F488370
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1020 | 447 | 1015 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300035113|Ga0373936_0020827|Ga0373936_0020827_947_2032 |
| Length | 361 |
| Sequence | MGPYDNACRRAGLLSQNCDLPVITERRTYFPRFGRIRAMNVIRRRGWEISDRLAAPEHLVFSRRGFLAGGASALALAPHAASAQRISDVSKIPDPSADLYPAKRNEKYALDRAITDEKINGNYNNFYEFGTSKTVTAAAQALPIRPWTVKIDGMVEKPMEVGIDDLVRKLTLEERTYRHRCVEAWGMAIAWTGFPFAKLVDFARPLGSAKYVRMETFMDPKVAPGQRQPWYPWPYVEGVTMAEATNELAFLVTGAYGHPLARQHGAPLRLALPWKYGFKSIKSIVHFSFTDQRPRGMWEALQPAEYGFWANVNPQVPHPRWSQASEEIIGTGERRPTLLFNGYGDYVAGLYNGMDNERLWA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 3 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 4 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 5 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 6 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 7 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 8 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 10 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 11 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 12 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 13 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 14 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 15 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 18 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 19 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 20 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 21 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 22 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 23 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 25 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 70 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 98 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 99 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 100 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 101 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 102 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 112 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 113 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 114 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 115 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 122 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 129 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 143 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 146 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 147 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 164 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 246 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 247 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 248 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 249 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 250 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 251 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 253 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 254 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 256 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 257 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 258 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 259 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 260 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 261 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 262 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 264 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 265 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 266 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 267 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 268 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 270 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 271 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 272 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 275 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 276 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 278 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 279 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 280 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 282 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 283 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 284 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 285 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 286 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 287 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 288 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 290 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 291 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 292 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 293 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 294 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 295 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 296 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 297 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 298 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 299 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 300 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 302 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 303 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 304 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 305 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 306 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 307 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 308 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 309 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 310 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 311 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 312 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 313 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 314 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 315 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 316 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 317 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 318 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 376 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 378 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 379 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 380 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 389 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 390 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 391 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 392 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 422 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 423 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 424 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 425 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 426 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 427 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 439 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 440 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 442 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 443 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 444 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 445 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.31 |
| Metatranscriptomes | 0.2 |
| Isolates | 0.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.06 |
| Nodule | 0 |
| Rhizoplane | 6.27 |
| Rhizosphere | 89.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214586617 | 2209111006 | Bacteria | 1167 |
| 2 | 2214745204 | 2209111006 | Bacteria | 15697 |
| 3 | ARSoilYngRDRAFT_c00018 | 3300000042 | Bacteria | 24203 |
| 4 | ARcpr5yngRDRAFT_c000071 | 3300000043 | Bacteria | 16851 |
| 5 | ARSoilOldRDRAFT_c000005 | 3300000044 | Bacteria | 61735 |
| 6 | ARCol0oldRDRAFT_c00312 | 3300000045 | Bacteria | 4724 |
| 7 | ARCol0yngRDRAFT_1000166 | 3300000652 | Bacteria | 11216 |
| 8 | JGI24032J14994_100069 | 3300001430 | Bacteria | 4322 |
| 9 | JGI24752J21851_1001285 | 3300001976 | Bacteria | 3398 |
| 10 | JGI24746J21847_1002142 | 3300001977 | Bacteria | 3159 |
| 11 | JGI24747J21853_1000415 | 3300001978 | Bacteria | 2586 |
| 12 | JGI24737J22298_10000309 | 3300001990 | Bacteria | 16281 |
| 13 | JGI24737J22298_10002334 | 3300001990 | Bacteria | 6765 |
| 14 | JGI24743J22301_10001195 | 3300001991 | Bacteria | 3505 |
| 15 | JGI24750J21931_1000368 | 3300002070 | Bacteria | 7645 |
| 16 | JGI24738J21930_10000219 | 3300002075 | Bacteria | 15450 |
| 17 | JGI24749J21850_1000528 | 3300002076 | Bacteria | 5601 |
| 18 | JGI24744J21845_10010135 | 3300002077 | Bacteria | 1931 |
| 19 | JGI24035J26624_1000067 | 3300002126 | Bacteria | 8325 |
| 20 | JGI25406J46586_10017341 | 3300003203 | Bacteria | 2980 |
| 21 | JGI25406J46586_10032468 | 3300003203 | Bacteria | 1940 |
| 22 | JGI25405J52794_10008119 | 3300003911 | Bacteria | 1953 |
| 23 | Ga0065716_1001582 | 3300005277 | Bacteria | 5864 |
| 24 | Ga0065704_10077656 | 3300005289 | Bacteria | 4650 |
| 25 | Ga0065712_10005999 | 3300005290 | Bacteria | 9360 |
| 26 | Ga0065712_10071612 | 3300005290 | Bacteria | 5159 |
| 27 | Ga0065715_10001902 | 3300005293 | Bacteria | 5416 |
| 28 | Ga0065715_10089334 | 3300005293 | Bacteria | 11121 |
| 29 | Ga0065707_10107519 | 3300005295 | Bacteria | 2550 |
| 30 | Ga0065707_10156336 | 3300005295 | Bacteria | 1605 |
| 31 | Ga0070658_10016082 | 3300005327 | Bacteria | 5984 |
| 32 | Ga0070658_10186969 | 3300005327 | Bacteria | 1745 |
| 33 | Ga0070676_10002258 | 3300005328 | Bacteria | 9827 |
| 34 | Ga0070683_100006961 | 3300005329 | Bacteria | 9511 |
| 35 | Ga0070683_100026317 | 3300005329 | Bacteria | 5236 |
| 36 | Ga0070683_100075385 | 3300005329 | Bacteria | 3152 |
| 37 | Ga0070683_100077513 | 3300005329 | Bacteria | 3108 |
| 38 | Ga0070690_100110159 | 3300005330 | Bacteria | 1836 |
| 39 | Ga0070690_100163494 | 3300005330 | Bacteria | 1527 |
| 40 | Ga0070670_100002178 | 3300005331 | Bacteria | 16098 |
| 41 | Ga0070677_10001477 | 3300005333 | Bacteria | 7435 |
| 42 | Ga0068869_100001327 | 3300005334 | Bacteria | 14667 |
| 43 | Ga0070666_10006983 | 3300005335 | Bacteria | 6961 |
| 44 | Ga0070666_10042637 | 3300005335 | Bacteria | 3037 |
| 45 | Ga0070666_10090928 | 3300005335 | Bacteria | 2096 |
| 46 | Ga0070666_10232003 | 3300005335 | Bacteria | 1304 |
| 47 | Ga0070680_100010314 | 3300005336 | Bacteria | 7203 |
| 48 | Ga0070680_100028504 | 3300005336 | Bacteria | 4479 |
| 49 | Ga0070680_100086684 | 3300005336 | Bacteria | 2588 |
| 50 | Ga0070680_100128125 | 3300005336 | Bacteria | 2122 |
| 51 | Ga0070682_100004337 | 3300005337 | Bacteria | 7877 |
| 52 | Ga0070682_100076349 | 3300005337 | Bacteria | 2157 |
| 53 | Ga0068868_100003112 | 3300005338 | Bacteria | 11551 |
| 54 | Ga0068868_100076695 | 3300005338 | Bacteria | 2673 |
| 55 | Ga0070660_100005069 | 3300005339 | Bacteria | 9102 |
| 56 | Ga0070660_100028339 | 3300005339 | Bacteria | 4189 |
| 57 | Ga0070660_100030377 | 3300005339 | Bacteria | 4054 |
| 58 | Ga0070660_100207633 | 3300005339 | Bacteria | 1590 |
| 59 | Ga0070689_100002417 | 3300005340 | Bacteria | 12201 |
| 60 | Ga0070689_100046491 | 3300005340 | Bacteria | 3345 |
| 61 | Ga0070689_100106691 | 3300005340 | Bacteria | 2223 |
| 62 | Ga0070689_100119533 | 3300005340 | Bacteria | 2103 |
| 63 | Ga0070689_100145194 | 3300005340 | Bacteria | 1911 |
| 64 | Ga0070691_10057825 | 3300005341 | Bacteria | 1861 |
| 65 | Ga0070687_100000334 | 3300005343 | Bacteria | 16027 |
| 66 | Ga0070687_100029805 | 3300005343 | Bacteria | 2661 |
| 67 | Ga0070661_100004209 | 3300005344 | Bacteria | 9932 |
| 68 | Ga0070661_100034218 | 3300005344 | Bacteria | 3684 |
| 69 | Ga0070692_10000022 | 3300005345 | Bacteria | 31371 |
| 70 | Ga0070668_100000947 | 3300005347 | Bacteria | 20237 |
| 71 | Ga0070668_100158767 | 3300005347 | Bacteria | 1833 |
| 72 | Ga0070669_100002667 | 3300005353 | Bacteria | 12852 |
| 73 | Ga0070669_100102382 | 3300005353 | Bacteria | 2162 |
| 74 | Ga0070675_100003214 | 3300005354 | Bacteria | 12377 |
| 75 | Ga0070675_100220489 | 3300005354 | Bacteria | 1652 |
| 76 | Ga0070671_100003818 | 3300005355 | Bacteria | 11829 |
| 77 | Ga0070671_100135757 | 3300005355 | Bacteria | 2074 |
| 78 | Ga0070671_100205454 | 3300005355 | Bacteria | 1670 |
| 79 | Ga0070674_100003265 | 3300005356 | Bacteria | 9061 |
| 80 | Ga0070673_100005122 | 3300005364 | Bacteria | 8358 |
| 81 | Ga0070673_100048608 | 3300005364 | Bacteria | 3308 |
| 82 | Ga0070688_100000196 | 3300005365 | Bacteria | 32063 |
| 83 | Ga0070688_100007034 | 3300005365 | Bacteria | 6050 |
| 84 | Ga0070688_100077346 | 3300005365 | Bacteria | 2144 |
| 85 | Ga0070659_100005334 | 3300005366 | Bacteria | 9223 |
| 86 | Ga0070659_100011916 | 3300005366 | Bacteria | 6437 |
| 87 | Ga0070667_100001157 | 3300005367 | Bacteria | 23956 |
| 88 | Ga0070667_100023226 | 3300005367 | Bacteria | 5145 |
| 89 | Ga0070667_100276601 | 3300005367 | Bacteria | 1507 |
| 90 | Ga0070667_100350889 | 3300005367 | Bacteria | 1336 |
| 91 | Ga0070709_10003295 | 3300005434 | Bacteria | 8687 |
| 92 | Ga0070709_10003520 | 3300005434 | Bacteria | 8414 |
| 93 | Ga0070714_100006005 | 3300005435 | Bacteria | 9324 |
| 94 | Ga0070714_100058536 | 3300005435 | Bacteria | 3301 |
| 95 | Ga0070714_100156314 | 3300005435 | Bacteria | 2059 |
| 96 | Ga0070713_100005513 | 3300005436 | Bacteria | 8663 |
| 97 | Ga0070713_100077628 | 3300005436 | Bacteria | 2824 |
| 98 | Ga0070713_100271396 | 3300005436 | Bacteria | 1553 |
| 99 | Ga0070710_10003606 | 3300005437 | Bacteria | 7331 |
| 100 | Ga0070710_10033131 | 3300005437 | Bacteria | 2804 |
| 101 | Ga0070701_10001542 | 3300005438 | Bacteria | 8549 |
| 102 | Ga0070701_10041269 | 3300005438 | Bacteria | 2350 |
| 103 | Ga0070711_100067897 | 3300005439 | Bacteria | 2503 |
| 104 | Ga0070711_100090595 | 3300005439 | Bacteria | 2203 |
| 105 | Ga0070711_100143784 | 3300005439 | Bacteria | 1791 |
| 106 | Ga0070711_100171400 | 3300005439 | Bacteria | 1654 |
| 107 | Ga0070711_100228706 | 3300005439 | Bacteria | 1449 |
| 108 | Ga0070705_100013342 | 3300005440 | Bacteria | 4199 |
| 109 | Ga0070700_100002190 | 3300005441 | Bacteria | 9932 |
| 110 | Ga0070700_100034842 | 3300005441 | Bacteria | 3042 |
| 111 | Ga0070694_100008562 | 3300005444 | Bacteria | 6261 |
| 112 | Ga0070694_100011023 | 3300005444 | Bacteria | 5593 |
| 113 | Ga0070708_100527740 | 3300005445 | Bacteria | 1114 |
| 114 | Ga0070663_100006630 | 3300005455 | Bacteria | 6980 |
| 115 | Ga0070663_100234758 | 3300005455 | Bacteria | 1445 |
| 116 | Ga0070662_100015790 | 3300005457 | Bacteria | 5063 |
| 117 | Ga0070681_10003089 | 3300005458 | Bacteria | 15461 |
| 118 | Ga0070681_10005185 | 3300005458 | Bacteria | 12578 |
| 119 | Ga0070681_10096066 | 3300005458 | Bacteria | 2912 |
| 120 | Ga0070681_10118248 | 3300005458 | Bacteria | 2587 |
| 121 | Ga0068867_100007041 | 3300005459 | Bacteria | 7945 |
| 122 | Ga0068867_100313316 | 3300005459 | Bacteria | 1297 |
| 123 | Ga0070685_10004138 | 3300005466 | Bacteria | 7320 |
| 124 | Ga0070685_10107297 | 3300005466 | Bacteria | 1715 |
| 125 | Ga0070706_100314634 | 3300005467 | Bacteria | 1460 |
| 126 | Ga0070707_100019827 | 3300005468 | Bacteria | 6339 |
| 127 | Ga0070707_100068982 | 3300005468 | Bacteria | 3404 |
| 128 | Ga0070707_100142133 | 3300005468 | Bacteria | 2336 |
| 129 | Ga0070707_100169398 | 3300005468 | Bacteria | 2128 |
| 130 | Ga0070698_100002604 | 3300005471 | Bacteria | 19881 |
| 131 | Ga0070699_100010837 | 3300005518 | Bacteria | 7889 |
| 132 | Ga0070699_100252828 | 3300005518 | Bacteria | 1575 |
| 133 | Ga0070699_100399696 | 3300005518 | Bacteria | 1242 |
| 134 | Ga0070679_100022319 | 3300005530 | Bacteria | 6186 |
| 135 | Ga0070679_100069216 | 3300005530 | Bacteria | 3520 |
| 136 | Ga0070679_100101367 | 3300005530 | Bacteria | 2866 |
| 137 | Ga0070679_100115337 | 3300005530 | Bacteria | 2672 |
| 138 | Ga0070679_100125270 | 3300005530 | Bacteria | 2552 |
| 139 | Ga0070679_100173463 | 3300005530 | Bacteria | 2129 |
| 140 | Ga0070679_100244129 | 3300005530 | Bacteria | 1753 |
| 141 | Ga0070684_100005283 | 3300005535 | Bacteria | 9882 |
| 142 | Ga0070684_100075569 | 3300005535 | Bacteria | 2972 |
| 143 | Ga0070684_100078438 | 3300005535 | Bacteria | 2918 |
| 144 | Ga0070697_100000922 | 3300005536 | Bacteria | 22107 |
| 145 | Ga0068853_100007403 | 3300005539 | Bacteria | 8780 |
| 146 | Ga0070672_100003202 | 3300005543 | Bacteria | 10594 |
| 147 | Ga0070686_100001904 | 3300005544 | Bacteria | 11614 |
| 148 | Ga0070686_100111025 | 3300005544 | Bacteria | 1868 |
| 149 | Ga0070686_100114499 | 3300005544 | Bacteria | 1842 |
| 150 | Ga0070695_100004009 | 3300005545 | Bacteria | 8608 |
| 151 | Ga0070695_100012010 | 3300005545 | Bacteria | 5188 |
| 152 | Ga0070696_100011552 | 3300005546 | Bacteria | 5916 |
| 153 | Ga0070696_100025402 | 3300005546 | Bacteria | 4028 |
| 154 | Ga0070696_100101583 | 3300005546 | Bacteria | 2061 |
| 155 | Ga0070696_100293152 | 3300005546 | Bacteria | 1243 |
| 156 | Ga0070693_100001415 | 3300005547 | Bacteria | 10826 |
| 157 | Ga0070693_100167530 | 3300005547 | Bacteria | 1404 |
| 158 | Ga0070665_100033372 | 3300005548 | Bacteria | 5179 |
| 159 | Ga0070665_100184052 | 3300005548 | Bacteria | 2090 |
| 160 | Ga0070704_100212712 | 3300005549 | Bacteria | 1568 |
| 161 | Ga0068855_100023429 | 3300005563 | Bacteria | 7394 |
| 162 | Ga0068855_100026702 | 3300005563 | Bacteria | 6909 |
| 163 | Ga0068855_100184084 | 3300005563 | Bacteria | 2360 |
| 164 | Ga0068855_100265405 | 3300005563 | Bacteria | 1911 |
| 165 | Ga0068855_100309001 | 3300005563 | Bacteria | 1750 |
| 166 | Ga0068855_100554614 | 3300005563 | Bacteria | 1243 |
| 167 | Ga0070664_100005578 | 3300005564 | Bacteria | 10113 |
| 168 | Ga0070664_100105612 | 3300005564 | Bacteria | 2453 |
| 169 | Ga0070664_100471296 | 3300005564 | Bacteria | 1155 |
| 170 | Ga0068857_100003700 | 3300005577 | Bacteria | 12829 |
| 171 | Ga0068854_100005149 | 3300005578 | Bacteria | 8242 |
| 172 | Ga0068854_100049880 | 3300005578 | Bacteria | 2992 |
| 173 | Ga0068856_100062644 | 3300005614 | Bacteria | 3674 |
| 174 | Ga0068856_100085483 | 3300005614 | Bacteria | 3134 |
| 175 | Ga0068856_100108184 | 3300005614 | Bacteria | 2776 |
| 176 | Ga0068856_100108264 | 3300005614 | Bacteria | 2775 |
| 177 | Ga0068856_100415741 | 3300005614 | Bacteria | 1365 |
| 178 | Ga0070702_100024377 | 3300005615 | Bacteria | 3227 |
| 179 | Ga0070702_100087656 | 3300005615 | Bacteria | 1880 |
| 180 | Ga0068852_100003095 | 3300005616 | Bacteria | 11583 |
| 181 | Ga0068852_100011531 | 3300005616 | Bacteria | 6659 |
| 182 | Ga0068852_100655031 | 3300005616 | Bacteria | 1058 |
| 183 | Ga0068859_100013731 | 3300005617 | Bacteria | 8120 |
| 184 | Ga0068859_100126913 | 3300005617 | Bacteria | 2621 |
| 185 | Ga0068859_100398843 | 3300005617 | Bacteria | 1471 |
| 186 | Ga0068864_100004616 | 3300005618 | Bacteria | 11301 |
| 187 | Ga0068866_10000805 | 3300005718 | Bacteria | 13998 |
| 188 | Ga0068866_10175450 | 3300005718 | Bacteria | 1261 |
| 189 | Ga0068861_100003522 | 3300005719 | Bacteria | 10404 |
| 190 | Ga0068870_10000414 | 3300005840 | Bacteria | 16043 |
| 191 | Ga0068863_100004632 | 3300005841 | Bacteria | 13552 |
| 192 | Ga0068863_100607235 | 3300005841 | Bacteria | 1083 |
| 193 | Ga0068858_100001573 | 3300005842 | Bacteria | 23400 |
| 194 | Ga0068858_100021262 | 3300005842 | Bacteria | 6060 |
| 195 | Ga0068858_100136544 | 3300005842 | Bacteria | 2301 |
| 196 | Ga0068858_100163156 | 3300005842 | Bacteria | 2099 |
| 197 | Ga0068860_100011587 | 3300005843 | Bacteria | 8694 |
| 198 | Ga0068860_100168980 | 3300005843 | Bacteria | 2112 |
| 199 | Ga0068860_100339213 | 3300005843 | Bacteria | 1477 |
| 200 | Ga0068862_100010270 | 3300005844 | Bacteria | 7725 |
| 201 | Ga0068862_100018526 | 3300005844 | Bacteria | 5799 |
| 202 | Ga0081455_10001269 | 3300005937 | Bacteria | 31519 |
| 203 | Ga0081455_10024762 | 3300005937 | Bacteria | 5549 |
| 204 | Ga0081455_10138904 | 3300005937 | Bacteria | 1890 |
| 205 | Ga0081455_10356718 | 3300005937 | Bacteria | 1029 |
| 206 | Ga0081538_10005636 | 3300005981 | Bacteria | 11233 |
| 207 | Ga0081538_10026613 | 3300005981 | Bacteria | 4040 |
| 208 | Ga0081539_10000115 | 3300005985 | Bacteria | 188623 |
| 209 | Ga0081539_10001357 | 3300005985 | Bacteria | 42598 |
| 210 | Ga0081539_10015315 | 3300005985 | Bacteria | 5583 |
| 211 | Ga0070717_10000230 | 3300006028 | Bacteria | 38578 |
| 212 | Ga0075365_10001374 | 3300006038 | Bacteria | 10940 |
| 213 | Ga0075364_10163182 | 3300006051 | Bacteria | 1504 |
| 214 | Ga0070715_10005041 | 3300006163 | Bacteria | 4378 |
| 215 | Ga0070715_10108946 | 3300006163 | Bacteria | 1304 |
| 216 | Ga0070716_100003237 | 3300006173 | Bacteria | 7645 |
| 217 | Ga0070716_100014532 | 3300006173 | Bacteria | 4033 |
| 218 | Ga0070716_100221113 | 3300006173 | Bacteria | 1272 |
| 219 | Ga0070712_100000431 | 3300006175 | Bacteria | 23938 |
| 220 | Ga0070712_100009409 | 3300006175 | Bacteria | 6158 |
| 221 | Ga0070712_100023648 | 3300006175 | Bacteria | 4062 |
| 222 | Ga0070712_100029920 | 3300006175 | Bacteria | 3654 |
| 223 | Ga0070712_100120327 | 3300006175 | Bacteria | 1975 |
| 224 | Ga0070712_100242649 | 3300006175 | Bacteria | 1436 |
| 225 | Ga0075362_10106101 | 3300006177 | Bacteria | 1318 |
| 226 | Ga0075369_10023630 | 3300006186 | Bacteria | 2542 |
| 227 | Ga0075427_10000546 | 3300006194 | Bacteria | 4347 |
| 228 | Ga0075366_10158023 | 3300006195 | Bacteria | 1373 |
| 229 | Ga0097621_100000432 | 3300006237 | Bacteria | 29159 |
| 230 | Ga0097621_100017374 | 3300006237 | Bacteria | 5461 |
| 231 | Ga0097621_100082967 | 3300006237 | Bacteria | 2670 |
| 232 | Ga0075370_10031031 | 3300006353 | Bacteria | 2983 |
| 233 | Ga0068871_100001626 | 3300006358 | Bacteria | 15134 |
| 234 | Ga0068871_100010210 | 3300006358 | Bacteria | 6839 |
| 235 | Ga0068871_100144502 | 3300006358 | Bacteria | 2024 |
| 236 | Ga0068871_100255427 | 3300006358 | Bacteria | 1528 |
| 237 | Ga0075428_100033719 | 3300006844 | Bacteria | 5650 |
| 238 | Ga0075428_100065761 | 3300006844 | Bacteria | 3971 |
| 239 | Ga0075430_100000312 | 3300006846 | Bacteria | 34556 |
| 240 | Ga0075431_100004142 | 3300006847 | Bacteria | 14157 |
| 241 | Ga0075431_100009808 | 3300006847 | Bacteria | 9616 |
| 242 | Ga0075433_10000217 | 3300006852 | Bacteria | 32575 |
| 243 | Ga0075433_10071485 | 3300006852 | Bacteria | 3050 |
| 244 | Ga0075434_100000482 | 3300006871 | Bacteria | 29922 |
| 245 | Ga0075434_100018131 | 3300006871 | Bacteria | 6794 |
| 246 | Ga0075434_100025778 | 3300006871 | Bacteria | 5755 |
| 247 | Ga0075434_100047122 | 3300006871 | Bacteria | 4278 |
| 248 | Ga0075434_100140061 | 3300006871 | Bacteria | 2438 |
| 249 | Ga0075434_100167534 | 3300006871 | Bacteria | 2217 |
| 250 | Ga0075429_100005934 | 3300006880 | Bacteria | 10543 |
| 251 | Ga0068865_100001764 | 3300006881 | Bacteria | 12696 |
| 252 | Ga0068865_100008848 | 3300006881 | Bacteria | 6227 |
| 253 | Ga0068865_100048210 | 3300006881 | Bacteria | 2931 |
| 254 | Ga0075436_100205572 | 3300006914 | Bacteria | 1395 |
| 255 | Ga0097620_100013731 | 3300006931 | Bacteria | 8120 |
| 256 | Ga0097620_100126907 | 3300006931 | Bacteria | 2621 |
| 257 | Ga0097620_100398827 | 3300006931 | Bacteria | 1471 |
| 258 | Ga0075435_100022837 | 3300007076 | Bacteria | 4830 |
| 259 | Ga0075435_100031001 | 3300007076 | Bacteria | 4209 |
| 260 | Ga0075435_100069473 | 3300007076 | Bacteria | 2872 |
| 261 | Ga0075435_100086830 | 3300007076 | Bacteria | 2577 |
| 262 | Ga0099794_10021200 | 3300007265 | Bacteria | 2950 |
| 263 | Ga0105251_10052350 | 3300009011 | Bacteria | 1944 |
| 264 | Ga0105250_10031284 | 3300009092 | Bacteria | 2137 |
| 265 | Ga0105240_10028942 | 3300009093 | Bacteria | 7226 |
| 266 | Ga0111539_10001938 | 3300009094 | Bacteria | 27600 |
| 267 | Ga0111539_10003842 | 3300009094 | Bacteria | 19781 |
| 268 | Ga0111539_10004907 | 3300009094 | Bacteria | 17409 |
| 269 | Ga0111539_10029777 | 3300009094 | Bacteria | 6644 |
| 270 | Ga0111539_10080586 | 3300009094 | Bacteria | 3829 |
| 271 | Ga0105245_10000534 | 3300009098 | Bacteria | 34896 |
| 272 | Ga0105245_10005575 | 3300009098 | Bacteria | 11062 |
| 273 | Ga0114129_10004108 | 3300009147 | Bacteria | 20574 |
| 274 | Ga0114129_10132378 | 3300009147 | Bacteria | 3424 |
| 275 | Ga0114129_10196053 | 3300009147 | Bacteria | 2738 |
| 276 | Ga0105243_10003508 | 3300009148 | Bacteria | 12668 |
| 277 | Ga0105243_10173381 | 3300009148 | Bacteria | 1870 |
| 278 | Ga0105241_10002008 | 3300009174 | Bacteria | 15393 |
| 279 | Ga0105241_10214633 | 3300009174 | Bacteria | 1614 |
| 280 | Ga0105241_10353554 | 3300009174 | Bacteria | 1276 |
| 281 | Ga0105242_10004301 | 3300009176 | Bacteria | 11098 |
| 282 | Ga0105242_10004986 | 3300009176 | Bacteria | 10269 |
| 283 | Ga0105242_10213004 | 3300009176 | Bacteria | 1723 |
| 284 | Ga0105242_10402279 | 3300009176 | Bacteria | 1278 |
| 285 | Ga0105248_10003814 | 3300009177 | Bacteria | 16715 |
| 286 | Ga0105248_10012337 | 3300009177 | Bacteria | 9429 |
| 287 | Ga0105248_10071076 | 3300009177 | Bacteria | 3909 |
| 288 | Ga0105248_10296134 | 3300009177 | Bacteria | 1822 |
| 289 | Ga0105248_10640719 | 3300009177 | Bacteria | 1199 |
| 290 | Ga0105237_10004785 | 3300009545 | Bacteria | 15562 |
| 291 | Ga0105237_10079240 | 3300009545 | Bacteria | 3275 |
| 292 | Ga0105237_10183774 | 3300009545 | Bacteria | 2091 |
| 293 | Ga0105238_10046828 | 3300009551 | Bacteria | 4361 |
| 294 | Ga0105238_10070748 | 3300009551 | Bacteria | 3487 |
| 295 | Ga0105249_10004067 | 3300009553 | Bacteria | 12616 |
| 296 | Ga0105249_10170337 | 3300009553 | Bacteria | 2111 |
| 297 | Ga0105249_10447589 | 3300009553 | Bacteria | 1330 |
| 298 | Ga0105249_10723447 | 3300009553 | Bacteria | 1056 |
| 299 | Ga0105028_101643 | 3300009993 | Bacteria | 2342 |
| 300 | Ga0105239_10039798 | 3300010375 | Bacteria | 5150 |
| 301 | Ga0105239_10063264 | 3300010375 | Bacteria | 4062 |
| 302 | Ga0105239_10655203 | 3300010375 | Bacteria | 1199 |
| 303 | Ga0105246_10001160 | 3300011119 | Bacteria | 15299 |
| 304 | Ga0157335_1002551 | 3300012492 | Bacteria | 1107 |
| 305 | Ga0157342_1002325 | 3300012507 | Bacteria | 1533 |
| 306 | Ga0157373_10004563 | 3300013100 | Bacteria | 10416 |
| 307 | Ga0157373_10037254 | 3300013100 | Bacteria | 3487 |
| 308 | Ga0157371_10028973 | 3300013102 | Bacteria | 4008 |
| 309 | Ga0157370_10259250 | 3300013104 | Bacteria | 1607 |
| 310 | Ga0157374_10006040 | 3300013296 | Bacteria | 10246 |
| 311 | Ga0157374_10036266 | 3300013296 | Bacteria | 4515 |
| 312 | Ga0157378_10006408 | 3300013297 | Bacteria | 10289 |
| 313 | Ga0163162_10018687 | 3300013306 | Bacteria | 6791 |
| 314 | Ga0163162_10303417 | 3300013306 | Bacteria | 1729 |
| 315 | Ga0163162_10372966 | 3300013306 | Bacteria | 1560 |
| 316 | Ga0157372_10003634 | 3300013307 | Bacteria | 16595 |
| 317 | Ga0157372_10058724 | 3300013307 | Bacteria | 4301 |
| 318 | Ga0157372_10080440 | 3300013307 | Bacteria | 3686 |
| 319 | Ga0157372_10084628 | 3300013307 | Bacteria | 3595 |
| 320 | Ga0157375_10002653 | 3300013308 | Bacteria | 15489 |
| 321 | Ga0157375_10013985 | 3300013308 | Bacteria | 7155 |
| 322 | Ga0163163_10003304 | 3300014325 | Bacteria | 13677 |
| 323 | Ga0163163_10006181 | 3300014325 | Bacteria | 10441 |
| 324 | Ga0163163_10288779 | 3300014325 | Bacteria | 1692 |
| 325 | Ga0157380_10000558 | 3300014326 | Bacteria | 22893 |
| 326 | Ga0157377_10000819 | 3300014745 | Bacteria | 12893 |
| 327 | Ga0157377_10213289 | 3300014745 | Bacteria | 1232 |
| 328 | Ga0157379_10004333 | 3300014968 | Bacteria | 12139 |
| 329 | Ga0157379_10034106 | 3300014968 | Bacteria | 4536 |
| 330 | Ga0157379_10174036 | 3300014968 | Bacteria | 1943 |
| 331 | Ga0157379_10410544 | 3300014968 | Bacteria | 1246 |
| 332 | Ga0157376_10001412 | 3300014969 | Bacteria | 15800 |
| 333 | Ga0157376_10093425 | 3300014969 | Bacteria | 2611 |
| 334 | Ga0157376_10315777 | 3300014969 | Bacteria | 1484 |
| 335 | Ga0157376_10464822 | 3300014969 | Bacteria | 1237 |
| 336 | Ga0163161_10001783 | 3300017792 | Bacteria | 15700 |
| 337 | Ga0213873_10020551 | 3300021358 | Bacteria | 1544 |
| 338 | Ga0213876_10000046 | 3300021384 | Bacteria | 150327 |
| 339 | Ga0213875_10001127 | 3300021388 | Bacteria | 18428 |
| 340 | Ga0224712_10007388 | 3300022467 | Bacteria | 3198 |
| 341 | Ga0224712_10117528 | 3300022467 | Bacteria | 1148 |
| 342 | Ga0207666_1000030 | 3300025271 | Bacteria | 31103 |
| 343 | Ga0207666_1001056 | 3300025271 | Bacteria | 3266 |
| 344 | Ga0207673_1000110 | 3300025290 | Bacteria | 7515 |
| 345 | Ga0209676_1000089 | 3300025292 | Bacteria | 260196 |
| 346 | Ga0209050_1008351 | 3300025298 | Bacteria | 5556 |
| 347 | Ga0207697_10000225 | 3300025315 | Bacteria | 30578 |
| 348 | Ga0207697_10007510 | 3300025315 | Bacteria | 4858 |
| 349 | Ga0207697_10033038 | 3300025315 | Bacteria | 2118 |
| 350 | Ga0207713_1054500 | 3300025735 | Bacteria | 1567 |
| 351 | Ga0207653_10025601 | 3300025885 | Bacteria | 1887 |
| 352 | Ga0207682_10000009 | 3300025893 | Bacteria | 86366 |
| 353 | Ga0207692_10043097 | 3300025898 | Bacteria | 2243 |
| 354 | Ga0207642_10000959 | 3300025899 | Bacteria | 9022 |
| 355 | Ga0207642_10153554 | 3300025899 | Bacteria | 1228 |
| 356 | Ga0207688_10000060 | 3300025901 | Bacteria | 40194 |
| 357 | Ga0207680_10001548 | 3300025903 | Bacteria | 10831 |
| 358 | Ga0207680_10116073 | 3300025903 | Bacteria | 1744 |
| 359 | Ga0207680_10296261 | 3300025903 | Bacteria | 1127 |
| 360 | Ga0207647_10000172 | 3300025904 | Bacteria | 51724 |
| 361 | Ga0207647_10001510 | 3300025904 | Bacteria | 17885 |
| 362 | Ga0207685_10135589 | 3300025905 | Bacteria | 1098 |
| 363 | Ga0207699_10029344 | 3300025906 | Bacteria | 3067 |
| 364 | Ga0207699_10072924 | 3300025906 | Bacteria | 2104 |
| 365 | Ga0207699_10078156 | 3300025906 | Bacteria | 2043 |
| 366 | Ga0207645_10001895 | 3300025907 | Bacteria | 16883 |
| 367 | Ga0207643_10000244 | 3300025908 | Bacteria | 37860 |
| 368 | Ga0207705_10160120 | 3300025909 | Bacteria | 1691 |
| 369 | Ga0207684_10049512 | 3300025910 | Bacteria | 3564 |
| 370 | Ga0207707_10003182 | 3300025912 | Bacteria | 14574 |
| 371 | Ga0207707_10032559 | 3300025912 | Bacteria | 4563 |
| 372 | Ga0207707_10045776 | 3300025912 | Bacteria | 3812 |
| 373 | Ga0207707_10075788 | 3300025912 | Bacteria | 2936 |
| 374 | Ga0207707_10105071 | 3300025912 | Bacteria | 2468 |
| 375 | Ga0207707_10146362 | 3300025912 | Bacteria | 2065 |
| 376 | Ga0207695_10037556 | 3300025913 | Bacteria | 5225 |
| 377 | Ga0207671_10003102 | 3300025914 | Bacteria | 16915 |
| 378 | Ga0207671_10044311 | 3300025914 | Bacteria | 3290 |
| 379 | Ga0207671_10197972 | 3300025914 | Bacteria | 1568 |
| 380 | Ga0207693_10000460 | 3300025915 | Bacteria | 37218 |
| 381 | Ga0207693_10001247 | 3300025915 | Bacteria | 22646 |
| 382 | Ga0207693_10002491 | 3300025915 | Bacteria | 16018 |
| 383 | Ga0207693_10008813 | 3300025915 | Bacteria | 8242 |
| 384 | Ga0207693_10136257 | 3300025915 | Bacteria | 1930 |
| 385 | Ga0207663_10055510 | 3300025916 | Bacteria | 2486 |
| 386 | Ga0207660_10000179 | 3300025917 | Bacteria | 40457 |
| 387 | Ga0207660_10013904 | 3300025917 | Bacteria | 5282 |
| 388 | Ga0207660_10052000 | 3300025917 | Bacteria | 2915 |
| 389 | Ga0207662_10000025 | 3300025918 | Bacteria | 70078 |
| 390 | Ga0207662_10224241 | 3300025918 | Bacteria | 1225 |
| 391 | Ga0207657_10001867 | 3300025919 | Bacteria | 22796 |
| 392 | Ga0207657_10016175 | 3300025919 | Bacteria | 7202 |
| 393 | Ga0207649_10002794 | 3300025920 | Bacteria | 9638 |
| 394 | Ga0207649_10201578 | 3300025920 | Bacteria | 1406 |
| 395 | Ga0207652_10032575 | 3300025921 | Bacteria | 4384 |
| 396 | Ga0207652_10035880 | 3300025921 | Bacteria | 4188 |
| 397 | Ga0207652_10107867 | 3300025921 | Bacteria | 2467 |
| 398 | Ga0207652_10194803 | 3300025921 | Bacteria | 1823 |
| 399 | Ga0207652_10335470 | 3300025921 | Bacteria | 1365 |
| 400 | Ga0207652_10343068 | 3300025921 | Bacteria | 1348 |
| 401 | Ga0207646_10005518 | 3300025922 | Bacteria | 13295 |
| 402 | Ga0207646_10457608 | 3300025922 | Bacteria | 1151 |
| 403 | Ga0207681_10000419 | 3300025923 | Bacteria | 29502 |
| 404 | Ga0207694_10019282 | 3300025924 | Bacteria | 5156 |
| 405 | Ga0207694_10049888 | 3300025924 | Bacteria | 3240 |
| 406 | Ga0207650_10015411 | 3300025925 | Bacteria | 5322 |
| 407 | Ga0207650_10033937 | 3300025925 | Bacteria | 3699 |
| 408 | Ga0207659_10000283 | 3300025926 | Bacteria | 30879 |
| 409 | Ga0207659_10148369 | 3300025926 | Bacteria | 1829 |
| 410 | Ga0207687_10004337 | 3300025927 | Bacteria | 9469 |
| 411 | Ga0207687_10016909 | 3300025927 | Bacteria | 4795 |
| 412 | Ga0207700_10002145 | 3300025928 | Bacteria | 11291 |
| 413 | Ga0207700_10015075 | 3300025928 | Bacteria | 5085 |
| 414 | Ga0207700_10092585 | 3300025928 | Bacteria | 2390 |
| 415 | Ga0207664_10011719 | 3300025929 | Bacteria | 6248 |
| 416 | Ga0207664_10068431 | 3300025929 | Bacteria | 2852 |
| 417 | Ga0207664_10082275 | 3300025929 | Bacteria | 2622 |
| 418 | Ga0207664_10123088 | 3300025929 | Bacteria | 2173 |
| 419 | Ga0207664_10171048 | 3300025929 | Bacteria | 1859 |
| 420 | Ga0207644_10004405 | 3300025931 | Bacteria | 9136 |
| 421 | Ga0207644_10044351 | 3300025931 | Bacteria | 3159 |
| 422 | Ga0207644_10059673 | 3300025931 | Bacteria | 2759 |
| 423 | Ga0207644_10130507 | 3300025931 | Bacteria | 1923 |
| 424 | Ga0207690_10000808 | 3300025932 | Bacteria | 20084 |
| 425 | Ga0207690_10060972 | 3300025932 | Bacteria | 2563 |
| 426 | Ga0207690_10155973 | 3300025932 | Bacteria | 1697 |
| 427 | Ga0207690_10361985 | 3300025932 | Bacteria | 1149 |
| 428 | Ga0207706_10000734 | 3300025933 | Bacteria | 34159 |
| 429 | Ga0207706_10030769 | 3300025933 | Bacteria | 4787 |
| 430 | Ga0207706_10075490 | 3300025933 | Bacteria | 2964 |
| 431 | Ga0207686_10000879 | 3300025934 | Bacteria | 18161 |
| 432 | Ga0207686_10012514 | 3300025934 | Bacteria | 4666 |
| 433 | Ga0207709_10005908 | 3300025935 | Bacteria | 6905 |
| 434 | Ga0207709_10021837 | 3300025935 | Bacteria | 3625 |
| 435 | Ga0207670_10001927 | 3300025936 | Bacteria | 10861 |
| 436 | Ga0207670_10008819 | 3300025936 | Bacteria | 5714 |
| 437 | Ga0207670_10296777 | 3300025936 | Bacteria | 1264 |
| 438 | Ga0207669_10000204 | 3300025937 | Bacteria | 27121 |
| 439 | Ga0207669_10044660 | 3300025937 | Bacteria | 2605 |
| 440 | Ga0207704_10002129 | 3300025938 | Bacteria | 8876 |
| 441 | Ga0207704_10012427 | 3300025938 | Bacteria | 4226 |
| 442 | Ga0207704_10147842 | 3300025938 | Bacteria | 1653 |
| 443 | Ga0207665_10001684 | 3300025939 | Bacteria | 14866 |
| 444 | Ga0207665_10005925 | 3300025939 | Bacteria | 8135 |
| 445 | Ga0207665_10014670 | 3300025939 | Bacteria | 5156 |
| 446 | Ga0207665_10090953 | 3300025939 | Bacteria | 2115 |
| 447 | Ga0207691_10000309 | 3300025940 | Bacteria | 48592 |
| 448 | Ga0207711_10003227 | 3300025941 | Bacteria | 14209 |
| 449 | Ga0207711_10009863 | 3300025941 | Bacteria | 7942 |
| 450 | Ga0207711_10013666 | 3300025941 | Bacteria | 6741 |
| 451 | Ga0207711_10034929 | 3300025941 | Bacteria | 4259 |
| 452 | Ga0207711_10066720 | 3300025941 | Bacteria | 3112 |
| 453 | Ga0207689_10000893 | 3300025942 | Bacteria | 28654 |
| 454 | Ga0207689_10039885 | 3300025942 | Bacteria | 3887 |
| 455 | Ga0207689_10050215 | 3300025942 | Bacteria | 3440 |
| 456 | Ga0207689_10116082 | 3300025942 | Bacteria | 2200 |
| 457 | Ga0207661_10003381 | 3300025944 | Bacteria | 11085 |
| 458 | Ga0207661_10119353 | 3300025944 | Bacteria | 2243 |
| 459 | Ga0207661_10543156 | 3300025944 | Bacteria | 1064 |
| 460 | Ga0207679_10000128 | 3300025945 | Bacteria | 61823 |
| 461 | Ga0207679_10098406 | 3300025945 | Bacteria | 2281 |
| 462 | Ga0207679_10352196 | 3300025945 | Bacteria | 1284 |
| 463 | Ga0207667_10015642 | 3300025949 | Bacteria | 8606 |
| 464 | Ga0207667_10025294 | 3300025949 | Bacteria | 6501 |
| 465 | Ga0207651_10003175 | 3300025960 | Bacteria | 8020 |
| 466 | Ga0207651_10042390 | 3300025960 | Bacteria | 3029 |
| 467 | Ga0207712_10003264 | 3300025961 | Bacteria | 10289 |
| 468 | Ga0207712_10156181 | 3300025961 | Bacteria | 1768 |
| 469 | Ga0207668_10002555 | 3300025972 | Bacteria | 10632 |
| 470 | Ga0207668_10359020 | 3300025972 | Bacteria | 1220 |
| 471 | Ga0207640_10005063 | 3300025981 | Bacteria | 7172 |
| 472 | Ga0207658_10005664 | 3300025986 | Bacteria | 8547 |
| 473 | Ga0207658_10027783 | 3300025986 | Bacteria | 3979 |
| 474 | Ga0207677_10008643 | 3300026023 | Bacteria | 5701 |
| 475 | Ga0207703_10007507 | 3300026035 | Bacteria | 8654 |
| 476 | Ga0207703_10040655 | 3300026035 | Bacteria | 3722 |
| 477 | Ga0207703_10063935 | 3300026035 | Bacteria | 3019 |
| 478 | Ga0207703_10254754 | 3300026035 | Bacteria | 1584 |
| 479 | Ga0207703_10390262 | 3300026035 | Bacteria | 1289 |
| 480 | Ga0207639_10007584 | 3300026041 | Bacteria | 7402 |
| 481 | Ga0207678_10000759 | 3300026067 | Bacteria | 29491 |
| 482 | Ga0207678_10020189 | 3300026067 | Bacteria | 5850 |
| 483 | Ga0207678_10026240 | 3300026067 | Bacteria | 5083 |
| 484 | Ga0207678_10094566 | 3300026067 | Bacteria | 2554 |
| 485 | Ga0207708_10000391 | 3300026075 | Bacteria | 34446 |
| 486 | Ga0207708_10098573 | 3300026075 | Bacteria | 2259 |
| 487 | Ga0207702_10008180 | 3300026078 | Bacteria | 8842 |
| 488 | Ga0207702_10174970 | 3300026078 | Bacteria | 1971 |
| 489 | Ga0207702_10547262 | 3300026078 | Bacteria | 1132 |
| 490 | Ga0207641_10006199 | 3300026088 | Bacteria | 10116 |
| 491 | Ga0207648_10000862 | 3300026089 | Bacteria | 34173 |
| 492 | Ga0207676_10003505 | 3300026095 | Bacteria | 11102 |
| 493 | Ga0207676_10024007 | 3300026095 | Bacteria | 4508 |
| 494 | Ga0207676_10281156 | 3300026095 | Bacteria | 1511 |
| 495 | Ga0207674_10000806 | 3300026116 | Bacteria | 40763 |
| 496 | Ga0207675_100000637 | 3300026118 | Bacteria | 34408 |
| 497 | Ga0207675_100041675 | 3300026118 | Bacteria | 4287 |
| 498 | Ga0207683_10000330 | 3300026121 | Bacteria | 43106 |
| 499 | Ga0207683_10006268 | 3300026121 | Bacteria | 10192 |
| 500 | Ga0207683_10030655 | 3300026121 | Bacteria | 4662 |
| 501 | Ga0207698_10002562 | 3300026142 | Bacteria | 10790 |
| 502 | Ga0207698_10183727 | 3300026142 | Bacteria | 1855 |
| 503 | Ga0210002_1001079 | 3300027617 | Bacteria | 3781 |
| 504 | Ga0209983_1006352 | 3300027665 | Bacteria | 2429 |
| 505 | Ga0209971_1008242 | 3300027682 | Bacteria | 2471 |
| 506 | Ga0209966_1001959 | 3300027695 | Bacteria | 3449 |
| 507 | Ga0209998_10001428 | 3300027717 | Bacteria | 5782 |
| 508 | Ga0209998_10002841 | 3300027717 | Bacteria | 3892 |
| 509 | Ga0209974_10000230 | 3300027876 | Bacteria | 18079 |
| 510 | Ga0207428_10000096 | 3300027907 | Bacteria | 123081 |
| 511 | Ga0207428_10000164 | 3300027907 | Bacteria | 91968 |
| 512 | Ga0207428_10000815 | 3300027907 | Bacteria | 35204 |
| 513 | Ga0207428_10001706 | 3300027907 | Bacteria | 22544 |
| 514 | Ga0268266_10070826 | 3300028379 | Bacteria | 3021 |
| 515 | Ga0268265_10002566 | 3300028380 | Bacteria | 13577 |
| 516 | Ga0268265_10038962 | 3300028380 | Bacteria | 3499 |
| 517 | Ga0268264_10006412 | 3300028381 | Bacteria | 9911 |
| 518 | Ga0268264_10248040 | 3300028381 | Bacteria | 1653 |
| 519 | Ga0268264_10370132 | 3300028381 | Bacteria | 1369 |
| 520 | Ga0265337_1000796 | 3300028556 | Bacteria | 16604 |
| 521 | Ga0265334_10017368 | 3300028573 | Bacteria | 2973 |
| 522 | Ga0265338_10023559 | 3300028800 | Bacteria | 6325 |
| 523 | Ga0265330_10009674 | 3300031235 | Bacteria | 4570 |
| 524 | Ga0265325_10000305 | 3300031241 | Bacteria | 34555 |
| 525 | Ga0265325_10000442 | 3300031241 | Bacteria | 29810 |
| 526 | Ga0265325_10004813 | 3300031241 | Bacteria | 8451 |
| 527 | Ga0265325_10010337 | 3300031241 | Bacteria | 5411 |
| 528 | Ga0265325_10022863 | 3300031241 | Bacteria | 3421 |
| 529 | Ga0265325_10035033 | 3300031241 | Bacteria | 2667 |
| 530 | Ga0265340_10008715 | 3300031247 | Bacteria | 5471 |
| 531 | Ga0265340_10018445 | 3300031247 | Bacteria | 3599 |
| 532 | Ga0265339_10002069 | 3300031249 | Bacteria | 14716 |
| 533 | Ga0265339_10039970 | 3300031249 | Bacteria | 2608 |
| 534 | Ga0265339_10081188 | 3300031249 | Bacteria | 1714 |
| 535 | Ga0265339_10100771 | 3300031249 | Bacteria | 1503 |
| 536 | Ga0265327_10021801 | 3300031251 | Bacteria | 3854 |
| 537 | Ga0265316_10107177 | 3300031344 | Bacteria | 2119 |
| 538 | Ga0265313_10000305 | 3300031595 | Bacteria | 53305 |
| 539 | Ga0265313_10001505 | 3300031595 | Bacteria | 21710 |
| 540 | Ga0265313_10013856 | 3300031595 | Bacteria | 4805 |
| 541 | Ga0265313_10025172 | 3300031595 | Bacteria | 3161 |
| 542 | Ga0316575_10018835 | 3300031665 | Bacteria | 2636 |
| 543 | Ga0265314_10001589 | 3300031711 | Bacteria | 24969 |
| 544 | Ga0265314_10016519 | 3300031711 | Bacteria | 5823 |
| 545 | Ga0265314_10109110 | 3300031711 | Bacteria | 1762 |
| 546 | Ga0265342_10000321 | 3300031712 | Bacteria | 54074 |
| 547 | Ga0265342_10002243 | 3300031712 | Bacteria | 16899 |
| 548 | Ga0265342_10056655 | 3300031712 | Bacteria | 2322 |
| 549 | Ga0316576_10163537 | 3300031727 | Bacteria | 1679 |
| 550 | Ga0307416_100236268 | 3300032002 | Bacteria | 1767 |
| 551 | Ga0307414_10011115 | 3300032004 | Bacteria | 5265 |
| 552 | Ga0316583_10000092 | 3300032133 | Bacteria | 19607 |
| 553 | Ga0373930_0000057 | 3300034816 | Bacteria | 10456 |
| 554 | Ga0373948_0001657 | 3300034817 | Bacteria | 3146 |
| 555 | Ga0373948_0009265 | 3300034817 | Bacteria | 1695 |
| 556 | Ga0373950_0004566 | 3300034818 | Bacteria | 2031 |
| 557 | Ga0373950_0004808 | 3300034818 | Bacteria | 1991 |
| 558 | Ga0373958_0006518 | 3300034819 | Bacteria | 1822 |
| 559 | Ga0373959_0002313 | 3300034820 | Bacteria | 3032 |
| 560 | Ga0373959_0006569 | 3300034820 | Bacteria | 1935 |
| 561 | Ga0373938_0003139 | 3300034957 | Bacteria | 2684 |
| 562 | Ga0373928_0002217 | 3300035084 | Bacteria | 3783 |
| 563 | Ga0373928_0009085 | 3300035084 | Bacteria | 1939 |
| 564 | Ga0373929_0003213 | 3300035085 | Bacteria | 2962 |
| 565 | Ga0373934_0098298 | 3300035086 | Bacteria | 1183 |
| 566 | Ga0373944_0002521 | 3300035089 | Bacteria | 4653 |
| 567 | Ga0373949_0004678 | 3300035090 | Bacteria | 3111 |
| 568 | Ga0373949_0005109 | 3300035090 | Bacteria | 2950 |
| 569 | Ga0373951_0000341 | 3300035091 | Bacteria | 14347 |
| 570 | Ga0373952_0001033 | 3300035092 | Bacteria | 5085 |
| 571 | Ga0373952_0001903 | 3300035092 | Bacteria | 3787 |
| 572 | Ga0373923_0034403 | 3300035111 | Bacteria | 2056 |
| 573 | Ga0373932_0003901 | 3300035112 | Bacteria | 3557 |
| 574 | Ga0373932_0019013 | 3300035112 | Bacteria | 1785 |
| 575 | Ga0373936_0020827 | 3300035113 | Bacteria | 2550 |
| 576 | Ga0373936_0029771 | 3300035113 | Bacteria | 2151 |
| 577 | Ga0373939_0001163 | 3300035114 | Bacteria | 6446 |
| 578 | Ga0373939_0001797 | 3300035114 | Bacteria | 5161 |
| 579 | Ga0373939_0007281 | 3300035114 | Bacteria | 2685 |
| 580 | Ga0373939_0051546 | 3300035114 | Bacteria | 1280 |
| 581 | Ga0373941_0000752 | 3300035115 | Bacteria | 6633 |
| 582 | Ga0373941_0001091 | 3300035115 | Bacteria | 5653 |
| 583 | Ga0373953_0042816 | 3300035117 | Bacteria | 1806 |
| 584 | Ga0373954_0022731 | 3300035118 | Bacteria | 2847 |
| 585 | Ga0373956_0015149 | 3300035119 | Bacteria | 3226 |
| 586 | Ga0373956_0020919 | 3300035119 | Bacteria | 2789 |
| 587 | Ga0373956_0104901 | 3300035119 | Bacteria | 1313 |
| 588 | Ga0373957_0012274 | 3300035120 | Bacteria | 2880 |
| 589 | Ga0373960_0000509 | 3300035121 | Bacteria | 7759 |
| 590 | Ga0373943_0006224 | 3300035170 | Bacteria | 5360 |
| 591 | Ga0373946_0018601 | 3300035171 | Bacteria | 2670 |
| 592 | Ga0373955_0000998 | 3300035172 | Bacteria | 12004 |
| 593 | Ga0373955_0001557 | 3300035172 | Bacteria | 9800 |
| 594 | Ga0373942_0002104 | 3300035207 | Bacteria | 4942 |
| 595 | Ga0373942_0020612 | 3300035207 | Bacteria | 1657 |
| 596 | Ga0373961_0001381 | 3300035241 | Bacteria | 7261 |
| 597 | Ga0373961_0038624 | 3300035241 | Bacteria | 1368 |
| 598 | Ga0373962_0000553 | 3300035242 | Bacteria | 8421 |
| 599 | Ga0373962_0004172 | 3300035242 | Bacteria | 3482 |
| 600 | Ga0373962_0019285 | 3300035242 | Bacteria | 1783 |
| 601 | Ga0373924_0001412 | 3300035410 | Bacteria | 7777 |
| 602 | Ga0373924_0009677 | 3300035410 | Bacteria | 3541 |
| 603 | Ga0373931_0002430 | 3300035691 | Bacteria | 8241 |
| 604 | Ga0373931_0021545 | 3300035691 | Bacteria | 3234 |
| 605 | Ga0373931_0089167 | 3300035691 | Bacteria | 1715 |
| 606 | Ga0373931_0101336 | 3300035691 | Bacteria | 1620 |
| 607 | Ga0373931_0153675 | 3300035691 | Bacteria | 1343 |
| 608 | Ga0373935_0016753 | 3300035692 | Bacteria | 4435 |
| 609 | Ga0373935_0046383 | 3300035692 | Bacteria | 2745 |
| 610 | Ga0373935_0101018 | 3300035692 | Bacteria | 1902 |
| 611 | Ga0373927_0048155 | 3300035695 | Bacteria | 2757 |
| 612 | Ga0373927_0139121 | 3300035695 | Bacteria | 1587 |
| 613 | Ga0373933_0019278 | 3300035724 | Bacteria | 3850 |
| 614 | Ga0373947_0001287 | 3300035725 | Bacteria | 15461 |
| 615 | Ga0373947_0117761 | 3300035725 | Bacteria | 1685 |
| 616 | Ga0373937_0001774 | 3300036401 | Bacteria | 18124 |
| 617 | Ga0373937_0002866 | 3300036401 | Bacteria | 14408 |
| 618 | Ga0373937_0106442 | 3300036401 | Bacteria | 2607 |
| 619 | Ga0373937_0177517 | 3300036401 | Bacteria | 1999 |
| 620 | Ga0316582_0144556 | 3300036647 | Bacteria | 1605 |
| 621 | Ga0316582_0168321 | 3300036647 | Bacteria | 1487 |
| 622 | Ga0316584_0033354 | 3300036712 | Bacteria | 3813 |
| 623 | Ga0373925_0057368 | 3300037068 | Bacteria | 2917 |
| 624 | Ga0373925_0064177 | 3300037068 | Bacteria | 2764 |
| 625 | Ga0373925_0071936 | 3300037068 | Bacteria | 2616 |
| 626 | Ga0395900_0082006 | 3300037418 | Bacteria | 3313 |
| 627 | Ga0395898_0136879 | 3300037466 | Bacteria | 2345 |
| 628 | Ga0436364_0022735 | 3300037853 | Bacteria | 162985 |
| 629 | Ga0436364_0326872 | 3300037853 | Bacteria | 1141 |
| 630 | Ga0436364_1355609 | 3300037853 | Bacteria | 12679 |
| 631 | Ga0400483_019258 | 3300039062 | Bacteria | 10917 |
| 632 | Ga0400483_118863 | 3300039062 | Bacteria | 1891 |
| 633 | Ga0400483_136500 | 3300039062 | Bacteria | 13362 |
| 634 | Ga0400483_179075 | 3300039062 | Bacteria | 12620 |
| 635 | Ga0400483_199061 | 3300039062 | Bacteria | 5704 |
| 636 | Ga0400483_220307 | 3300039062 | Bacteria | 7187 |
| 637 | Ga0436365_0858460 | 3300039437 | Bacteria | 1568 |
| 638 | Ga0436365_1061189 | 3300039437 | Bacteria | 6054 |
| 639 | Ga0436365_1136139 | 3300039437 | Bacteria | 1683 |
| 640 | Ga0436365_1389092 | 3300039437 | Bacteria | 2778 |
| 641 | Ga0436365_1437456 | 3300039437 | Bacteria | 5526 |
| 642 | Ga0436365_1658434 | 3300039437 | Bacteria | 42037 |
| 643 | Ga0436365_1708732 | 3300039437 | Bacteria | 2302 |
| 644 | Ga0436360_0547038 | 3300039438 | Bacteria | 1925 |
| 645 | Ga0436360_1260651 | 3300039438 | Bacteria | 3052 |
| 646 | Ga0436361_0128609 | 3300039447 | Bacteria | 3552 |
| 647 | Ga0436361_0546261 | 3300039447 | Bacteria | 8206 |
| 648 | Ga0436361_0673711 | 3300039447 | Bacteria | 1308 |
| 649 | Ga0436363_0532621 | 3300039450 | Bacteria | 5002 |
| 650 | Ga0436363_1390095 | 3300039450 | Bacteria | 1431 |
| 651 | Ga0451839_1410856 | 3300041496 | Bacteria | 994 |
| 652 | Ga0439463_008198 | 3300042016 | Bacteria | 2575 |
| 653 | Ga0451577_0067584 | 3300042876 | Bacteria | 3188 |
| 654 | Ga0466961_0195839 | 3300044693 | Bacteria | 1251 |
| 655 | Ga0466963_0051199 | 3300044694 | Bacteria | 2736 |
| 656 | Ga0466957_0040658 | 3300044842 | Bacteria | 2809 |
| 657 | Ga0466960_0051950 | 3300044901 | Bacteria | 1982 |
| 658 | Ga0451576_0281917 | 3300045051 | Bacteria | 1737 |
| 659 | Ga0466967_0210469 | 3300045976 | Bacteria | 1844 |
| 660 | Ga0495592_0017778 | 3300046454 | Bacteria | 5404 |
| 661 | Ga0495592_0023319 | 3300046454 | Bacteria | 4706 |
| 662 | Ga0495592_0029219 | 3300046454 | Bacteria | 4174 |
| 663 | Ga0495592_0129180 | 3300046454 | Bacteria | 1769 |
| 664 | Ga0495603_0010286 | 3300046455 | Bacteria | 5663 |
| 665 | Ga0495629_0063552 | 3300046459 | Bacteria | 2578 |
| 666 | Ga0495629_0134926 | 3300046459 | Bacteria | 1718 |
| 667 | Ga0495629_0271185 | 3300046459 | Bacteria | 1165 |
| 668 | Ga0495638_0059425 | 3300046460 | Bacteria | 2367 |
| 669 | Ga0495651_0008162 | 3300046462 | Bacteria | 8029 |
| 670 | Ga0495651_0009584 | 3300046462 | Bacteria | 7440 |
| 671 | Ga0495651_0027137 | 3300046462 | Bacteria | 4460 |
| 672 | Ga0495653_0019240 | 3300046463 | Bacteria | 5537 |
| 673 | Ga0495653_0032847 | 3300046463 | Bacteria | 4116 |
| 674 | Ga0495580_0017021 | 3300046472 | Bacteria | 5446 |
| 675 | Ga0495582_0010775 | 3300046473 | Bacteria | 5032 |
| 676 | Ga0495639_0065883 | 3300046475 | Bacteria | 1666 |
| 677 | Ga0495639_0134523 | 3300046475 | Bacteria | 1185 |
| 678 | Ga0495662_0032617 | 3300046476 | Bacteria | 2516 |
| 679 | Ga0495664_0001573 | 3300046477 | Bacteria | 12102 |
| 680 | Ga0495664_0013502 | 3300046477 | Bacteria | 4631 |
| 681 | Ga0495664_0020642 | 3300046477 | Bacteria | 3801 |
| 682 | Ga0495584_0109421 | 3300046491 | Bacteria | 1398 |
| 683 | Ga0495585_0023565 | 3300046492 | Bacteria | 3532 |
| 684 | Ga0495594_0032856 | 3300046499 | Bacteria | 2818 |
| 685 | Ga0495594_0067084 | 3300046499 | Bacteria | 1991 |
| 686 | Ga0495607_0008175 | 3300046501 | Bacteria | 7171 |
| 687 | Ga0495608_0010527 | 3300046511 | Bacteria | 6453 |
| 688 | Ga0495608_0013659 | 3300046511 | Bacteria | 5635 |
| 689 | Ga0495608_0073807 | 3300046511 | Bacteria | 2224 |
| 690 | Ga0495618_0004210 | 3300046514 | Bacteria | 8880 |
| 691 | Ga0495618_0065107 | 3300046514 | Bacteria | 2316 |
| 692 | Ga0495618_0065214 | 3300046514 | Bacteria | 2315 |
| 693 | Ga0495628_0003455 | 3300046516 | Bacteria | 14149 |
| 694 | Ga0495628_0036997 | 3300046516 | Bacteria | 3914 |
| 695 | Ga0495628_0048386 | 3300046516 | Bacteria | 3370 |
| 696 | Ga0495630_0061516 | 3300046517 | Bacteria | 2819 |
| 697 | Ga0495630_0222646 | 3300046517 | Bacteria | 1440 |
| 698 | Ga0495643_0054324 | 3300046522 | Bacteria | 2145 |
| 699 | Ga0495644_0001086 | 3300046523 | Bacteria | 11264 |
| 700 | Ga0495666_0083998 | 3300046526 | Bacteria | 1504 |
| 701 | Ga0495652_0013724 | 3300046529 | Bacteria | 7287 |
| 702 | Ga0495652_0022189 | 3300046529 | Bacteria | 5636 |
| 703 | Ga0495652_0040814 | 3300046529 | Bacteria | 4010 |
| 704 | Ga0495652_0225300 | 3300046529 | Bacteria | 1406 |
| 705 | Ga0495665_0073438 | 3300046531 | Bacteria | 1801 |
| 706 | Ga0495640_0025674 | 3300046533 | Bacteria | 4268 |
| 707 | Ga0495640_0203025 | 3300046533 | Bacteria | 1255 |
| 708 | Ga0495586_0013594 | 3300046535 | Bacteria | 4318 |
| 709 | Ga0495587_0004856 | 3300046536 | Bacteria | 8823 |
| 710 | Ga0495587_0028036 | 3300046536 | Bacteria | 3428 |
| 711 | Ga0495645_0001639 | 3300046543 | Bacteria | 15179 |
| 712 | Ga0495645_0005664 | 3300046543 | Bacteria | 8601 |
| 713 | Ga0495645_0074217 | 3300046543 | Bacteria | 2450 |
| 714 | Ga0495622_0010042 | 3300046557 | Bacteria | 4379 |
| 715 | Ga0495622_0130847 | 3300046557 | Bacteria | 1143 |
| 716 | Ga0495633_0011736 | 3300046558 | Bacteria | 4704 |
| 717 | Ga0495667_0005288 | 3300046559 | Bacteria | 8726 |
| 718 | Ga0495667_0011244 | 3300046559 | Bacteria | 6059 |
| 719 | Ga0495667_0031399 | 3300046559 | Bacteria | 3566 |
| 720 | Ga0495667_0040965 | 3300046559 | Bacteria | 3073 |
| 721 | Ga0495656_0001089 | 3300046615 | Bacteria | 8801 |
| 722 | Ga0495634_0016364 | 3300046642 | Bacteria | 5304 |
| 723 | Ga0495635_0000337 | 3300046663 | Bacteria | 30021 |
| 724 | Ga0495635_0007593 | 3300046663 | Bacteria | 7566 |
| 725 | Ga0495635_0035522 | 3300046663 | Bacteria | 3455 |
| 726 | Ga0495635_0036181 | 3300046663 | Bacteria | 3422 |
| 727 | Ga0495659_0001476 | 3300046664 | Bacteria | 7976 |
| 728 | Ga0495661_0007028 | 3300046665 | Bacteria | 7869 |
| 729 | Ga0495588_0013858 | 3300046674 | Bacteria | 3848 |
| 730 | Ga0495657_0001580 | 3300046675 | Bacteria | 19584 |
| 731 | Ga0495657_0030152 | 3300046675 | Bacteria | 3800 |
| 732 | Ga0495657_0207652 | 3300046675 | Bacteria | 1191 |
| 733 | Ga0495599_0018494 | 3300046678 | Bacteria | 4341 |
| 734 | Ga0495599_0019711 | 3300046678 | Bacteria | 4204 |
| 735 | Ga0495623_0000723 | 3300046679 | Bacteria | 22059 |
| 736 | Ga0495623_0078996 | 3300046679 | Bacteria | 2039 |
| 737 | Ga0495646_0002017 | 3300046680 | Bacteria | 12292 |
| 738 | Ga0495646_0028777 | 3300046680 | Bacteria | 3476 |
| 739 | Ga0495647_0016555 | 3300046681 | Bacteria | 2596 |
| 740 | Ga0495658_0000221 | 3300046683 | Bacteria | 32569 |
| 741 | Ga0495658_0038807 | 3300046683 | Bacteria | 2638 |
| 742 | Ga0495613_0112336 | 3300046689 | Bacteria | 1962 |
| 743 | Ga0495624_0041634 | 3300046690 | Bacteria | 2937 |
| 744 | Ga0495624_0066693 | 3300046690 | Bacteria | 2246 |
| 745 | Ga0495670_0001346 | 3300046691 | Bacteria | 12002 |
| 746 | Ga0495600_0000619 | 3300046809 | Bacteria | 18337 |
| 747 | Ga0495600_0000936 | 3300046809 | Bacteria | 15687 |
| 748 | Ga0495600_0004078 | 3300046809 | Bacteria | 8688 |
| 749 | Ga0495660_0105716 | 3300046810 | Bacteria | 1443 |
| 750 | Ga0495581_0014587 | 3300047315 | Bacteria | 4556 |
| 751 | Ga0495581_0028658 | 3300047315 | Bacteria | 3228 |
| 752 | Ga0495604_0008572 | 3300047317 | Bacteria | 8077 |
| 753 | Ga0495604_0009858 | 3300047317 | Bacteria | 7560 |
| 754 | Ga0495604_0023992 | 3300047317 | Bacteria | 4869 |
| 755 | Ga0495604_0037657 | 3300047317 | Bacteria | 3808 |
| 756 | Ga0495604_0110796 | 3300047317 | Bacteria | 2002 |
| 757 | Ga0495674_0001395 | 3300047319 | Bacteria | 23609 |
| 758 | Ga0495674_0010509 | 3300047319 | Bacteria | 8761 |
| 759 | Ga0495674_0303528 | 3300047319 | Bacteria | 1303 |
| 760 | Ga0495680_0002033 | 3300047322 | Bacteria | 21172 |
| 761 | Ga0495680_0007002 | 3300047322 | Bacteria | 10400 |
| 762 | Ga0495680_0019881 | 3300047322 | Bacteria | 5660 |
| 763 | Ga0495680_0024415 | 3300047322 | Bacteria | 5015 |
| 764 | Ga0495680_0026609 | 3300047322 | Bacteria | 4765 |
| 765 | Ga0495675_0000716 | 3300047444 | Bacteria | 20715 |
| 766 | Ga0495675_0190095 | 3300047444 | Bacteria | 1254 |
| 767 | Ga0495684_0008600 | 3300047471 | Bacteria | 7900 |
| 768 | Ga0495684_0095331 | 3300047471 | Bacteria | 2252 |
| 769 | Ga0495593_0020521 | 3300047673 | Bacteria | 3701 |
| 770 | Ga0495593_0023727 | 3300047673 | Bacteria | 3406 |
| 771 | Ga0495593_0036543 | 3300047673 | Bacteria | 2663 |
| 772 | Ga0495602_0010114 | 3300048088 | Bacteria | 9793 |
| 773 | Ga0495602_0025010 | 3300048088 | Bacteria | 5785 |
| 774 | Ga0495614_0049400 | 3300048089 | Bacteria | 1803 |
| 775 | Ga0495614_0115959 | 3300048089 | Bacteria | 1178 |
| 776 | Ga0496100_0001614 | 3300048903 | Bacteria | 11145 |
| 777 | Ga0496100_0002013 | 3300048903 | Bacteria | 10167 |
| 778 | Ga0496100_0005202 | 3300048903 | Bacteria | 6984 |
| 779 | Ga0496101_0002338 | 3300048904 | Bacteria | 11626 |
| 780 | Ga0496101_0006083 | 3300048904 | Bacteria | 7748 |
| 781 | Ga0496101_0121203 | 3300048904 | Bacteria | 1977 |
| 782 | Ga0496102_0009896 | 3300048905 | Bacteria | 8198 |
| 783 | Ga0496102_0070151 | 3300048905 | Bacteria | 3218 |
| 784 | Ga0496102_0076321 | 3300048905 | Bacteria | 3082 |
| 785 | Ga0496102_0230921 | 3300048905 | Bacteria | 1744 |
| 786 | Ga0496103_0001271 | 3300048906 | Bacteria | 17190 |
| 787 | Ga0496103_0159084 | 3300048906 | Bacteria | 1448 |
| 788 | Ga0496104_0013151 | 3300048907 | Bacteria | 7460 |
| 789 | Ga0496104_0120433 | 3300048907 | Bacteria | 2519 |
| 790 | Ga0496104_0240792 | 3300048907 | Bacteria | 1721 |
| 791 | Ga0496104_0398623 | 3300048907 | Bacteria | 1288 |
| 792 | Ga0496105_0001594 | 3300048908 | Bacteria | 16062 |
| 793 | Ga0496105_0036464 | 3300048908 | Bacteria | 4051 |
| 794 | Ga0496105_0089643 | 3300048908 | Bacteria | 2540 |
| 795 | Ga0496106_0004028 | 3300048909 | Bacteria | 10985 |
| 796 | Ga0496106_0045330 | 3300048909 | Bacteria | 3302 |
| 797 | Ga0496106_0090801 | 3300048909 | Bacteria | 2357 |
| 798 | Ga0496106_0140721 | 3300048909 | Bacteria | 1898 |
| 799 | Ga0496106_0149281 | 3300048909 | Bacteria | 1843 |
| 800 | Ga0496106_0160876 | 3300048909 | Bacteria | 1775 |
| 801 | Ga0496106_0363003 | 3300048909 | Bacteria | 1163 |
| 802 | Ga0496107_0006617 | 3300048910 | Bacteria | 7978 |
| 803 | Ga0496107_0020151 | 3300048910 | Bacteria | 4709 |
| 804 | Ga0496107_0062685 | 3300048910 | Bacteria | 2693 |
| 805 | Ga0496107_0150293 | 3300048910 | Bacteria | 1722 |
| 806 | Ga0496108_0000693 | 3300048911 | Bacteria | 26096 |
| 807 | Ga0496108_0005626 | 3300048911 | Bacteria | 10143 |
| 808 | Ga0496109_0006483 | 3300048912 | Bacteria | 9854 |
| 809 | Ga0496109_0007782 | 3300048912 | Bacteria | 9073 |
| 810 | Ga0496109_0017400 | 3300048912 | Bacteria | 6302 |
| 811 | Ga0496109_0061612 | 3300048912 | Bacteria | 3430 |
| 812 | Ga0496109_0091481 | 3300048912 | Bacteria | 2814 |
| 813 | Ga0496109_0172714 | 3300048912 | Bacteria | 2028 |
| 814 | Ga0496110_0001702 | 3300048913 | Bacteria | 16176 |
| 815 | Ga0496110_0002745 | 3300048913 | Bacteria | 13292 |
| 816 | Ga0496110_0051870 | 3300048913 | Bacteria | 3605 |
| 817 | Ga0496110_0090904 | 3300048913 | Bacteria | 2730 |
| 818 | Ga0496110_0093264 | 3300048913 | Bacteria | 2695 |
| 819 | Ga0496110_0141793 | 3300048913 | Bacteria | 2172 |
| 820 | Ga0496111_0004679 | 3300048914 | Bacteria | 8675 |
| 821 | Ga0496111_0142288 | 3300048914 | Bacteria | 1778 |
| 822 | Ga0496112_0001842 | 3300048915 | Bacteria | 16684 |
| 823 | Ga0496112_0099336 | 3300048915 | Bacteria | 2880 |
| 824 | Ga0496112_0255817 | 3300048915 | Bacteria | 1701 |
| 825 | Ga0496112_0258616 | 3300048915 | Bacteria | 1691 |
| 826 | Ga0496113_0009047 | 3300048916 | Bacteria | 6523 |
| 827 | Ga0496113_0039278 | 3300048916 | Bacteria | 3483 |
| 828 | Ga0496113_0071201 | 3300048916 | Bacteria | 2645 |
| 829 | Ga0496113_0198002 | 3300048916 | Bacteria | 1596 |
| 830 | Ga0496114_0002210 | 3300048917 | Bacteria | 14814 |
| 831 | Ga0496114_0047239 | 3300048917 | Bacteria | 3580 |
| 832 | Ga0496114_0053250 | 3300048917 | Bacteria | 3373 |
| 833 | Ga0496114_0415992 | 3300048917 | Bacteria | 1191 |
| 834 | Ga0496115_0005059 | 3300048918 | Bacteria | 9585 |
| 835 | Ga0496115_0042697 | 3300048918 | Bacteria | 3613 |
| 836 | Ga0496115_0052320 | 3300048918 | Bacteria | 3276 |
| 837 | Ga0496115_0151627 | 3300048918 | Bacteria | 1914 |
| 838 | Ga0496115_0206468 | 3300048918 | Bacteria | 1623 |
| 839 | Ga0496115_0268618 | 3300048918 | Bacteria | 1402 |
| 840 | Ga0496126_0446933 | 3300048929 | Bacteria | 1041 |
| 841 | Ga0501031_0008594 | 3300049568 | Bacteria | 6645 |
| 842 | Ga0501031_0170117 | 3300049568 | Bacteria | 1424 |
| 843 | Ga0501032_0033829 | 3300049569 | Bacteria | 3501 |
| 844 | Ga0501032_0050173 | 3300049569 | Bacteria | 2814 |
| 845 | Ga0501032_0190710 | 3300049569 | Bacteria | 1340 |
| 846 | Ga0501033_0008039 | 3300049570 | Bacteria | 8171 |
| 847 | Ga0501034_0000593 | 3300049571 | Bacteria | 57233 |
| 848 | Ga0501034_0003500 | 3300049571 | Bacteria | 17827 |
| 849 | Ga0501034_0013580 | 3300049571 | Bacteria | 8380 |
| 850 | Ga0501034_0038501 | 3300049571 | Bacteria | 4841 |
| 851 | Ga0501034_0057995 | 3300049571 | Bacteria | 3892 |
| 852 | Ga0501034_0122679 | 3300049571 | Bacteria | 2584 |
| 853 | Ga0501034_0351777 | 3300049571 | Bacteria | 1401 |
| 854 | Ga0501034_0426869 | 3300049571 | Bacteria | 1246 |
| 855 | Ga0501036_0009653 | 3300049572 | Bacteria | 7940 |
| 856 | Ga0501036_0012201 | 3300049572 | Bacteria | 7119 |
| 857 | Ga0501036_0092836 | 3300049572 | Bacteria | 2550 |
| 858 | Ga0501037_0010535 | 3300049573 | Bacteria | 6790 |
| 859 | Ga0501037_0012851 | 3300049573 | Bacteria | 6171 |
| 860 | Ga0501037_0046114 | 3300049573 | Bacteria | 3197 |
| 861 | Ga0501037_0047700 | 3300049573 | Bacteria | 3138 |
| 862 | Ga0501037_0049652 | 3300049573 | Bacteria | 3072 |
| 863 | Ga0501038_0008716 | 3300049574 | Bacteria | 9308 |
| 864 | Ga0501038_0054702 | 3300049574 | Bacteria | 3431 |
| 865 | Ga0501038_0055563 | 3300049574 | Bacteria | 3400 |
| 866 | Ga0501038_0086495 | 3300049574 | Bacteria | 2633 |
| 867 | Ga0501038_0171469 | 3300049574 | Bacteria | 1756 |
| 868 | Ga0501038_0212993 | 3300049574 | Bacteria | 1545 |
| 869 | Ga0501038_0215001 | 3300049574 | Bacteria | 1536 |
| 870 | Ga0501039_0016524 | 3300049575 | Bacteria | 5652 |
| 871 | Ga0501040_0151938 | 3300049576 | Bacteria | 1634 |
| 872 | Ga0501041_0032275 | 3300049577 | Bacteria | 3165 |
| 873 | Ga0501042_0225216 | 3300049578 | Bacteria | 1353 |
| 874 | Ga0501043_0005751 | 3300049579 | Bacteria | 9990 |
| 875 | Ga0501043_0008613 | 3300049579 | Bacteria | 8038 |
| 876 | Ga0501043_0127088 | 3300049579 | Bacteria | 1999 |
| 877 | Ga0501043_0383726 | 3300049579 | Bacteria | 1063 |
| 878 | Ga0501046_0027172 | 3300049580 | Bacteria | 4672 |
| 879 | Ga0501046_0153731 | 3300049580 | Bacteria | 1735 |
| 880 | Ga0501047_0010766 | 3300049581 | Bacteria | 8644 |
| 881 | Ga0501047_0019566 | 3300049581 | Bacteria | 6495 |
| 882 | Ga0501047_0079851 | 3300049581 | Bacteria | 3145 |
| 883 | Ga0501047_0094930 | 3300049581 | Bacteria | 2861 |
| 884 | Ga0501047_0220107 | 3300049581 | Bacteria | 1755 |
| 885 | Ga0501047_0236914 | 3300049581 | Bacteria | 1677 |
| 886 | Ga0501047_0366331 | 3300049581 | Bacteria | 1276 |
| 887 | Ga0501048_0005729 | 3300049582 | Bacteria | 9442 |
| 888 | Ga0501048_0287479 | 3300049582 | Bacteria | 1169 |
| 889 | Ga0501067_0006118 | 3300049583 | Bacteria | 6673 |
| 890 | Ga0501067_0057298 | 3300049583 | Bacteria | 2158 |
| 891 | Ga0501068_0005466 | 3300049584 | Bacteria | 6958 |
| 892 | Ga0501068_0061389 | 3300049584 | Bacteria | 2284 |
| 893 | Ga0501068_0117101 | 3300049584 | Bacteria | 1659 |
| 894 | Ga0501069_0011787 | 3300049585 | Bacteria | 4636 |
| 895 | Ga0501069_0137945 | 3300049585 | Bacteria | 1398 |
| 896 | Ga0501069_0212107 | 3300049585 | Bacteria | 1124 |
| 897 | Ga0501070_0017280 | 3300049586 | Bacteria | 6057 |
| 898 | Ga0501070_0039667 | 3300049586 | Bacteria | 3926 |
| 899 | Ga0501070_0048612 | 3300049586 | Bacteria | 3522 |
| 900 | Ga0501070_0055929 | 3300049586 | Bacteria | 3271 |
| 901 | Ga0501070_0097662 | 3300049586 | Bacteria | 2429 |
| 902 | Ga0501070_0116611 | 3300049586 | Bacteria | 2205 |
| 903 | Ga0501070_0241723 | 3300049586 | Bacteria | 1478 |
| 904 | Ga0501070_0260795 | 3300049586 | Bacteria | 1416 |
| 905 | Ga0501071_0011718 | 3300049587 | Bacteria | 5917 |
| 906 | Ga0501071_0033606 | 3300049587 | Bacteria | 3644 |
| 907 | Ga0501071_0092462 | 3300049587 | Bacteria | 2223 |
| 908 | Ga0501073_0010149 | 3300049589 | Bacteria | 6919 |
| 909 | Ga0501073_0079612 | 3300049589 | Bacteria | 2280 |
| 910 | Ga0501073_0082127 | 3300049589 | Bacteria | 2241 |
| 911 | Ga0501073_0138779 | 3300049589 | Bacteria | 1684 |
| 912 | Ga0501073_0235968 | 3300049589 | Bacteria | 1263 |
| 913 | Ga0501073_0301621 | 3300049589 | Bacteria | 1105 |
| 914 | Ga0501073_0304516 | 3300049589 | Bacteria | 1099 |
| 915 | Ga0501074_0009969 | 3300049590 | Bacteria | 6901 |
| 916 | Ga0501074_0025531 | 3300049590 | Bacteria | 4289 |
| 917 | Ga0501074_0072194 | 3300049590 | Bacteria | 2480 |
| 918 | Ga0501074_0333346 | 3300049590 | Bacteria | 1077 |
| 919 | Ga0501076_0037021 | 3300049592 | Bacteria | 3824 |
| 920 | Ga0501079_0122851 | 3300049741 | Bacteria | 2019 |
| 921 | Ga0501079_0132194 | 3300049741 | Bacteria | 1942 |
| 922 | Ga0501080_0000953 | 3300049742 | Bacteria | 23696 |
| 923 | Ga0501080_0027894 | 3300049742 | Bacteria | 5250 |
| 924 | Ga0501080_0041071 | 3300049742 | Bacteria | 4312 |
| 925 | Ga0501080_0042019 | 3300049742 | Bacteria | 4259 |
| 926 | Ga0501080_0043365 | 3300049742 | Bacteria | 4189 |
| 927 | Ga0501080_0139005 | 3300049742 | Bacteria | 2246 |
| 928 | Ga0501080_0236398 | 3300049742 | Bacteria | 1669 |
| 929 | Ga0501083_0001052 | 3300049744 | Bacteria | 18390 |
| 930 | Ga0501083_0018436 | 3300049744 | Bacteria | 4864 |
| 931 | Ga0501083_0031534 | 3300049744 | Bacteria | 3638 |
| 932 | Ga0501083_0262086 | 3300049744 | Bacteria | 1124 |
| 933 | Ga0501035_0000745 | 3300049822 | Bacteria | 35086 |
| 934 | Ga0501035_0043901 | 3300049822 | Bacteria | 4027 |
| 935 | Ga0501035_0066829 | 3300049822 | Bacteria | 3190 |
| 936 | Ga0501035_0081308 | 3300049822 | Bacteria | 2859 |
| 937 | Ga0501035_0143535 | 3300049822 | Bacteria | 2074 |
| 938 | Ga0501044_0016146 | 3300049823 | Bacteria | 8026 |
| 939 | Ga0501044_0052404 | 3300049823 | Bacteria | 4204 |
| 940 | Ga0501044_0062443 | 3300049823 | Bacteria | 3808 |
| 941 | Ga0501044_0068690 | 3300049823 | Bacteria | 3609 |
| 942 | Ga0501044_0092338 | 3300049823 | Bacteria | 3053 |
| 943 | Ga0501044_0185224 | 3300049823 | Bacteria | 2047 |
| 944 | Ga0501044_0249781 | 3300049823 | Bacteria | 1715 |
| 945 | Ga0501044_0352224 | 3300049823 | Bacteria | 1392 |
| 946 | Ga0501045_0079364 | 3300049824 | Bacteria | 2420 |
| 947 | Ga0501045_0112175 | 3300049824 | Bacteria | 2022 |
| 948 | Ga0501045_0128437 | 3300049824 | Bacteria | 1884 |
| 949 | nmdc:mga03n38_53175_c1 | 3300050490 | Bacteria | 1815 |
| 950 | nmdc:mga0yw44_4808_c1 | 3300050492 | Bacteria | 6266 |
| 951 | nmdc:mga06z11_33586_c1 | 3300050494 | Bacteria | 2511 |
| 952 | nmdc:mga06z11_8879_c1 | 3300050494 | Bacteria | 4213 |
| 953 | nmdc:mga07m45_25315_c1 | 3300050496 | Bacteria | 3254 |
| 954 | nmdc:mga05p37_117053_c1 | 3300050507 | Bacteria | 3275 |
| 955 | nmdc:mga05p37_1375_c1 | 3300050507 | Bacteria | 28284 |
| 956 | nmdc:mga09592_4676_c1 | 3300050508 | Bacteria | 11079 |
| 957 | nmdc:mga0qj67_959_c1 | 3300050509 | Bacteria | 19847 |
| 958 | nmdc:mga06r32_167782_c1 | 3300050510 | Bacteria | 2178 |
| 959 | nmdc:mga06r32_40373_c1 | 3300050510 | Bacteria | 4429 |
| 960 | nmdc:mga06r32_592_c1 | 3300050510 | Bacteria | 31540 |
| 961 | nmdc:mga08y16_108_c1 | 3300050511 | Bacteria | 69804 |
| 962 | nmdc:mga08y16_19155_c1 | 3300050511 | Bacteria | 7212 |
| 963 | nmdc:mga08y16_4119_c1 | 3300050511 | Bacteria | 15172 |
| 964 | nmdc:mga08y16_447745_c1 | 3300050511 | Bacteria | 1317 |
| 965 | nmdc:mga08y16_568_c1 | 3300050511 | Bacteria | 34301 |
| 966 | nmdc:mga0n895_104_c1 | 3300050512 | Bacteria | 49584 |
| 967 | nmdc:mga0n895_148662_c1 | 3300050512 | Bacteria | 2372 |
| 968 | nmdc:mga0n895_337_c1 | 3300050512 | Bacteria | 31380 |
| 969 | nmdc:mga0n895_436576_c1 | 3300050512 | Bacteria | 1323 |
| 970 | nmdc:mga0n895_57644_c1 | 3300050512 | Bacteria | 3829 |
| 971 | nmdc:mga0n895_84342_c1 | 3300050512 | Bacteria | 3170 |
| 972 | nmdc:mga0rr50_1110_c1 | 3300050513 | Bacteria | 14607 |
| 973 | nmdc:mga0rr50_17098_c1 | 3300050513 | Bacteria | 4832 |
| 974 | nmdc:mga0rr50_340097_c1 | 3300050513 | Bacteria | 1261 |
| 975 | nmdc:mga08x19_6_c1 | 3300050514 | Bacteria | 405679 |
| 976 | nmdc:mga08x19_95882_c1 | 3300050514 | Bacteria | 1963 |
| 977 | nmdc:mga0a205_2128_c1 | 3300050515 | Bacteria | 17383 |
| 978 | nmdc:mga0a205_2355_c2 | 3300050515 | Bacteria | 7021 |
| 979 | nmdc:mga0a205_492444_c1 | 3300050515 | Bacteria | 1083 |
| 980 | Ga0495601_0000280 | 3300053077 | Bacteria | 27384 |
| 981 | Ga0495601_0001337 | 3300053077 | Bacteria | 13545 |
| 982 | Ga0495601_0015893 | 3300053077 | Bacteria | 4554 |
| 983 | Ga0495601_0017450 | 3300053077 | Bacteria | 4357 |
| 984 | Ga0495601_0074515 | 3300053077 | Bacteria | 2171 |
| 985 | Ga0495612_0000501 | 3300053078 | Bacteria | 15645 |
| 986 | Ga0495612_0010034 | 3300053078 | Bacteria | 3832 |
| 987 | Ga0495612_0010083 | 3300053078 | Bacteria | 3821 |
| 988 | Ga0495612_0012382 | 3300053078 | Bacteria | 3438 |
| 989 | Ga0495612_0030723 | 3300053078 | Bacteria | 2164 |
| 990 | Ga0495595_0000612 | 3300053084 | Bacteria | 13580 |
| 991 | Ga0495595_0002010 | 3300053084 | Bacteria | 7899 |
| 992 | Ga0495595_0003562 | 3300053084 | Bacteria | 6182 |
| 993 | Ga0495595_0009498 | 3300053084 | Bacteria | 4025 |
| 994 | Ga0495619_0000048 | 3300053085 | Bacteria | 102117 |
| 995 | Ga0495619_0000314 | 3300053085 | Bacteria | 33926 |
| 996 | Ga0495619_0000459 | 3300053085 | Bacteria | 27482 |
| 997 | Ga0495619_0002080 | 3300053085 | Bacteria | 13304 |
| 998 | Ga0495619_0002348 | 3300053085 | Bacteria | 12455 |
| 999 | Ga0495619_0028684 | 3300053085 | Bacteria | 3591 |
| 1000 | Ga0495619_0127919 | 3300053085 | Bacteria | 1744 |
| 1001 | Ga0500643_005961 | 3300053087 | Bacteria | 5165 |
| 1002 | Ga0500651_0074070 | 3300053093 | Bacteria | 2116 |
| 1003 | Ga0500566_0058957 | 3300053094 | Bacteria | 2178 |
| 1004 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 1005 | Ga0500595_050791 | 3300053119 | Bacteria | 1286 |
| 1006 | Ga0500652_000010 | 3300053131 | Bacteria | 162810 |
| 1007 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1008 | Ga0500645_000217 | 3300053730 | Bacteria | 43911 |
| 1009 | Ga0501084_0045310 | 3300054114 | Bacteria | 3683 |
| 1010 | Ga0501084_0407720 | 3300054114 | Bacteria | 1149 |
| 1011 | Ga0501082_0004160 | 3300060353 | Bacteria | 12646 |
| 1012 | Ga0501082_0120968 | 3300060353 | Bacteria | 2269 |
| 1013 | Ga0501082_0226016 | 3300060353 | Bacteria | 1629 |
| 1014 | Ga0501082_0382965 | 3300060353 | Bacteria | 1227 |
| 1015 | Ga0530510_0284098 | 3300061734 | Bacteria | 1236 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041496 | Ga0451839_1410856 | Ga0451839_1410856_56_931 | 279 |
| 2 | 3300003203 | JGI25406J46586_10032468 | JGI25406J46586_100324682 | 281 |
| 3 | 3300005985 | Ga0081539_10000115 | Ga0081539_100001152 | 281 |
| 4 | 3300009147 | Ga0114129_10196053 | Ga0114129_101960532 | 281 |
| 5 | 3300039437 | Ga0436365_1389092 | Ga0436365_1389092_1424_2404 | 281 |
| 6 | 3300050510 | nmdc:mga06r32_40373_c1 | nmdc:mga06r32_40373_c1_3331_4344 | 281 |
| 7 | 3300025905 | Ga0207685_10135589 | Ga0207685_101355892 | 282 |
| 8 | 3300006173 | Ga0070716_100221113 | Ga0070716_1002211132 | 283 |
| 9 | 3300048929 | Ga0496126_0446933 | Ga0496126_0446933_141_1028 | 286 |
| 10 | 3300005458 | Ga0070681_10003089 | Ga0070681_1000308914 | 287 |
| 11 | 3300009148 | Ga0105243_10173381 | Ga0105243_101733811 | 287 |
| 12 | 3300025912 | Ga0207707_10032559 | Ga0207707_100325593 | 287 |
| 13 | 3300037853 | Ga0436364_0326872 | Ga0436364_0326872_71_1036 | 288 |
| 14 | 3300025942 | Ga0207689_10116082 | Ga0207689_101160822 | 289 |
| 15 | 3300027907 | Ga0207428_10000096 | Ga0207428_10000096111 | 289 |
| 16 | 3300050511 | nmdc:mga08y16_568_c1 | nmdc:mga08y16_568_c1_16310_17314 | 289 |
| 17 | 3300005458 | Ga0070681_10118248 | Ga0070681_101182483 | 291 |
| 18 | 3300005985 | Ga0081539_10001357 | Ga0081539_1000135715 | 291 |
| 19 | 3300025921 | Ga0207652_10335470 | Ga0207652_103354702 | 291 |
| 20 | 3300009176 | Ga0105242_10213004 | Ga0105242_102130042 | 292 |
| 21 | 3300031249 | Ga0265339_10081188 | Ga0265339_100811882 | 292 |
| 22 | 3300031251 | Ga0265327_10021801 | Ga0265327_100218012 | 292 |
| 23 | 3300031344 | Ga0265316_10107177 | Ga0265316_101071772 | 292 |
| 24 | 3300050490 | nmdc:mga03n38_53175_c1 | nmdc:mga03n38_53175_c1_782_1741 | 292 |
| 25 | 3300049742 | Ga0501080_0042019 | Ga0501080_0042019_2552_3526 | 293 |
| 26 | 3300028556 | Ga0265337_1000796 | Ga0265337_10007967 | 294 |
| 27 | 3300028573 | Ga0265334_10017368 | Ga0265334_100173682 | 294 |
| 28 | 3300003203 | JGI25406J46586_10017341 | JGI25406J46586_100173413 | 295 |
| 29 | iso_pu_bacteria | 2842775625 | 2842776261 | 295 |
| 30 | 3300005329 | Ga0070683_100075385 | Ga0070683_1000753852 | 296 |
| 31 | 3300009551 | Ga0105238_10070748 | Ga0105238_100707482 | 296 |
| 32 | 3300013307 | Ga0157372_10084628 | Ga0157372_100846284 | 296 |
| 33 | 3300025924 | Ga0207694_10049888 | Ga0207694_100498882 | 296 |
| 34 | 3300025944 | Ga0207661_10119353 | Ga0207661_101193531 | 296 |
| 35 | 3300039437 | Ga0436365_0858460 | Ga0436365_0858460_462_1433 | 296 |
| 36 | 3300048918 | Ga0496115_0268618 | Ga0496115_0268618_100_1071 | 296 |
| 37 | 3300005458 | Ga0070681_10096066 | Ga0070681_100960663 | 297 |
| 38 | 3300021384 | Ga0213876_10000046 | Ga0213876_1000004637 | 297 |
| 39 | 3300022467 | Ga0224712_10007388 | Ga0224712_100073882 | 297 |
| 40 | 3300025912 | Ga0207707_10075788 | Ga0207707_100757882 | 297 |
| 41 | 3300025918 | Ga0207662_10224241 | Ga0207662_102242411 | 297 |
| 42 | 3300039437 | Ga0436365_1658434 | Ga0436365_1658434_23456_24442 | 297 |
| 43 | 3300039437 | Ga0436365_1061189 | Ga0436365_1061189_2823_3782 | 298 |
| 44 | 3300049744 | Ga0501083_0018436 | Ga0501083_0018436_2740_3708 | 298 |
| 45 | 3300031711 | Ga0265314_10016519 | Ga0265314_100165194 | 299 |
| 46 | 3300039450 | Ga0436363_1390095 | Ga0436363_1390095_260_1237 | 299 |
| 47 | 3300005518 | Ga0070699_100010837 | Ga0070699_1000108375 | 300 |
| 48 | 3300025292 | Ga0209676_1000089 | Ga0209676_1000089232 | 300 |
| 49 | 3300025298 | Ga0209050_1008351 | Ga0209050_10083515 | 300 |
| 50 | 3300014745 | Ga0157377_10213289 | Ga0157377_102132891 | 301 |
| 51 | 3300025937 | Ga0207669_10044660 | Ga0207669_100446601 | 301 |
| 52 | 3300031247 | Ga0265340_10008715 | Ga0265340_100087152 | 301 |
| 53 | 3300037466 | Ga0395898_0136879 | Ga0395898_0136879_743_1708 | 301 |
| 54 | 3300039438 | Ga0436360_1260651 | Ga0436360_1260651_612_1586 | 301 |
| 55 | 3300039450 | Ga0436363_0532621 | Ga0436363_0532621_2574_3626 | 301 |
| 56 | 3300047444 | Ga0495675_0190095 | Ga0495675_0190095_132_1103 | 301 |
| 57 | 3300005355 | Ga0070671_100205454 | Ga0070671_1002054542 | 302 |
| 58 | 3300005365 | Ga0070688_100077346 | Ga0070688_1000773462 | 302 |
| 59 | 3300005564 | Ga0070664_100471296 | Ga0070664_1004712961 | 302 |
| 60 | 3300005617 | Ga0068859_100126913 | Ga0068859_1001269131 | 302 |
| 61 | 3300005718 | Ga0068866_10175450 | Ga0068866_101754501 | 302 |
| 62 | 3300005843 | Ga0068860_100339213 | Ga0068860_1003392132 | 302 |
| 63 | 3300005981 | Ga0081538_10005636 | Ga0081538_100056364 | 302 |
| 64 | 3300006931 | Ga0097620_100126907 | Ga0097620_1001269071 | 302 |
| 65 | 3300009177 | Ga0105248_10640719 | Ga0105248_106407191 | 302 |
| 66 | 3300025315 | Ga0207697_10033038 | Ga0207697_100330382 | 302 |
| 67 | 3300025931 | Ga0207644_10059673 | Ga0207644_100596732 | 302 |
| 68 | 3300025936 | Ga0207670_10008819 | Ga0207670_100088195 | 302 |
| 69 | 3300026095 | Ga0207676_10024007 | Ga0207676_100240073 | 302 |
| 70 | 3300028381 | Ga0268264_10248040 | Ga0268264_102480401 | 302 |
| 71 | 3300035691 | Ga0373931_0021545 | Ga0373931_0021545_1743_2711 | 302 |
| 72 | 3300044901 | Ga0466960_0051950 | Ga0466960_0051950_593_1537 | 302 |
| 73 | 3300009094 | Ga0111539_10080586 | Ga0111539_100805864 | 303 |
| 74 | 3300026118 | Ga0207675_100041675 | Ga0207675_1000416753 | 303 |
| 75 | 3300032002 | Ga0307416_100236268 | Ga0307416_1002362682 | 303 |
| 76 | 3300006847 | Ga0075431_100009808 | Ga0075431_1000098085 | 304 |
| 77 | 3300036401 | Ga0373937_0106442 | Ga0373937_0106442_595_1557 | 304 |
| 78 | 3300049571 | Ga0501034_0122679 | Ga0501034_0122679_1032_1985 | 304 |
| 79 | iso_pu_bacteria | 2842694124 | 2842695407 | 304 |
| 80 | 3300039438 | Ga0436360_0547038 | Ga0436360_0547038_560_1522 | 305 |
| 81 | 3300046522 | Ga0495643_0054324 | Ga0495643_0054324_745_1701 | 305 |
| 82 | 3300049583 | Ga0501067_0006118 | Ga0501067_0006118_1475_2449 | 305 |
| 83 | 3300054114 | Ga0501084_0045310 | Ga0501084_0045310_1625_2599 | 305 |
| 84 | iso_pu_bacteria | 2883291878 | 2883292898 | 305 |
| 85 | iso_pu_bacteria | 2917554339 | 2917556729 | 305 |
| 86 | 3300005355 | Ga0070671_100135757 | Ga0070671_1001357572 | 306 |
| 87 | 3300009993 | Ga0105028_101643 | Ga0105028_1016432 | 306 |
| 88 | 3300031249 | Ga0265339_10002069 | Ga0265339_100020694 | 306 |
| 89 | 3300031595 | Ga0265313_10001505 | Ga0265313_1000150515 | 306 |
| 90 | 3300031712 | Ga0265342_10002243 | Ga0265342_100022439 | 306 |
| 91 | 3300031727 | Ga0316576_10163537 | Ga0316576_101635372 | 306 |
| 92 | 3300036712 | Ga0316584_0033354 | Ga0316584_0033354_468_1442 | 306 |
| 93 | 3300037068 | Ga0373925_0064177 | Ga0373925_0064177_1326_2288 | 306 |
| 94 | 3300039062 | Ga0400483_019258 | Ga0400483_019258_6461_7435 | 306 |
| 95 | 3300039062 | Ga0400483_118863 | Ga0400483_118863_159_1133 | 306 |
| 96 | 3300039062 | Ga0400483_179075 | Ga0400483_179075_381_1355 | 306 |
| 97 | 3300039062 | Ga0400483_199061 | Ga0400483_199061_4427_5461 | 306 |
| 98 | 3300039437 | Ga0436365_1136139 | Ga0436365_1136139_160_1125 | 306 |
| 99 | 3300049569 | Ga0501032_0190710 | Ga0501032_0190710_231_1202 | 306 |
| 100 | 3300049581 | Ga0501047_0366331 | Ga0501047_0366331_236_1207 | 306 |
| 101 | 3300049589 | Ga0501073_0079612 | Ga0501073_0079612_629_1600 | 306 |
| 102 | 3300049589 | Ga0501073_0082127 | Ga0501073_0082127_1059_2024 | 306 |
| 103 | 3300049741 | Ga0501079_0132194 | Ga0501079_0132194_604_1575 | 306 |
| 104 | 3300049744 | Ga0501083_0031534 | Ga0501083_0031534_1392_2363 | 306 |
| 105 | 3300049823 | Ga0501044_0249781 | Ga0501044_0249781_509_1480 | 306 |
| 106 | 3300060353 | Ga0501082_0004160 | Ga0501082_0004160_67_1038 | 306 |
| 107 | 3300005329 | Ga0070683_100077513 | Ga0070683_1000775132 | 307 |
| 108 | 3300005467 | Ga0070706_100314634 | Ga0070706_1003146341 | 307 |
| 109 | 3300005468 | Ga0070707_100019827 | Ga0070707_1000198273 | 307 |
| 110 | 3300005535 | Ga0070684_100078438 | Ga0070684_1000784383 | 307 |
| 111 | 3300005536 | Ga0070697_100000922 | Ga0070697_10000092216 | 307 |
| 112 | 3300005614 | Ga0068856_100108184 | Ga0068856_1001081842 | 307 |
| 113 | 3300005614 | Ga0068856_100415741 | Ga0068856_1004157412 | 307 |
| 114 | 3300005841 | Ga0068863_100607235 | Ga0068863_1006072351 | 307 |
| 115 | 3300006871 | Ga0075434_100018131 | Ga0075434_1000181314 | 307 |
| 116 | 3300009147 | Ga0114129_10004108 | Ga0114129_1000410816 | 307 |
| 117 | 3300021388 | Ga0213875_10001127 | Ga0213875_1000112717 | 307 |
| 118 | 3300022467 | Ga0224712_10117528 | Ga0224712_101175281 | 307 |
| 119 | 3300025906 | Ga0207699_10078156 | Ga0207699_100781562 | 307 |
| 120 | 3300025915 | Ga0207693_10000460 | Ga0207693_100004603 | 307 |
| 121 | 3300025922 | Ga0207646_10005518 | Ga0207646_100055186 | 307 |
| 122 | 3300025928 | Ga0207700_10015075 | Ga0207700_100150752 | 307 |
| 123 | 3300025929 | Ga0207664_10068431 | Ga0207664_100684313 | 307 |
| 124 | 3300025939 | Ga0207665_10014670 | Ga0207665_100146702 | 307 |
| 125 | 3300025939 | Ga0207665_10090953 | Ga0207665_100909532 | 307 |
| 126 | 3300025944 | Ga0207661_10543156 | Ga0207661_105431561 | 307 |
| 127 | 3300026035 | Ga0207703_10254754 | Ga0207703_102547542 | 307 |
| 128 | 3300026078 | Ga0207702_10174970 | Ga0207702_101749702 | 307 |
| 129 | 3300026095 | Ga0207676_10281156 | Ga0207676_102811562 | 307 |
| 130 | 3300031247 | Ga0265340_10018445 | Ga0265340_100184452 | 307 |
| 131 | 3300037853 | Ga0436364_0022735 | Ga0436364_0022735_144476_145441 | 307 |
| 132 | 3300039062 | Ga0400483_136500 | Ga0400483_136500_2964_3953 | 307 |
| 133 | 3300039062 | Ga0400483_220307 | Ga0400483_220307_4879_5868 | 307 |
| 134 | 3300039437 | Ga0436365_1708732 | Ga0436365_1708732_1041_1994 | 307 |
| 135 | 3300048909 | Ga0496106_0160876 | Ga0496106_0160876_745_1716 | 307 |
| 136 | 3300048912 | Ga0496109_0091481 | Ga0496109_0091481_939_1910 | 307 |
| 137 | 3300048913 | Ga0496110_0093264 | Ga0496110_0093264_988_1953 | 307 |
| 138 | 3300049572 | Ga0501036_0092836 | Ga0501036_0092836_1023_2000 | 307 |
| 139 | 3300049574 | Ga0501038_0171469 | Ga0501038_0171469_393_1370 | 307 |
| 140 | 3300049576 | Ga0501040_0151938 | Ga0501040_0151938_417_1394 | 307 |
| 141 | 3300049577 | Ga0501041_0032275 | Ga0501041_0032275_219_1196 | 307 |
| 142 | 3300049580 | Ga0501046_0027172 | Ga0501046_0027172_3061_4038 | 307 |
| 143 | 3300049584 | Ga0501068_0061389 | Ga0501068_0061389_347_1324 | 307 |
| 144 | 3300049587 | Ga0501071_0092462 | Ga0501071_0092462_497_1474 | 307 |
| 145 | 3300049592 | Ga0501076_0037021 | Ga0501076_0037021_2571_3548 | 307 |
| 146 | 3300049741 | Ga0501079_0122851 | Ga0501079_0122851_219_1196 | 307 |
| 147 | 3300049742 | Ga0501080_0236398 | Ga0501080_0236398_603_1580 | 307 |
| 148 | 3300050512 | nmdc:mga0n895_57644_c1 | nmdc:mga0n895_57644_c1_1189_2208 | 307 |
| 149 | 3300050513 | nmdc:mga0rr50_340097_c1 | nmdc:mga0rr50_340097_c1_289_1242 | 307 |
| 150 | 3300050514 | nmdc:mga08x19_6_c1 | nmdc:mga08x19_6_c1_31469_32422 | 307 |
| 151 | 3300060353 | Ga0501082_0382965 | Ga0501082_0382965_110_1087 | 307 |
| 152 | 3300032004 | Ga0307414_10011115 | Ga0307414_100111153 | 308 |
| 153 | 3300035119 | Ga0373956_0104901 | Ga0373956_0104901_101_1135 | 308 |
| 154 | 3300039437 | Ga0436365_1437456 | Ga0436365_1437456_65_1033 | 308 |
| 155 | 3300046454 | Ga0495592_0129180 | Ga0495592_0129180_576_1610 | 308 |
| 156 | 3300046514 | Ga0495618_0065214 | Ga0495618_0065214_910_1944 | 308 |
| 157 | 3300046559 | Ga0495667_0011244 | Ga0495667_0011244_4701_5735 | 308 |
| 158 | 3300049589 | Ga0501073_0304516 | Ga0501073_0304516_15_1007 | 308 |
| 159 | 3300049823 | Ga0501044_0092338 | Ga0501044_0092338_1388_2380 | 308 |
| 160 | 3300053077 | Ga0495601_0017450 | Ga0495601_0017450_906_1940 | 308 |
| 161 | 3300054114 | Ga0501084_0407720 | Ga0501084_0407720_151_1119 | 308 |
| 162 | 3300005340 | Ga0070689_100106691 | Ga0070689_1001066911 | 309 |
| 163 | 3300005468 | Ga0070707_100068982 | Ga0070707_1000689821 | 309 |
| 164 | 3300005471 | Ga0070698_100002604 | Ga0070698_10000260410 | 309 |
| 165 | 3300005518 | Ga0070699_100399696 | Ga0070699_1003996962 | 309 |
| 166 | 3300005937 | Ga0081455_10356718 | Ga0081455_103567181 | 309 |
| 167 | 3300005985 | Ga0081539_10015315 | Ga0081539_100153152 | 309 |
| 168 | 3300006028 | Ga0070717_10000230 | Ga0070717_1000023026 | 309 |
| 169 | 3300021358 | Ga0213873_10020551 | Ga0213873_100205512 | 309 |
| 170 | 3300025922 | Ga0207646_10457608 | Ga0207646_104576081 | 309 |
| 171 | 3300025936 | Ga0207670_10296777 | Ga0207670_102967771 | 309 |
| 172 | 3300031665 | Ga0316575_10018835 | Ga0316575_100188351 | 309 |
| 173 | 3300032133 | Ga0316583_10000092 | Ga0316583_1000009216 | 309 |
| 174 | 3300035112 | Ga0373932_0019013 | Ga0373932_0019013_704_1711 | 309 |
| 175 | 3300036647 | Ga0316582_0168321 | Ga0316582_0168321_347_1315 | 309 |
| 176 | 3300037853 | Ga0436364_1355609 | Ga0436364_1355609_6821_7804 | 309 |
| 177 | 3300039447 | Ga0436361_0128609 | Ga0436361_0128609_110_1072 | 309 |
| 178 | 3300039447 | Ga0436361_0673711 | Ga0436361_0673711_299_1261 | 309 |
| 179 | 3300049581 | Ga0501047_0220107 | Ga0501047_0220107_613_1605 | 309 |
| 180 | 3300005937 | Ga0081455_10138904 | Ga0081455_101389043 | 310 |
| 181 | 3300031241 | Ga0265325_10000305 | Ga0265325_1000030524 | 310 |
| 182 | 3300044694 | Ga0466963_0051199 | Ga0466963_0051199_1157_2110 | 310 |
| 183 | 3300049585 | Ga0501069_0011787 | Ga0501069_0011787_1048_2025 | 311 |
| 184 | 3300049585 | Ga0501069_0137945 | Ga0501069_0137945_149_1126 | 311 |
| 185 | 3300049586 | Ga0501070_0017280 | Ga0501070_0017280_2176_3153 | 311 |
| 186 | 3300049586 | Ga0501070_0039667 | Ga0501070_0039667_2522_3499 | 311 |
| 187 | 3300049590 | Ga0501074_0072194 | Ga0501074_0072194_793_1770 | 311 |
| 188 | 3300049742 | Ga0501080_0041071 | Ga0501080_0041071_2941_3918 | 311 |
| 189 | 3300049742 | Ga0501080_0043365 | Ga0501080_0043365_1536_2513 | 311 |
| 190 | 3300049822 | Ga0501035_0000745 | Ga0501035_0000745_16734_17711 | 311 |
| 191 | 3300050494 | nmdc:mga06z11_33586_c1 | nmdc:mga06z11_33586_c1_1439_2398 | 311 |
| 192 | 3300005338 | Ga0068868_100076695 | Ga0068868_1000766953 | 312 |
| 193 | 3300005434 | Ga0070709_10003295 | Ga0070709_100032959 | 312 |
| 194 | 3300005435 | Ga0070714_100006005 | Ga0070714_1000060054 | 312 |
| 195 | 3300005435 | Ga0070714_100156314 | Ga0070714_1001563142 | 312 |
| 196 | 3300005436 | Ga0070713_100005513 | Ga0070713_1000055137 | 312 |
| 197 | 3300005436 | Ga0070713_100271396 | Ga0070713_1002713962 | 312 |
| 198 | 3300005439 | Ga0070711_100067897 | Ga0070711_1000678972 | 312 |
| 199 | 3300005439 | Ga0070711_100228706 | Ga0070711_1002287062 | 312 |
| 200 | 3300005468 | Ga0070707_100169398 | Ga0070707_1001693982 | 312 |
| 201 | 3300005546 | Ga0070696_100293152 | Ga0070696_1002931521 | 312 |
| 202 | 3300005842 | Ga0068858_100136544 | Ga0068858_1001365442 | 312 |
| 203 | 3300005981 | Ga0081538_10026613 | Ga0081538_100266134 | 312 |
| 204 | 3300006038 | Ga0075365_10001374 | Ga0075365_100013747 | 312 |
| 205 | 3300006163 | Ga0070715_10005041 | Ga0070715_100050414 | 312 |
| 206 | 3300006173 | Ga0070716_100014532 | Ga0070716_1000145322 | 312 |
| 207 | 3300006175 | Ga0070712_100000431 | Ga0070712_10000043123 | 312 |
| 208 | 3300006175 | Ga0070712_100120327 | Ga0070712_1001203272 | 312 |
| 209 | 3300006237 | Ga0097621_100082967 | Ga0097621_1000829672 | 312 |
| 210 | 3300006358 | Ga0068871_100255427 | Ga0068871_1002554271 | 312 |
| 211 | 3300006844 | Ga0075428_100065761 | Ga0075428_1000657616 | 312 |
| 212 | 3300006871 | Ga0075434_100047122 | Ga0075434_1000471223 | 312 |
| 213 | 3300006871 | Ga0075434_100140061 | Ga0075434_1001400613 | 312 |
| 214 | 3300007076 | Ga0075435_100069473 | Ga0075435_1000694732 | 312 |
| 215 | 3300007265 | Ga0099794_10021200 | Ga0099794_100212003 | 312 |
| 216 | 3300009098 | Ga0105245_10005575 | Ga0105245_100055759 | 312 |
| 217 | 3300013306 | Ga0163162_10372966 | Ga0163162_103729662 | 312 |
| 218 | 3300025903 | Ga0207680_10116073 | Ga0207680_101160732 | 312 |
| 219 | 3300025906 | Ga0207699_10029344 | Ga0207699_100293442 | 312 |
| 220 | 3300025910 | Ga0207684_10049512 | Ga0207684_100495122 | 312 |
| 221 | 3300025915 | Ga0207693_10001247 | Ga0207693_100012473 | 312 |
| 222 | 3300025915 | Ga0207693_10008813 | Ga0207693_100088134 | 312 |
| 223 | 3300025915 | Ga0207693_10136257 | Ga0207693_101362572 | 312 |
| 224 | 3300025916 | Ga0207663_10055510 | Ga0207663_100555102 | 312 |
| 225 | 3300025927 | Ga0207687_10016909 | Ga0207687_100169093 | 312 |
| 226 | 3300025928 | Ga0207700_10002145 | Ga0207700_100021457 | 312 |
| 227 | 3300025929 | Ga0207664_10011719 | Ga0207664_100117196 | 312 |
| 228 | 3300025929 | Ga0207664_10082275 | Ga0207664_100822752 | 312 |
| 229 | 3300025939 | Ga0207665_10005925 | Ga0207665_100059252 | 312 |
| 230 | 3300026035 | Ga0207703_10040655 | Ga0207703_100406552 | 312 |
| 231 | 3300035695 | Ga0373927_0048155 | Ga0373927_0048155_1550_2515 | 312 |
| 232 | 3300039447 | Ga0436361_0546261 | Ga0436361_0546261_5734_6717 | 312 |
| 233 | 3300045976 | Ga0466967_0210469 | Ga0466967_0210469_498_1457 | 312 |
| 234 | 3300046459 | Ga0495629_0063552 | Ga0495629_0063552_798_1763 | 312 |
| 235 | 3300048904 | Ga0496101_0006083 | Ga0496101_0006083_6473_7441 | 312 |
| 236 | 3300048905 | Ga0496102_0070151 | Ga0496102_0070151_565_1530 | 312 |
| 237 | 3300048905 | Ga0496102_0230921 | Ga0496102_0230921_308_1276 | 312 |
| 238 | 3300048908 | Ga0496105_0036464 | Ga0496105_0036464_865_1833 | 312 |
| 239 | 3300048909 | Ga0496106_0149281 | Ga0496106_0149281_372_1337 | 312 |
| 240 | 3300048912 | Ga0496109_0017400 | Ga0496109_0017400_4608_5576 | 312 |
| 241 | 3300048913 | Ga0496110_0002745 | Ga0496110_0002745_12059_13024 | 312 |
| 242 | 3300048915 | Ga0496112_0258616 | Ga0496112_0258616_236_1201 | 312 |
| 243 | 3300048917 | Ga0496114_0002210 | Ga0496114_0002210_11524_12492 | 312 |
| 244 | 3300048918 | Ga0496115_0005059 | Ga0496115_0005059_5558_6526 | 312 |
| 245 | 3300048918 | Ga0496115_0206468 | Ga0496115_0206468_631_1596 | 312 |
| 246 | 3300049574 | Ga0501038_0212993 | Ga0501038_0212993_73_1038 | 312 |
| 247 | 3300049579 | Ga0501043_0127088 | Ga0501043_0127088_291_1259 | 312 |
| 248 | 3300049579 | Ga0501043_0383726 | Ga0501043_0383726_73_1038 | 312 |
| 249 | 3300049587 | Ga0501071_0033606 | Ga0501071_0033606_1956_2924 | 312 |
| 250 | 3300049590 | Ga0501074_0333346 | Ga0501074_0333346_82_1047 | 312 |
| 251 | 3300049824 | Ga0501045_0079364 | Ga0501045_0079364_211_1176 | 312 |
| 252 | 3300050510 | nmdc:mga06r32_167782_c1 | nmdc:mga06r32_167782_c1_92_1114 | 312 |
| 253 | 3300050512 | nmdc:mga0n895_436576_c1 | nmdc:mga0n895_436576_c1_250_1215 | 312 |
| 254 | 3300050512 | nmdc:mga0n895_84342_c1 | nmdc:mga0n895_84342_c1_1172_2137 | 312 |
| 255 | 3300050515 | nmdc:mga0a205_492444_c1 | nmdc:mga0a205_492444_c1_43_1008 | 312 |
| 256 | 3300061734 | Ga0530510_0284098 | Ga0530510_0284098_148_1113 | 312 |
| 257 | iso_pu_bacteria | 2643221547 | 2643757545 | 312 |
| 258 | 3300005339 | Ga0070660_100030377 | Ga0070660_1000303772 | 313 |
| 259 | 3300005340 | Ga0070689_100145194 | Ga0070689_1001451942 | 313 |
| 260 | 3300005563 | Ga0068855_100265405 | Ga0068855_1002654052 | 313 |
| 261 | 3300006051 | Ga0075364_10163182 | Ga0075364_101631822 | 313 |
| 262 | 3300006177 | Ga0075362_10106101 | Ga0075362_101061012 | 313 |
| 263 | 3300006186 | Ga0075369_10023630 | Ga0075369_100236301 | 313 |
| 264 | 3300006195 | Ga0075366_10158023 | Ga0075366_101580232 | 313 |
| 265 | 3300009147 | Ga0114129_10132378 | Ga0114129_101323782 | 313 |
| 266 | 3300009177 | Ga0105248_10296134 | Ga0105248_102961342 | 313 |
| 267 | 3300013306 | Ga0163162_10303417 | Ga0163162_103034172 | 313 |
| 268 | 3300014968 | Ga0157379_10174036 | Ga0157379_101740362 | 313 |
| 269 | 3300025899 | Ga0207642_10153554 | Ga0207642_101535541 | 313 |
| 270 | 3300025917 | Ga0207660_10052000 | Ga0207660_100520003 | 313 |
| 271 | 3300025921 | Ga0207652_10035880 | Ga0207652_100358802 | 313 |
| 272 | 3300025931 | Ga0207644_10044351 | Ga0207644_100443511 | 313 |
| 273 | 3300025941 | Ga0207711_10003227 | Ga0207711_100032273 | 313 |
| 274 | 3300031241 | Ga0265325_10035033 | Ga0265325_100350332 | 313 |
| 275 | 3300031249 | Ga0265339_10039970 | Ga0265339_100399702 | 313 |
| 276 | 3300031595 | Ga0265313_10025172 | Ga0265313_100251724 | 313 |
| 277 | 3300031711 | Ga0265314_10109110 | Ga0265314_101091102 | 313 |
| 278 | 3300035114 | Ga0373939_0051546 | Ga0373939_0051546_64_1035 | 313 |
| 279 | 3300035691 | Ga0373931_0153675 | Ga0373931_0153675_28_999 | 313 |
| 280 | 3300035692 | Ga0373935_0101018 | Ga0373935_0101018_890_1891 | 313 |
| 281 | 3300036401 | Ga0373937_0002866 | Ga0373937_0002866_3849_4853 | 313 |
| 282 | 3300048903 | Ga0496100_0005202 | Ga0496100_0005202_3059_4030 | 313 |
| 283 | 3300048907 | Ga0496104_0120433 | Ga0496104_0120433_989_1960 | 313 |
| 284 | 3300048909 | Ga0496106_0090801 | Ga0496106_0090801_45_1016 | 313 |
| 285 | 3300048910 | Ga0496107_0020151 | Ga0496107_0020151_2096_3067 | 313 |
| 286 | 3300048913 | Ga0496110_0001702 | Ga0496110_0001702_736_1707 | 313 |
| 287 | 3300048915 | Ga0496112_0255817 | Ga0496112_0255817_552_1523 | 313 |
| 288 | 3300048916 | Ga0496113_0039278 | Ga0496113_0039278_392_1363 | 313 |
| 289 | 3300049568 | Ga0501031_0008594 | Ga0501031_0008594_2077_3048 | 313 |
| 290 | 3300049569 | Ga0501032_0050173 | Ga0501032_0050173_1615_2586 | 313 |
| 291 | 3300049570 | Ga0501033_0008039 | Ga0501033_0008039_1245_2216 | 313 |
| 292 | 3300049571 | Ga0501034_0057995 | Ga0501034_0057995_1909_2880 | 313 |
| 293 | 3300049571 | Ga0501034_0426869 | Ga0501034_0426869_241_1209 | 313 |
| 294 | 3300049572 | Ga0501036_0009653 | Ga0501036_0009653_356_1327 | 313 |
| 295 | 3300049573 | Ga0501037_0047700 | Ga0501037_0047700_1289_2260 | 313 |
| 296 | 3300049580 | Ga0501046_0153731 | Ga0501046_0153731_154_1125 | 313 |
| 297 | 3300049581 | Ga0501047_0079851 | Ga0501047_0079851_1869_2840 | 313 |
| 298 | 3300049581 | Ga0501047_0236914 | Ga0501047_0236914_397_1365 | 313 |
| 299 | 3300049822 | Ga0501035_0066829 | Ga0501035_0066829_1634_2605 | 313 |
| 300 | 3300049823 | Ga0501044_0062443 | Ga0501044_0062443_1566_2537 | 313 |
| 301 | 3300050492 | nmdc:mga0yw44_4808_c1 | nmdc:mga0yw44_4808_c1_5128_6096 | 313 |
| 302 | 3300050507 | nmdc:mga05p37_117053_c1 | nmdc:mga05p37_117053_c1_1326_2294 | 313 |
| 303 | 3300053119 | Ga0500595_050791 | Ga0500595_050791_173_1141 | 313 |
| 304 | 3300053131 | Ga0500652_000010 | Ga0500652_000010_6147_7115 | 313 |
| 305 | 3300005439 | Ga0070711_100090595 | Ga0070711_1000905952 | 314 |
| 306 | 3300006175 | Ga0070712_100242649 | Ga0070712_1002426491 | 314 |
| 307 | 3300025929 | Ga0207664_10171048 | Ga0207664_101710481 | 314 |
| 308 | 3300031241 | Ga0265325_10022863 | Ga0265325_100228633 | 314 |
| 309 | 3300031711 | Ga0265314_10001589 | Ga0265314_1000158922 | 314 |
| 310 | 3300049824 | Ga0501045_0112175 | Ga0501045_0112175_869_1834 | 314 |
| 311 | 3300005327 | Ga0070658_10016082 | Ga0070658_100160824 | 315 |
| 312 | 3300005327 | Ga0070658_10186969 | Ga0070658_101869692 | 315 |
| 313 | 3300005329 | Ga0070683_100026317 | Ga0070683_1000263174 | 315 |
| 314 | 3300005336 | Ga0070680_100086684 | Ga0070680_1000866842 | 315 |
| 315 | 3300005336 | Ga0070680_100128125 | Ga0070680_1001281252 | 315 |
| 316 | 3300005339 | Ga0070660_100005069 | Ga0070660_1000050698 | 315 |
| 317 | 3300005435 | Ga0070714_100058536 | Ga0070714_1000585364 | 315 |
| 318 | 3300005437 | Ga0070710_10033131 | Ga0070710_100331313 | 315 |
| 319 | 3300005439 | Ga0070711_100143784 | Ga0070711_1001437842 | 315 |
| 320 | 3300005530 | Ga0070679_100101367 | Ga0070679_1001013672 | 315 |
| 321 | 3300005530 | Ga0070679_100115337 | Ga0070679_1001153372 | 315 |
| 322 | 3300005530 | Ga0070679_100173463 | Ga0070679_1001734632 | 315 |
| 323 | 3300005535 | Ga0070684_100075569 | Ga0070684_1000755693 | 315 |
| 324 | 3300005563 | Ga0068855_100026702 | Ga0068855_1000267023 | 315 |
| 325 | 3300005563 | Ga0068855_100184084 | Ga0068855_1001840843 | 315 |
| 326 | 3300005563 | Ga0068855_100554614 | Ga0068855_1005546142 | 315 |
| 327 | 3300005578 | Ga0068854_100049880 | Ga0068854_1000498802 | 315 |
| 328 | 3300005614 | Ga0068856_100108264 | Ga0068856_1001082642 | 315 |
| 329 | 3300005616 | Ga0068852_100011531 | Ga0068852_1000115316 | 315 |
| 330 | 3300006175 | Ga0070712_100023648 | Ga0070712_1000236481 | 315 |
| 331 | 3300009174 | Ga0105241_10214633 | Ga0105241_102146332 | 315 |
| 332 | 3300009551 | Ga0105238_10046828 | Ga0105238_100468284 | 315 |
| 333 | 3300013307 | Ga0157372_10058724 | Ga0157372_100587242 | 315 |
| 334 | 3300013307 | Ga0157372_10080440 | Ga0157372_100804404 | 315 |
| 335 | 3300025909 | Ga0207705_10160120 | Ga0207705_101601202 | 315 |
| 336 | 3300025912 | Ga0207707_10045776 | Ga0207707_100457762 | 315 |
| 337 | 3300025912 | Ga0207707_10105071 | Ga0207707_101050712 | 315 |
| 338 | 3300025919 | Ga0207657_10016175 | Ga0207657_100161754 | 315 |
| 339 | 3300025921 | Ga0207652_10194803 | Ga0207652_101948031 | 315 |
| 340 | 3300025921 | Ga0207652_10343068 | Ga0207652_103430682 | 315 |
| 341 | 3300025924 | Ga0207694_10019282 | Ga0207694_100192823 | 315 |
| 342 | 3300025932 | Ga0207690_10060972 | Ga0207690_100609722 | 315 |
| 343 | 3300025949 | Ga0207667_10025294 | Ga0207667_100252943 | 315 |
| 344 | 3300026142 | Ga0207698_10183727 | Ga0207698_101837273 | 315 |
| 345 | 3300028800 | Ga0265338_10023559 | Ga0265338_100235596 | 315 |
| 346 | 3300031235 | Ga0265330_10009674 | Ga0265330_100096744 | 315 |
| 347 | 3300031241 | Ga0265325_10000442 | Ga0265325_1000044229 | 315 |
| 348 | 3300031241 | Ga0265325_10010337 | Ga0265325_100103375 | 315 |
| 349 | 3300031249 | Ga0265339_10100771 | Ga0265339_101007712 | 315 |
| 350 | 3300031595 | Ga0265313_10000305 | Ga0265313_1000030534 | 315 |
| 351 | 3300031595 | Ga0265313_10013856 | Ga0265313_100138562 | 315 |
| 352 | 3300031712 | Ga0265342_10000321 | Ga0265342_1000032121 | 315 |
| 353 | 3300031712 | Ga0265342_10056655 | Ga0265342_100566552 | 315 |
| 354 | 3300037418 | Ga0395900_0082006 | Ga0395900_0082006_1491_2585 | 315 |
| 355 | 3300044693 | Ga0466961_0195839 | Ga0466961_0195839_36_1004 | 315 |
| 356 | 3300044842 | Ga0466957_0040658 | Ga0466957_0040658_20_988 | 315 |
| 357 | 3300049568 | Ga0501031_0170117 | Ga0501031_0170117_376_1344 | 315 |
| 358 | 3300049569 | Ga0501032_0033829 | Ga0501032_0033829_883_1938 | 315 |
| 359 | 3300049571 | Ga0501034_0000593 | Ga0501034_0000593_13978_14946 | 315 |
| 360 | 3300049571 | Ga0501034_0003500 | Ga0501034_0003500_16254_17222 | 315 |
| 361 | 3300049571 | Ga0501034_0013580 | Ga0501034_0013580_34_1005 | 315 |
| 362 | 3300049571 | Ga0501034_0038501 | Ga0501034_0038501_959_2014 | 315 |
| 363 | 3300049571 | Ga0501034_0351777 | Ga0501034_0351777_98_1066 | 315 |
| 364 | 3300049572 | Ga0501036_0012201 | Ga0501036_0012201_6052_7020 | 315 |
| 365 | 3300049573 | Ga0501037_0010535 | Ga0501037_0010535_4335_5390 | 315 |
| 366 | 3300049573 | Ga0501037_0012851 | Ga0501037_0012851_222_1190 | 315 |
| 367 | 3300049573 | Ga0501037_0046114 | Ga0501037_0046114_1237_2208 | 315 |
| 368 | 3300049574 | Ga0501038_0008716 | Ga0501038_0008716_7217_8272 | 315 |
| 369 | 3300049574 | Ga0501038_0054702 | Ga0501038_0054702_1284_2255 | 315 |
| 370 | 3300049575 | Ga0501039_0016524 | Ga0501039_0016524_684_1655 | 315 |
| 371 | 3300049579 | Ga0501043_0005751 | Ga0501043_0005751_1904_2959 | 315 |
| 372 | 3300049579 | Ga0501043_0008613 | Ga0501043_0008613_5519_6487 | 315 |
| 373 | 3300049581 | Ga0501047_0010766 | Ga0501047_0010766_2790_3758 | 315 |
| 374 | 3300049581 | Ga0501047_0019566 | Ga0501047_0019566_4113_5168 | 315 |
| 375 | 3300049582 | Ga0501048_0005729 | Ga0501048_0005729_1221_2189 | 315 |
| 376 | 3300049583 | Ga0501067_0057298 | Ga0501067_0057298_717_1688 | 315 |
| 377 | 3300049584 | Ga0501068_0005466 | Ga0501068_0005466_5681_6652 | 315 |
| 378 | 3300049586 | Ga0501070_0097662 | Ga0501070_0097662_732_1700 | 315 |
| 379 | 3300049586 | Ga0501070_0116611 | Ga0501070_0116611_334_1305 | 315 |
| 380 | 3300049586 | Ga0501070_0241723 | Ga0501070_0241723_465_1433 | 315 |
| 381 | 3300049586 | Ga0501070_0260795 | Ga0501070_0260795_77_1132 | 315 |
| 382 | 3300049589 | Ga0501073_0010149 | Ga0501073_0010149_705_1676 | 315 |
| 383 | 3300049589 | Ga0501073_0235968 | Ga0501073_0235968_95_1063 | 315 |
| 384 | 3300049589 | Ga0501073_0301621 | Ga0501073_0301621_73_1056 | 315 |
| 385 | 3300049590 | Ga0501074_0009969 | Ga0501074_0009969_380_1348 | 315 |
| 386 | 3300049590 | Ga0501074_0025531 | Ga0501074_0025531_34_1005 | 315 |
| 387 | 3300049742 | Ga0501080_0000953 | Ga0501080_0000953_6875_7843 | 315 |
| 388 | 3300049742 | Ga0501080_0027894 | Ga0501080_0027894_1273_2328 | 315 |
| 389 | 3300049742 | Ga0501080_0139005 | Ga0501080_0139005_148_1119 | 315 |
| 390 | 3300049744 | Ga0501083_0001052 | Ga0501083_0001052_1575_2543 | 315 |
| 391 | 3300049822 | Ga0501035_0043901 | Ga0501035_0043901_724_1695 | 315 |
| 392 | 3300049823 | Ga0501044_0016146 | Ga0501044_0016146_5699_6754 | 315 |
| 393 | 3300049823 | Ga0501044_0052404 | Ga0501044_0052404_38_1009 | 315 |
| 394 | 3300049823 | Ga0501044_0068690 | Ga0501044_0068690_613_1581 | 315 |
| 395 | 3300049823 | Ga0501044_0185224 | Ga0501044_0185224_607_1575 | 315 |
| 396 | 3300049824 | Ga0501045_0128437 | Ga0501045_0128437_456_1511 | 315 |
| 397 | 2209111006 | 2214586617 | 2213627035 | 316 |
| 398 | 2209111006 | 2214745204 | 2213754670 | 316 |
| 399 | 3300000042 | ARSoilYngRDRAFT_c00018 | ARSoilYngRDRAFT_0001817 | 316 |
| 400 | 3300000043 | ARcpr5yngRDRAFT_c000071 | ARcpr5yngRDRAFT_00007110 | 316 |
| 401 | 3300000044 | ARSoilOldRDRAFT_c000005 | ARSoilOldRDRAFT_00000553 | 316 |
| 402 | 3300000045 | ARCol0oldRDRAFT_c00312 | ARCol0oldRDRAFT_003123 | 316 |
| 403 | 3300000652 | ARCol0yngRDRAFT_1000166 | ARCol0yngRDRAFT_10001663 | 316 |
| 404 | 3300001430 | JGI24032J14994_100069 | JGI24032J14994_1000692 | 316 |
| 405 | 3300001976 | JGI24752J21851_1001285 | JGI24752J21851_10012853 | 316 |
| 406 | 3300001977 | JGI24746J21847_1002142 | JGI24746J21847_10021423 | 316 |
| 407 | 3300001978 | JGI24747J21853_1000415 | JGI24747J21853_10004153 | 316 |
| 408 | 3300001990 | JGI24737J22298_10000309 | JGI24737J22298_100003096 | 316 |
| 409 | 3300001990 | JGI24737J22298_10002334 | JGI24737J22298_100023345 | 316 |
| 410 | 3300001991 | JGI24743J22301_10001195 | JGI24743J22301_100011952 | 316 |
| 411 | 3300002070 | JGI24750J21931_1000368 | JGI24750J21931_10003683 | 316 |
| 412 | 3300002075 | JGI24738J21930_10000219 | JGI24738J21930_1000021915 | 316 |
| 413 | 3300002076 | JGI24749J21850_1000528 | JGI24749J21850_10005283 | 316 |
| 414 | 3300002077 | JGI24744J21845_10010135 | JGI24744J21845_100101351 | 316 |
| 415 | 3300002126 | JGI24035J26624_1000067 | JGI24035J26624_10000677 | 316 |
| 416 | 3300003911 | JGI25405J52794_10008119 | JGI25405J52794_100081192 | 316 |
| 417 | 3300005277 | Ga0065716_1001582 | Ga0065716_10015826 | 316 |
| 418 | 3300005289 | Ga0065704_10077656 | Ga0065704_100776561 | 316 |
| 419 | 3300005290 | Ga0065712_10005999 | Ga0065712_100059997 | 316 |
| 420 | 3300005290 | Ga0065712_10071612 | Ga0065712_100716123 | 316 |
| 421 | 3300005293 | Ga0065715_10001902 | Ga0065715_100019022 | 316 |
| 422 | 3300005293 | Ga0065715_10089334 | Ga0065715_100893349 | 316 |
| 423 | 3300005295 | Ga0065707_10107519 | Ga0065707_101075191 | 316 |
| 424 | 3300005295 | Ga0065707_10156336 | Ga0065707_101563362 | 316 |
| 425 | 3300005328 | Ga0070676_10002258 | Ga0070676_100022587 | 316 |
| 426 | 3300005329 | Ga0070683_100006961 | Ga0070683_1000069617 | 316 |
| 427 | 3300005330 | Ga0070690_100110159 | Ga0070690_1001101591 | 316 |
| 428 | 3300005330 | Ga0070690_100163494 | Ga0070690_1001634942 | 316 |
| 429 | 3300005331 | Ga0070670_100002178 | Ga0070670_1000021785 | 316 |
| 430 | 3300005333 | Ga0070677_10001477 | Ga0070677_100014772 | 316 |
| 431 | 3300005334 | Ga0068869_100001327 | Ga0068869_1000013277 | 316 |
| 432 | 3300005335 | Ga0070666_10006983 | Ga0070666_100069833 | 316 |
| 433 | 3300005335 | Ga0070666_10042637 | Ga0070666_100426372 | 316 |
| 434 | 3300005335 | Ga0070666_10090928 | Ga0070666_100909281 | 316 |
| 435 | 3300005335 | Ga0070666_10232003 | Ga0070666_102320032 | 316 |
| 436 | 3300005336 | Ga0070680_100010314 | Ga0070680_1000103142 | 316 |
| 437 | 3300005336 | Ga0070680_100028504 | Ga0070680_1000285043 | 316 |
| 438 | 3300005337 | Ga0070682_100004337 | Ga0070682_1000043372 | 316 |
| 439 | 3300005337 | Ga0070682_100076349 | Ga0070682_1000763492 | 316 |
| 440 | 3300005338 | Ga0068868_100003112 | Ga0068868_1000031122 | 316 |
| 441 | 3300005339 | Ga0070660_100028339 | Ga0070660_1000283393 | 316 |
| 442 | 3300005339 | Ga0070660_100207633 | Ga0070660_1002076332 | 316 |
| 443 | 3300005340 | Ga0070689_100002417 | Ga0070689_1000024175 | 316 |
| 444 | 3300005340 | Ga0070689_100046491 | Ga0070689_1000464912 | 316 |
| 445 | 3300005340 | Ga0070689_100119533 | Ga0070689_1001195332 | 316 |
| 446 | 3300005341 | Ga0070691_10057825 | Ga0070691_100578251 | 316 |
| 447 | 3300005343 | Ga0070687_100000334 | Ga0070687_10000033411 | 316 |
| 448 | 3300005343 | Ga0070687_100029805 | Ga0070687_1000298052 | 316 |
| 449 | 3300005344 | Ga0070661_100004209 | Ga0070661_1000042093 | 316 |
| 450 | 3300005344 | Ga0070661_100034218 | Ga0070661_1000342182 | 316 |
| 451 | 3300005345 | Ga0070692_10000022 | Ga0070692_100000224 | 316 |
| 452 | 3300005347 | Ga0070668_100000947 | Ga0070668_1000009475 | 316 |
| 453 | 3300005347 | Ga0070668_100158767 | Ga0070668_1001587672 | 316 |
| 454 | 3300005353 | Ga0070669_100002667 | Ga0070669_1000026676 | 316 |
| 455 | 3300005353 | Ga0070669_100102382 | Ga0070669_1001023822 | 316 |
| 456 | 3300005354 | Ga0070675_100003214 | Ga0070675_1000032145 | 316 |
| 457 | 3300005354 | Ga0070675_100220489 | Ga0070675_1002204892 | 316 |
| 458 | 3300005355 | Ga0070671_100003818 | Ga0070671_1000038186 | 316 |
| 459 | 3300005356 | Ga0070674_100003265 | Ga0070674_1000032654 | 316 |
| 460 | 3300005364 | Ga0070673_100005122 | Ga0070673_1000051225 | 316 |
| 461 | 3300005364 | Ga0070673_100048608 | Ga0070673_1000486082 | 316 |
| 462 | 3300005365 | Ga0070688_100000196 | Ga0070688_10000019628 | 316 |
| 463 | 3300005365 | Ga0070688_100007034 | Ga0070688_1000070343 | 316 |
| 464 | 3300005366 | Ga0070659_100005334 | Ga0070659_1000053343 | 316 |
| 465 | 3300005366 | Ga0070659_100011916 | Ga0070659_1000119162 | 316 |
| 466 | 3300005367 | Ga0070667_100001157 | Ga0070667_1000011573 | 316 |
| 467 | 3300005367 | Ga0070667_100023226 | Ga0070667_1000232264 | 316 |
| 468 | 3300005367 | Ga0070667_100276601 | Ga0070667_1002766012 | 316 |
| 469 | 3300005367 | Ga0070667_100350889 | Ga0070667_1003508891 | 316 |
| 470 | 3300005434 | Ga0070709_10003520 | Ga0070709_100035203 | 316 |
| 471 | 3300005436 | Ga0070713_100077628 | Ga0070713_1000776282 | 316 |
| 472 | 3300005437 | Ga0070710_10003606 | Ga0070710_100036064 | 316 |
| 473 | 3300005438 | Ga0070701_10001542 | Ga0070701_100015425 | 316 |
| 474 | 3300005438 | Ga0070701_10041269 | Ga0070701_100412692 | 316 |
| 475 | 3300005439 | Ga0070711_100171400 | Ga0070711_1001714002 | 316 |
| 476 | 3300005440 | Ga0070705_100013342 | Ga0070705_1000133423 | 316 |
| 477 | 3300005441 | Ga0070700_100002190 | Ga0070700_1000021903 | 316 |
| 478 | 3300005441 | Ga0070700_100034842 | Ga0070700_1000348422 | 316 |
| 479 | 3300005444 | Ga0070694_100008562 | Ga0070694_1000085626 | 316 |
| 480 | 3300005444 | Ga0070694_100011023 | Ga0070694_1000110233 | 316 |
| 481 | 3300005445 | Ga0070708_100527740 | Ga0070708_1005277401 | 316 |
| 482 | 3300005455 | Ga0070663_100006630 | Ga0070663_1000066303 | 316 |
| 483 | 3300005455 | Ga0070663_100234758 | Ga0070663_1002347581 | 316 |
| 484 | 3300005457 | Ga0070662_100015790 | Ga0070662_1000157902 | 316 |
| 485 | 3300005458 | Ga0070681_10005185 | Ga0070681_100051857 | 316 |
| 486 | 3300005459 | Ga0068867_100007041 | Ga0068867_1000070417 | 316 |
| 487 | 3300005459 | Ga0068867_100313316 | Ga0068867_1003133161 | 316 |
| 488 | 3300005466 | Ga0070685_10004138 | Ga0070685_100041385 | 316 |
| 489 | 3300005466 | Ga0070685_10107297 | Ga0070685_101072972 | 316 |
| 490 | 3300005468 | Ga0070707_100142133 | Ga0070707_1001421333 | 316 |
| 491 | 3300005518 | Ga0070699_100252828 | Ga0070699_1002528282 | 316 |
| 492 | 3300005530 | Ga0070679_100022319 | Ga0070679_1000223194 | 316 |
| 493 | 3300005530 | Ga0070679_100069216 | Ga0070679_1000692162 | 316 |
| 494 | 3300005530 | Ga0070679_100125270 | Ga0070679_1001252702 | 316 |
| 495 | 3300005530 | Ga0070679_100244129 | Ga0070679_1002441292 | 316 |
| 496 | 3300005535 | Ga0070684_100005283 | Ga0070684_1000052833 | 316 |
| 497 | 3300005539 | Ga0068853_100007403 | Ga0068853_1000074033 | 316 |
| 498 | 3300005543 | Ga0070672_100003202 | Ga0070672_1000032027 | 316 |
| 499 | 3300005544 | Ga0070686_100001904 | Ga0070686_1000019045 | 316 |
| 500 | 3300005544 | Ga0070686_100111025 | Ga0070686_1001110252 | 316 |
| 501 | 3300005544 | Ga0070686_100114499 | Ga0070686_1001144992 | 316 |
| 502 | 3300005545 | Ga0070695_100004009 | Ga0070695_1000040093 | 316 |
| 503 | 3300005545 | Ga0070695_100012010 | Ga0070695_1000120103 | 316 |
| 504 | 3300005546 | Ga0070696_100011552 | Ga0070696_1000115522 | 316 |
| 505 | 3300005546 | Ga0070696_100025402 | Ga0070696_1000254021 | 316 |
| 506 | 3300005546 | Ga0070696_100101583 | Ga0070696_1001015833 | 316 |
| 507 | 3300005547 | Ga0070693_100001415 | Ga0070693_1000014154 | 316 |
| 508 | 3300005547 | Ga0070693_100167530 | Ga0070693_1001675302 | 316 |
| 509 | 3300005548 | Ga0070665_100033372 | Ga0070665_1000333723 | 316 |
| 510 | 3300005548 | Ga0070665_100184052 | Ga0070665_1001840522 | 316 |
| 511 | 3300005549 | Ga0070704_100212712 | Ga0070704_1002127122 | 316 |
| 512 | 3300005563 | Ga0068855_100023429 | Ga0068855_1000234292 | 316 |
| 513 | 3300005563 | Ga0068855_100309001 | Ga0068855_1003090011 | 316 |
| 514 | 3300005564 | Ga0070664_100005578 | Ga0070664_1000055786 | 316 |
| 515 | 3300005564 | Ga0070664_100105612 | Ga0070664_1001056123 | 316 |
| 516 | 3300005577 | Ga0068857_100003700 | Ga0068857_1000037005 | 316 |
| 517 | 3300005578 | Ga0068854_100005149 | Ga0068854_1000051493 | 316 |
| 518 | 3300005614 | Ga0068856_100062644 | Ga0068856_1000626443 | 316 |
| 519 | 3300005614 | Ga0068856_100085483 | Ga0068856_1000854832 | 316 |
| 520 | 3300005615 | Ga0070702_100024377 | Ga0070702_1000243772 | 316 |
| 521 | 3300005615 | Ga0070702_100087656 | Ga0070702_1000876561 | 316 |
| 522 | 3300005616 | Ga0068852_100003095 | Ga0068852_1000030956 | 316 |
| 523 | 3300005616 | Ga0068852_100655031 | Ga0068852_1006550311 | 316 |
| 524 | 3300005617 | Ga0068859_100013731 | Ga0068859_1000137312 | 316 |
| 525 | 3300005617 | Ga0068859_100398843 | Ga0068859_1003988431 | 316 |
| 526 | 3300005618 | Ga0068864_100004616 | Ga0068864_1000046163 | 316 |
| 527 | 3300005718 | Ga0068866_10000805 | Ga0068866_100008053 | 316 |
| 528 | 3300005719 | Ga0068861_100003522 | Ga0068861_1000035223 | 316 |
| 529 | 3300005840 | Ga0068870_10000414 | Ga0068870_1000041411 | 316 |
| 530 | 3300005841 | Ga0068863_100004632 | Ga0068863_10000463211 | 316 |
| 531 | 3300005842 | Ga0068858_100001573 | Ga0068858_1000015733 | 316 |
| 532 | 3300005842 | Ga0068858_100021262 | Ga0068858_1000212624 | 316 |
| 533 | 3300005842 | Ga0068858_100163156 | Ga0068858_1001631562 | 316 |
| 534 | 3300005843 | Ga0068860_100011587 | Ga0068860_1000115873 | 316 |
| 535 | 3300005843 | Ga0068860_100168980 | Ga0068860_1001689802 | 316 |
| 536 | 3300005844 | Ga0068862_100010270 | Ga0068862_1000102704 | 316 |
| 537 | 3300005844 | Ga0068862_100018526 | Ga0068862_1000185266 | 316 |
| 538 | 3300005937 | Ga0081455_10001269 | Ga0081455_1000126915 | 316 |
| 539 | 3300005937 | Ga0081455_10024762 | Ga0081455_100247624 | 316 |
| 540 | 3300006163 | Ga0070715_10108946 | Ga0070715_101089461 | 316 |
| 541 | 3300006173 | Ga0070716_100003237 | Ga0070716_1000032371 | 316 |
| 542 | 3300006175 | Ga0070712_100009409 | Ga0070712_1000094092 | 316 |
| 543 | 3300006175 | Ga0070712_100029920 | Ga0070712_1000299202 | 316 |
| 544 | 3300006194 | Ga0075427_10000546 | Ga0075427_100005462 | 316 |
| 545 | 3300006237 | Ga0097621_100000432 | Ga0097621_1000004326 | 316 |
| 546 | 3300006237 | Ga0097621_100017374 | Ga0097621_1000173745 | 316 |
| 547 | 3300006353 | Ga0075370_10031031 | Ga0075370_100310313 | 316 |
| 548 | 3300006358 | Ga0068871_100001626 | Ga0068871_1000016265 | 316 |
| 549 | 3300006358 | Ga0068871_100010210 | Ga0068871_1000102106 | 316 |
| 550 | 3300006358 | Ga0068871_100144502 | Ga0068871_1001445021 | 316 |
| 551 | 3300006844 | Ga0075428_100033719 | Ga0075428_1000337196 | 316 |
| 552 | 3300006846 | Ga0075430_100000312 | Ga0075430_1000003126 | 316 |
| 553 | 3300006847 | Ga0075431_100004142 | Ga0075431_1000041429 | 316 |
| 554 | 3300006852 | Ga0075433_10000217 | Ga0075433_1000021721 | 316 |
| 555 | 3300006852 | Ga0075433_10071485 | Ga0075433_100714853 | 316 |
| 556 | 3300006871 | Ga0075434_100000482 | Ga0075434_1000004825 | 316 |
| 557 | 3300006871 | Ga0075434_100025778 | Ga0075434_1000257782 | 316 |
| 558 | 3300006871 | Ga0075434_100167534 | Ga0075434_1001675342 | 316 |
| 559 | 3300006880 | Ga0075429_100005934 | Ga0075429_1000059345 | 316 |
| 560 | 3300006881 | Ga0068865_100001764 | Ga0068865_1000017647 | 316 |
| 561 | 3300006881 | Ga0068865_100008848 | Ga0068865_1000088484 | 316 |
| 562 | 3300006881 | Ga0068865_100048210 | Ga0068865_1000482102 | 316 |
| 563 | 3300006914 | Ga0075436_100205572 | Ga0075436_1002055722 | 316 |
| 564 | 3300006931 | Ga0097620_100013731 | Ga0097620_1000137312 | 316 |
| 565 | 3300006931 | Ga0097620_100398827 | Ga0097620_1003988271 | 316 |
| 566 | 3300007076 | Ga0075435_100022837 | Ga0075435_1000228373 | 316 |
| 567 | 3300007076 | Ga0075435_100031001 | Ga0075435_1000310013 | 316 |
| 568 | 3300007076 | Ga0075435_100086830 | Ga0075435_1000868302 | 316 |
| 569 | 3300009011 | Ga0105251_10052350 | Ga0105251_100523502 | 316 |
| 570 | 3300009092 | Ga0105250_10031284 | Ga0105250_100312841 | 316 |
| 571 | 3300009093 | Ga0105240_10028942 | Ga0105240_100289423 | 316 |
| 572 | 3300009094 | Ga0111539_10001938 | Ga0111539_1000193824 | 316 |
| 573 | 3300009094 | Ga0111539_10003842 | Ga0111539_1000384215 | 316 |
| 574 | 3300009094 | Ga0111539_10004907 | Ga0111539_100049077 | 316 |
| 575 | 3300009094 | Ga0111539_10029777 | Ga0111539_100297773 | 316 |
| 576 | 3300009098 | Ga0105245_10000534 | Ga0105245_100005346 | 316 |
| 577 | 3300009148 | Ga0105243_10003508 | Ga0105243_1000350811 | 316 |
| 578 | 3300009174 | Ga0105241_10002008 | Ga0105241_100020085 | 316 |
| 579 | 3300009174 | Ga0105241_10353554 | Ga0105241_103535542 | 316 |
| 580 | 3300009176 | Ga0105242_10004301 | Ga0105242_100043016 | 316 |
| 581 | 3300009176 | Ga0105242_10004986 | Ga0105242_100049863 | 316 |
| 582 | 3300009176 | Ga0105242_10402279 | Ga0105242_104022791 | 316 |
| 583 | 3300009177 | Ga0105248_10003814 | Ga0105248_100038146 | 316 |
| 584 | 3300009177 | Ga0105248_10012337 | Ga0105248_100123375 | 316 |
| 585 | 3300009177 | Ga0105248_10071076 | Ga0105248_100710762 | 316 |
| 586 | 3300009545 | Ga0105237_10004785 | Ga0105237_1000478511 | 316 |
| 587 | 3300009545 | Ga0105237_10079240 | Ga0105237_100792402 | 316 |
| 588 | 3300009545 | Ga0105237_10183774 | Ga0105237_101837742 | 316 |
| 589 | 3300009553 | Ga0105249_10004067 | Ga0105249_100040673 | 316 |
| 590 | 3300009553 | Ga0105249_10170337 | Ga0105249_101703372 | 316 |
| 591 | 3300009553 | Ga0105249_10447589 | Ga0105249_104475891 | 316 |
| 592 | 3300009553 | Ga0105249_10723447 | Ga0105249_107234471 | 316 |
| 593 | 3300010375 | Ga0105239_10039798 | Ga0105239_100397982 | 316 |
| 594 | 3300010375 | Ga0105239_10063264 | Ga0105239_100632643 | 316 |
| 595 | 3300010375 | Ga0105239_10655203 | Ga0105239_106552031 | 316 |
| 596 | 3300011119 | Ga0105246_10001160 | Ga0105246_100011605 | 316 |
| 597 | 3300012492 | Ga0157335_1002551 | Ga0157335_10025511 | 316 |
| 598 | 3300012507 | Ga0157342_1002325 | Ga0157342_10023252 | 316 |
| 599 | 3300013100 | Ga0157373_10004563 | Ga0157373_100045633 | 316 |
| 600 | 3300013100 | Ga0157373_10037254 | Ga0157373_100372542 | 316 |
| 601 | 3300013102 | Ga0157371_10028973 | Ga0157371_100289733 | 316 |
| 602 | 3300013104 | Ga0157370_10259250 | Ga0157370_102592501 | 316 |
| 603 | 3300013296 | Ga0157374_10006040 | Ga0157374_100060403 | 316 |
| 604 | 3300013296 | Ga0157374_10036266 | Ga0157374_100362663 | 316 |
| 605 | 3300013297 | Ga0157378_10006408 | Ga0157378_100064086 | 316 |
| 606 | 3300013306 | Ga0163162_10018687 | Ga0163162_100186875 | 316 |
| 607 | 3300013307 | Ga0157372_10003634 | Ga0157372_1000363417 | 316 |
| 608 | 3300013308 | Ga0157375_10002653 | Ga0157375_100026535 | 316 |
| 609 | 3300013308 | Ga0157375_10013985 | Ga0157375_100139852 | 316 |
| 610 | 3300014325 | Ga0163163_10003304 | Ga0163163_1000330410 | 316 |
| 611 | 3300014325 | Ga0163163_10006181 | Ga0163163_100061815 | 316 |
| 612 | 3300014325 | Ga0163163_10288779 | Ga0163163_102887792 | 316 |
| 613 | 3300014326 | Ga0157380_10000558 | Ga0157380_1000055817 | 316 |
| 614 | 3300014745 | Ga0157377_10000819 | Ga0157377_100008196 | 316 |
| 615 | 3300014968 | Ga0157379_10004333 | Ga0157379_1000433311 | 316 |
| 616 | 3300014968 | Ga0157379_10034106 | Ga0157379_100341063 | 316 |
| 617 | 3300014968 | Ga0157379_10410544 | Ga0157379_104105442 | 316 |
| 618 | 3300014969 | Ga0157376_10001412 | Ga0157376_1000141211 | 316 |
| 619 | 3300014969 | Ga0157376_10093425 | Ga0157376_100934252 | 316 |
| 620 | 3300014969 | Ga0157376_10315777 | Ga0157376_103157771 | 316 |
| 621 | 3300014969 | Ga0157376_10464822 | Ga0157376_104648222 | 316 |
| 622 | 3300017792 | Ga0163161_10001783 | Ga0163161_100017835 | 316 |
| 623 | 3300025271 | Ga0207666_1000030 | Ga0207666_100003027 | 316 |
| 624 | 3300025271 | Ga0207666_1001056 | Ga0207666_10010563 | 316 |
| 625 | 3300025290 | Ga0207673_1000110 | Ga0207673_10001102 | 316 |
| 626 | 3300025315 | Ga0207697_10000225 | Ga0207697_1000022529 | 316 |
| 627 | 3300025315 | Ga0207697_10007510 | Ga0207697_100075106 | 316 |
| 628 | 3300025735 | Ga0207713_1054500 | Ga0207713_10545002 | 316 |
| 629 | 3300025885 | Ga0207653_10025601 | Ga0207653_100256013 | 316 |
| 630 | 3300025893 | Ga0207682_10000009 | Ga0207682_1000000920 | 316 |
| 631 | 3300025898 | Ga0207692_10043097 | Ga0207692_100430971 | 316 |
| 632 | 3300025899 | Ga0207642_10000959 | Ga0207642_100009594 | 316 |
| 633 | 3300025901 | Ga0207688_10000060 | Ga0207688_100000605 | 316 |
| 634 | 3300025903 | Ga0207680_10001548 | Ga0207680_100015485 | 316 |
| 635 | 3300025903 | Ga0207680_10296261 | Ga0207680_102962611 | 316 |
| 636 | 3300025904 | Ga0207647_10000172 | Ga0207647_1000017227 | 316 |
| 637 | 3300025904 | Ga0207647_10001510 | Ga0207647_100015103 | 316 |
| 638 | 3300025906 | Ga0207699_10072924 | Ga0207699_100729242 | 316 |
| 639 | 3300025907 | Ga0207645_10001895 | Ga0207645_100018956 | 316 |
| 640 | 3300025908 | Ga0207643_10000244 | Ga0207643_100002445 | 316 |
| 641 | 3300025912 | Ga0207707_10003182 | Ga0207707_1000318212 | 316 |
| 642 | 3300025912 | Ga0207707_10146362 | Ga0207707_101463623 | 316 |
| 643 | 3300025913 | Ga0207695_10037556 | Ga0207695_100375564 | 316 |
| 644 | 3300025914 | Ga0207671_10003102 | Ga0207671_1000310215 | 316 |
| 645 | 3300025914 | Ga0207671_10044311 | Ga0207671_100443113 | 316 |
| 646 | 3300025914 | Ga0207671_10197972 | Ga0207671_101979722 | 316 |
| 647 | 3300025915 | Ga0207693_10002491 | Ga0207693_100024919 | 316 |
| 648 | 3300025917 | Ga0207660_10000179 | Ga0207660_1000017935 | 316 |
| 649 | 3300025917 | Ga0207660_10013904 | Ga0207660_100139042 | 316 |
| 650 | 3300025918 | Ga0207662_10000025 | Ga0207662_1000002519 | 316 |
| 651 | 3300025919 | Ga0207657_10001867 | Ga0207657_1000186719 | 316 |
| 652 | 3300025920 | Ga0207649_10002794 | Ga0207649_100027942 | 316 |
| 653 | 3300025920 | Ga0207649_10201578 | Ga0207649_102015782 | 316 |
| 654 | 3300025921 | Ga0207652_10032575 | Ga0207652_100325752 | 316 |
| 655 | 3300025921 | Ga0207652_10107867 | Ga0207652_101078672 | 316 |
| 656 | 3300025923 | Ga0207681_10000419 | Ga0207681_1000041924 | 316 |
| 657 | 3300025925 | Ga0207650_10015411 | Ga0207650_100154113 | 316 |
| 658 | 3300025925 | Ga0207650_10033937 | Ga0207650_100339373 | 316 |
| 659 | 3300025926 | Ga0207659_10000283 | Ga0207659_100002836 | 316 |
| 660 | 3300025926 | Ga0207659_10148369 | Ga0207659_101483691 | 316 |
| 661 | 3300025927 | Ga0207687_10004337 | Ga0207687_100043376 | 316 |
| 662 | 3300025928 | Ga0207700_10092585 | Ga0207700_100925852 | 316 |
| 663 | 3300025929 | Ga0207664_10123088 | Ga0207664_101230882 | 316 |
| 664 | 3300025931 | Ga0207644_10004405 | Ga0207644_100044056 | 316 |
| 665 | 3300025931 | Ga0207644_10130507 | Ga0207644_101305072 | 316 |
| 666 | 3300025932 | Ga0207690_10000808 | Ga0207690_1000080815 | 316 |
| 667 | 3300025932 | Ga0207690_10155973 | Ga0207690_101559732 | 316 |
| 668 | 3300025932 | Ga0207690_10361985 | Ga0207690_103619851 | 316 |
| 669 | 3300025933 | Ga0207706_10000734 | Ga0207706_100007345 | 316 |
| 670 | 3300025933 | Ga0207706_10030769 | Ga0207706_100307693 | 316 |
| 671 | 3300025933 | Ga0207706_10075490 | Ga0207706_100754903 | 316 |
| 672 | 3300025934 | Ga0207686_10000879 | Ga0207686_1000087911 | 316 |
| 673 | 3300025934 | Ga0207686_10012514 | Ga0207686_100125143 | 316 |
| 674 | 3300025935 | Ga0207709_10005908 | Ga0207709_100059086 | 316 |
| 675 | 3300025935 | Ga0207709_10021837 | Ga0207709_100218373 | 316 |
| 676 | 3300025936 | Ga0207670_10001927 | Ga0207670_100019273 | 316 |
| 677 | 3300025937 | Ga0207669_10000204 | Ga0207669_100002046 | 316 |
| 678 | 3300025938 | Ga0207704_10002129 | Ga0207704_100021296 | 316 |
| 679 | 3300025938 | Ga0207704_10012427 | Ga0207704_100124273 | 316 |
| 680 | 3300025938 | Ga0207704_10147842 | Ga0207704_101478421 | 316 |
| 681 | 3300025939 | Ga0207665_10001684 | Ga0207665_1000168410 | 316 |
| 682 | 3300025940 | Ga0207691_10000309 | Ga0207691_1000030929 | 316 |
| 683 | 3300025941 | Ga0207711_10009863 | Ga0207711_100098634 | 316 |
| 684 | 3300025941 | Ga0207711_10013666 | Ga0207711_100136665 | 316 |
| 685 | 3300025941 | Ga0207711_10034929 | Ga0207711_100349291 | 316 |
| 686 | 3300025941 | Ga0207711_10066720 | Ga0207711_100667203 | 316 |
| 687 | 3300025942 | Ga0207689_10000893 | Ga0207689_100008935 | 316 |
| 688 | 3300025942 | Ga0207689_10039885 | Ga0207689_100398853 | 316 |
| 689 | 3300025942 | Ga0207689_10050215 | Ga0207689_100502154 | 316 |
| 690 | 3300025944 | Ga0207661_10003381 | Ga0207661_100033813 | 316 |
| 691 | 3300025945 | Ga0207679_10000128 | Ga0207679_1000012826 | 316 |
| 692 | 3300025945 | Ga0207679_10098406 | Ga0207679_100984062 | 316 |
| 693 | 3300025945 | Ga0207679_10352196 | Ga0207679_103521961 | 316 |
| 694 | 3300025949 | Ga0207667_10015642 | Ga0207667_100156425 | 316 |
| 695 | 3300025960 | Ga0207651_10003175 | Ga0207651_100031752 | 316 |
| 696 | 3300025960 | Ga0207651_10042390 | Ga0207651_100423903 | 316 |
| 697 | 3300025961 | Ga0207712_10003264 | Ga0207712_100032644 | 316 |
| 698 | 3300025961 | Ga0207712_10156181 | Ga0207712_101561812 | 316 |
| 699 | 3300025972 | Ga0207668_10002555 | Ga0207668_100025555 | 316 |
| 700 | 3300025972 | Ga0207668_10359020 | Ga0207668_103590201 | 316 |
| 701 | 3300025981 | Ga0207640_10005063 | Ga0207640_100050635 | 316 |
| 702 | 3300025986 | Ga0207658_10005664 | Ga0207658_100056644 | 316 |
| 703 | 3300025986 | Ga0207658_10027783 | Ga0207658_100277832 | 316 |
| 704 | 3300026023 | Ga0207677_10008643 | Ga0207677_100086434 | 316 |
| 705 | 3300026035 | Ga0207703_10007507 | Ga0207703_100075073 | 316 |
| 706 | 3300026035 | Ga0207703_10063935 | Ga0207703_100639353 | 316 |
| 707 | 3300026035 | Ga0207703_10390262 | Ga0207703_103902621 | 316 |
| 708 | 3300026041 | Ga0207639_10007584 | Ga0207639_100075843 | 316 |
| 709 | 3300026067 | Ga0207678_10000759 | Ga0207678_100007595 | 316 |
| 710 | 3300026067 | Ga0207678_10020189 | Ga0207678_100201893 | 316 |
| 711 | 3300026067 | Ga0207678_10026240 | Ga0207678_100262403 | 316 |
| 712 | 3300026067 | Ga0207678_10094566 | Ga0207678_100945662 | 316 |
| 713 | 3300026075 | Ga0207708_10000391 | Ga0207708_100003915 | 316 |
| 714 | 3300026075 | Ga0207708_10098573 | Ga0207708_100985733 | 316 |
| 715 | 3300026078 | Ga0207702_10008180 | Ga0207702_100081803 | 316 |
| 716 | 3300026078 | Ga0207702_10547262 | Ga0207702_105472621 | 316 |
| 717 | 3300026088 | Ga0207641_10006199 | Ga0207641_100061996 | 316 |
| 718 | 3300026089 | Ga0207648_10000862 | Ga0207648_100008625 | 316 |
| 719 | 3300026095 | Ga0207676_10003505 | Ga0207676_100035053 | 316 |
| 720 | 3300026116 | Ga0207674_10000806 | Ga0207674_1000080635 | 316 |
| 721 | 3300026118 | Ga0207675_100000637 | Ga0207675_10000063729 | 316 |
| 722 | 3300026121 | Ga0207683_10000330 | Ga0207683_1000033025 | 316 |
| 723 | 3300026121 | Ga0207683_10006268 | Ga0207683_100062685 | 316 |
| 724 | 3300026121 | Ga0207683_10030655 | Ga0207683_100306552 | 316 |
| 725 | 3300026142 | Ga0207698_10002562 | Ga0207698_100025625 | 316 |
| 726 | 3300027617 | Ga0210002_1001079 | Ga0210002_10010792 | 316 |
| 727 | 3300027665 | Ga0209983_1006352 | Ga0209983_10063522 | 316 |
| 728 | 3300027682 | Ga0209971_1008242 | Ga0209971_10082422 | 316 |
| 729 | 3300027695 | Ga0209966_1001959 | Ga0209966_10019593 | 316 |
| 730 | 3300027717 | Ga0209998_10001428 | Ga0209998_100014283 | 316 |
| 731 | 3300027717 | Ga0209998_10002841 | Ga0209998_100028413 | 316 |
| 732 | 3300027876 | Ga0209974_10000230 | Ga0209974_1000023017 | 316 |
| 733 | 3300027907 | Ga0207428_10000164 | Ga0207428_1000016491 | 316 |
| 734 | 3300027907 | Ga0207428_10000815 | Ga0207428_1000081518 | 316 |
| 735 | 3300027907 | Ga0207428_10001706 | Ga0207428_1000170619 | 316 |
| 736 | 3300028379 | Ga0268266_10070826 | Ga0268266_100708263 | 316 |
| 737 | 3300028380 | Ga0268265_10002566 | Ga0268265_100025669 | 316 |
| 738 | 3300028380 | Ga0268265_10038962 | Ga0268265_100389621 | 316 |
| 739 | 3300028381 | Ga0268264_10006412 | Ga0268264_100064123 | 316 |
| 740 | 3300028381 | Ga0268264_10370132 | Ga0268264_103701322 | 316 |
| 741 | 3300031241 | Ga0265325_10004813 | Ga0265325_100048134 | 316 |
| 742 | 3300034816 | Ga0373930_0000057 | Ga0373930_0000057_9063_10034 | 316 |
| 743 | 3300034817 | Ga0373948_0001657 | Ga0373948_0001657_2161_3132 | 316 |
| 744 | 3300034817 | Ga0373948_0009265 | Ga0373948_0009265_24_995 | 316 |
| 745 | 3300034818 | Ga0373950_0004566 | Ga0373950_0004566_91_1062 | 316 |
| 746 | 3300034818 | Ga0373950_0004808 | Ga0373950_0004808_677_1648 | 316 |
| 747 | 3300034819 | Ga0373958_0006518 | Ga0373958_0006518_719_1690 | 316 |
| 748 | 3300034820 | Ga0373959_0002313 | Ga0373959_0002313_1146_2117 | 316 |
| 749 | 3300034820 | Ga0373959_0006569 | Ga0373959_0006569_466_1437 | 316 |
| 750 | 3300034957 | Ga0373938_0003139 | Ga0373938_0003139_1439_2410 | 316 |
| 751 | 3300035084 | Ga0373928_0002217 | Ga0373928_0002217_577_1548 | 316 |
| 752 | 3300035084 | Ga0373928_0009085 | Ga0373928_0009085_704_1675 | 316 |
| 753 | 3300035085 | Ga0373929_0003213 | Ga0373929_0003213_1562_2533 | 316 |
| 754 | 3300035086 | Ga0373934_0098298 | Ga0373934_0098298_50_1021 | 316 |
| 755 | 3300035089 | Ga0373944_0002521 | Ga0373944_0002521_619_1590 | 316 |
| 756 | 3300035090 | Ga0373949_0004678 | Ga0373949_0004678_1717_2688 | 316 |
| 757 | 3300035090 | Ga0373949_0005109 | Ga0373949_0005109_1464_2435 | 316 |
| 758 | 3300035091 | Ga0373951_0000341 | Ga0373951_0000341_10847_11818 | 316 |
| 759 | 3300035092 | Ga0373952_0001033 | Ga0373952_0001033_1926_2897 | 316 |
| 760 | 3300035092 | Ga0373952_0001903 | Ga0373952_0001903_780_1751 | 316 |
| 761 | 3300035111 | Ga0373923_0034403 | Ga0373923_0034403_92_1063 | 316 |
| 762 | 3300035112 | Ga0373932_0003901 | Ga0373932_0003901_1850_2821 | 316 |
| 763 | 3300035113 | Ga0373936_0020827 | Ga0373936_0020827_947_2032 | 316 |
| 764 | 3300035113 | Ga0373936_0029771 | Ga0373936_0029771_131_1102 | 316 |
| 765 | 3300035114 | Ga0373939_0001163 | Ga0373939_0001163_4495_5466 | 316 |
| 766 | 3300035114 | Ga0373939_0001797 | Ga0373939_0001797_3488_4459 | 316 |
| 767 | 3300035114 | Ga0373939_0007281 | Ga0373939_0007281_1051_2022 | 316 |
| 768 | 3300035115 | Ga0373941_0000752 | Ga0373941_0000752_5541_6512 | 316 |
| 769 | 3300035115 | Ga0373941_0001091 | Ga0373941_0001091_3470_4441 | 316 |
| 770 | 3300035117 | Ga0373953_0042816 | Ga0373953_0042816_496_1581 | 316 |
| 771 | 3300035118 | Ga0373954_0022731 | Ga0373954_0022731_1676_2761 | 316 |
| 772 | 3300035119 | Ga0373956_0015149 | Ga0373956_0015149_1850_2935 | 316 |
| 773 | 3300035119 | Ga0373956_0020919 | Ga0373956_0020919_373_1344 | 316 |
| 774 | 3300035120 | Ga0373957_0012274 | Ga0373957_0012274_975_2060 | 316 |
| 775 | 3300035121 | Ga0373960_0000509 | Ga0373960_0000509_1050_2021 | 316 |
| 776 | 3300035170 | Ga0373943_0006224 | Ga0373943_0006224_3808_4779 | 316 |
| 777 | 3300035171 | Ga0373946_0018601 | Ga0373946_0018601_730_1701 | 316 |
| 778 | 3300035172 | Ga0373955_0000998 | Ga0373955_0000998_292_1263 | 316 |
| 779 | 3300035172 | Ga0373955_0001557 | Ga0373955_0001557_1986_3071 | 316 |
| 780 | 3300035207 | Ga0373942_0002104 | Ga0373942_0002104_2525_3496 | 316 |
| 781 | 3300035207 | Ga0373942_0020612 | Ga0373942_0020612_340_1311 | 316 |
| 782 | 3300035241 | Ga0373961_0001381 | Ga0373961_0001381_134_1105 | 316 |
| 783 | 3300035241 | Ga0373961_0038624 | Ga0373961_0038624_295_1266 | 316 |
| 784 | 3300035242 | Ga0373962_0000553 | Ga0373962_0000553_2394_3365 | 316 |
| 785 | 3300035242 | Ga0373962_0004172 | Ga0373962_0004172_551_1522 | 316 |
| 786 | 3300035242 | Ga0373962_0019285 | Ga0373962_0019285_353_1324 | 316 |
| 787 | 3300035410 | Ga0373924_0001412 | Ga0373924_0001412_4262_5233 | 316 |
| 788 | 3300035410 | Ga0373924_0009677 | Ga0373924_0009677_986_1957 | 316 |
| 789 | 3300035691 | Ga0373931_0002430 | Ga0373931_0002430_5135_6106 | 316 |
| 790 | 3300035691 | Ga0373931_0089167 | Ga0373931_0089167_340_1311 | 316 |
| 791 | 3300035691 | Ga0373931_0101336 | Ga0373931_0101336_223_1299 | 316 |
| 792 | 3300035692 | Ga0373935_0016753 | Ga0373935_0016753_2400_3371 | 316 |
| 793 | 3300035692 | Ga0373935_0046383 | Ga0373935_0046383_1357_2328 | 316 |
| 794 | 3300035695 | Ga0373927_0139121 | Ga0373927_0139121_165_1136 | 316 |
| 795 | 3300035724 | Ga0373933_0019278 | Ga0373933_0019278_550_1635 | 316 |
| 796 | 3300035725 | Ga0373947_0001287 | Ga0373947_0001287_5456_6427 | 316 |
| 797 | 3300035725 | Ga0373947_0117761 | Ga0373947_0117761_268_1239 | 316 |
| 798 | 3300036401 | Ga0373937_0001774 | Ga0373937_0001774_10420_11391 | 316 |
| 799 | 3300036401 | Ga0373937_0177517 | Ga0373937_0177517_923_1894 | 316 |
| 800 | 3300036647 | Ga0316582_0144556 | Ga0316582_0144556_10_1143 | 316 |
| 801 | 3300037068 | Ga0373925_0057368 | Ga0373925_0057368_562_1533 | 316 |
| 802 | 3300037068 | Ga0373925_0071936 | Ga0373925_0071936_1112_2083 | 316 |
| 803 | 3300042016 | Ga0439463_008198 | Ga0439463_008198_292_1263 | 316 |
| 804 | 3300042876 | Ga0451577_0067584 | Ga0451577_0067584_254_1225 | 316 |
| 805 | 3300045051 | Ga0451576_0281917 | Ga0451576_0281917_215_1186 | 316 |
| 806 | 3300046454 | Ga0495592_0017778 | Ga0495592_0017778_2017_2988 | 316 |
| 807 | 3300046454 | Ga0495592_0023319 | Ga0495592_0023319_2980_3951 | 316 |
| 808 | 3300046454 | Ga0495592_0029219 | Ga0495592_0029219_2667_3752 | 316 |
| 809 | 3300046455 | Ga0495603_0010286 | Ga0495603_0010286_775_1746 | 316 |
| 810 | 3300046459 | Ga0495629_0134926 | Ga0495629_0134926_521_1492 | 316 |
| 811 | 3300046459 | Ga0495629_0271185 | Ga0495629_0271185_164_1135 | 316 |
| 812 | 3300046460 | Ga0495638_0059425 | Ga0495638_0059425_832_1803 | 316 |
| 813 | 3300046462 | Ga0495651_0008162 | Ga0495651_0008162_1003_1974 | 316 |
| 814 | 3300046462 | Ga0495651_0009584 | Ga0495651_0009584_1519_2490 | 316 |
| 815 | 3300046462 | Ga0495651_0027137 | Ga0495651_0027137_1186_2271 | 316 |
| 816 | 3300046463 | Ga0495653_0019240 | Ga0495653_0019240_1113_2084 | 316 |
| 817 | 3300046463 | Ga0495653_0032847 | Ga0495653_0032847_492_1577 | 316 |
| 818 | 3300046472 | Ga0495580_0017021 | Ga0495580_0017021_2076_3047 | 316 |
| 819 | 3300046473 | Ga0495582_0010775 | Ga0495582_0010775_1993_2964 | 316 |
| 820 | 3300046475 | Ga0495639_0065883 | Ga0495639_0065883_310_1281 | 316 |
| 821 | 3300046475 | Ga0495639_0134523 | Ga0495639_0134523_169_1140 | 316 |
| 822 | 3300046476 | Ga0495662_0032617 | Ga0495662_0032617_134_1105 | 316 |
| 823 | 3300046477 | Ga0495664_0001573 | Ga0495664_0001573_10215_11300 | 316 |
| 824 | 3300046477 | Ga0495664_0013502 | Ga0495664_0013502_1866_2837 | 316 |
| 825 | 3300046477 | Ga0495664_0020642 | Ga0495664_0020642_703_1674 | 316 |
| 826 | 3300046491 | Ga0495584_0109421 | Ga0495584_0109421_86_1057 | 316 |
| 827 | 3300046492 | Ga0495585_0023565 | Ga0495585_0023565_1785_2756 | 316 |
| 828 | 3300046499 | Ga0495594_0032856 | Ga0495594_0032856_1692_2663 | 316 |
| 829 | 3300046499 | Ga0495594_0067084 | Ga0495594_0067084_640_1611 | 316 |
| 830 | 3300046501 | Ga0495607_0008175 | Ga0495607_0008175_1722_2693 | 316 |
| 831 | 3300046511 | Ga0495608_0010527 | Ga0495608_0010527_2765_3850 | 316 |
| 832 | 3300046511 | Ga0495608_0013659 | Ga0495608_0013659_2433_3404 | 316 |
| 833 | 3300046511 | Ga0495608_0073807 | Ga0495608_0073807_510_1481 | 316 |
| 834 | 3300046514 | Ga0495618_0004210 | Ga0495618_0004210_1984_3069 | 316 |
| 835 | 3300046514 | Ga0495618_0065107 | Ga0495618_0065107_106_1077 | 316 |
| 836 | 3300046516 | Ga0495628_0003455 | Ga0495628_0003455_6800_7771 | 316 |
| 837 | 3300046516 | Ga0495628_0036997 | Ga0495628_0036997_2348_3319 | 316 |
| 838 | 3300046516 | Ga0495628_0048386 | Ga0495628_0048386_2088_3173 | 316 |
| 839 | 3300046517 | Ga0495630_0061516 | Ga0495630_0061516_230_1201 | 316 |
| 840 | 3300046517 | Ga0495630_0222646 | Ga0495630_0222646_97_1068 | 316 |
| 841 | 3300046523 | Ga0495644_0001086 | Ga0495644_0001086_9663_10634 | 316 |
| 842 | 3300046526 | Ga0495666_0083998 | Ga0495666_0083998_29_1000 | 316 |
| 843 | 3300046529 | Ga0495652_0013724 | Ga0495652_0013724_2666_3637 | 316 |
| 844 | 3300046529 | Ga0495652_0022189 | Ga0495652_0022189_198_1283 | 316 |
| 845 | 3300046529 | Ga0495652_0040814 | Ga0495652_0040814_1883_2854 | 316 |
| 846 | 3300046529 | Ga0495652_0225300 | Ga0495652_0225300_251_1222 | 316 |
| 847 | 3300046531 | Ga0495665_0073438 | Ga0495665_0073438_172_1143 | 316 |
| 848 | 3300046533 | Ga0495640_0025674 | Ga0495640_0025674_2584_3669 | 316 |
| 849 | 3300046533 | Ga0495640_0203025 | Ga0495640_0203025_58_1029 | 316 |
| 850 | 3300046535 | Ga0495586_0013594 | Ga0495586_0013594_2176_3261 | 316 |
| 851 | 3300046536 | Ga0495587_0004856 | Ga0495587_0004856_7541_8626 | 316 |
| 852 | 3300046536 | Ga0495587_0028036 | Ga0495587_0028036_272_1243 | 316 |
| 853 | 3300046543 | Ga0495645_0001639 | Ga0495645_0001639_13544_14629 | 316 |
| 854 | 3300046543 | Ga0495645_0005664 | Ga0495645_0005664_1482_2453 | 316 |
| 855 | 3300046543 | Ga0495645_0074217 | Ga0495645_0074217_353_1324 | 316 |
| 856 | 3300046557 | Ga0495622_0010042 | Ga0495622_0010042_2305_3276 | 316 |
| 857 | 3300046557 | Ga0495622_0130847 | Ga0495622_0130847_57_1028 | 316 |
| 858 | 3300046558 | Ga0495633_0011736 | Ga0495633_0011736_3684_4655 | 316 |
| 859 | 3300046559 | Ga0495667_0005288 | Ga0495667_0005288_5038_6123 | 316 |
| 860 | 3300046559 | Ga0495667_0031399 | Ga0495667_0031399_182_1153 | 316 |
| 861 | 3300046559 | Ga0495667_0040965 | Ga0495667_0040965_1715_2686 | 316 |
| 862 | 3300046615 | Ga0495656_0001089 | Ga0495656_0001089_1747_2718 | 316 |
| 863 | 3300046642 | Ga0495634_0016364 | Ga0495634_0016364_3132_4217 | 316 |
| 864 | 3300046663 | Ga0495635_0000337 | Ga0495635_0000337_3806_4891 | 316 |
| 865 | 3300046663 | Ga0495635_0007593 | Ga0495635_0007593_4212_5183 | 316 |
| 866 | 3300046663 | Ga0495635_0035522 | Ga0495635_0035522_34_1005 | 316 |
| 867 | 3300046663 | Ga0495635_0036181 | Ga0495635_0036181_2011_2982 | 316 |
| 868 | 3300046664 | Ga0495659_0001476 | Ga0495659_0001476_6127_7098 | 316 |
| 869 | 3300046665 | Ga0495661_0007028 | Ga0495661_0007028_6593_7564 | 316 |
| 870 | 3300046674 | Ga0495588_0013858 | Ga0495588_0013858_837_1808 | 316 |
| 871 | 3300046675 | Ga0495657_0001580 | Ga0495657_0001580_14067_15038 | 316 |
| 872 | 3300046675 | Ga0495657_0030152 | Ga0495657_0030152_1236_2207 | 316 |
| 873 | 3300046675 | Ga0495657_0207652 | Ga0495657_0207652_110_1081 | 316 |
| 874 | 3300046678 | Ga0495599_0018494 | Ga0495599_0018494_3266_4237 | 316 |
| 875 | 3300046678 | Ga0495599_0019711 | Ga0495599_0019711_2962_3933 | 316 |
| 876 | 3300046679 | Ga0495623_0000723 | Ga0495623_0000723_3592_4677 | 316 |
| 877 | 3300046679 | Ga0495623_0078996 | Ga0495623_0078996_876_1847 | 316 |
| 878 | 3300046680 | Ga0495646_0002017 | Ga0495646_0002017_2604_3689 | 316 |
| 879 | 3300046680 | Ga0495646_0028777 | Ga0495646_0028777_584_1555 | 316 |
| 880 | 3300046681 | Ga0495647_0016555 | Ga0495647_0016555_1121_2092 | 316 |
| 881 | 3300046683 | Ga0495658_0000221 | Ga0495658_0000221_3624_4595 | 316 |
| 882 | 3300046683 | Ga0495658_0038807 | Ga0495658_0038807_1163_2134 | 316 |
| 883 | 3300046689 | Ga0495613_0112336 | Ga0495613_0112336_11_982 | 316 |
| 884 | 3300046690 | Ga0495624_0041634 | Ga0495624_0041634_442_1413 | 316 |
| 885 | 3300046690 | Ga0495624_0066693 | Ga0495624_0066693_971_2056 | 316 |
| 886 | 3300046691 | Ga0495670_0001346 | Ga0495670_0001346_5145_6116 | 316 |
| 887 | 3300046809 | Ga0495600_0000619 | Ga0495600_0000619_6559_7530 | 316 |
| 888 | 3300046809 | Ga0495600_0000936 | Ga0495600_0000936_786_1871 | 316 |
| 889 | 3300046809 | Ga0495600_0004078 | Ga0495600_0004078_5482_6453 | 316 |
| 890 | 3300046810 | Ga0495660_0105716 | Ga0495660_0105716_347_1318 | 316 |
| 891 | 3300047315 | Ga0495581_0014587 | Ga0495581_0014587_1407_2378 | 316 |
| 892 | 3300047315 | Ga0495581_0028658 | Ga0495581_0028658_1967_2938 | 316 |
| 893 | 3300047317 | Ga0495604_0008572 | Ga0495604_0008572_1346_2317 | 316 |
| 894 | 3300047317 | Ga0495604_0009858 | Ga0495604_0009858_1957_3042 | 316 |
| 895 | 3300047317 | Ga0495604_0023992 | Ga0495604_0023992_3240_4211 | 316 |
| 896 | 3300047317 | Ga0495604_0037657 | Ga0495604_0037657_1682_2653 | 316 |
| 897 | 3300047317 | Ga0495604_0110796 | Ga0495604_0110796_296_1267 | 316 |
| 898 | 3300047319 | Ga0495674_0001395 | Ga0495674_0001395_1761_2846 | 316 |
| 899 | 3300047319 | Ga0495674_0010509 | Ga0495674_0010509_6157_7128 | 316 |
| 900 | 3300047319 | Ga0495674_0303528 | Ga0495674_0303528_227_1198 | 316 |
| 901 | 3300047322 | Ga0495680_0002033 | Ga0495680_0002033_17484_18569 | 316 |
| 902 | 3300047322 | Ga0495680_0007002 | Ga0495680_0007002_7055_8026 | 316 |
| 903 | 3300047322 | Ga0495680_0019881 | Ga0495680_0019881_3528_4499 | 316 |
| 904 | 3300047322 | Ga0495680_0024415 | Ga0495680_0024415_2519_3490 | 316 |
| 905 | 3300047322 | Ga0495680_0026609 | Ga0495680_0026609_1476_2447 | 316 |
| 906 | 3300047444 | Ga0495675_0000716 | Ga0495675_0000716_4029_5114 | 316 |
| 907 | 3300047471 | Ga0495684_0008600 | Ga0495684_0008600_5691_6662 | 316 |
| 908 | 3300047471 | Ga0495684_0095331 | Ga0495684_0095331_447_1532 | 316 |
| 909 | 3300047673 | Ga0495593_0020521 | Ga0495593_0020521_452_1423 | 316 |
| 910 | 3300047673 | Ga0495593_0023727 | Ga0495593_0023727_1000_1971 | 316 |
| 911 | 3300047673 | Ga0495593_0036543 | Ga0495593_0036543_628_1599 | 316 |
| 912 | 3300048088 | Ga0495602_0010114 | Ga0495602_0010114_3249_4220 | 316 |
| 913 | 3300048088 | Ga0495602_0025010 | Ga0495602_0025010_4101_5186 | 316 |
| 914 | 3300048089 | Ga0495614_0049400 | Ga0495614_0049400_354_1325 | 316 |
| 915 | 3300048089 | Ga0495614_0115959 | Ga0495614_0115959_189_1160 | 316 |
| 916 | 3300048903 | Ga0496100_0001614 | Ga0496100_0001614_4378_5349 | 316 |
| 917 | 3300048903 | Ga0496100_0002013 | Ga0496100_0002013_1911_2987 | 316 |
| 918 | 3300048904 | Ga0496101_0002338 | Ga0496101_0002338_4767_5738 | 316 |
| 919 | 3300048904 | Ga0496101_0121203 | Ga0496101_0121203_924_1946 | 316 |
| 920 | 3300048905 | Ga0496102_0009896 | Ga0496102_0009896_6303_7274 | 316 |
| 921 | 3300048905 | Ga0496102_0076321 | Ga0496102_0076321_1692_2768 | 316 |
| 922 | 3300048906 | Ga0496103_0001271 | Ga0496103_0001271_9393_10364 | 316 |
| 923 | 3300048906 | Ga0496103_0159084 | Ga0496103_0159084_78_1049 | 316 |
| 924 | 3300048907 | Ga0496104_0013151 | Ga0496104_0013151_2539_3510 | 316 |
| 925 | 3300048907 | Ga0496104_0240792 | Ga0496104_0240792_342_1418 | 316 |
| 926 | 3300048907 | Ga0496104_0398623 | Ga0496104_0398623_238_1209 | 316 |
| 927 | 3300048908 | Ga0496105_0001594 | Ga0496105_0001594_8318_9289 | 316 |
| 928 | 3300048908 | Ga0496105_0089643 | Ga0496105_0089643_1295_2371 | 316 |
| 929 | 3300048909 | Ga0496106_0004028 | Ga0496106_0004028_5753_6724 | 316 |
| 930 | 3300048909 | Ga0496106_0045330 | Ga0496106_0045330_2273_3244 | 316 |
| 931 | 3300048909 | Ga0496106_0140721 | Ga0496106_0140721_503_1474 | 316 |
| 932 | 3300048909 | Ga0496106_0363003 | Ga0496106_0363003_117_1088 | 316 |
| 933 | 3300048910 | Ga0496107_0006617 | Ga0496107_0006617_2479_3450 | 316 |
| 934 | 3300048910 | Ga0496107_0062685 | Ga0496107_0062685_1622_2593 | 316 |
| 935 | 3300048910 | Ga0496107_0150293 | Ga0496107_0150293_138_1109 | 316 |
| 936 | 3300048911 | Ga0496108_0000693 | Ga0496108_0000693_4436_5407 | 316 |
| 937 | 3300048911 | Ga0496108_0005626 | Ga0496108_0005626_6789_7760 | 316 |
| 938 | 3300048912 | Ga0496109_0006483 | Ga0496109_0006483_5347_6318 | 316 |
| 939 | 3300048912 | Ga0496109_0007782 | Ga0496109_0007782_2479_3450 | 316 |
| 940 | 3300048912 | Ga0496109_0061612 | Ga0496109_0061612_849_1925 | 316 |
| 941 | 3300048912 | Ga0496109_0172714 | Ga0496109_0172714_387_1358 | 316 |
| 942 | 3300048913 | Ga0496110_0051870 | Ga0496110_0051870_738_1709 | 316 |
| 943 | 3300048913 | Ga0496110_0090904 | Ga0496110_0090904_1663_2634 | 316 |
| 944 | 3300048913 | Ga0496110_0141793 | Ga0496110_0141793_315_1400 | 316 |
| 945 | 3300048914 | Ga0496111_0004679 | Ga0496111_0004679_7397_8368 | 316 |
| 946 | 3300048914 | Ga0496111_0142288 | Ga0496111_0142288_310_1386 | 316 |
| 947 | 3300048915 | Ga0496112_0001842 | Ga0496112_0001842_12250_13221 | 316 |
| 948 | 3300048915 | Ga0496112_0099336 | Ga0496112_0099336_1863_2834 | 316 |
| 949 | 3300048916 | Ga0496113_0009047 | Ga0496113_0009047_1773_2744 | 316 |
| 950 | 3300048916 | Ga0496113_0071201 | Ga0496113_0071201_900_1976 | 316 |
| 951 | 3300048916 | Ga0496113_0198002 | Ga0496113_0198002_499_1470 | 316 |
| 952 | 3300048917 | Ga0496114_0047239 | Ga0496114_0047239_1128_2099 | 316 |
| 953 | 3300048917 | Ga0496114_0053250 | Ga0496114_0053250_943_1971 | 316 |
| 954 | 3300048917 | Ga0496114_0415992 | Ga0496114_0415992_207_1178 | 316 |
| 955 | 3300048918 | Ga0496115_0042697 | Ga0496115_0042697_1047_2018 | 316 |
| 956 | 3300048918 | Ga0496115_0052320 | Ga0496115_0052320_312_1283 | 316 |
| 957 | 3300048918 | Ga0496115_0151627 | Ga0496115_0151627_783_1868 | 316 |
| 958 | 3300049573 | Ga0501037_0049652 | Ga0501037_0049652_1949_2920 | 316 |
| 959 | 3300049574 | Ga0501038_0055563 | Ga0501038_0055563_1695_2666 | 316 |
| 960 | 3300049574 | Ga0501038_0086495 | Ga0501038_0086495_153_1124 | 316 |
| 961 | 3300049574 | Ga0501038_0215001 | Ga0501038_0215001_454_1428 | 316 |
| 962 | 3300049578 | Ga0501042_0225216 | Ga0501042_0225216_223_1194 | 316 |
| 963 | 3300049581 | Ga0501047_0094930 | Ga0501047_0094930_244_1215 | 316 |
| 964 | 3300049582 | Ga0501048_0287479 | Ga0501048_0287479_85_1056 | 316 |
| 965 | 3300049584 | Ga0501068_0117101 | Ga0501068_0117101_505_1476 | 316 |
| 966 | 3300049585 | Ga0501069_0212107 | Ga0501069_0212107_66_1037 | 316 |
| 967 | 3300049586 | Ga0501070_0048612 | Ga0501070_0048612_124_1095 | 316 |
| 968 | 3300049586 | Ga0501070_0055929 | Ga0501070_0055929_1948_2919 | 316 |
| 969 | 3300049587 | Ga0501071_0011718 | Ga0501071_0011718_4083_5054 | 316 |
| 970 | 3300049589 | Ga0501073_0138779 | Ga0501073_0138779_152_1123 | 316 |
| 971 | 3300049744 | Ga0501083_0262086 | Ga0501083_0262086_114_1085 | 316 |
| 972 | 3300049822 | Ga0501035_0081308 | Ga0501035_0081308_863_1834 | 316 |
| 973 | 3300049822 | Ga0501035_0143535 | Ga0501035_0143535_542_1513 | 316 |
| 974 | 3300049823 | Ga0501044_0352224 | Ga0501044_0352224_305_1276 | 316 |
| 975 | 3300050494 | nmdc:mga06z11_8879_c1 | nmdc:mga06z11_8879_c1_40_1011 | 316 |
| 976 | 3300050496 | nmdc:mga07m45_25315_c1 | nmdc:mga07m45_25315_c1_299_1270 | 316 |
| 977 | 3300050507 | nmdc:mga05p37_1375_c1 | nmdc:mga05p37_1375_c1_11348_12319 | 316 |
| 978 | 3300050508 | nmdc:mga09592_4676_c1 | nmdc:mga09592_4676_c1_2166_3137 | 316 |
| 979 | 3300050509 | nmdc:mga0qj67_959_c1 | nmdc:mga0qj67_959_c1_15509_16480 | 316 |
| 980 | 3300050510 | nmdc:mga06r32_592_c1 | nmdc:mga06r32_592_c1_20642_21613 | 316 |
| 981 | 3300050511 | nmdc:mga08y16_108_c1 | nmdc:mga08y16_108_c1_5739_6710 | 316 |
| 982 | 3300050511 | nmdc:mga08y16_19155_c1 | nmdc:mga08y16_19155_c1_140_1111 | 316 |
| 983 | 3300050511 | nmdc:mga08y16_4119_c1 | nmdc:mga08y16_4119_c1_8460_9431 | 316 |
| 984 | 3300050511 | nmdc:mga08y16_447745_c1 | nmdc:mga08y16_447745_c1_189_1160 | 316 |
| 985 | 3300050512 | nmdc:mga0n895_104_c1 | nmdc:mga0n895_104_c1_46251_47222 | 316 |
| 986 | 3300050512 | nmdc:mga0n895_148662_c1 | nmdc:mga0n895_148662_c1_698_1669 | 316 |
| 987 | 3300050512 | nmdc:mga0n895_337_c1 | nmdc:mga0n895_337_c1_3531_4502 | 316 |
| 988 | 3300050513 | nmdc:mga0rr50_1110_c1 | nmdc:mga0rr50_1110_c1_10055_11026 | 316 |
| 989 | 3300050513 | nmdc:mga0rr50_17098_c1 | nmdc:mga0rr50_17098_c1_2212_3183 | 316 |
| 990 | 3300050514 | nmdc:mga08x19_95882_c1 | nmdc:mga08x19_95882_c1_770_1741 | 316 |
| 991 | 3300050515 | nmdc:mga0a205_2128_c1 | nmdc:mga0a205_2128_c1_12917_13888 | 316 |
| 992 | 3300050515 | nmdc:mga0a205_2355_c2 | nmdc:mga0a205_2355_c2_330_1301 | 316 |
| 993 | 3300053077 | Ga0495601_0000280 | Ga0495601_0000280_16257_17228 | 316 |
| 994 | 3300053077 | Ga0495601_0001337 | Ga0495601_0001337_8612_9583 | 316 |
| 995 | 3300053077 | Ga0495601_0015893 | Ga0495601_0015893_931_2016 | 316 |
| 996 | 3300053077 | Ga0495601_0074515 | Ga0495601_0074515_837_1808 | 316 |
| 997 | 3300053078 | Ga0495612_0000501 | Ga0495612_0000501_6806_7777 | 316 |
| 998 | 3300053078 | Ga0495612_0010034 | Ga0495612_0010034_1055_2026 | 316 |
| 999 | 3300053078 | Ga0495612_0010083 | Ga0495612_0010083_2539_3624 | 316 |
| 1000 | 3300053078 | Ga0495612_0012382 | Ga0495612_0012382_1307_2278 | 316 |
| 1001 | 3300053078 | Ga0495612_0030723 | Ga0495612_0030723_1047_2018 | 316 |
| 1002 | 3300053084 | Ga0495595_0000612 | Ga0495595_0000612_8007_8978 | 316 |
| 1003 | 3300053084 | Ga0495595_0002010 | Ga0495595_0002010_51_1022 | 316 |
| 1004 | 3300053084 | Ga0495595_0003562 | Ga0495595_0003562_1832_2917 | 316 |
| 1005 | 3300053084 | Ga0495595_0009498 | Ga0495595_0009498_972_1943 | 316 |
| 1006 | 3300053085 | Ga0495619_0000048 | Ga0495619_0000048_6628_7599 | 316 |
| 1007 | 3300053085 | Ga0495619_0000314 | Ga0495619_0000314_17766_18737 | 316 |
| 1008 | 3300053085 | Ga0495619_0000459 | Ga0495619_0000459_16339_17310 | 316 |
| 1009 | 3300053085 | Ga0495619_0002080 | Ga0495619_0002080_10034_11005 | 316 |
| 1010 | 3300053085 | Ga0495619_0002348 | Ga0495619_0002348_8301_9386 | 316 |
| 1011 | 3300053085 | Ga0495619_0028684 | Ga0495619_0028684_227_1198 | 316 |
| 1012 | 3300053085 | Ga0495619_0127919 | Ga0495619_0127919_292_1263 | 316 |
| 1013 | 3300053087 | Ga0500643_005961 | Ga0500643_005961_3076_4047 | 316 |
| 1014 | 3300053093 | Ga0500651_0074070 | Ga0500651_0074070_251_1222 | 316 |
| 1015 | 3300053094 | Ga0500566_0058957 | Ga0500566_0058957_727_1698 | 316 |
| 1016 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_186283_187254 | 316 |
| 1017 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1374673_1375644 | 316 |
| 1018 | 3300053730 | Ga0500645_000217 | Ga0500645_000217_27276_28247 | 316 |
| 1019 | 3300060353 | Ga0501082_0120968 | Ga0501082_0120968_506_1477 | 316 |
| 1020 | 3300060353 | Ga0501082_0226016 | Ga0501082_0226016_82_1053 | 316 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xdq-assembly3.cif.gz_C | structural and biochemical identification of a novel bacterial oxidoreductase | 0.9459 | 65 | 309 |
| 1xdy-assembly7.cif.gz_G | structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor | 0.9449 | 66 | 308 |
| 1xdy-assembly7.cif.gz_G | structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor | 0.8785 | 66 | 308 |
| 1xdq-assembly3.cif.gz_C | structural and biochemical identification of a novel bacterial oxidoreductase | 0.8768 | 65 | 309 |
| 2ca4-assembly1.cif.gz_A | sulfite dehydrogenase from starkeya novella mutant | 0.8094 | 104 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xdyH00 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.9564 | 65 | 308 | 3.90.420.10 |
| 1xdyH00 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8827 | 65 | 308 | 3.90.420.10 |
| af_P11035_116_359_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.8083 | 109 | 253 | 3.90.420.10 |
| af_P96400_291_442_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.7399 | 100 | 247 | 3.90.420.10 |
| af_A0A0R4IKF7_192_441_3.90.420.10 | Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain | 0.7285 | 104 | 272 | 3.90.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-D9PGU8-F1-model_v4 | Oxidoreductase molybdopterin binding (EC 1.8.2.1) | 0.9756 | 70 | 172 |
GO:0050310
|
| AF-A0A258K6M1-F1-model_v4 | Mononuclear molybdenum enzyme YedY | 0.9696 | 98 | 316 |
|
| AF-A0A162C394-F1-model_v4 | Oxidoreductase molybdopterin-binding domain-containing protein | 0.9673 | 91 | 222 |
|
| AF-A0A388NT57-F1-model_v4 | Protein-methionine-sulfoxide reductase catalytic subunit MsrP | 0.9648 | 114 | 308 |
|
| AF-A0A7Y3TXV4-F1-model_v4 | Protein-methionine-sulfoxide reductase catalytic subunit MsrP (EC 1.8.5.-) | 0.9633 | 76 | 308 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar