria | 28159 |
| 54 | Ga0070710_10007238 | 3300005437 | Bacteria | 5363 |
| 55 | Ga0070710_10024093 | 3300005437 | Bacteria | 3207 |
| 56 | Ga0070701_10000896 | 3300005438 | Bacteria | 10743 |
| 57 | Ga0070711_100001123 | 3300005439 | Bacteria | 14301 |
| 58 | Ga0070711_100003442 | 3300005439 | Bacteria | 9219 |
| 59 | Ga0070705_100061611 | 3300005440 | Bacteria | 2230 |
| 60 | Ga0070700_100002004 | 3300005441 | Bacteria | 10344 |
| 61 | Ga0070708_100000179 | 3300005445 | Bacteria | 45458 |
| 62 | Ga0070708_100001197 | 3300005445 | Bacteria | 19969 |
| 63 | Ga0070678_100000266 | 3300005456 | Bacteria | 24153 |
| 64 | Ga0070678_100000665 | 3300005456 | Bacteria | 16871 |
| 65 | Ga0070678_100042350 | 3300005456 | Bacteria | 3236 |
| 66 | Ga0070678_100096157 | 3300005456 | Bacteria | 2284 |
| 67 | Ga0070678_100241051 | 3300005456 | Bacteria | 1512 |
| 68 | Ga0070662_100001304 | 3300005457 | Bacteria | 15325 |
| 69 | Ga0070681_10000365 | 3300005458 | Bacteria | 36498 |
| 70 | Ga0070681_10000695 | 3300005458 | Bacteria | 27954 |
| 71 | Ga0068867_100003480 | 3300005459 | Bacteria | 11068 |
| 72 | Ga0070706_100001142 | 3300005467 | Bacteria | 28615 |
| 73 | Ga0070706_100001344 | 3300005467 | Bacteria | 26148 |
| 74 | Ga0070706_100002020 | 3300005467 | Bacteria | 20818 |
| 75 | Ga0070706_100315799 | 3300005467 | Bacteria | 1457 |
| 76 | Ga0070707_100000872 | 3300005468 | Bacteria | 29927 |
| 77 | Ga0070707_100076569 | 3300005468 | Bacteria | 3227 |
| 78 | Ga0070707_100137655 | 3300005468 | Bacteria | 2375 |
| 79 | Ga0070698_100026557 | 3300005471 | Bacteria | 6027 |
| 80 | Ga0070698_100186115 | 3300005471 | Bacteria | 2014 |
| 81 | Ga0070699_100002327 | 3300005518 | Bacteria | 17056 |
| 82 | Ga0070699_100006049 | 3300005518 | Bacteria | 10581 |
| 83 | Ga0070679_100001038 | 3300005530 | Bacteria | 24240 |
| 84 | Ga0070697_100005715 | 3300005536 | Bacteria | 9583 |
| 85 | Ga0070697_100006668 | 3300005536 | Bacteria | 8956 |
| 86 | Ga0070697_100008402 | 3300005536 | Bacteria | 8057 |
| 87 | Ga0068853_100092105 | 3300005539 | Bacteria | 2666 |
| 88 | Ga0068853_100112865 | 3300005539 | Bacteria | 2415 |
| 89 | Ga0070672_100109922 | 3300005543 | Bacteria | 2246 |
| 90 | Ga0070686_100113684 | 3300005544 | Bacteria | 1848 |
| 91 | Ga0070665_100036202 | 3300005548 | Bacteria | 4965 |
| 92 | Ga0070704_100000494 | 3300005549 | Bacteria | 18742 |
| 93 | Ga0068855_100066593 | 3300005563 | Bacteria | 4199 |
| 94 | Ga0068855_100075414 | 3300005563 | Bacteria | 3916 |
| 95 | Ga0068855_100098156 | 3300005563 | Bacteria | 3375 |
| 96 | Ga0068855_100280855 | 3300005563 | Bacteria | 1849 |
| 97 | Ga0068854_100004995 | 3300005578 | Bacteria | 8363 |
| 98 | Ga0068856_100227694 | 3300005614 | Bacteria | 1880 |
| 99 | Ga0068856_100292532 | 3300005614 | Bacteria | 1646 |
| 100 | Ga0068856_100311914 | 3300005614 | Bacteria | 1591 |
| 101 | Ga0070702_100074044 | 3300005615 | Bacteria | 2019 |
| 102 | Ga0068852_100144354 | 3300005616 | Bacteria | 2206 |
| 103 | Ga0068859_100003471 | 3300005617 | Bacteria | 16034 |
| 104 | Ga0068859_100012981 | 3300005617 | Bacteria | 8370 |
| 105 | Ga0068859_100335154 | 3300005617 | Bacteria | 1607 |
| 106 | Ga0068866_10002675 | 3300005718 | Bacteria | 7352 |
| 107 | Ga0068866_10050079 | 3300005718 | Bacteria | 2120 |
| 108 | Ga0068861_100001756 | 3300005719 | Bacteria | 13937 |
| 109 | Ga0068861_100079970 | 3300005719 | Bacteria | 2556 |
| 110 | Ga0068863_100001461 | 3300005841 | Bacteria | 23435 |
| 111 | Ga0068863_100003619 | 3300005841 | Bacteria | 15258 |
| 112 | Ga0068863_100007025 | 3300005841 | Bacteria | 11033 |
| 113 | Ga0068863_100037746 | 3300005841 | Bacteria | 4597 |
| 114 | Ga0068863_100044201 | 3300005841 | Bacteria | 4228 |
| 115 | Ga0068858_100011847 | 3300005842 | Bacteria | 8220 |
| 116 | Ga0068858_100057380 | 3300005842 | Bacteria | 3598 |
| 117 | Ga0068860_100000016 | 3300005843 | Bacteria | 310468 |
| 118 | Ga0068860_100012750 | 3300005843 | Bacteria | 8264 |
| 119 | Ga0068860_100042915 | 3300005843 | Bacteria | 4316 |
| 120 | Ga0068860_100155536 | 3300005843 | Bacteria | 2203 |
| 121 | Ga0068862_100000051 | 3300005844 | Bacteria | 145362 |
| 122 | Ga0068862_100002100 | 3300005844 | Bacteria | 17963 |
| 123 | Ga0081455_10005085 | 3300005937 | Bacteria | 14514 |
| 124 | Ga0081455_10018841 | 3300005937 | Bacteria | 6547 |
| 125 | Ga0081538_10068249 | 3300005981 | Bacteria | 1978 |
| 126 | Ga0081540_1036517 | 3300005983 | Bacteria | 2618 |
| 127 | Ga0081539_10000088 | 3300005985 | Bacteria | 212765 |
| 128 | Ga0070717_10000035 | 3300006028 | Bacteria | 126598 |
| 129 | Ga0070717_10000786 | 3300006028 | Bacteria | 20797 |
| 130 | Ga0070717_10142566 | 3300006028 | Bacteria | 2068 |
| 131 | Ga0075365_10003121 | 3300006038 | Bacteria | 8432 |
| 132 | Ga0075365_10022391 | 3300006038 | Bacteria | 3959 |
| 133 | Ga0075365_10026965 | 3300006038 | Bacteria | 3651 |
| 134 | Ga0075363_100000311 | 3300006048 | Bacteria | 14346 |
| 135 | Ga0075363_100003969 | 3300006048 | Bacteria | 6394 |
| 136 | Ga0075363_100007262 | 3300006048 | Bacteria | 5081 |
| 137 | Ga0075363_100012419 | 3300006048 | Bacteria | 4105 |
| 138 | Ga0075363_100019029 | 3300006048 | Bacteria | 3428 |
| 139 | Ga0075363_100028692 | 3300006048 | Bacteria | 2865 |
| 140 | Ga0075363_100115369 | 3300006048 | Bacteria | 1495 |
| 141 | Ga0075364_10001449 | 3300006051 | Bacteria | 12883 |
| 142 | Ga0075364_10001842 | 3300006051 | Bacteria | 11745 |
| 143 | Ga0075364_10002181 | 3300006051 | Bacteria | 10969 |
| 144 | Ga0075364_10018214 | 3300006051 | Bacteria | 4395 |
| 145 | Ga0075364_10021337 | 3300006051 | Bacteria | 4081 |
| 146 | Ga0075364_10023226 | 3300006051 | Bacteria | 3925 |
| 147 | Ga0075364_10024399 | 3300006051 | Bacteria | 3839 |
| 148 | Ga0075364_10041474 | 3300006051 | Bacteria | 2988 |
| 149 | Ga0075432_10003041 | 3300006058 | Bacteria | 5656 |
| 150 | Ga0070716_100011593 | 3300006173 | Bacteria | 4441 |
| 151 | Ga0075362_10006975 | 3300006177 | Bacteria | 4241 |
| 152 | Ga0075362_10061836 | 3300006177 | Bacteria | 1695 |
| 153 | Ga0075367_10038965 | 3300006178 | Bacteria | 2769 |
| 154 | Ga0075367_10049019 | 3300006178 | Bacteria | 2489 |
| 155 | Ga0075367_10083584 | 3300006178 | Bacteria | 1934 |
| 156 | Ga0075369_10002066 | 3300006186 | Bacteria | 7083 |
| 157 | Ga0075369_10003829 | 3300006186 | Bacteria | 5516 |
| 158 | Ga0075369_10013502 | 3300006186 | Bacteria | 3243 |
| 159 | Ga0075369_10014781 | 3300006186 | Bacteria | 3123 |
| 160 | Ga0075369_10028874 | 3300006186 | Bacteria | 2327 |
| 161 | Ga0097621_100037724 | 3300006237 | Bacteria | 3874 |
| 162 | Ga0097621_100096298 | 3300006237 | Bacteria | 2484 |
| 163 | Ga0075370_10000615 | 3300006353 | Bacteria | 13785 |
| 164 | Ga0075370_10012101 | 3300006353 | Bacteria | 4552 |
| 165 | Ga0075370_10080890 | 3300006353 | Bacteria | 1867 |
| 166 | Ga0075370_10096389 | 3300006353 | Bacteria | 1709 |
| 167 | Ga0068871_100048836 | 3300006358 | Bacteria | 3417 |
| 168 | Ga0075428_100008221 | 3300006844 | Bacteria | 11574 |
| 169 | Ga0075431_100004137 | 3300006847 | Bacteria | 14162 |
| 170 | Ga0075431_100034950 | 3300006847 | Bacteria | 5177 |
| 171 | Ga0075433_10040235 | 3300006852 | Bacteria | 4045 |
| 172 | Ga0068865_100004825 | 3300006881 | Bacteria | 8148 |
| 173 | Ga0068865_100037438 | 3300006881 | Bacteria | 3276 |
| 174 | Ga0068865_100095691 | 3300006881 | Bacteria | 2164 |
| 175 | Ga0068865_100196603 | 3300006881 | Bacteria | 1563 |
| 176 | Ga0097620_100003471 | 3300006931 | Bacteria | 16034 |
| 177 | Ga0097620_100012980 | 3300006931 | Bacteria | 8370 |
| 178 | Ga0097620_100335173 | 3300006931 | Bacteria | 1607 |
| 179 | Ga0111539_10032005 | 3300009094 | Bacteria | 6390 |
| 180 | Ga0105245_10001901 | 3300009098 | Bacteria | 18974 |
| 181 | Ga0105245_10274004 | 3300009098 | Bacteria | 1647 |
| 182 | Ga0105247_10000017 | 3300009101 | Bacteria | 260438 |
| 183 | Ga0105247_10000042 | 3300009101 | Bacteria | 158046 |
| 184 | Ga0105247_10000697 | 3300009101 | Bacteria | 26376 |
| 185 | Ga0114129_10499526 | 3300009147 | Bacteria | 1589 |
| 186 | Ga0105243_10000598 | 3300009148 | Bacteria | 36100 |
| 187 | Ga0105243_10006183 | 3300009148 | Bacteria | 9260 |
| 188 | Ga0105243_10006892 | 3300009148 | Bacteria | 8757 |
| 189 | Ga0105243_10230750 | 3300009148 | Bacteria | 1642 |
| 190 | Ga0105241_10013846 | 3300009174 | Bacteria | 5908 |
| 191 | Ga0105242_10004254 | 3300009176 | Bacteria | 11156 |
| 192 | Ga0105242_10010413 | 3300009176 | Bacteria | 7133 |
| 193 | Ga0105242_10329592 | 3300009176 | Bacteria | 1403 |
| 194 | Ga0105248_10000025 | 3300009177 | Bacteria | 259691 |
| 195 | Ga0105248_10000058 | 3300009177 | Bacteria | 137708 |
| 196 | Ga0105248_10002782 | 3300009177 | Bacteria | 19446 |
| 197 | Ga0105248_10018012 | 3300009177 | Bacteria | 7796 |
| 198 | Ga0105248_10113059 | 3300009177 | Bacteria | 3062 |
| 199 | Ga0105237_10006530 | 3300009545 | Bacteria | 12910 |
| 200 | Ga0105237_10028972 | 3300009545 | Bacteria | 5633 |
| 201 | Ga0105237_10031502 | 3300009545 | Bacteria | 5376 |
| 202 | Ga0105237_10031742 | 3300009545 | Bacteria | 5350 |
| 203 | Ga0105238_10005487 | 3300009551 | Bacteria | 12528 |
| 204 | Ga0105238_10140809 | 3300009551 | Bacteria | 2389 |
| 205 | Ga0105238_10225670 | 3300009551 | Bacteria | 1850 |
| 206 | Ga0105249_10000021 | 3300009553 | Bacteria | 260448 |
| 207 | Ga0105249_10003602 | 3300009553 | Bacteria | 13399 |
| 208 | Ga0105239_10015207 | 3300010375 | Bacteria | 8529 |
| 209 | Ga0105239_10063693 | 3300010375 | Unclassified | 4048 |
| 210 | Ga0157369_10001401 | 3300013105 | Bacteria | 29603 |
| 211 | Ga0157369_10030568 | 3300013105 | Bacteria | 5939 |
| 212 | Ga0157374_10009548 | 3300013296 | Bacteria | 8332 |
| 213 | Ga0157374_10048375 | 3300013296 | Bacteria | 3945 |
| 214 | Ga0157374_10101784 | 3300013296 | Bacteria | 2754 |
| 215 | Ga0157374_10152563 | 3300013296 | Bacteria | 2247 |
| 216 | Ga0157378_10006852 | 3300013297 | Bacteria | 9937 |
| 217 | Ga0157378_10135374 | 3300013297 | Bacteria | 2284 |
| 218 | Ga0163162_10011274 | 3300013306 | Bacteria | 8717 |
| 219 | Ga0163162_10022847 | 3300013306 | Bacteria | 6166 |
| 220 | Ga0163162_10304020 | 3300013306 | Bacteria | 1727 |
| 221 | Ga0157372_10005875 | 3300013307 | Bacteria | 13060 |
| 222 | Ga0157375_10251939 | 3300013308 | Bacteria | 1926 |
| 223 | Ga0157375_10327761 | 3300013308 | Bacteria | 1696 |
| 224 | Ga0163163_10043279 | 3300014325 | Bacteria | 4414 |
| 225 | Ga0163163_10050313 | 3300014325 | Bacteria | 4103 |
| 226 | Ga0163163_10094826 | 3300014325 | Bacteria | 3003 |
| 227 | Ga0157380_10000311 | 3300014326 | Bacteria | 29419 |
| 228 | Ga0157379_10027988 | 3300014968 | Bacteria | 5017 |
| 229 | Ga0157379_10033670 | 3300014968 | Bacteria | 4569 |
| 230 | Ga0157379_10121632 | 3300014968 | Bacteria | 2348 |
| 231 | Ga0157376_10045505 | 3300014969 | Bacteria | 3614 |
| 232 | Ga0157376_10174493 | 3300014969 | Bacteria | 1960 |
| 233 | Ga0163161_10000438 | 3300017792 | Bacteria | 34726 |
| 234 | Ga0163161_10157258 | 3300017792 | Bacteria | 1731 |
| 235 | Ga0197907_11435767 | 3300020069 | Bacteria | 2850 |
| 236 | Ga0206356_10927913 | 3300020070 | Bacteria | 2937 |
| 237 | Ga0206356_11409457 | 3300020070 | Bacteria | 2247 |
| 238 | Ga0206351_10693814 | 3300020077 | Bacteria | 1740 |
| 239 | Ga0206350_10130933 | 3300020080 | Bacteria | 2856 |
| 240 | Ga0206354_10133691 | 3300020081 | Bacteria | 3487 |
| 241 | Ga0206353_10411335 | 3300020082 | Bacteria | 34381 |
| 242 | Ga0213876_10001169 | 3300021384 | Bacteria | 16584 |
| 243 | Ga0224712_10025437 | 3300022467 | Bacteria | 2081 |
| 244 | Ga0209673_1013816 | 3300025273 | Bacteria | 3166 |
| 245 | Ga0209051_1000328 | 3300025303 | Bacteria | 71477 |
| 246 | Ga0209051_1000495 | 3300025303 | Bacteria | 50813 |
| 247 | Ga0209051_1001554 | 3300025303 | Bacteria | 19000 |
| 248 | Ga0209051_1002304 | 3300025303 | Bacteria | 13890 |
| 249 | Ga0207697_10006310 | 3300025315 | Bacteria | 5385 |
| 250 | Ga0207682_10004990 | 3300025893 | Bacteria | 5445 |
| 251 | Ga0207692_10000508 | 3300025898 | Bacteria | 13743 |
| 252 | Ga0207692_10020107 | 3300025898 | Bacteria | 3030 |
| 253 | Ga0207642_10000444 | 3300025899 | Bacteria | 12552 |
| 254 | Ga0207642_10024153 | 3300025899 | Bacteria | 2440 |
| 255 | Ga0207710_10000033 | 3300025900 | Bacteria | 260531 |
| 256 | Ga0207710_10000037 | 3300025900 | Bacteria | 243545 |
| 257 | Ga0207710_10000058 | 3300025900 | Bacteria | 172242 |
| 258 | Ga0207710_10007311 | 3300025900 | Bacteria | 4679 |
| 259 | Ga0207688_10000419 | 3300025901 | Bacteria | 19964 |
| 260 | Ga0207688_10003935 | 3300025901 | Bacteria | 8097 |
| 261 | Ga0207688_10045168 | 3300025901 | Bacteria | 2457 |
| 262 | Ga0207685_10070083 | 3300025905 | Bacteria | 1418 |
| 263 | Ga0207685_10075705 | 3300025905 | Bacteria | 1378 |
| 264 | Ga0207645_10019600 | 3300025907 | Bacteria | 4433 |
| 265 | Ga0207705_10004883 | 3300025909 | Bacteria | 10057 |
| 266 | Ga0207684_10001406 | 3300025910 | Bacteria | 26157 |
| 267 | Ga0207684_10007904 | 3300025910 | Bacteria | 9509 |
| 268 | Ga0207684_10025535 | 3300025910 | Bacteria | 5036 |
| 269 | Ga0207684_10037155 | 3300025910 | Bacteria | 4133 |
| 270 | Ga0207707_10000304 | 3300025912 | Bacteria | 51680 |
| 271 | Ga0207671_10004366 | 3300025914 | Bacteria | 13558 |
| 272 | Ga0207671_10022844 | 3300025914 | Bacteria | 4723 |
| 273 | Ga0207693_10003367 | 3300025915 | Bacteria | 13655 |
| 274 | Ga0207693_10008209 | 3300025915 | Bacteria | 8554 |
| 275 | Ga0207660_10007493 | 3300025917 | Bacteria | 7062 |
| 276 | Ga0207662_10013035 | 3300025918 | Bacteria | 4642 |
| 277 | Ga0207662_10028528 | 3300025918 | Bacteria | 3227 |
| 278 | Ga0207657_10025206 | 3300025919 | Bacteria | 5487 |
| 279 | Ga0207652_10001158 | 3300025921 | Bacteria | 23716 |
| 280 | Ga0207652_10253983 | 3300025921 | Bacteria | 1585 |
| 281 | Ga0207646_10006312 | 3300025922 | Bacteria | 12285 |
| 282 | Ga0207646_10036652 | 3300025922 | Bacteria | 4426 |
| 283 | Ga0207681_10001320 | 3300025923 | Bacteria | 16003 |
| 284 | Ga0207687_10001562 | 3300025927 | Bacteria | 15734 |
| 285 | Ga0207687_10036673 | 3300025927 | Bacteria | 3340 |
| 286 | Ga0207687_10052886 | 3300025927 | Bacteria | 2835 |
| 287 | Ga0207664_10044487 | 3300025929 | Bacteria | 3477 |
| 288 | Ga0207706_10022607 | 3300025933 | Bacteria | 5644 |
| 289 | Ga0207686_10046725 | 3300025934 | Bacteria | 2672 |
| 290 | Ga0207686_10073117 | 3300025934 | Bacteria | 2211 |
| 291 | Ga0207686_10074607 | 3300025934 | Bacteria | 2192 |
| 292 | Ga0207709_10004170 | 3300025935 | Bacteria | 8408 |
| 293 | Ga0207709_10030574 | 3300025935 | Bacteria | 3134 |
| 294 | Ga0207709_10118048 | 3300025935 | Bacteria | 1786 |
| 295 | Ga0207709_10148331 | 3300025935 | Bacteria | 1621 |
| 296 | Ga0207670_10047570 | 3300025936 | Bacteria | 2858 |
| 297 | Ga0207669_10000871 | 3300025937 | Bacteria | 12803 |
| 298 | Ga0207669_10020340 | 3300025937 | Bacteria | 3479 |
| 299 | Ga0207704_10004808 | 3300025938 | Bacteria | 6201 |
| 300 | Ga0207704_10029821 | 3300025938 | Bacteria | 3049 |
| 301 | Ga0207711_10000079 | 3300025941 | Bacteria | 104006 |
| 302 | Ga0207711_10000390 | 3300025941 | Bacteria | 46512 |
| 303 | Ga0207711_10042329 | 3300025941 | Bacteria | 3881 |
| 304 | Ga0207711_10087317 | 3300025941 | Bacteria | 2736 |
| 305 | Ga0207689_10007162 | 3300025942 | Bacteria | 9807 |
| 306 | Ga0207689_10015324 | 3300025942 | Bacteria | 6488 |
| 307 | Ga0207689_10083209 | 3300025942 | Bacteria | 2631 |
| 308 | Ga0207661_10108973 | 3300025944 | Bacteria | 2339 |
| 309 | Ga0207667_10045100 | 3300025949 | Bacteria | 4670 |
| 310 | Ga0207712_10000005 | 3300025961 | Bacteria | 608697 |
| 311 | Ga0207712_10092886 | 3300025961 | Bacteria | 2226 |
| 312 | Ga0207668_10000367 | 3300025972 | Bacteria | 28871 |
| 313 | Ga0207668_10003927 | 3300025972 | Bacteria | 8769 |
| 314 | Ga0207640_10001703 | 3300025981 | Bacteria | 11791 |
| 315 | Ga0207658_10000299 | 3300025986 | Bacteria | 51661 |
| 316 | Ga0207658_10026757 | 3300025986 | Bacteria | 4047 |
| 317 | Ga0207658_10040144 | 3300025986 | Bacteria | 3381 |
| 318 | Ga0207677_10005896 | 3300026023 | Bacteria | 6667 |
| 319 | Ga0207677_10128190 | 3300026023 | Bacteria | 1921 |
| 320 | Ga0207677_10137400 | 3300026023 | Bacteria | 1866 |
| 321 | Ga0207703_10047718 | 3300026035 | Bacteria | 3454 |
| 322 | Ga0207703_10051984 | 3300026035 | Bacteria | 3325 |
| 323 | Ga0207639_10087557 | 3300026041 | Bacteria | 2483 |
| 324 | Ga0207678_10103036 | 3300026067 | Bacteria | 2436 |
| 325 | Ga0207708_10015701 | 3300026075 | Bacteria | 5682 |
| 326 | Ga0207708_10016638 | 3300026075 | Bacteria | 5532 |
| 327 | Ga0207708_10042213 | 3300026075 | Bacteria | 3477 |
| 328 | Ga0207702_10112390 | 3300026078 | Bacteria | 2424 |
| 329 | Ga0207641_10002135 | 3300026088 | Bacteria | 18699 |
| 330 | Ga0207641_10003252 | 3300026088 | Bacteria | 14481 |
| 331 | Ga0207641_10030028 | 3300026088 | Bacteria | 4499 |
| 332 | Ga0207641_10086040 | 3300026088 | Bacteria | 2740 |
| 333 | Ga0207641_10127178 | 3300026088 | Bacteria | 2283 |
| 334 | Ga0207648_10005009 | 3300026089 | Bacteria | 13451 |
| 335 | Ga0207648_10031811 | 3300026089 | Bacteria | 4663 |
| 336 | Ga0207648_10157952 | 3300026089 | Bacteria | 2002 |
| 337 | Ga0207676_10031434 | 3300026095 | Bacteria | 3993 |
| 338 | Ga0207674_10106367 | 3300026116 | Bacteria | 2783 |
| 339 | Ga0207675_100001197 | 3300026118 | Bacteria | 25872 |
| 340 | Ga0207683_10001171 | 3300026121 | Bacteria | 23719 |
| 341 | Ga0207683_10001880 | 3300026121 | Bacteria | 18570 |
| 342 | Ga0207683_10106911 | 3300026121 | Bacteria | 2502 |
| 343 | Ga0207683_10186696 | 3300026121 | Bacteria | 1881 |
| 344 | Ga0207683_10202502 | 3300026121 | Bacteria | 1805 |
| 345 | Ga0207683_10205485 | 3300026121 | Bacteria | 1791 |
| 346 | Ga0207698_10120298 | 3300026142 | Bacteria | 2221 |
| 347 | Ga0209966_1009875 | 3300027695 | Bacteria | 1711 |
| 348 | Ga0209813_10008008 | 3300027866 | Bacteria | 2654 |
| 349 | Ga0207428_10019950 | 3300027907 | Bacteria | 5709 |
| 350 | Ga0207428_10023717 | 3300027907 | Bacteria | 5154 |
| 351 | Ga0268266_10010168 | 3300028379 | Bacteria | 8245 |
| 352 | Ga0268266_10037138 | 3300028379 | Bacteria | 4150 |
| 353 | Ga0268266_10216605 | 3300028379 | Bacteria | 1758 |
| 354 | Ga0268265_10000022 | 3300028380 | Bacteria | 270788 |
| 355 | Ga0268265_10031049 | 3300028380 | Bacteria | 3855 |
| 356 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 357 | Ga0268264_10007501 | 3300028381 | Bacteria | 9100 |
| 358 | Ga0268264_10038729 | 3300028381 | Bacteria | 3936 |
| 359 | Ga0268264_10182670 | 3300028381 | Bacteria | 1906 |
| 360 | Ga0265337_1001324 | 3300028556 | Bacteria | 12321 |
| 361 | Ga0265337_1002094 | 3300028556 | Bacteria | 9432 |
| 362 | Ga0265337_1010239 | 3300028556 | Bacteria | 3297 |
| 363 | Ga0265319_1002032 | 3300028563 | Bacteria | 11388 |
| 364 | Ga0265319_1008662 | 3300028563 | Bacteria | 4428 |
| 365 | Ga0265334_10003597 | 3300028573 | Bacteria | 7024 |
| 366 | Ga0265334_10008202 | 3300028573 | Bacteria | 4445 |
| 367 | Ga0265318_10002937 | 3300028577 | Bacteria | 8847 |
| 368 | Ga0265323_10000678 | 3300028653 | Bacteria | 18519 |
| 369 | Ga0265323_10001439 | 3300028653 | Bacteria | 11698 |
| 370 | Ga0265323_10003228 | 3300028653 | Bacteria | 7265 |
| 371 | Ga0265323_10006818 | 3300028653 | Bacteria | 4779 |
| 372 | Ga0265323_10008699 | 3300028653 | Bacteria | 4175 |
| 373 | Ga0265323_10017331 | 3300028653 | Bacteria | 2798 |
| 374 | Ga0265323_10020425 | 3300028653 | Bacteria | 2550 |
| 375 | Ga0265322_10001818 | 3300028654 | Bacteria | 6765 |
| 376 | Ga0265322_10007563 | 3300028654 | Bacteria | 3167 |
| 377 | Ga0265336_10002184 | 3300028666 | Bacteria | 8258 |
| 378 | Ga0265336_10005894 | 3300028666 | Bacteria | 4470 |
| 379 | Ga0265336_10008603 | 3300028666 | Bacteria | 3570 |
| 380 | Ga0265336_10012947 | 3300028666 | Bacteria | 2792 |
| 381 | Ga0265336_10025005 | 3300028666 | Bacteria | 1883 |
| 382 | Ga0307515_10000019 | 3300028794 | Bacteria | 422262 |
| 383 | Ga0265338_10000202 | 3300028800 | Bacteria | 112706 |
| 384 | Ga0265338_10000593 | 3300028800 | Bacteria | 63891 |
| 385 | Ga0265338_10001712 | 3300028800 | Bacteria | 34790 |
| 386 | Ga0265338_10002195 | 3300028800 | Bacteria | 29897 |
| 387 | Ga0265338_10002795 | 3300028800 | Bacteria | 25520 |
| 388 | Ga0265338_10004158 | 3300028800 | Bacteria | 19773 |
| 389 | Ga0265338_10011960 | 3300028800 | Bacteria | 9944 |
| 390 | Ga0265338_10012809 | 3300028800 | Bacteria | 9533 |
| 391 | Ga0265338_10016258 | 3300028800 | Bacteria | 8108 |
| 392 | Ga0265338_10019798 | 3300028800 | Bacteria | 7114 |
| 393 | Ga0265338_10031405 | 3300028800 | Bacteria | 5208 |
| 394 | Ga0265338_10032968 | 3300028800 | Bacteria | 5040 |
| 395 | Ga0265338_10036411 | 3300028800 | Bacteria | 4709 |
| 396 | Ga0265338_10038466 | 3300028800 | Bacteria | 4533 |
| 397 | Ga0265338_10159286 | 3300028800 | Bacteria | 1745 |
| 398 | Ga0265338_10162237 | 3300028800 | Bacteria | 1725 |
| 399 | Ga0265324_10000672 | 3300029957 | Bacteria | 23043 |
| 400 | Ga0265324_10004349 | 3300029957 | Bacteria | 6447 |
| 401 | Ga0265324_10004476 | 3300029957 | Bacteria | 6288 |
| 402 | Ga0265324_10008523 | 3300029957 | Bacteria | 4069 |
| 403 | Ga0265324_10013480 | 3300029957 | Bacteria | 3049 |
| 404 | Ga0307511_10048755 | 3300030521 | Bacteria | 3441 |
| 405 | Ga0265330_10013290 | 3300031235 | Bacteria | 3840 |
| 406 | Ga0265328_10008023 | 3300031239 | Bacteria | 4376 |
| 407 | Ga0265320_10001321 | 3300031240 | Bacteria | 18120 |
| 408 | Ga0265320_10009020 | 3300031240 | Bacteria | 6047 |
| 409 | Ga0265320_10013227 | 3300031240 | Bacteria | 4755 |
| 410 | Ga0265320_10020043 | 3300031240 | Bacteria | 3636 |
| 411 | Ga0265320_10022735 | 3300031240 | Bacteria | 3349 |
| 412 | Ga0265320_10070918 | 3300031240 | Bacteria | 1642 |
| 413 | Ga0265325_10008116 | 3300031241 | Bacteria | 6221 |
| 414 | Ga0265325_10011164 | 3300031241 | Bacteria | 5169 |
| 415 | Ga0265325_10021374 | 3300031241 | Bacteria | 3555 |
| 416 | Ga0265329_10001514 | 3300031242 | Bacteria | 11120 |
| 417 | Ga0265329_10001626 | 3300031242 | Bacteria | 10774 |
| 418 | Ga0265340_10000308 | 3300031247 | Bacteria | 25727 |
| 419 | Ga0265340_10000975 | 3300031247 | Bacteria | 16339 |
| 420 | Ga0265340_10006808 | 3300031247 | Bacteria | 6255 |
| 421 | Ga0265327_10000019 | 3300031251 | Bacteria | 427653 |
| 422 | Ga0265327_10000182 | 3300031251 | Bacteria | 133209 |
| 423 | Ga0265327_10000690 | 3300031251 | Bacteria | 53948 |
| 424 | Ga0265327_10002506 | 3300031251 | Bacteria | 19194 |
| 425 | Ga0265327_10018346 | 3300031251 | Bacteria | 4343 |
| 426 | Ga0265327_10020593 | 3300031251 | Bacteria | 4011 |
| 427 | Ga0265327_10068298 | 3300031251 | Bacteria | 1788 |
| 428 | Ga0265316_10000107 | 3300031344 | Bacteria | 89406 |
| 429 | Ga0265316_10001496 | 3300031344 | Bacteria | 25062 |
| 430 | Ga0265316_10002751 | 3300031344 | Bacteria | 18013 |
| 431 | Ga0265316_10003188 | 3300031344 | Bacteria | 16685 |
| 432 | Ga0265316_10005815 | 3300031344 | Bacteria | 11895 |
| 433 | Ga0265316_10008210 | 3300031344 | Bacteria | 9715 |
| 434 | Ga0265316_10008948 | 3300031344 | Bacteria | 9239 |
| 435 | Ga0265316_10031987 | 3300031344 | Bacteria | 4298 |
| 436 | Ga0265316_10047659 | 3300031344 | Bacteria | 3388 |
| 437 | Ga0265316_10054760 | 3300031344 | Bacteria | 3122 |
| 438 | Ga0265316_10058262 | 3300031344 | Bacteria | 3010 |
| 439 | Ga0265316_10071644 | 3300031344 | Bacteria | 2671 |
| 440 | Ga0265313_10009009 | 3300031595 | Bacteria | 6543 |
| 441 | Ga0265313_10019814 | 3300031595 | Bacteria | 3732 |
| 442 | Ga0307508_10000106 | 3300031616 | Bacteria | 98674 |
| 443 | Ga0316575_10000001 | 3300031665 | Bacteria | 151281 |
| 444 | Ga0316575_10000789 | 3300031665 | Bacteria | 9601 |
| 445 | Ga0316579_10000430 | 3300031691 | Bacteria | 13354 |
| 446 | Ga0316579_10037568 | 3300031691 | Bacteria | 2237 |
| 447 | Ga0265314_10000037 | 3300031711 | Bacteria | 225790 |
| 448 | Ga0265314_10001733 | 3300031711 | Bacteria | 23601 |
| 449 | Ga0265314_10131237 | 3300031711 | Bacteria | 1563 |
| 450 | Ga0265342_10028537 | 3300031712 | Bacteria | 3475 |
| 451 | Ga0265342_10051523 | 3300031712 | Bacteria | 2456 |
| 452 | Ga0316576_10001950 | 3300031727 | Bacteria | 11522 |
| 453 | Ga0316576_10004230 | 3300031727 | Bacteria | 8574 |
| 454 | Ga0316576_10012412 | 3300031727 | Bacteria | 5626 |
| 455 | Ga0316576_10018732 | 3300031727 | Unclassified | 4733 |
| 456 | Ga0316576_10019056 | 3300031727 | Bacteria | 4696 |
| 457 | Ga0316576_10026619 | 3300031727 | Bacteria | 4060 |
| 458 | Ga0316576_10072298 | 3300031727 | Bacteria | 2545 |
| 459 | Ga0316576_10072350 | 3300031727 | Unclassified | 2545 |
| 460 | Ga0316576_10076618 | 3300031727 | Bacteria | 2475 |
| 461 | Ga0316576_10119225 | 3300031727 | Bacteria | 1981 |
| 462 | Ga0316576_10195274 | 3300031727 | Bacteria | 1525 |
| 463 | Ga0316578_10000121 | 3300031728 | Bacteria | 19126 |
| 464 | Ga0316578_10006775 | 3300031728 | Bacteria | 5682 |
| 465 | Ga0316578_10008229 | 3300031728 | Bacteria | 5292 |
| 466 | Ga0316578_10009570 | 3300031728 | Bacteria | 4986 |
| 467 | Ga0316578_10024130 | 3300031728 | Bacteria | 3410 |
| 468 | Ga0316578_10118072 | 3300031728 | Bacteria | 1594 |
| 469 | Ga0307405_10039074 | 3300031731 | Bacteria | 2866 |
| 470 | Ga0307405_10056850 | 3300031731 | Bacteria | 2455 |
| 471 | Ga0316577_10000394 | 3300031733 | Bacteria | 16722 |
| 472 | Ga0316577_10000416 | 3300031733 | Bacteria | 16477 |
| 473 | Ga0316577_10041012 | 3300031733 | Bacteria | 2589 |
| 474 | Ga0316577_10113263 | 3300031733 | Bacteria | 1522 |
| 475 | Ga0316577_10125455 | 3300031733 | Bacteria | 1443 |
| 476 | Ga0307413_10020937 | 3300031824 | Bacteria | 3490 |
| 477 | Ga0307410_10003317 | 3300031852 | Bacteria | 8045 |
| 478 | Ga0307410_10007656 | 3300031852 | Bacteria | 5927 |
| 479 | Ga0307410_10012288 | 3300031852 | Bacteria | 4944 |
| 480 | Ga0307407_10049675 | 3300031903 | Bacteria | 2395 |
| 481 | Ga0307412_10002784 | 3300031911 | Bacteria | 9715 |
| 482 | Ga0307409_100004986 | 3300031995 | Bacteria | 7559 |
| 483 | Ga0307409_100005582 | 3300031995 | Bacteria | 7271 |
| 484 | Ga0307409_100010907 | 3300031995 | Bacteria | 5689 |
| 485 | Ga0307409_100111080 | 3300031995 | Bacteria | 2298 |
| 486 | Ga0307416_100010647 | 3300032002 | Bacteria | 6089 |
| 487 | Ga0307416_100077099 | 3300032002 | Bacteria | 2798 |
| 488 | Ga0307416_100208032 | 3300032002 | Bacteria | 1863 |
| 489 | Ga0307414_10082462 | 3300032004 | Bacteria | 2358 |
| 490 | Ga0307414_10095821 | 3300032004 | Bacteria | 2219 |
| 491 | Ga0307411_10006306 | 3300032005 | Bacteria | 5924 |
| 492 | Ga0307411_10117721 | 3300032005 | Bacteria | 1915 |
| 493 | Ga0307415_100151194 | 3300032126 | Bacteria | 1787 |
| 494 | Ga0307415_100255714 | 3300032126 | Bacteria | 1426 |
| 495 | Ga0316583_10001507 | 3300032133 | Bacteria | 7819 |
| 496 | Ga0316583_10004878 | 3300032133 | Bacteria | 4792 |
| 497 | Ga0316583_10019282 | 3300032133 | Bacteria | 2449 |
| 498 | Ga0316583_10023096 | 3300032133 | Bacteria | 2224 |
| 499 | Ga0316585_10000073 | 3300032137 | Bacteria | 16824 |
| 500 | Ga0316585_10002133 | 3300032137 | Bacteria | 5313 |
| 501 | Ga0316585_10003695 | 3300032137 | Bacteria | 4217 |
| 502 | Ga0316585_10017436 | 3300032137 | Bacteria | 2171 |
| 503 | Ga0316580_10000051 | 3300032139 | Bacteria | 18436 |
| 504 | Ga0316580_10025706 | 3300032139 | Bacteria | 1820 |
| 505 | Ga0316593_10021582 | 3300032168 | Bacteria | 2015 |
| 506 | Ga0316592_1003106 | 3300033524 | Bacteria | 2949 |
| 507 | Ga0316592_1017061 | 3300033524 | Bacteria | 1522 |
| 508 | Ga0316588_1006791 | 3300033528 | Bacteria | 2301 |
| 509 | Ga0316596_1008035 | 3300033541 | Bacteria | 2503 |
| 510 | Ga0316596_1017544 | 3300033541 | Bacteria | 1801 |
| 511 | Ga0373934_0000733 | 3300035086 | Bacteria | 11722 |
| 512 | Ga0373956_0000052 | 3300035119 | Bacteria | 39445 |
| 513 | Ga0373942_0027915 | 3300035207 | Bacteria | 1472 |
| 514 | Ga0316574_0000364 | 3300035398 | Bacteria | 17597 |
| 515 | Ga0316574_0002040 | 3300035398 | Bacteria | 9965 |
| 516 | Ga0316574_0002613 | 3300035398 | Bacteria | 9078 |
| 517 | Ga0316574_0002894 | 3300035398 | Bacteria | 8728 |
| 518 | Ga0316574_0004691 | 3300035398 | Bacteria | 7202 |
| 519 | Ga0316574_0009554 | 3300035398 | Bacteria | 5437 |
| 520 | Ga0316574_0012398 | 3300035398 | Bacteria | 4876 |
| 521 | Ga0316574_0098399 | 3300035398 | Bacteria | 1871 |
| 522 | Ga0373931_0013648 | 3300035691 | Bacteria | 3960 |
| 523 | Ga0373927_0000005 | 3300035695 | Bacteria | 221415 |
| 524 | Ga0373927_0000534 | 3300035695 | Bacteria | 28917 |
| 525 | Ga0373927_0095577 | 3300035695 | Bacteria | 1931 |
| 526 | Ga0373947_0068933 | 3300035725 | Bacteria | 2164 |
| 527 | Ga0316582_0000061 | 3300036647 | Bacteria | 27141 |
| 528 | Ga0316582_0002101 | 3300036647 | Bacteria | 9197 |
| 529 | Ga0316582_0041377 | 3300036647 | Unclassified | 2880 |
| 530 | Ga0316584_0000438 | 3300036712 | Bacteria | 21611 |
| 531 | Ga0316584_0002041 | 3300036712 | Bacteria | 12629 |
| 532 | Ga0316584_0004425 | 3300036712 | Bacteria | 9306 |
| 533 | Ga0316584_0005513 | 3300036712 | Bacteria | 8502 |
| 534 | Ga0316584_0006548 | 3300036712 | Bacteria | 7891 |
| 535 | Ga0316584_0041492 | 3300036712 | Bacteria | 3430 |
| 536 | Ga0316584_0083829 | 3300036712 | Bacteria | 2387 |
| 537 | Ga0316584_0101902 | 3300036712 | Bacteria | 2150 |
| 538 | Ga0373925_0004158 | 3300037068 | Bacteria | 10975 |
| 539 | Ga0395899_0004006 | 3300037312 | Bacteria | 11610 |
| 540 | Ga0395900_0037099 | 3300037418 | Bacteria | 5026 |
| 541 | Ga0395900_0228334 | 3300037418 | Bacteria | 1873 |
| 542 | Ga0395898_0161312 | 3300037466 | Bacteria | 2144 |
| 543 | Ga0395905_0000508 | 3300037471 | Bacteria | 53375 |
| 544 | Ga0316581_0002092 | 3300037588 | Bacteria | 4690 |
| 545 | Ga0436364_0134803 | 3300037853 | Bacteria | 7473 |
| 546 | Ga0436364_0479890 | 3300037853 | Bacteria | 6056 |
| 547 | Ga0436364_1156075 | 3300037853 | Bacteria | 5698 |
| 548 | Ga0436364_1361321 | 3300037853 | Bacteria | 5774 |
| 549 | Ga0395901_0261684 | 3300038443 | Bacteria | 1800 |
| 550 | Ga0400484_20588 | 3300038725 | Bacteria | 6383 |
| 551 | Ga0400490_21698 | 3300038726 | Bacteria | 11841 |
| 552 | Ga0400488_10895 | 3300038741 | Bacteria | 23438 |
| 553 | Ga0400483_078057 | 3300039062 | Bacteria | 3698 |
| 554 | Ga0400483_253101 | 3300039062 | Bacteria | 3193 |
| 555 | Ga0400489_36173 | 3300039093 | Bacteria | 23860 |
| 556 | Ga0436365_0133306 | 3300039437 | Bacteria | 59687 |
| 557 | Ga0436365_0393632 | 3300039437 | Bacteria | 30038 |
| 558 | Ga0436365_0400866 | 3300039437 | Bacteria | 29144 |
| 559 | Ga0436365_1568843 | 3300039437 | Bacteria | 2081 |
| 560 | Ga0436360_0887245 | 3300039438 | Bacteria | 4584 |
| 561 | Ga0436363_0972237 | 3300039450 | Bacteria | 3245 |
| 562 | Ga0436362_0303488 | 3300039453 | Bacteria | 4043 |
| 563 | Ga0439438_009557 | 3300041405 | Bacteria | 3131 |
| 564 | Ga0439461_0001049 | 3300041410 | Bacteria | 4162 |
| 565 | Ga0439461_0002801 | 3300041410 | Bacteria | 2818 |
| 566 | Ga0439466_0002725 | 3300041411 | Bacteria | 6921 |
| 567 | Ga0439466_0004980 | 3300041411 | Bacteria | 5099 |
| 568 | Ga0439466_0007166 | 3300041411 | Bacteria | 4217 |
| 569 | Ga0439465_0000360 | 3300041413 | Bacteria | 13039 |
| 570 | Ga0439465_0027256 | 3300041413 | Bacteria | 1809 |
| 571 | Ga0451791_1743147 | 3300041451 | Bacteria | 2192 |
| 572 | Ga0451793_0347653 | 3300041452 | Bacteria | 2251 |
| 573 | Ga0451797_0475613 | 3300041453 | Bacteria | 5154 |
| 574 | Ga0451795_1334275 | 3300041456 | Bacteria | 2559 |
| 575 | Ga0451843_0670195 | 3300041509 | Bacteria | 5635 |
| 576 | Ga0451855_0221036 | 3300041511 | Bacteria | 1931 |
| 577 | Ga0451855_0653154 | 3300041511 | Bacteria | 3167 |
| 578 | Ga0451855_0972306 | 3300041511 | Bacteria | 1592 |
| 579 | Ga0439431_0008065 | 3300041997 | Bacteria | 2361 |
| 580 | Ga0439445_0001784 | 3300042004 | Bacteria | 4744 |
| 581 | Ga0439448_0003342 | 3300042005 | Bacteria | 4439 |
| 582 | Ga0439449_0014739 | 3300042007 | Bacteria | 2937 |
| 583 | Ga0439450_016217 | 3300042008 | Bacteria | 1538 |
| 584 | Ga0450907_000166 | 3300042146 | Bacteria | 24177 |
| 585 | Ga0439434_0003113 | 3300042435 | Bacteria | 4875 |
| 586 | Ga0439434_0006469 | 3300042435 | Bacteria | 3423 |
| 587 | Ga0439434_0037420 | 3300042435 | Bacteria | 1486 |
| 588 | Ga0451577_0000033 | 3300042876 | Bacteria | 378714 |
| 589 | Ga0451577_0000678 | 3300042876 | Bacteria | 53675 |
| 590 | Ga0451577_0001461 | 3300042876 | Bacteria | 31393 |
| 591 | Ga0451577_0012257 | 3300042876 | Bacteria | 8057 |
| 592 | Ga0451577_0053272 | 3300042876 | Bacteria | 3612 |
| 593 | Ga0451577_0056221 | 3300042876 | Bacteria | 3509 |
| 594 | Ga0451577_0068080 | 3300042876 | Bacteria | 3175 |
| 595 | Ga0451577_0094592 | 3300042876 | Bacteria | 2668 |
| 596 | Ga0451577_0113821 | 3300042876 | Bacteria | 2421 |
| 597 | Ga0451577_0245705 | 3300042876 | Bacteria | 1620 |
| 598 | Ga0466972_0001036 | 3300044658 | Bacteria | 13349 |
| 599 | Ga0466972_0003356 | 3300044658 | Bacteria | 7934 |
| 600 | Ga0466972_0016856 | 3300044658 | Bacteria | 3655 |
| 601 | Ga0466972_0030839 | 3300044658 | Bacteria | 2639 |
| 602 | Ga0466972_0054111 | 3300044658 | Bacteria | 1931 |
| 603 | Ga0453683_0000014 | 3300044673 | Bacteria | 364381 |
| 604 | Ga0453683_0103589 | 3300044673 | Bacteria | 1787 |
| 605 | Ga0453683_0174037 | 3300044673 | Bacteria | 1364 |
| 606 | Ga0466965_0000992 | 3300044683 | Bacteria | 10972 |
| 607 | Ga0466965_0014127 | 3300044683 | Bacteria | 3777 |
| 608 | Ga0466965_0024392 | 3300044683 | Bacteria | 2925 |
| 609 | Ga0466965_0038153 | 3300044683 | Bacteria | 2359 |
| 610 | Ga0466966_0001673 | 3300044684 | Bacteria | 14302 |
| 611 | Ga0466966_0013763 | 3300044684 | Bacteria | 5352 |
| 612 | Ga0466966_0041805 | 3300044684 | Bacteria | 2944 |
| 613 | Ga0466961_0002498 | 3300044693 | Bacteria | 11408 |
| 614 | Ga0466961_0003492 | 3300044693 | Bacteria | 9801 |
| 615 | Ga0466961_0054203 | 3300044693 | Bacteria | 2558 |
| 616 | Ga0466963_0007601 | 3300044694 | Bacteria | 6470 |
| 617 | Ga0466963_0013858 | 3300044694 | Bacteria | 4964 |
| 618 | Ga0466963_0017445 | 3300044694 | Bacteria | 4476 |
| 619 | Ga0466963_0019045 | 3300044694 | Bacteria | 4298 |
| 620 | Ga0466963_0079577 | 3300044694 | Bacteria | 2217 |
| 621 | Ga0453684_0000001 | 3300044712 | Bacteria | 2623166 |
| 622 | Ga0453684_0000109 | 3300044712 | Bacteria | 361015 |
| 623 | Ga0453684_0000192 | 3300044712 | Bacteria | 266757 |
| 624 | Ga0453684_0000221 | 3300044712 | Bacteria | 249908 |
| 625 | Ga0453684_0000242 | 3300044712 | Bacteria | 234895 |
| 626 | Ga0453684_0002738 | 3300044712 | Bacteria | 41734 |
| 627 | Ga0453684_0005564 | 3300044712 | Bacteria | 24856 |
| 628 | Ga0453684_0023701 | 3300044712 | Bacteria | 9018 |
| 629 | Ga0453684_0031402 | 3300044712 | Bacteria | 7467 |
| 630 | Ga0453684_0046343 | 3300044712 | Bacteria | 5782 |
| 631 | Ga0453684_0048265 | 3300044712 | Bacteria | 5633 |
| 632 | Ga0453684_0049072 | 3300044712 | Bacteria | 5571 |
| 633 | Ga0453684_0083330 | 3300044712 | Bacteria | 3980 |
| 634 | Ga0453684_0097493 | 3300044712 | Bacteria | 3608 |
| 635 | Ga0453684_0097761 | 3300044712 | Bacteria | 3602 |
| 636 | Ga0466971_0006008 | 3300044719 | Bacteria | 5283 |
| 637 | Ga0466971_0078608 | 3300044719 | Bacteria | 1503 |
| 638 | Ga0466968_0031547 | 3300044735 | Bacteria | 2199 |
| 639 | Ga0466970_0004237 | 3300044765 | Bacteria | 7057 |
| 640 | Ga0466970_0133977 | 3300044765 | Bacteria | 1362 |
| 641 | Ga0466957_0007005 | 3300044842 | Bacteria | 6372 |
| 642 | Ga0466957_0044123 | 3300044842 | Unclassified | 2702 |
| 643 | Ga0466957_0140765 | 3300044842 | Bacteria | 1554 |
| 644 | Ga0466960_0000113 | 3300044901 | Bacteria | 27016 |
| 645 | Ga0466960_0007813 | 3300044901 | Bacteria | 4361 |
| 646 | Ga0466960_0016089 | 3300044901 | Bacteria | 3237 |
| 647 | Ga0466960_0017361 | 3300044901 | Bacteria | 3136 |
| 648 | Ga0466959_0003322 | 3300045049 | Bacteria | 10503 |
| 649 | Ga0466959_0004649 | 3300045049 | Bacteria | 9236 |
| 650 | Ga0466959_0045606 | 3300045049 | Bacteria | 3228 |
| 651 | Ga0466959_0077378 | 3300045049 | Unclassified | 2401 |
| 652 | Ga0451576_0001145 | 3300045051 | Bacteria | 47877 |
| 653 | Ga0451576_0018340 | 3300045051 | Bacteria | 7674 |
| 654 | Ga0451576_0036371 | 3300045051 | Bacteria | 5220 |
| 655 | Ga0451576_0105848 | 3300045051 | Bacteria | 2927 |
| 656 | Ga0451576_0197712 | 3300045051 | Unclassified | 2100 |
| 657 | Ga0466958_0002748 | 3300045836 | Bacteria | 8935 |
| 658 | Ga0466967_0007991 | 3300045976 | Bacteria | 7702 |
| 659 | Ga0466967_0019764 | 3300045976 | Bacteria | 5425 |
| 660 | Ga0466967_0020561 | 3300045976 | Bacteria | 5340 |
| 661 | Ga0466967_0022311 | 3300045976 | Bacteria | 5163 |
| 662 | Ga0466967_0027709 | 3300045976 | Bacteria | 4717 |
| 663 | Ga0466967_0056280 | 3300045976 | Bacteria | 3467 |
| 664 | Ga0466967_0098295 | 3300045976 | Bacteria | 2672 |
| 665 | Ga0466967_0339618 | 3300045976 | Bacteria | 1452 |
| 666 | Ga0495592_0114713 | 3300046454 | Bacteria | 1902 |
| 667 | Ga0495603_0031908 | 3300046455 | Bacteria | 3171 |
| 668 | Ga0495629_0024641 | 3300046459 | Bacteria | 4283 |
| 669 | Ga0495638_0008490 | 3300046460 | Bacteria | 7280 |
| 670 | Ga0495641_0039333 | 3300046461 | Bacteria | 2206 |
| 671 | Ga0495664_0067289 | 3300046477 | Bacteria | 2137 |
| 672 | Ga0495606_0019487 | 3300046507 | Bacteria | 5045 |
| 673 | Ga0495630_0048775 | 3300046517 | Bacteria | 3169 |
| 674 | Ga0495652_0002631 | 3300046529 | Bacteria | 18326 |
| 675 | Ga0495665_0011992 | 3300046531 | Bacteria | 4692 |
| 676 | Ga0495640_0073042 | 3300046533 | Bacteria | 2297 |
| 677 | Ga0495586_0002297 | 3300046535 | Bacteria | 10396 |
| 678 | Ga0495645_0027997 | 3300046543 | Bacteria | 4094 |
| 679 | Ga0495668_0000128 | 3300046616 | Bacteria | 113090 |
| 680 | Ga0495668_0008106 | 3300046616 | Bacteria | 6612 |
| 681 | Ga0495668_0022852 | 3300046616 | Bacteria | 3572 |
| 682 | Ga0495635_0050572 | 3300046663 | Bacteria | 2865 |
| 683 | Ga0495635_0082358 | 3300046663 | Bacteria | 2202 |
| 684 | Ga0495635_0204098 | 3300046663 | Bacteria | 1340 |
| 685 | Ga0495647_0050664 | 3300046681 | Bacteria | 1612 |
| 686 | Ga0495658_0021852 | 3300046683 | Bacteria | 3378 |
| 687 | Ga0495600_0142981 | 3300046809 | Bacteria | 1552 |
| 688 | Ga0495581_0082839 | 3300047315 | Bacteria | 1858 |
| 689 | Ga0495672_0005443 | 3300047320 | Bacteria | 10101 |
| 690 | Ga0495676_0065244 | 3300047321 | Bacteria | 2827 |
| 691 | Ga0495673_0003890 | 3300047469 | Bacteria | 9609 |
| 692 | Ga0495686_0021000 | 3300047472 | Bacteria | 4347 |
| 693 | Ga0495593_0014585 | 3300047673 | Bacteria | 4466 |
| 694 | Ga0496100_0002549 | 3300048903 | Bacteria | 9283 |
| 695 | Ga0496100_0005877 | 3300048903 | Bacteria | 6643 |
| 696 | Ga0496100_0009791 | 3300048903 | Bacteria | 5398 |
| 697 | Ga0496100_0028477 | 3300048903 | Bacteria | 3446 |
| 698 | Ga0496100_0040299 | 3300048903 | Bacteria | 2971 |
| 699 | Ga0496100_0101540 | 3300048903 | Bacteria | 1983 |
| 700 | Ga0496101_0000257 | 3300048904 | Bacteria | 37750 |
| 701 | Ga0496101_0003088 | 3300048904 | Bacteria | 10295 |
| 702 | Ga0496101_0074169 | 3300048904 | Bacteria | 2502 |
| 703 | Ga0496102_0000449 | 3300048905 | Bacteria | 46890 |
| 704 | Ga0496102_0001144 | 3300048905 | Bacteria | 24248 |
| 705 | Ga0496102_0012550 | 3300048905 | Bacteria | 7337 |
| 706 | Ga0496102_0023733 | 3300048905 | Bacteria | 5450 |
| 707 | Ga0496102_0048684 | 3300048905 | Bacteria | 3854 |
| 708 | Ga0496102_0097768 | 3300048905 | Bacteria | 2723 |
| 709 | Ga0496102_0097913 | 3300048905 | Bacteria | 2721 |
| 710 | Ga0496102_0112039 | 3300048905 | Bacteria | 2544 |
| 711 | Ga0496103_0000515 | 3300048906 | Bacteria | 31901 |
| 712 | Ga0496103_0002601 | 3300048906 | Bacteria | 11301 |
| 713 | Ga0496103_0004413 | 3300048906 | Bacteria | 8534 |
| 714 | Ga0496103_0005803 | 3300048906 | Bacteria | 7374 |
| 715 | Ga0496103_0064025 | 3300048906 | Bacteria | 2291 |
| 716 | Ga0496103_0090101 | 3300048906 | Bacteria | 1935 |
| 717 | Ga0496103_0172465 | 3300048906 | Bacteria | 1389 |
| 718 | Ga0496104_0000393 | 3300048907 | Bacteria | 38237 |
| 719 | Ga0496104_0025610 | 3300048907 | Bacteria | 5439 |
| 720 | Ga0496104_0041185 | 3300048907 | Bacteria | 4330 |
| 721 | Ga0496104_0157869 | 3300048907 | Bacteria | 2176 |
| 722 | Ga0496105_0004210 | 3300048908 | Bacteria | 10805 |
| 723 | Ga0496105_0005980 | 3300048908 | Bacteria | 9289 |
| 724 | Ga0496105_0007202 | 3300048908 | Bacteria | 8587 |
| 725 | Ga0496105_0008164 | 3300048908 | Bacteria | 8137 |
| 726 | Ga0496105_0049593 | 3300048908 | Bacteria | 3467 |
| 727 | Ga0496105_0079234 | 3300048908 | Bacteria | 2713 |
| 728 | Ga0496106_0001146 | 3300048909 | Bacteria | 19638 |
| 729 | Ga0496106_0001338 | 3300048909 | Bacteria | 18479 |
| 730 | Ga0496106_0007880 | 3300048909 | Bacteria | 7874 |
| 731 | Ga0496106_0167881 | 3300048909 | Bacteria | 1738 |
| 732 | Ga0496107_0009085 | 3300048910 | Bacteria | 6890 |
| 733 | Ga0496107_0009400 | 3300048910 | Bacteria | 6781 |
| 734 | Ga0496107_0050830 | 3300048910 | Bacteria | 2988 |
| 735 | Ga0496107_0084787 | 3300048910 | Bacteria | 2312 |
| 736 | Ga0496108_0008469 | 3300048911 | Bacteria | 8343 |
| 737 | Ga0496108_0072025 | 3300048911 | Bacteria | 2917 |
| 738 | Ga0496109_0000077 | 3300048912 | Bacteria | 103492 |
| 739 | Ga0496109_0001897 | 3300048912 | Bacteria | 17353 |
| 740 | Ga0496109_0007105 | 3300048912 | Bacteria | 9452 |
| 741 | Ga0496109_0009146 | 3300048912 | Bacteria | 8436 |
| 742 | Ga0496109_0067612 | 3300048912 | Bacteria | 3274 |
| 743 | Ga0496110_0001985 | 3300048913 | Bacteria | 15214 |
| 744 | Ga0496110_0022702 | 3300048913 | Bacteria | 5331 |
| 745 | Ga0496112_0026657 | 3300048915 | Bacteria | 5566 |
| 746 | Ga0496112_0032298 | 3300048915 | Bacteria | 5082 |
| 747 | Ga0496112_0255298 | 3300048915 | Bacteria | 1703 |
| 748 | Ga0496113_0029412 | 3300048916 | Bacteria | 3967 |
| 749 | Ga0496113_0110460 | 3300048916 | Bacteria | 2139 |
| 750 | Ga0496114_0000505 | 3300048917 | Bacteria | 28572 |
| 751 | Ga0496114_0001642 | 3300048917 | Bacteria | 16968 |
| 752 | Ga0496114_0002421 | 3300048917 | Bacteria | 14237 |
| 753 | Ga0496114_0004211 | 3300048917 | Bacteria | 11148 |
| 754 | Ga0496114_0010931 | 3300048917 | Bacteria | 7236 |
| 755 | Ga0496114_0012312 | 3300048917 | Bacteria | 6844 |
| 756 | Ga0496114_0019626 | 3300048917 | Bacteria | 5477 |
| 757 | Ga0496114_0025042 | 3300048917 | Bacteria | 4875 |
| 758 | Ga0496114_0077898 | 3300048917 | Bacteria | 2796 |
| 759 | Ga0496114_0171499 | 3300048917 | Bacteria | 1891 |
| 760 | Ga0496115_0000841 | 3300048918 | Bacteria | 22438 |
| 761 | Ga0496115_0011790 | 3300048918 | Bacteria | 6564 |
| 762 | Ga0496115_0087804 | 3300048918 | Bacteria | 2538 |
| 763 | Ga0496116_0000270 | 3300048919 | Bacteria | 90462 |
| 764 | Ga0496116_0004509 | 3300048919 | Bacteria | 13254 |
| 765 | Ga0496117_0000417 | 3300048920 | Bacteria | 71654 |
| 766 | Ga0496117_0007971 | 3300048920 | Bacteria | 10171 |
| 767 | Ga0496117_0105474 | 3300048920 | Bacteria | 1771 |
| 768 | Ga0496118_0000350 | 3300048921 | Bacteria | 78354 |
| 769 | Ga0496118_0002093 | 3300048921 | Bacteria | 28035 |
| 770 | Ga0496118_0003067 | 3300048921 | Bacteria | 21437 |
| 771 | Ga0496118_0072894 | 3300048921 | Bacteria | 2463 |
| 772 | Ga0496119_0000287 | 3300048922 | Bacteria | 70711 |
| 773 | Ga0496119_0000986 | 3300048922 | Bacteria | 36613 |
| 774 | Ga0496119_0001473 | 3300048922 | Bacteria | 28179 |
| 775 | Ga0496119_0006715 | 3300048922 | Bacteria | 10576 |
| 776 | Ga0496119_0016401 | 3300048922 | Bacteria | 5639 |
| 777 | Ga0496120_0000666 | 3300048923 | Bacteria | 50471 |
| 778 | Ga0496120_0002191 | 3300048923 | Bacteria | 20676 |
| 779 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 780 | Ga0496122_0000051 | 3300048925 | Bacteria | 265104 |
| 781 | Ga0496122_0000999 | 3300048925 | Bacteria | 50246 |
| 782 | Ga0496122_0022058 | 3300048925 | Bacteria | 5673 |
| 783 | Ga0496123_0004459 | 3300048926 | Bacteria | 14695 |
| 784 | Ga0496123_0008921 | 3300048926 | Bacteria | 9117 |
| 785 | Ga0496123_0018252 | 3300048926 | Bacteria | 5588 |
| 786 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 787 | Ga0496124_0026671 | 3300048927 | Bacteria | 5206 |
| 788 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 789 | Ga0496125_0008825 | 3300048928 | Bacteria | 10481 |
| 790 | Ga0496125_0074147 | 3300048928 | Bacteria | 2640 |
| 791 | Ga0496125_0111564 | 3300048928 | Bacteria | 1978 |
| 792 | Ga0496126_0000011 | 3300048929 | Bacteria | 744275 |
| 793 | Ga0496126_0001185 | 3300048929 | Bacteria | 42682 |
| 794 | Ga0496126_0006073 | 3300048929 | Bacteria | 13554 |
| 795 | Ga0496126_0009101 | 3300048929 | Bacteria | 10605 |
| 796 | Ga0501031_0062214 | 3300049568 | Bacteria | 2432 |
| 797 | Ga0501032_0000220 | 3300049569 | Bacteria | 47403 |
| 798 | Ga0501032_0001996 | 3300049569 | Bacteria | 16076 |
| 799 | Ga0501032_0036656 | 3300049569 | Bacteria | 3347 |
| 800 | Ga0501032_0041401 | 3300049569 | Bacteria | 3129 |
| 801 | Ga0501033_0004341 | 3300049570 | Bacteria | 11370 |
| 802 | Ga0501034_0000445 | 3300049571 | Bacteria | 68416 |
| 803 | Ga0501034_0001377 | 3300049571 | Bacteria | 32679 |
| 804 | Ga0501034_0005081 | 3300049571 | Bacteria | 14453 |
| 805 | Ga0501034_0023012 | 3300049571 | Bacteria | 6349 |
| 806 | Ga0501034_0040207 | 3300049571 | Bacteria | 4734 |
| 807 | Ga0501034_0061252 | 3300049571 | Bacteria | 3779 |
| 808 | Ga0501034_0073318 | 3300049571 | Bacteria | 3432 |
| 809 | Ga0501034_0077654 | 3300049571 | Bacteria | 3326 |
| 810 | Ga0501034_0096570 | 3300049571 | Bacteria | 2951 |
| 811 | Ga0501034_0134219 | 3300049571 | Bacteria | 2457 |
| 812 | Ga0501036_0008832 | 3300049572 | Bacteria | 8273 |
| 813 | Ga0501037_0001541 | 3300049573 | Bacteria | 16809 |
| 814 | Ga0501037_0002453 | 3300049573 | Bacteria | 13411 |
| 815 | Ga0501037_0015180 | 3300049573 | Bacteria | 5668 |
| 816 | Ga0501038_0008674 | 3300049574 | Bacteria | 9333 |
| 817 | Ga0501038_0016120 | 3300049574 | Bacteria | 6782 |
| 818 | Ga0501038_0020165 | 3300049574 | Bacteria | 5998 |
| 819 | Ga0501038_0086295 | 3300049574 | Bacteria | 2637 |
| 820 | Ga0501038_0302616 | 3300049574 | Bacteria | 1255 |
| 821 | Ga0501039_0001154 | 3300049575 | Bacteria | 19473 |
| 822 | Ga0501039_0189807 | 3300049575 | Bacteria | 1616 |
| 823 | Ga0501040_0168984 | 3300049576 | Bacteria | 1548 |
| 824 | Ga0501041_0120087 | 3300049577 | Bacteria | 1633 |
| 825 | Ga0501041_0123359 | 3300049577 | Bacteria | 1611 |
| 826 | Ga0501041_0232753 | 3300049577 | Bacteria | 1157 |
| 827 | Ga0501042_0005190 | 3300049578 | Bacteria | 8374 |
| 828 | Ga0501043_0002601 | 3300049579 | Bacteria | 15219 |
| 829 | Ga0501043_0043361 | 3300049579 | Bacteria | 3536 |
| 830 | Ga0501043_0055752 | 3300049579 | Bacteria | 3105 |
| 831 | Ga0501043_0064409 | 3300049579 | Bacteria | 2878 |
| 832 | Ga0501043_0143612 | 3300049579 | Bacteria | 1868 |
| 833 | Ga0501046_0011076 | 3300049580 | Bacteria | 7721 |
| 834 | Ga0501046_0016736 | 3300049580 | Bacteria | 6133 |
| 835 | Ga0501046_0044416 | 3300049580 | Bacteria | 3534 |
| 836 | Ga0501046_0231279 | 3300049580 | Bacteria | 1366 |
| 837 | Ga0501047_0013811 | 3300049581 | Bacteria | 7668 |
| 838 | Ga0501047_0018744 | 3300049581 | Bacteria | 6636 |
| 839 | Ga0501047_0044590 | 3300049581 | Bacteria | 4285 |
| 840 | Ga0501047_0073879 | 3300049581 | Bacteria | 3283 |
| 841 | Ga0501047_0076463 | 3300049581 | Bacteria | 3222 |
| 842 | Ga0501047_0078593 | 3300049581 | Bacteria | 3172 |
| 843 | Ga0501048_0005738 | 3300049582 | Bacteria | 9432 |
| 844 | Ga0501048_0085604 | 3300049582 | Bacteria | 2223 |
| 845 | Ga0501048_0110601 | 3300049582 | Bacteria | 1940 |
| 846 | Ga0501069_0056106 | 3300049585 | Bacteria | 2194 |
| 847 | Ga0501070_0000598 | 3300049586 | Bacteria | 32974 |
| 848 | Ga0501070_0020478 | 3300049586 | Bacteria | 5547 |
| 849 | Ga0501070_0055617 | 3300049586 | Bacteria | 3280 |
| 850 | Ga0501070_0125704 | 3300049586 | Bacteria | 2119 |
| 851 | Ga0501071_0065178 | 3300049587 | Bacteria | 2644 |
| 852 | Ga0501072_0008751 | 3300049588 | Bacteria | 7684 |
| 853 | Ga0501072_0057602 | 3300049588 | Bacteria | 3062 |
| 854 | Ga0501074_0056498 | 3300049590 | Bacteria | 2829 |
| 855 | Ga0501243_000303 | 3300049675 | Bacteria | 6343 |
| 856 | Ga0501079_0054308 | 3300049741 | Bacteria | 3090 |
| 857 | Ga0501079_0155125 | 3300049741 | Bacteria | 1785 |
| 858 | Ga0501080_0165019 | 3300049742 | Bacteria | 2044 |
| 859 | Ga0501035_0001245 | 3300049822 | Bacteria | 26448 |
| 860 | Ga0501035_0003175 | 3300049822 | Bacteria | 15766 |
| 861 | Ga0501035_0007676 | 3300049822 | Bacteria | 10077 |
| 862 | Ga0501035_0025913 | 3300049822 | Bacteria | 5372 |
| 863 | Ga0501035_0052011 | 3300049822 | Bacteria | 3666 |
| 864 | Ga0501035_0079202 | 3300049822 | Bacteria | 2902 |
| 865 | Ga0501044_0001562 | 3300049823 | Bacteria | 26827 |
| 866 | Ga0501044_0002930 | 3300049823 | Bacteria | 19405 |
| 867 | Ga0501044_0003864 | 3300049823 | Bacteria | 16786 |
| 868 | Ga0501044_0005126 | 3300049823 | Bacteria | 14613 |
| 869 | Ga0501044_0005857 | 3300049823 | Bacteria | 13613 |
| 870 | Ga0501044_0007350 | 3300049823 | Bacteria | 12109 |
| 871 | Ga0501044_0028145 | 3300049823 | Bacteria | 5932 |
| 872 | nmdc:mga03683_1170_c1 | 3300050489 | Bacteria | 4572 |
| 873 | nmdc:mga03683_73819_c1 | 3300050489 | Bacteria | 1463 |
| 874 | nmdc:mga03n38_1283_c1 | 3300050490 | Bacteria | 7074 |
| 875 | nmdc:mga03n38_33103_c1 | 3300050490 | Bacteria | 2196 |
| 876 | nmdc:mga00v17_11210_c1 | 3300050491 | Bacteria | 4922 |
| 877 | nmdc:mga00v17_121415_c1 | 3300050491 | Bacteria | 1664 |
| 878 | nmdc:mga00v17_1409_c1 | 3300050491 | Bacteria | 12612 |
| 879 | nmdc:mga00v17_18414_c1 | 3300050491 | Bacteria | 3967 |
| 880 | nmdc:mga00v17_23933_c1 | 3300050491 | Bacteria | 3538 |
| 881 | nmdc:mga00v17_2600_c1 | 3300050491 | Bacteria | 9257 |
| 882 | nmdc:mga00v17_2741_c1 | 3300050491 | Bacteria | 9040 |
| 883 | nmdc:mga00v17_4248_c1 | 3300050491 | Bacteria | 7436 |
| 884 | nmdc:mga00v17_6295_c1 | 3300050491 | Bacteria | 6295 |
| 885 | nmdc:mga0yw44_14219_c1 | 3300050492 | Bacteria | 4217 |
| 886 | nmdc:mga0yw44_23304_c1 | 3300050492 | Bacteria | 3486 |
| 887 | nmdc:mga0yw44_4278_c1 | 3300050492 | Bacteria | 6512 |
| 888 | nmdc:mga06z11_35071_c1 | 3300050494 | Bacteria | 2466 |
| 889 | nmdc:mga04h51_16199_c1 | 3300050495 | Bacteria | 2161 |
| 890 | nmdc:mga04h51_9089_c1 | 3300050495 | Bacteria | 2680 |
| 891 | nmdc:mga07m45_16107_c1 | 3300050496 | Bacteria | 4000 |
| 892 | nmdc:mga07m45_39538_c2 | 3300050496 | Bacteria | 1822 |
| 893 | nmdc:mga07m45_7367_c1 | 3300050496 | Bacteria | 5619 |
| 894 | nmdc:mga07m45_74716_c1 | 3300050496 | Bacteria | 1931 |
| 895 | nmdc:mga05p37_215378_c1 | 3300050507 | Bacteria | 2320 |
| 896 | nmdc:mga05p37_2806_c1 | 3300050507 | Bacteria | 20259 |
| 897 | nmdc:mga05p37_55499_c1 | 3300050507 | Bacteria | 4875 |
| 898 | nmdc:mga0qj67_2769_c1 | 3300050509 | Bacteria | 12576 |
| 899 | nmdc:mga06r32_16909_c1 | 3300050510 | Bacteria | 6654 |
| 900 | nmdc:mga06r32_20521_c1 | 3300050510 | Bacteria | 6084 |
| 901 | nmdc:mga06r32_28548_c1 | 3300050510 | Bacteria | 5223 |
| 902 | nmdc:mga06r32_60262_c1 | 3300050510 | Bacteria | 3652 |
| 903 | nmdc:mga08y16_16944_c1 | 3300050511 | Bacteria | 7672 |
| 904 | nmdc:mga08y16_21860_c1 | 3300050511 | Bacteria | 6751 |
| 905 | nmdc:mga0n895_298925_c1 | 3300050512 | Bacteria | 1632 |
| 906 | nmdc:mga0sz30_11890_c1 | 3300050516 | Bacteria | 3375 |
| 907 | nmdc:mga0sz30_12763_c1 | 3300050516 | Bacteria | 3274 |
| 908 | nmdc:mga0sz30_16847_c1 | 3300050516 | Bacteria | 2907 |
| 909 | nmdc:mga0sz30_866_c1 | 3300050516 | Bacteria | 10911 |
| 910 | Ga0500610_0048020 | 3300053079 | Bacteria | 2219 |
| 911 | Ga0495619_0071254 | 3300053085 | Bacteria | 2326 |
| 912 | Ga0500643_003393 | 3300053087 | Bacteria | 7699 |
| 913 | Ga0500641_0029591 | 3300053096 | Bacteria | 2147 |
| 914 | Ga0500562_024787 | 3300053108 | Bacteria | 1568 |
| 915 | Ga0500652_000732 | 3300053131 | Bacteria | 11126 |
| 916 | Ga0500568_0000053 | 3300053139 | Bacteria | 111636 |
| 917 | Ga0500616_0001306 | 3300053153 | Bacteria | 24694 |
| 918 | Ga0500616_0011313 | 3300053153 | Bacteria | 5280 |
| 919 | Ga0500616_0044570 | 3300053153 | Bacteria | 2366 |
| 920 | Ga0500616_0075697 | 3300053153 | Bacteria | 1703 |
| 921 | Ga0500627_0010229 | 3300053158 | Bacteria | 3413 |
| 922 | Ga0500645_000096 | 3300053730 | Bacteria | 69252 |
| 923 | Ga0500645_003598 | 3300053730 | Bacteria | 6219 |
| 924 | Ga0501084_0000063 | 3300054114 | Bacteria | 81573 |
| 925 | Ga0501084_0041178 | 3300054114 | Bacteria | 3864 |
| 926 | Ga0501084_0258334 | 3300054114 | Bacteria | 1470 |
| 927 | Ga0501082_0048677 | 3300060353 | Bacteria | 3654 |
| 928 | Ga0501082_0092554 | 3300060353 | Bacteria | 2612 |
| 929 | Ga0466962_0000285 | 3300061719 | Bacteria | 21386 |
| 930 | Ga0466962_0012520 | 3300061719 | Bacteria | 4078 |
| 931 | 2546948877 | 2546825537 | Bacteria | 5389291 |
| 932 | 2506868136 | 2506783011 | Bacteria | 5323186 |
| 933 | 2517759158 | 2517572101 | Bacteria | 6884336 |
| 934 | 2523382544 | 2523231044 | Bacteria | 6434991 |
| 935 | 2528204355 | 2527291627 | Bacteria | 5309833 |
| 936 | 2528213981 | 2527291629 | Bacteria | 5267418 |
| 937 | 2548695500 | 2547132424 | Bacteria | 8348532 |
| 938 | 2552106016 | 2551306166 | Bacteria | 9731570 |
| 939 | 2566992057 | 2565956761 | Bacteria | 6601618 |
| 940 | 2566995162 | 2565956761 | Bacteria | 6601618 |
| 941 | 2579749714 | 2576861822 | Bacteria | 5004595 |
| 942 | 2579853456 | 2579778521 | Bacteria | 7624758 |
| 943 | 2619857976 | 2619618881 | Bacteria | 7521104 |
| 944 | 2620349112 | 2619619003 | Bacteria | 7619552 |
| 945 | 2623498053 | 2622736605 | Bacteria | 4992138 |
| 946 | 2626637144 | 2626541554 | Bacteria | 7741902 |
| 947 | 2644034166 | 2643221604 | Bacteria | 5014917 |
| 948 | 2644489900 | 2643221687 | Bacteria | 6500351 |
| 949 | 2644504744 | 2643221690 | Bacteria | 4654705 |
| 950 | 2644515214 | 2643221692 | Bacteria | 7282860 |
| 951 | 2644523790 | 2643221694 | Bacteria | 4392972 |
| 952 | 2644635510 | 2643221715 | Bacteria | 6671032 |
| 953 | 2644667893 | 2643221722 | Bacteria | 4247614 |
| 954 | 2671836105 | 2671180195 | Bacteria | 9757215 |
| 955 | 2686536806 | 2684623035 | Bacteria | 8032739 |
| 956 | 2686544445 | 2684623036 | Bacteria | 5199090 |
| 957 | 2687236625 | 2684623219 | Bacteria | 8442773 |
| 958 | 2689991341 | 2687453743 | Bacteria | 8361025 |
| 959 | 2710605847 | 2710264753 | Bacteria | 5455564 |
| 960 | 2729906859 | 2728369276 | Bacteria | 5610032 |
| 961 | 2731905650 | 2731639228 | Bacteria | 4187555 |
| 962 | 2738664556 | 2738541264 | Bacteria | 5935393 |
| 963 | 2738707526 | 2738541274 | Bacteria | 6909446 |
| 964 | 2738887333 | 2738541308 | Bacteria | 7020677 |
| 965 | 2738889444 | 2738541308 | Bacteria | 7020677 |
| 966 | 2739143691 | 2738541356 | Bacteria | 5935017 |
| 967 | 2739202918 | 2738543005 | Bacteria | 5278128 |
| 968 | 2739236446 | 2738543011 | Bacteria | 5731169 |
| 969 | 2739334015 | 2738543028 | Bacteria | 6917070 |
| 970 | 2739367344 | 2738543034 | Bacteria | 6084756 |
| 971 | 2744956313 | 2744054611 | Bacteria | 5611514 |
| 972 | 2745169017 | 2744054657 | Bacteria | 5016802 |
| 973 | 2753038016 | 2751185725 | Bacteria | 5740550 |
| 974 | 2753325884 | 2751185792 | Bacteria | 5739090 |
| 975 | 2774854261 | 2773857922 | Bacteria | 9757215 |
| 976 | 2774867966 | 2773857924 | Bacteria | 5256821 |
| 977 | 2774902560 | 2773857933 | Bacteria | 5818019 |
| 978 | 2788433336 | 2786546940 | Bacteria | 6396474 |
| 979 | 2808894850 | 2808606370 | Bacteria | 4942454 |
| 980 | 2817618377 | 2816332336 | Bacteria | 5207640 |
| 981 | 2837183184 | 2837183177 | Bacteria | 4637169 |
| 982 | 2842136954 | 2842134933 | Bacteria | 5847019 |
| 983 | 2842890165 | 2842888712 | Bacteria | 4279094 |
| 984 | 2862507686 | 2862507626 | Bacteria | 9425308 |
| 985 | 2889305927 | 2889300758 | Bacteria | 5690814 |
| 986 | 2895890386 | 2895880812 | Bacteria | 11255272 |
| 987 | 2902793271 | 2902792274 | Bacteria | 7270173 |
| 988 | 2902802861 | 2902799365 | Bacteria | 5419524 |
| 989 | 2902813457 | 2902810491 | Bacteria | 6794147 |
| 990 | 2902841525 | 2902837492 | Bacteria | 6697721 |
| 991 | 2904537314 | 2904535858 | Bacteria | 6308016 |
| 992 | 2904538540 | 2904535858 | Bacteria | 6308016 |
| 993 | 2904766041 | 2904765812 | Bacteria | 5369154 |
| 994 | 2904773468 | 2904770941 | Bacteria | 5580202 |
| 995 | 2908812194 | 2908811453 | Bacteria | 5478616 |
| 996 | 2919421534 | 2919420072 | Bacteria | 5390363 |
| 997 | 2919432708 | 2919432681 | Bacteria | 5390474 |
| 998 | 2919538796 | 2919538618 | Bacteria | 4677069 |
| 999 | 2919714399 | 2919713450 | Bacteria | 7431245 |
| 1000 | 2922559071 | 2922554459 | Bacteria | 6683962 |
| 1001 | 2922559272 | 2922554459 | Bacteria | 6683962 |
| 1002 | 2928142860 | 2928142448 | Bacteria | 5288925 |
| 1003 | 2929214008 | 2929212328 | Bacteria | 7708288 |
| 1004 | 2939587810 | 2939582691 | Bacteria | 7088898 |
| 1005 | 2939744069 | 2939743619 | Bacteria | 5762299 |
| 1006 | 2945924372 | 2945920336 | Bacteria | 4501603 |
| 1007 | 2956941094 | 2956939328 | Bacteria | 3474458 |
| 1008 | 2974318086 | 2974315732 | Bacteria | 4602776 |
| 1009 | 2984526303 | 2984523437 | Bacteria | 4508481 |
| 1010 | 3001120783 | 3001119090 | Bacteria | 3449530 |
| 1011 | 3006861234 | 3006858327 | Bacteria | 4317835 |
| 1012 | 637880151 | 637000116 | Bacteria | 5433628 |
| 1013 | 8002786083 | 8002784119 | Bacteria | 9788632 |
| 1014 | 8007378855 | 8007375930 | Bacteria | 4080554 |
| 1015 | 8022952780 | 8022948649 | Bacteria | 5366783 |
| 1016 | 8054800025 | 8054795415 | Bacteria | 9785225 |
| 1017 | 8054920686 | 8054913762 | Bacteria | 7713009 |
| 1018 | 8054925882 | 8054920844 | Bacteria | 7068637 |
| 1019 | 8055159036 | 8055157932 | Bacteria | 6429399 |
| 1020 | JGI24748J21848_1002610 | |||
| 1021 | JGI24744J21845_10000374 | |||
| 1022 | JGI24744J21845_10004592 | |||
| 1023 | Ga0007423J48922_100202 | |||
| 1024 | Ga0055532_1000354 | |||
| 1025 | Ga0055540_1000143 | |||
| 1026 | Ga0055540_1001925 | |||
| 1027 | Ga0055540_1002814 | |||
| 1028 | Ga0055540_1016761 | |||
| 1029 | Ga0065712_10079918 | |||
| 1030 | Ga0070658_10000640 | |||
| 1031 | Ga0070683_100014996 | |||
| 1032 | Ga0070683_100120895 | |||
| 1033 | Ga0070690_100074457 | |||
| 1034 | Ga0070670_100235857 | |||
| 1035 | Ga0068869_100008020 | |||
| 1036 | Ga0068869_100024055 | |||
| 1037 | Ga0070666_10050122 | |||
| 1038 | Ga0070666_10057114 | |||
| 1039 | Ga0070680_100000516 | |||
| 1040 | Ga0070682_100057091 | |||
| 1041 | Ga0070682_100077059 | |||
| 1042 | Ga0068868_100001422 | |||
| 1043 | Ga0068868_100180333 | |||
| 1044 | Ga0070660_100050741 | |||
| 1045 | Ga0070689_100036512 | |||
| 1046 | Ga0070687_100070656 | |||
| 1047 | Ga0070692_10015533 | |||
| 1048 | Ga0070692_10053492 | |||
| 1049 | Ga0070668_100000664 | |||
| 1050 | Ga0070668_100002923 | |||
| 1051 | Ga0070669_100001172 | |||
| 1052 | Ga0070669_100083302 | |||
| 1053 | Ga0070675_100196168 | |||
| 1054 | Ga0070671_100041760 | |||
| 1055 | Ga0070671_100053670 | |||
| 1056 | Ga0070674_100000217 | |||
| 1057 | Ga0070674_100008453 | |||
| 1058 | Ga0070688_100001298 | |||
| 1059 | Ga0070688_100064071 | |||
| 1060 | Ga0070659_100071487 | |||
| 1061 | Ga0070667_100000447 | |||
| 1062 | Ga0070667_100000722 | |||
| 1063 | Ga0070667_100004508 | |||
| 1064 | Ga0070667_100125612 | |||
| 1065 | Ga0070703_10016123 | |||
| 1066 | Ga0070703_10036339 | |||
| 1067 | Ga0070714_100043726 | |||
| 1068 | Ga0070714_100063662 | |||
| 1069 | Ga0070714_100128142 | |||
| 1070 | Ga0070714_100162410 | |||
| 1071 | Ga0070713_100022249 | |||
| 1072 | Ga0070710_10000197 | |||
| 1073 | Ga0070710_10007238 | |||
| 1074 | Ga0070710_10024093 | |||
| 1075 | Ga0070701_10000896 | |||
| 1076 | Ga0070711_100001123 | |||
| 1077 | Ga0070711_100003442 | |||
| 1078 | Ga0070705_100061611 | |||
| 1079 | Ga0070700_100002004 | |||
| 1080 | Ga0070708_100000179 | |||
| 1081 | Ga0070708_100001197 | |||
| 1082 | Ga0070678_100000266 | |||
| 1083 | Ga0070678_100000665 | |||
| 1084 | Ga0070678_100042350 | |||
| 1085 | Ga0070678_100096157 | |||
| 1086 | Ga0070678_100241051 | |||
| 1087 | Ga0070662_100001304 | |||
| 1088 | Ga0070681_10000365 | |||
| 1089 | Ga0070681_10000695 | |||
| 1090 | Ga0068867_100003480 | |||
| 1091 | Ga0070706_100001142 | |||
| 1092 | Ga0070706_100001344 | |||
| 1093 | Ga0070706_100002020 | |||
| 1094 | Ga0070706_100315799 | |||
| 1095 | Ga0070707_100000872 | |||
| 1096 | Ga0070707_100076569 | |||
| 1097 | Ga0070707_100137655 | |||
| 1098 | Ga0070698_100026557 | |||
| 1099 | Ga0070698_100186115 | |||
| 1100 | Ga0070699_100002327 | |||
| 1101 | Ga0070699_100006049 | |||
| 1102 | Ga0070679_100001038 | |||
| 1103 | Ga0070697_100005715 | |||
| 1104 | Ga0070697_100006668 | |||
| 1105 | Ga0070697_100008402 | |||
| 1106 | Ga0068853_100092105 | |||
| 1107 | Ga0068853_100112865 | |||
| 1108 | Ga0070672_100109922 | |||
| 1109 | Ga0070686_100113684 | |||
| 1110 | Ga0070665_100036202 | |||
| 1111 | Ga0070704_100000494 | |||
| 1112 | Ga0068855_100066593 | |||
| 1113 | Ga0068855_100075414 | |||
| 1114 | Ga0068855_100098156 | |||
| 1115 | Ga0068855_100280855 | |||
| 1116 | Ga0068854_100004995 | |||
| 1117 | Ga0068856_100227694 | |||
| 1118 | Ga0068856_100292532 | |||
| 1119 | Ga0068856_100311914 | |||
| 1120 | Ga0070702_100074044 | |||
| 1121 | Ga0068852_100144354 | |||
| 1122 | Ga0068859_100003471 | |||
| 1123 | Ga0068859_100012981 | |||
| 1124 | Ga0068859_100335154 | |||
| 1125 | Ga0068866_10002675 | |||
| 1126 | Ga0068866_10050079 | |||
| 1127 | Ga0068861_100001756 | |||
| 1128 | Ga0068861_100079970 | |||
| 1129 | Ga0068863_100001461 | |||
| 1130 | Ga0068863_100003619 | |||
| 1131 | Ga0068863_100007025 | |||
| 1132 | Ga0068863_100037746 | |||
| 1133 | Ga0068863_100044201 | |||
| 1134 | Ga0068858_100011847 | |||
| 1135 | Ga0068858_100057380 | |||
| 1136 | Ga0068860_100000016 | |||
| 1137 | Ga0068860_100012750 | |||
| 1138 | Ga0068860_100042915 | |||
| 1139 | Ga0068860_100155536 | |||
| 1140 | Ga0068862_100000051 | |||
| 1141 | Ga0068862_100002100 | |||
| 1142 | Ga0081455_10005085 | |||
| 1143 | Ga0081455_10018841 | |||
| 1144 | Ga0081538_10068249 | |||
| 1145 | Ga0081540_1036517 | |||
| 1146 | Ga0081539_10000088 | |||
| 1147 | Ga0070717_10000035 | |||
| 1148 | Ga0070717_10000786 | |||
| 1149 | Ga0070717_10142566 | |||
| 1150 | Ga0075365_10003121 | |||
| 1151 | Ga0075365_10022391 | |||
| 1152 | Ga0075365_10026965 | |||
| 1153 | Ga0075363_100000311 | |||
| 1154 | Ga0075363_100003969 | |||
| 1155 | Ga0075363_100007262 | |||
| 1156 | Ga0075363_100012419 | |||
| 1157 | Ga0075363_100019029 | |||
| 1158 | Ga0075363_100028692 | |||
| 1159 | Ga0075363_100115369 | |||
| 1160 | Ga0075364_10001449 | |||
| 1161 | Ga0075364_10001842 | |||
| 1162 | Ga0075364_10002181 | |||
| 1163 | Ga0075364_10018214 | |||
| 1164 | Ga0075364_10021337 | |||
| 1165 | Ga0075364_10023226 | |||
| 1166 | Ga0075364_10024399 | |||
| 1167 | Ga0075364_10041474 | |||
| 1168 | Ga0075432_10003041 | |||
| 1169 | Ga0070716_100011593 | |||
| 1170 | Ga0075362_10006975 | |||
| 1171 | Ga0075362_10061836 | |||
| 1172 | Ga0075367_10038965 | |||
| 1173 | Ga0075367_10049019 | |||
| 1174 | Ga0075367_10083584 | |||
| 1175 | Ga0075369_10002066 | |||
| 1176 | Ga0075369_10003829 | |||
| 1177 | Ga0075369_10013502 | |||
| 1178 | Ga0075369_10014781 | |||
| 1179 | Ga0075369_10028874 | |||
| 1180 | Ga0097621_100037724 | |||
| 1181 | Ga0097621_100096298 | |||
| 1182 | Ga0075370_10000615 | |||
| 1183 | Ga0075370_10012101 | |||
| 1184 | Ga0075370_10080890 | |||
| 1185 | Ga0075370_10096389 | |||
| 1186 | Ga0068871_100048836 | |||
| 1187 | Ga0075428_100008221 | |||
| 1188 | Ga0075431_100004137 | |||
| 1189 | Ga0075431_100034950 | |||
| 1190 | Ga0075433_10040235 | |||
| 1191 | Ga0068865_100004825 | |||
| 1192 | Ga0068865_100037438 | |||
| 1193 | Ga0068865_100095691 | |||
| 1194 | Ga0068865_100196603 | |||
| 1195 | Ga0097620_100003471 | |||
| 1196 | Ga0097620_100012980 | |||
| 1197 | Ga0097620_100335173 | |||
| 1198 | Ga0111539_10032005 | |||
| 1199 | Ga0105245_10001901 | |||
| 1200 | Ga0105245_10274004 | |||
| 1201 | Ga0105247_10000017 | |||
| 1202 | Ga0105247_10000042 | |||
| 1203 | Ga0105247_10000697 | |||
| 1204 | Ga0114129_10499526 | |||
| 1205 | Ga0105243_10000598 | |||
| 1206 | Ga0105243_10006183 | |||
| 1207 | Ga0105243_10006892 | |||
| 1208 | Ga0105243_10230750 | |||
| 1209 | Ga0105241_10013846 | |||
| 1210 | Ga0105242_10004254 | |||
| 1211 | Ga0105242_10010413 | |||
| 1212 | Ga0105242_10329592 | |||
| 1213 | Ga0105248_10000025 | |||
| 1214 | Ga0105248_10000058 | |||
| 1215 | Ga0105248_10002782 | |||
| 1216 | Ga0105248_10018012 | |||
| 1217 | Ga0105248_10113059 | |||
| 1218 | Ga0105237_10006530 | |||
| 1219 | Ga0105237_10028972 | |||
| 1220 | Ga0105237_10031502 | |||
| 1221 | Ga0105237_10031742 | |||
| 1222 | Ga0105238_10005487 | |||
| 1223 | Ga0105238_10140809 | |||
| 1224 | Ga0105238_10225670 | |||
| 1225 | Ga0105249_10000021 | |||
| 1226 | Ga0105249_10003602 | |||
| 1227 | Ga0105239_10015207 | |||
| 1228 | Ga0105239_10063693 | |||
| 1229 | Ga0157369_10001401 | |||
| 1230 | Ga0157369_10030568 | |||
| 1231 | Ga0157374_10009548 | |||
| 1232 | Ga0157374_10048375 | |||
| 1233 | Ga0157374_10101784 | |||
| 1234 | Ga0157374_10152563 | |||
| 1235 | Ga0157378_10006852 | |||
| 1236 | Ga0157378_10135374 | |||
| 1237 | Ga0163162_10011274 | |||
| 1238 | Ga0163162_10022847 | |||
| 1239 | Ga0163162_10304020 | |||
| 1240 | Ga0157372_10005875 | |||
| 1241 | Ga0157375_10251939 | |||
| 1242 | Ga0157375_10327761 | |||
| 1243 | Ga0163163_10043279 | |||
| 1244 | Ga0163163_10050313 | |||
| 1245 | Ga0163163_10094826 | |||
| 1246 | Ga0157380_10000311 | |||
| 1247 | Ga0157379_10027988 | |||
| 1248 | Ga0157379_10033670 | |||
| 1249 | Ga0157379_10121632 | |||
| 1250 | Ga0157376_10045505 | |||
| 1251 | Ga0157376_10174493 | |||
| 1252 | Ga0163161_10000438 | |||
| 1253 | Ga0163161_10157258 | |||
| 1254 | Ga0197907_11435767 | |||
| 1255 | Ga0206356_10927913 | |||
| 1256 | Ga0206356_11409457 | |||
| 1257 | Ga0206351_10693814 | |||
| 1258 | Ga0206350_10130933 | |||
| 1259 | Ga0206354_10133691 | |||
| 1260 | Ga0206353_10411335 | |||
| 1261 | Ga0213876_10001169 | |||
| 1262 | Ga0224712_10025437 | |||
| 1263 | Ga0209673_1013816 | |||
| 1264 | Ga0209051_1000328 | |||
| 1265 | Ga0209051_1000495 | |||
| 1266 | Ga0209051_1001554 | |||
| 1267 | Ga0209051_1002304 | |||
| 1268 | Ga0207697_10006310 | |||
| 1269 | Ga0207682_10004990 | |||
| 1270 | Ga0207692_10000508 | |||
| 1271 | Ga0207692_10020107 | |||
| 1272 | Ga0207642_10000444 | |||
| 1273 | Ga0207642_10024153 | |||
| 1274 | Ga0207710_10000033 | |||
| 1275 | Ga0207710_10000037 | |||
| 1276 | Ga0207710_10000058 | |||
| 1277 | Ga0207710_10007311 | |||
| 1278 | Ga0207688_10000419 | |||
| 1279 | Ga0207688_10003935 | |||
| 1280 | Ga0207688_10045168 | |||
| 1281 | Ga0207685_10070083 | |||
| 1282 | Ga0207685_10075705 | |||
| 1283 | Ga0207645_10019600 | |||
| 1284 | Ga0207705_10004883 | |||
| 1285 | Ga0207684_10001406 | |||
| 1286 | Ga0207684_10007904 | |||
| 1287 | Ga0207684_10025535 | |||
| 1288 | Ga0207684_10037155 | |||
| 1289 | Ga0207707_10000304 | |||
| 1290 | Ga0207671_10004366 | |||
| 1291 | Ga0207671_10022844 | |||
| 1292 | Ga0207693_10003367 | |||
| 1293 | Ga0207693_10008209 | |||
| 1294 | Ga0207660_10007493 | |||
| 1295 | Ga0207662_10013035 | |||
| 1296 | Ga0207662_10028528 | |||
| 1297 | Ga0207657_10025206 | |||
| 1298 | Ga0207652_10001158 | |||
| 1299 | Ga0207652_10253983 | |||
| 1300 | Ga0207646_10006312 | |||
| 1301 | Ga0207646_10036652 | |||
| 1302 | Ga0207681_10001320 | |||
| 1303 | Ga0207687_10001562 | |||
| 1304 | Ga0207687_10036673 | |||
| 1305 | Ga0207687_10052886 | |||
| 1306 | Ga0207664_10044487 | |||
| 1307 | Ga0207706_10022607 | |||
| 1308 | Ga0207686_10046725 | |||
| 1309 | Ga0207686_10073117 | |||
| 1310 | Ga0207686_10074607 | |||
| 1311 | Ga0207709_10004170 | |||
| 1312 | Ga0207709_10030574 | |||
| 1313 | Ga0207709_10118048 | |||
| 1314 | Ga0207709_10148331 | |||
| 1315 | Ga0207670_10047570 | |||
| 1316 | Ga0207669_10000871 | |||
| 1317 | Ga0207669_10020340 | |||
| 1318 | Ga0207704_10004808 | |||
| 1319 | Ga0207704_10029821 | |||
| 1320 | Ga0207711_10000079 | |||
| 1321 | Ga0207711_10000390 | |||
| 1322 | Ga0207711_10042329 | |||
| 1323 | Ga0207711_10087317 | |||
| 1324 | Ga0207689_10007162 | |||
| 1325 | Ga0207689_10015324 | |||
| 1326 | Ga0207689_10083209 | |||
| 1327 | Ga0207661_10108973 | |||
| 1328 | Ga0207667_10045100 | |||
| 1329 | Ga0207712_10000005 | |||
| 1330 | Ga0207712_10092886 | |||
| 1331 | Ga0207668_10000367 | |||
| 1332 | Ga0207668_10003927 | |||
| 1333 | Ga0207640_10001703 | |||
| 1334 | Ga0207658_10000299 | |||
| 1335 | Ga0207658_10026757 | |||
| 1336 | Ga0207658_10040144 | |||
| 1337 | Ga0207677_10005896 | |||
| 1338 | Ga0207677_10128190 | |||
| 1339 | Ga0207677_10137400 | |||
| 1340 | Ga0207703_10047718 | |||
| 1341 | Ga0207703_10051984 | |||
| 1342 | Ga0207639_10087557 | |||
| 1343 | Ga0207678_10103036 | |||
| 1344 | Ga0207708_10015701 | |||
| 1345 | Ga0207708_10016638 | |||
| 1346 | Ga0207708_10042213 | |||
| 1347 | Ga0207702_10112390 | |||
| 1348 | Ga0207641_10002135 | |||
| 1349 | Ga0207641_10003252 | |||
| 1350 | Ga0207641_10030028 | |||
| 1351 | Ga0207641_10086040 | |||
| 1352 | Ga0207641_10127178 | |||
| 1353 | Ga0207648_10005009 | |||
| 1354 | Ga0207648_10031811 | |||
| 1355 | Ga0207648_10157952 | |||
| 1356 | Ga0207676_10031434 | |||
| 1357 | Ga0207674_10106367 | |||
| 1358 | Ga0207675_100001197 | |||
| 1359 | Ga0207683_10001171 | |||
| 1360 | Ga0207683_10001880 | |||
| 1361 | Ga0207683_10106911 | |||
| 1362 | Ga0207683_10186696 | |||
| 1363 | Ga0207683_10202502 | |||
| 1364 | Ga0207683_10205485 | |||
| 1365 | Ga0207698_10120298 | |||
| 1366 | Ga0209966_1009875 | |||
| 1367 | Ga0209813_10008008 | |||
| 1368 | Ga0207428_10019950 | |||
| 1369 | Ga0207428_10023717 | |||
| 1370 | Ga0268266_10010168 | |||
| 1371 | Ga0268266_10037138 | |||
| 1372 | Ga0268266_10216605 | |||
| 1373 | Ga0268265_10000022 | |||
| 1374 | Ga0268265_10031049 | |||
| 1375 | Ga0268264_10000005 | |||
| 1376 | Ga0268264_10007501 | |||
| 1377 | Ga0268264_10038729 | |||
| 1378 | Ga0268264_10182670 | |||
| 1379 | Ga0265337_1001324 | |||
| 1380 | Ga0265337_1002094 | |||
| 1381 | Ga0265337_1010239 | |||
| 1382 | Ga0265319_1002032 | |||
| 1383 | Ga0265319_1008662 | |||
| 1384 | Ga0265334_10003597 | |||
| 1385 | Ga0265334_10008202 | |||
| 1386 | Ga0265318_10002937 | |||
| 1387 | Ga0265323_10000678 | |||
| 1388 | Ga0265323_10001439 | |||
| 1389 | Ga0265323_10003228 | |||
| 1390 | Ga0265323_10006818 | |||
| 1391 | Ga0265323_10008699 | |||
| 1392 | Ga0265323_10017331 | |||
| 1393 | Ga0265323_10020425 | |||
| 1394 | Ga0265322_10001818 | |||
| 1395 | Ga0265322_10007563 | |||
| 1396 | Ga0265336_10002184 | |||
| 1397 | Ga0265336_10005894 | |||
| 1398 | Ga0265336_10008603 | |||
| 1399 | Ga0265336_10012947 | |||
| 1400 | Ga0265336_10025005 | |||
| 1401 | Ga0307515_10000019 | |||
| 1402 | Ga0265338_10000202 | |||
| 1403 | Ga0265338_10000593 | |||
| 1404 | Ga0265338_10001712 | |||
| 1405 | Ga0265338_10002195 | |||
| 1406 | Ga0265338_10002795 | |||
| 1407 | Ga0265338_10004158 | |||
| 1408 | Ga0265338_10011960 | |||
| 1409 | Ga0265338_10012809 | |||
| 1410 | Ga0265338_10016258 | |||
| 1411 | Ga0265338_10019798 | |||
| 1412 | Ga0265338_10031405 | |||
| 1413 | Ga0265338_10032968 | |||
| 1414 | Ga0265338_10036411 | |||
| 1415 | Ga0265338_10038466 | |||
| 1416 | Ga0265338_10159286 | |||
| 1417 | Ga0265338_10162237 | |||
| 1418 | Ga0265324_10000672 | |||
| 1419 | Ga0265324_10004349 | |||
| 1420 | Ga0265324_10004476 | |||
| 1421 | Ga0265324_10008523 | |||
| 1422 | Ga0265324_10013480 | |||
| 1423 | Ga0307511_10048755 | |||
| 1424 | Ga0265330_10013290 | |||
| 1425 | Ga0265328_10008023 | |||
| 1426 | Ga0265320_10001321 | |||
| 1427 | Ga0265320_10009020 | |||
| 1428 | Ga0265320_10013227 | |||
| 1429 | Ga0265320_10020043 | |||
| 1430 | Ga0265320_10022735 | |||
| 1431 | Ga0265320_10070918 | |||
| 1432 | Ga0265325_10008116 | |||
| 1433 | Ga0265325_10011164 | |||
| 1434 | Ga0265325_10021374 | |||
| 1435 | Ga0265329_10001514 | |||
| 1436 | Ga0265329_10001626 | |||
| 1437 | Ga0265340_10000308 | |||
| 1438 | Ga0265340_10000975 | |||
| 1439 | Ga0265340_10006808 | |||
| 1440 | Ga0265327_10000019 | |||
| 1441 | Ga0265327_10000182 | |||
| 1442 | Ga0265327_10000690 | |||
| 1443 | Ga0265327_10002506 | |||
| 1444 | Ga0265327_10018346 | |||
| 1445 | Ga0265327_10020593 | |||
| 1446 | Ga0265327_10068298 | |||
| 1447 | Ga0265316_10000107 | |||
| 1448 | Ga0265316_10001496 | |||
| 1449 | Ga0265316_10002751 | |||
| 1450 | Ga0265316_10003188 | |||
| 1451 | Ga0265316_10005815 | |||
| 1452 | Ga0265316_10008210 | |||
| 1453 | Ga0265316_10008948 | |||
| 1454 | Ga0265316_10031987 | |||
| 1455 | Ga0265316_10047659 | |||
| 1456 | Ga0265316_10054760 | |||
| 1457 | Ga0265316_10058262 | |||
| 1458 | Ga0265316_10071644 | |||
| 1459 | Ga0265313_10009009 | |||
| 1460 | Ga0265313_10019814 | |||
| 1461 | Ga0307508_10000106 | |||
| 1462 | Ga0316575_10000001 | |||
| 1463 | Ga0316575_10000789 | |||
| 1464 | Ga0316579_10000430 | |||
| 1465 | Ga0316579_10037568 | |||
| 1466 | Ga0265314_10000037 | |||
| 1467 | Ga0265314_10001733 | |||
| 1468 | Ga0265314_10131237 | |||
| 1469 | Ga0265342_10028537 | |||
| 1470 | Ga0265342_10051523 | |||
| 1471 | Ga0316576_10001950 | |||
| 1472 | Ga0316576_10004230 | |||
| 1473 | Ga0316576_10012412 | |||
| 1474 | Ga0316576_10018732 | |||
| 1475 | Ga0316576_10019056 | |||
| 1476 | Ga0316576_10026619 | |||
| 1477 | Ga0316576_10072298 | |||
| 1478 | Ga0316576_10072350 | |||
| 1479 | Ga0316576_10076618 | |||
| 1480 | Ga0316576_10119225 | |||
| 1481 | Ga0316576_10195274 | |||
| 1482 | Ga0316578_10000121 | |||
| 1483 | Ga0316578_10006775 | |||
| 1484 | Ga0316578_10008229 | |||
| 1485 | Ga0316578_10009570 | |||
| 1486 | Ga0316578_10024130 | |||
| 1487 | Ga0316578_10118072 | |||
| 1488 | Ga0307405_10039074 | |||
| 1489 | Ga0307405_10056850 | |||
| 1490 | Ga0316577_10000394 | |||
| 1491 | Ga0316577_10000416 | |||
| 1492 | Ga0316577_10041012 | |||
| 1493 | Ga0316577_10113263 | |||
| 1494 | Ga0316577_10125455 | |||
| 1495 | Ga0307413_10020937 | |||
| 1496 | Ga0307410_10003317 | |||
| 1497 | Ga0307410_10007656 | |||
| 1498 | Ga0307410_10012288 | |||
| 1499 | Ga0307407_10049675 | |||
| 1500 | Ga0307412_10002784 | |||
| 1501 | Ga0307409_100004986 | |||
| 1502 | Ga0307409_100005582 | |||
| 1503 | Ga0307409_100010907 | |||
| 1504 | Ga0307409_100111080 | |||
| 1505 | Ga0307416_100010647 | |||
| 1506 | Ga0307416_100077099 | |||
| 1507 | Ga0307416_100208032 | |||
| 1508 | Ga0307414_10082462 | |||
| 1509 | Ga0307414_10095821 | |||
| 1510 | Ga0307411_10006306 | |||
| 1511 | Ga0307411_10117721 | |||
| 1512 | Ga0307415_100151194 | |||
| 1513 | Ga0307415_100255714 | |||
| 1514 | Ga0316583_10001507 | |||
| 1515 | Ga0316583_10004878 | |||
| 1516 | Ga0316583_10019282 | |||
| 1517 | Ga0316583_10023096 | |||
| 1518 | Ga0316585_10000073 | |||
| 1519 | Ga0316585_10002133 | |||
| 1520 | Ga0316585_10003695 | |||
| 1521 | Ga0316585_10017436 | |||
| 1522 | Ga0316580_10000051 | |||
| 1523 | Ga0316580_10025706 | |||
| 1524 | Ga0316593_10021582 | |||
| 1525 | Ga0316592_1003106 | |||
| 1526 | Ga0316592_1017061 | |||
| 1527 | Ga0316588_1006791 | |||
| 1528 | Ga0316596_1008035 | |||
| 1529 | Ga0316596_1017544 | |||
| 1530 | Ga0373934_0000733 | |||
| 1531 | Ga0373956_0000052 | |||
| 1532 | Ga0373942_0027915 | |||
| 1533 | Ga0316574_0000364 | |||
| 1534 | Ga0316574_0002040 | |||
| 1535 | Ga0316574_0002613 | |||
| 1536 | Ga0316574_0002894 | |||
| 1537 | Ga0316574_0004691 | |||
| 1538 | Ga0316574_0009554 | |||
| 1539 | Ga0316574_0012398 | |||
| 1540 | Ga0316574_0098399 | |||
| 1541 | Ga0373931_0013648 | |||
| 1542 | Ga0373927_0000005 | |||
| 1543 | Ga0373927_0000534 | |||
| 1544 | Ga0373927_0095577 | |||
| 1545 | Ga0373947_0068933 | |||
| 1546 | Ga0316582_0000061 | |||
| 1547 | Ga0316582_0002101 | |||
| 1548 | Ga0316582_0041377 | |||
| 1549 | Ga0316584_0000438 | |||
| 1550 | Ga0316584_0002041 | |||
| 1551 | Ga0316584_0004425 | |||
| 1552 | Ga0316584_0005513 | |||
| 1553 | Ga0316584_0006548 | |||
| 1554 | Ga0316584_0041492 | |||
| 1555 | Ga0316584_0083829 | |||
| 1556 | Ga0316584_0101902 | |||
| 1557 | Ga0373925_0004158 | |||
| 1558 | Ga0395899_0004006 | |||
| 1559 | Ga0395900_0037099 | |||
| 1560 | Ga0395900_0228334 | |||
| 1561 | Ga0395898_0161312 | |||
| 1562 | Ga0395905_0000508 | |||
| 1563 | Ga0316581_0002092 | |||
| 1564 | Ga0436364_0134803 | |||
| 1565 | Ga0436364_0479890 | |||
| 1566 | Ga0436364_1156075 | |||
| 1567 | Ga0436364_1361321 | |||
| 1568 | Ga0395901_0261684 | |||
| 1569 | Ga0400484_20588 | |||
| 1570 | Ga0400490_21698 | |||
| 1571 | Ga0400488_10895 | |||
| 1572 | Ga0400483_078057 | |||
| 1573 | Ga0400483_253101 | |||
| 1574 | Ga0400489_36173 | |||
| 1575 | Ga0436365_0133306 | |||
| 1576 | Ga0436365_0393632 | |||
| 1577 | Ga0436365_0400866 | |||
| 1578 | Ga0436365_1568843 | |||
| 1579 | Ga0436360_0887245 | |||
| 1580 | Ga0436363_0972237 | |||
| 1581 | Ga0436362_0303488 | |||
| 1582 | Ga0439438_009557 | |||
| 1583 | Ga0439461_0001049 | |||
| 1584 | Ga0439461_0002801 | |||
| 1585 | Ga0439466_0002725 | |||
| 1586 | Ga0439466_0004980 | |||
| 1587 | Ga0439466_0007166 | |||
| 1588 | Ga0439465_0000360 | |||
| 1589 | Ga0439465_0027256 | |||
| 1590 | Ga0451791_1743147 | |||
| 1591 | Ga0451793_0347653 | |||
| 1592 | Ga0451797_0475613 | |||
| 1593 | Ga0451795_1334275 | |||
| 1594 | Ga0451843_0670195 | |||
| 1595 | Ga0451855_0221036 | |||
| 1596 | Ga0451855_0653154 | |||
| 1597 | Ga0451855_0972306 | |||
| 1598 | Ga0439431_0008065 | |||
| 1599 | Ga0439445_0001784 | |||
| 1600 | Ga0439448_0003342 | |||
| 1601 | Ga0439449_0014739 | |||
| 1602 | Ga0439450_016217 | |||
| 1603 | Ga0450907_000166 | |||
| 1604 | Ga0439434_0003113 | |||
| 1605 | Ga0439434_0006469 | |||
| 1606 | Ga0439434_0037420 | |||
| 1607 | Ga0451577_0000033 | |||
| 1608 | Ga0451577_0000678 | |||
| 1609 | Ga0451577_0001461 | |||
| 1610 | Ga0451577_0012257 | |||
| 1611 | Ga0451577_0053272 | |||
| 1612 | Ga0451577_0056221 | |||
| 1613 | Ga0451577_0068080 | |||
| 1614 | Ga0451577_0094592 | |||
| 1615 | Ga0451577_0113821 | |||
| 1616 | Ga0451577_0245705 | |||
| 1617 | Ga0466972_0001036 | |||
| 1618 | Ga0466972_0003356 | |||
| 1619 | Ga0466972_0016856 | |||
| 1620 | Ga0466972_0030839 | |||
| 1621 | Ga0466972_0054111 | |||
| 1622 | Ga0453683_0000014 | |||
| 1623 | Ga0453683_0103589 | |||
| 1624 | Ga0453683_0174037 | |||
| 1625 | Ga0466965_0000992 | |||
| 1626 | Ga0466965_0014127 | |||
| 1627 | Ga0466965_0024392 | |||
| 1628 | Ga0466965_0038153 | |||
| 1629 | Ga0466966_0001673 | |||
| 1630 | Ga0466966_0013763 | |||
| 1631 | Ga0466966_0041805 | |||
| 1632 | Ga0466961_0002498 | |||
| 1633 | Ga0466961_0003492 | |||
| 1634 | Ga0466961_0054203 | |||
| 1635 | Ga0466963_0007601 | |||
| 1636 | Ga0466963_0013858 | |||
| 1637 | Ga0466963_0017445 | |||
| 1638 | Ga0466963_0019045 | |||
| 1639 | Ga0466963_0079577 | |||
| 1640 | Ga0453684_0000001 | |||
| 1641 | Ga0453684_0000109 | |||
| 1642 | Ga0453684_0000192 | |||
| 1643 | Ga0453684_0000221 | |||
| 1644 | Ga0453684_0000242 | |||
| 1645 | Ga0453684_0002738 | |||
| 1646 | Ga0453684_0005564 | |||
| 1647 | Ga0453684_0023701 | |||
| 1648 | Ga0453684_0031402 | |||
| 1649 | Ga0453684_0046343 | |||
| 1650 | Ga0453684_0048265 | |||
| 1651 | Ga0453684_0049072 | |||
| 1652 | Ga0453684_0083330 | |||
| 1653 | Ga0453684_0097493 | |||
| 1654 | Ga0453684_0097761 | |||
| 1655 | Ga0466971_0006008 | |||
| 1656 | Ga0466971_0078608 | |||
| 1657 | Ga0466968_0031547 | |||
| 1658 | Ga0466970_0004237 | |||
| 1659 | Ga0466970_0133977 | |||
| 1660 | Ga0466957_0007005 | |||
| 1661 | Ga0466957_0044123 | |||
| 1662 | Ga0466957_0140765 | |||
| 1663 | Ga0466960_0000113 | |||
| 1664 | Ga0466960_0007813 | |||
| 1665 | Ga0466960_0016089 | |||
| 1666 | Ga0466960_0017361 | |||
| 1667 | Ga0466959_0003322 | |||
| 1668 | Ga0466959_0004649 | |||
| 1669 | Ga0466959_0045606 | |||
| 1670 | Ga0466959_0077378 | |||
| 1671 | Ga0451576_0001145 | |||
| 1672 | Ga0451576_0018340 | |||
| 1673 | Ga0451576_0036371 | |||
| 1674 | Ga0451576_0105848 | |||
| 1675 | Ga0451576_0197712 | |||
| 1676 | Ga0466958_0002748 | |||
| 1677 | Ga0466967_0007991 | |||
| 1678 | Ga0466967_0019764 | |||
| 1679 | Ga0466967_0020561 | |||
| 1680 | Ga0466967_0022311 | |||
| 1681 | Ga0466967_0027709 | |||
| 1682 | Ga0466967_0056280 | |||
| 1683 | Ga0466967_0098295 | |||
| 1684 | Ga0466967_0339618 | |||
| 1685 | Ga0495592_0114713 | |||
| 1686 | Ga0495603_0031908 | |||
| 1687 | Ga0495629_0024641 | |||
| 1688 | Ga0495638_0008490 | |||
| 1689 | Ga0495641_0039333 | |||
| 1690 | Ga0495664_0067289 | |||
| 1691 | Ga0495606_0019487 | |||
| 1692 | Ga0495630_0048775 | |||
| 1693 | Ga0495652_0002631 | |||
| 1694 | Ga0495665_0011992 | |||
| 1695 | Ga0495640_0073042 | |||
| 1696 | Ga0495586_0002297 | |||
| 1697 | Ga0495645_0027997 | |||
| 1698 | Ga0495668_0000128 | |||
| 1699 | Ga0495668_0008106 | |||
| 1700 | Ga0495668_0022852 | |||
| 1701 | Ga0495635_0050572 | |||
| 1702 | Ga0495635_0082358 | |||
| 1703 | Ga0495635_0204098 | |||
| 1704 | Ga0495647_0050664 | |||
| 1705 | Ga0495658_0021852 | |||
| 1706 | Ga0495600_0142981 | |||
| 1707 | Ga0495581_0082839 | |||
| 1708 | Ga0495672_0005443 | |||
| 1709 | Ga0495676_0065244 | |||
| 1710 | Ga0495673_0003890 | |||
| 1711 | Ga0495686_0021000 | |||
| 1712 | Ga0495593_0014585 | |||
| 1713 | Ga0496100_0002549 | |||
| 1714 | Ga0496100_0005877 | |||
| 1715 | Ga0496100_0009791 | |||
| 1716 | Ga0496100_0028477 | |||
| 1717 | Ga0496100_0040299 | |||
| 1718 | Ga0496100_0101540 | |||
| 1719 | Ga0496101_0000257 | |||
| 1720 | Ga0496101_0003088 | |||
| 1721 | Ga0496101_0074169 | |||
| 1722 | Ga0496102_0000449 | |||
| 1723 | Ga0496102_0001144 | |||
| 1724 | Ga0496102_0012550 | |||
| 1725 | Ga0496102_0023733 | |||
| 1726 | Ga0496102_0048684 | |||
| 1727 | Ga0496102_0097768 | |||
| 1728 | Ga0496102_0097913 | |||
| 1729 | Ga0496102_0112039 | |||
| 1730 | Ga0496103_0000515 | |||
| 1731 | Ga0496103_0002601 | |||
| 1732 | Ga0496103_0004413 | |||
| 1733 | Ga0496103_0005803 | |||
| 1734 | Ga0496103_0064025 | |||
| 1735 | Ga0496103_0090101 | |||
| 1736 | Ga0496103_0172465 | |||
| 1737 | Ga0496104_0000393 | |||
| 1738 | Ga0496104_0025610 | |||
| 1739 | Ga0496104_0041185 | |||
| 1740 | Ga0496104_0157869 | |||
| 1741 | Ga0496105_0004210 | |||
| 1742 | Ga0496105_0005980 | |||
| 1743 | Ga0496105_0007202 | |||
| 1744 | Ga0496105_0008164 | |||
| 1745 | Ga0496105_0049593 | |||
| 1746 | Ga0496105_0079234 | |||
| 1747 | Ga0496106_0001146 | |||
| 1748 | Ga0496106_0001338 | |||
| 1749 | Ga0496106_0007880 | |||
| 1750 | Ga0496106_0167881 | |||
| 1751 | Ga0496107_0009085 | |||
| 1752 | Ga0496107_0009400 | |||
| 1753 | Ga0496107_0050830 | |||
| 1754 | Ga0496107_0084787 | |||
| 1755 | Ga0496108_0008469 | |||
| 1756 | Ga0496108_0072025 | |||
| 1757 | Ga0496109_0000077 | |||
| 1758 | Ga0496109_0001897 | |||
| 1759 | Ga0496109_0007105 | |||
| 1760 | Ga0496109_0009146 | |||
| 1761 | Ga0496109_0067612 | |||
| 1762 | Ga0496110_0001985 | |||
| 1763 | Ga0496110_0022702 | |||
| 1764 | Ga0496112_0026657 | |||
| 1765 | Ga0496112_0032298 | |||
| 1766 | Ga0496112_0255298 | |||
| 1767 | Ga0496113_0029412 | |||
| 1768 | Ga0496113_0110460 | |||
| 1769 | Ga0496114_0000505 | |||
| 1770 | Ga0496114_0001642 | |||
| 1771 | Ga0496114_0002421 | |||
| 1772 | Ga0496114_0004211 | |||
| 1773 | Ga0496114_0010931 | |||
| 1774 | Ga0496114_0012312 | |||
| 1775 | Ga0496114_0019626 | |||
| 1776 | Ga0496114_0025042 | |||
| 1777 | Ga0496114_0077898 | |||
| 1778 | Ga0496114_0171499 | |||
| 1779 | Ga0496115_0000841 | |||
| 1780 | Ga0496115_0011790 | |||
| 1781 | Ga0496115_0087804 | |||
| 1782 | Ga0496116_0000270 | |||
| 1783 | Ga0496116_0004509 | |||
| 1784 | Ga0496117_0000417 | |||
| 1785 | Ga0496117_0007971 | |||
| 1786 | Ga0496117_0105474 | |||
| 1787 | Ga0496118_0000350 | |||
| 1788 | Ga0496118_0002093 | |||
| 1789 | Ga0496118_0003067 | |||
| 1790 | Ga0496118_0072894 | |||
| 1791 | Ga0496119_0000287 | |||
| 1792 | Ga0496119_0000986 | |||
| 1793 | Ga0496119_0001473 | |||
| 1794 | Ga0496119_0006715 | |||
| 1795 | Ga0496119_0016401 | |||
| 1796 | Ga0496120_0000666 | |||
| 1797 | Ga0496120_0002191 | |||
| 1798 | Ga0496121_0000002 | |||
| 1799 | Ga0496122_0000051 | |||
| 1800 | Ga0496122_0000999 | |||
| 1801 | Ga0496122_0022058 | |||
| 1802 | Ga0496123_0004459 | |||
| 1803 | Ga0496123_0008921 | |||
| 1804 | Ga0496123_0018252 | |||
| 1805 | Ga0496124_0000002 | |||
| 1806 | Ga0496124_0026671 | |||
| 1807 | Ga0496125_0000002 | |||
| 1808 | Ga0496125_0008825 | |||
| 1809 | Ga0496125_0074147 | |||
| 1810 | Ga0496125_0111564 | |||
| 1811 | Ga0496126_0000011 | |||
| 1812 | Ga0496126_0001185 | |||
| 1813 | Ga0496126_0006073 | |||
| 1814 | Ga0496126_0009101 | |||
| 1815 | Ga0501031_0062214 | |||
| 1816 | Ga0501032_0000220 | |||
| 1817 | Ga0501032_0001996 | |||
| 1818 | Ga0501032_0036656 | |||
| 1819 | Ga0501032_0041401 | |||
| 1820 | Ga0501033_0004341 | |||
| 1821 | Ga0501034_0000445 | |||
| 1822 | Ga0501034_0001377 | |||
| 1823 | Ga0501034_0005081 | |||
| 1824 | Ga0501034_0023012 | |||
| 1825 | Ga0501034_0040207 | |||
| 1826 | Ga0501034_0061252 | |||
| 1827 | Ga0501034_0073318 | |||
| 1828 | Ga0501034_0077654 | |||
| 1829 | Ga0501034_0096570 | |||
| 1830 | Ga0501034_0134219 | |||
| 1831 | Ga0501036_0008832 | |||
| 1832 | Ga0501037_0001541 | |||
| 1833 | Ga0501037_0002453 | |||
| 1834 | Ga0501037_0015180 | |||
| 1835 | Ga0501038_0008674 | |||
| 1836 | Ga0501038_0016120 | |||
| 1837 | Ga0501038_0020165 | |||
| 1838 | Ga0501038_0086295 | |||
| 1839 | Ga0501038_0302616 | |||
| 1840 | Ga0501039_0001154 | |||
| 1841 | Ga0501039_0189807 | |||
| 1842 | Ga0501040_0168984 | |||
| 1843 | Ga0501041_0120087 | |||
| 1844 | Ga0501041_0123359 | |||
| 1845 | Ga0501041_0232753 | |||
| 1846 | Ga0501042_0005190 | |||
| 1847 | Ga0501043_0002601 | |||
| 1848 | Ga0501043_0043361 | |||
| 1849 | Ga0501043_0055752 | |||
| 1850 | Ga0501043_0064409 | |||
| 1851 | Ga0501043_0143612 | |||
| 1852 | Ga0501046_0011076 | |||
| 1853 | Ga0501046_0016736 | |||
| 1854 | Ga0501046_0044416 | |||
| 1855 | Ga0501046_0231279 | |||
| 1856 | Ga0501047_0013811 | |||
| 1857 | Ga0501047_0018744 | |||
| 1858 | Ga0501047_0044590 | |||
| 1859 | Ga0501047_0073879 | |||
| 1860 | Ga0501047_0076463 | |||
| 1861 | Ga0501047_0078593 | |||
| 1862 | Ga0501048_0005738 | |||
| 1863 | Ga0501048_0085604 | |||
| 1864 | Ga0501048_0110601 | |||
| 1865 | Ga0501069_0056106 | |||
| 1866 | Ga0501070_0000598 | |||
| 1867 | Ga0501070_0020478 | |||
| 1868 | Ga0501070_0055617 | |||
| 1869 | Ga0501070_0125704 | |||
| 1870 | Ga0501071_0065178 | |||
| 1871 | Ga0501072_0008751 | |||
| 1872 | Ga0501072_0057602 | |||
| 1873 | Ga0501074_0056498 | |||
| 1874 | Ga0501243_000303 | |||
| 1875 | Ga0501079_0054308 | |||
| 1876 | Ga0501079_0155125 | |||
| 1877 | Ga0501080_0165019 | |||
| 1878 | Ga0501035_0001245 | |||
| 1879 | Ga0501035_0003175 | |||
| 1880 | Ga0501035_0007676 | |||
| 1881 | Ga0501035_0025913 | |||
| 1882 | Ga0501035_0052011 | |||
| 1883 | Ga0501035_0079202 | |||
| 1884 | Ga0501044_0001562 | |||
| 1885 | Ga0501044_0002930 | |||
| 1886 | Ga0501044_0003864 | |||
| 1887 | Ga0501044_0005126 | |||
| 1888 | Ga0501044_0005857 | |||
| 1889 | Ga0501044_0007350 | |||
| 1890 | Ga0501044_0028145 | |||
| 1891 | nmdc:mga03683_1170_c1 | |||
| 1892 | nmdc:mga03683_73819_c1 | |||
| 1893 | nmdc:mga03n38_1283_c1 | |||
| 1894 | nmdc:mga03n38_33103_c1 | |||
| 1895 | nmdc:mga00v17_11210_c1 | |||
| 1896 | nmdc:mga00v17_121415_c1 | |||
| 1897 | nmdc:mga00v17_1409_c1 | |||
| 1898 | nmdc:mga00v17_18414_c1 | |||
| 1899 | nmdc:mga00v17_23933_c1 | |||
| 1900 | nmdc:mga00v17_2600_c1 | |||
| 1901 | nmdc:mga00v17_2741_c1 | |||
| 1902 | nmdc:mga00v17_4248_c1 | |||
| 1903 | nmdc:mga00v17_6295_c1 | |||
| 1904 | nmdc:mga0yw44_14219_c1 | |||
| 1905 | nmdc:mga0yw44_23304_c1 | |||
| 1906 | nmdc:mga0yw44_4278_c1 | |||
| 1907 | nmdc:mga06z11_35071_c1 | |||
| 1908 | nmdc:mga04h51_16199_c1 | |||
| 1909 | nmdc:mga04h51_9089_c1 | |||
| 1910 | nmdc:mga07m45_16107_c1 | |||
| 1911 | nmdc:mga07m45_39538_c2 | |||
| 1912 | nmdc:mga07m45_7367_c1 | |||
| 1913 | nmdc:mga07m45_74716_c1 | |||
| 1914 | nmdc:mga05p37_215378_c1 | |||
| 1915 | nmdc:mga05p37_2806_c1 | |||
| 1916 | nmdc:mga05p37_55499_c1 | |||
| 1917 | nmdc:mga0qj67_2769_c1 | |||
| 1918 | nmdc:mga06r32_16909_c1 | |||
| 1919 | nmdc:mga06r32_20521_c1 | |||
| 1920 | nmdc:mga06r32_28548_c1 | |||
| 1921 | nmdc:mga06r32_60262_c1 | |||
| 1922 | nmdc:mga08y16_16944_c1 | |||
| 1923 | nmdc:mga08y16_21860_c1 | |||
| 1924 | nmdc:mga0n895_298925_c1 | |||
| 1925 | nmdc:mga0sz30_11890_c1 | |||
| 1926 | nmdc:mga0sz30_12763_c1 | |||
| 1927 | nmdc:mga0sz30_16847_c1 | |||
| 1928 | nmdc:mga0sz30_866_c1 | |||
| 1929 | Ga0500610_0048020 | |||
| 1930 | Ga0495619_0071254 | |||
| 1931 | Ga0500643_003393 | |||
| 1932 | Ga0500641_0029591 | |||
| 1933 | Ga0500562_024787 | |||
| 1934 | Ga0500652_000732 | |||
| 1935 | Ga0500568_0000053 | |||
| 1936 | Ga0500616_0001306 | |||
| 1937 | Ga0500616_0011313 | |||
| 1938 | Ga0500616_0044570 | |||
| 1939 | Ga0500616_0075697 | |||
| 1940 | Ga0500627_0010229 | |||
| 1941 | Ga0500645_000096 | |||
| 1942 | Ga0500645_003598 | |||
| 1943 | Ga0501084_0000063 | |||
| 1944 | Ga0501084_0041178 | |||
| 1945 | Ga0501084_0258334 | |||
| 1946 | Ga0501082_0048677 | |||
| 1947 | Ga0501082_0092554 | |||
| 1948 | Ga0466962_0000285 | |||
| 1949 | Ga0466962_0012520 | |||
| 1950 | 2546948877 | |||
| 1951 | 2506868136 | |||
| 1952 | 2517759158 | |||
| 1953 | 2523382544 | |||
| 1954 | 2528204355 | |||
| 1955 | 2528213981 | |||
| 1956 | 2548695500 | |||
| 1957 | 2552106016 | |||
| 1958 | 2566992057 | |||
| 1959 | 2566995162 | |||
| 1960 | 2579749714 | |||
| 1961 | 2579853456 | |||
| 1962 | 2619857976 | |||
| 1963 | 2620349112 | |||
| 1964 | 2623498053 | |||
| 1965 | 2626637144 | |||
| 1966 | 2644034166 | |||
| 1967 | 2644489900 | |||
| 1968 | 2644504744 | |||
| 1969 | 2644515214 | |||
| 1970 | 2644523790 | |||
| 1971 | 2644635510 | |||
| 1972 | 2644667893 | |||
| 1973 | 2671836105 | |||
| 1974 | 2686536806 | |||
| 1975 | 2686544445 | |||
| 1976 | 2687236625 | |||
| 1977 | 2689991341 | |||
| 1978 | 2710605847 | |||
| 1979 | 2729906859 | |||
| 1980 | 2731905650 | |||
| 1981 | 2738664556 | |||
| 1982 | 2738707526 | |||
| 1983 | 2738887333 | |||
| 1984 | 2738889444 | |||
| 1985 | 2739143691 | |||
| 1986 | 2739202918 | |||
| 1987 | 2739236446 | |||
| 1988 | 2739334015 | |||
| 1989 | 2739367344 | |||
| 1990 | 2744956313 | |||
| 1991 | 2745169017 | |||
| 1992 | 2753038016 | |||
| 1993 | 2753325884 | |||
| 1994 | 2774854261 | |||
| 1995 | 2774867966 | |||
| 1996 | 2774902560 | |||
| 1997 | 2788433336 | |||
| 1998 | 2808894850 | |||
| 1999 | 2817618377 | |||
| 2000 | 2837183184 | |||
| 2001 | 2842136954 | |||
| 2002 | 2842890165 | |||
| 2003 | 2862507686 | |||
| 2004 | 2889305927 | |||
| 2005 | 2895890386 | |||
| 2006 | 2902793271 | |||
| 2007 | 2902802861 | |||
| 2008 | 2902813457 | |||
| 2009 | 2902841525 | |||
| 2010 | 2904537314 | |||
| 2011 | 2904538540 | |||
| 2012 | 2904766041 | |||
| 2013 | 2904773468 | |||
| 2014 | 2908812194 | |||
| 2015 | 2919421534 | |||
| 2016 | 2919432708 | |||
| 2017 | 2919538796 | |||
| 2018 | 2919714399 | |||
| 2019 | 2922559071 | |||
| 2020 | 2922559272 | |||
| 2021 | 2928142860 | |||
| 2022 | 2929214008 | |||
| 2023 | 2939587810 | |||
| 2024 | 2939744069 | |||
| 2025 | 2945924372 | |||
| 2026 | 2956941094 | |||
| 2027 | 2974318086 | |||
| 2028 | 2984526303 | |||
| 2029 | 3001120783 | |||
| 2030 | 3006861234 | |||
| 2031 | 637880151 | |||
| 2032 | 8002786083 | |||
| 2033 | 8007378855 | |||
| 2034 | 8022952780 | |||
| 2035 | 8054800025 | |||
| 2036 | 8054920686 | |||
| 2037 | 8054925882 | |||
| 2038 | 8055159036 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4kam-assembly2.cif.gz_B | x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m | 0.9896 | 10 | 437 |
| 8sf5-assembly1.cif.gz_A-2 | promiscuous amino acid gamma synthase from caldicellulosiruptor hydrothermalis in open conformation | 0.9896 | 14 | 431 |
| 8sf5-assembly1.cif.gz_B-2 | promiscuous amino acid gamma synthase from caldicellulosiruptor hydrothermalis in open conformation | 0.9881 | 14 | 432 |
| 4kam-assembly3.cif.gz_D | x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m | 0.9874 | 13 | 431 |
| 4kam-assembly2.cif.gz_B | x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m | 0.9871 | 10 | 437 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kamA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9971 | 74 | 299 | 3.40.640.10 |
| 4kamA01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9927 | 74 | 299 | 3.40.640.10 |
| af_Q59US5_3_288_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.986 | 14 | 295 | 3.40.640.10 |
| 4kamB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9815 | 301 | 437 | 3.90.1150.10 |
| 2nmpB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9787 | 300 | 434 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J7UM90-F1-model_v4 | Unannotated protein | 0.9984 | 303 | 434 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-X8FDD2-F1-model_v4 | deleted | 0.9973 | 154 | 355 |
|
| AF-A0A6I2ZN71-F1-model_v4 | deleted | 0.9965 | 11 | 198 |
|
| AF-A0A382DB25-F1-model_v4 | Aminotransferase class V domain-containing protein | 0.9949 | 14 | 237 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |
| AF-A0A3M1X8D9-F1-model_v4 | Bifunctional O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (EC 2.5.1.49) | 0.9943 | 357 | 432 |
GO:0003961
GO:0004124 GO:0005737 GO:0006535 GO:0019346 GO:0030170 GO:0071269 |