F488370

General Info

Members Datasets Scaffolds Average Seq Length
1020 447 1015 324

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0020827|Ga0373936_0020827_947_2032
Length 361
Sequence MGPYDNACRRAGLLSQNCDLPVITERRTYFPRFGRIRAMNVIRRRGWEISDRLAAPEHLVFSRRGFLAGGASALALAPHAASAQRISDVSKIPDPSADLYPAKRNEKYALDRAITDEKINGNYNNFYEFGTSKTVTAAAQALPIRPWTVKIDGMVEKPMEVGIDDLVRKLTLEERTYRHRCVEAWGMAIAWTGFPFAKLVDFARPLGSAKYVRMETFMDPKVAPGQRQPWYPWPYVEGVTMAEATNELAFLVTGAYGHPLARQHGAPLRLALPWKYGFKSIKSIVHFSFTDQRPRGMWEALQPAEYGFWANVNPQVPHPRWSQASEEIIGTGERRPTLLFNGYGDYVAGLYNGMDNERLWA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
3 2842694124 Methylopila sp. R-72369 Isolate Unclassified
4 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
5 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
6 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
7 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
8 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
9 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
10 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
11 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
12 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
13 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
14 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
15 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
20 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
21 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
22 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
68 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
69 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
70 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
109 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
110 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
111 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
114 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
115 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
136 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
139 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
140 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
141 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
142 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
146 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
164 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
242 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
246 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
247 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
248 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
251 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
252 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
253 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
254 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
255 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
258 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
259 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
260 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
261 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
262 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
263 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
264 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
265 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
266 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
267 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
268 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
269 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
270 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
271 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
272 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
273 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
274 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
275 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
276 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
277 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
278 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
279 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
280 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
281 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
282 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
283 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
284 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
285 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
286 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
287 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
288 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
289 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
290 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
291 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
292 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
293 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
294 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
295 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
296 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
297 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
298 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
299 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
300 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
302 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
303 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
304 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
305 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
306 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
307 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
308 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
309 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
310 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
311 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
312 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
313 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
314 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
315 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
316 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
317 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
318 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
319 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
320 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
321 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
322 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
323 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
324 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
325 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
326 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
327 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
328 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
329 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
330 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
331 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
332 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
333 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
334 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
337 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
338 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
339 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
340 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
341 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
342 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
343 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
344 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
348 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
349 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
350 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
351 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
352 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
353 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
356 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
357 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
358 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
359 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
360 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
361 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
362 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
363 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
364 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
365 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
366 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
367 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
368 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
369 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
370 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
371 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
372 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
373 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
374 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
389 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
390 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
391 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
392 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
412 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
413 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
414 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
415 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
416 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
417 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
418 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
421 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
422 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
423 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
424 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
425 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
426 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
427 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
428 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
429 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
430 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
431 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
432 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
433 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
434 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
435 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
436 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
437 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
438 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
439 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
440 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
441 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
442 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
443 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
444 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
445 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
446 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
447 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.2
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.06
Nodule 0
Rhizoplane 6.27
Rhizosphere 89.22
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214586617 2209111006 Bacteria 1167
2 2214745204 2209111006 Bacteria 15697
3 ARSoilYngRDRAFT_c00018 3300000042 Bacteria 24203
4 ARcpr5yngRDRAFT_c000071 3300000043 Bacteria 16851
5 ARSoilOldRDRAFT_c000005 3300000044 Bacteria 61735
6 ARCol0oldRDRAFT_c00312 3300000045 Bacteria 4724
7 ARCol0yngRDRAFT_1000166 3300000652 Bacteria 11216
8 JGI24032J14994_100069 3300001430 Bacteria 4322
9 JGI24752J21851_1001285 3300001976 Bacteria 3398
10 JGI24746J21847_1002142 3300001977 Bacteria 3159
11 JGI24747J21853_1000415 3300001978 Bacteria 2586
12 JGI24737J22298_10000309 3300001990 Bacteria 16281
13 JGI24737J22298_10002334 3300001990 Bacteria 6765
14 JGI24743J22301_10001195 3300001991 Bacteria 3505
15 JGI24750J21931_1000368 3300002070 Bacteria 7645
16 JGI24738J21930_10000219 3300002075 Bacteria 15450
17 JGI24749J21850_1000528 3300002076 Bacteria 5601
18 JGI24744J21845_10010135 3300002077 Bacteria 1931
19 JGI24035J26624_1000067 3300002126 Bacteria 8325
20 JGI25406J46586_10017341 3300003203 Bacteria 2980
21 JGI25406J46586_10032468 3300003203 Bacteria 1940
22 JGI25405J52794_10008119 3300003911 Bacteria 1953
23 Ga0065716_1001582 3300005277 Bacteria 5864
24 Ga0065704_10077656 3300005289 Bacteria 4650
25 Ga0065712_10005999 3300005290 Bacteria 9360
26 Ga0065712_10071612 3300005290 Bacteria 5159
27 Ga0065715_10001902 3300005293 Bacteria 5416
28 Ga0065715_10089334 3300005293 Bacteria 11121
29 Ga0065707_10107519 3300005295 Bacteria 2550
30 Ga0065707_10156336 3300005295 Bacteria 1605
31 Ga0070658_10016082 3300005327 Bacteria 5984
32 Ga0070658_10186969 3300005327 Bacteria 1745
33 Ga0070676_10002258 3300005328 Bacteria 9827
34 Ga0070683_100006961 3300005329 Bacteria 9511
35 Ga0070683_100026317 3300005329 Bacteria 5236
36 Ga0070683_100075385 3300005329 Bacteria 3152
37 Ga0070683_100077513 3300005329 Bacteria 3108
38 Ga0070690_100110159 3300005330 Bacteria 1836
39 Ga0070690_100163494 3300005330 Bacteria 1527
40 Ga0070670_100002178 3300005331 Bacteria 16098
41 Ga0070677_10001477 3300005333 Bacteria 7435
42 Ga0068869_100001327 3300005334 Bacteria 14667
43 Ga0070666_10006983 3300005335 Bacteria 6961
44 Ga0070666_10042637 3300005335 Bacteria 3037
45 Ga0070666_10090928 3300005335 Bacteria 2096
46 Ga0070666_10232003 3300005335 Bacteria 1304
47 Ga0070680_100010314 3300005336 Bacteria 7203
48 Ga0070680_100028504 3300005336 Bacteria 4479
49 Ga0070680_100086684 3300005336 Bacteria 2588
50 Ga0070680_100128125 3300005336 Bacteria 2122
51 Ga0070682_100004337 3300005337 Bacteria 7877
52 Ga0070682_100076349 3300005337 Bacteria 2157
53 Ga0068868_100003112 3300005338 Bacteria 11551
54 Ga0068868_100076695 3300005338 Bacteria 2673
55 Ga0070660_100005069 3300005339 Bacteria 9102
56 Ga0070660_100028339 3300005339 Bacteria 4189
57 Ga0070660_100030377 3300005339 Bacteria 4054
58 Ga0070660_100207633 3300005339 Bacteria 1590
59 Ga0070689_100002417 3300005340 Bacteria 12201
60 Ga0070689_100046491 3300005340 Bacteria 3345
61 Ga0070689_100106691 3300005340 Bacteria 2223
62 Ga0070689_100119533 3300005340 Bacteria 2103
63 Ga0070689_100145194 3300005340 Bacteria 1911
64 Ga0070691_10057825 3300005341 Bacteria 1861
65 Ga0070687_100000334 3300005343 Bacteria 16027
66 Ga0070687_100029805 3300005343 Bacteria 2661
67 Ga0070661_100004209 3300005344 Bacteria 9932
68 Ga0070661_100034218 3300005344 Bacteria 3684
69 Ga0070692_10000022 3300005345 Bacteria 31371
70 Ga0070668_100000947 3300005347 Bacteria 20237
71 Ga0070668_100158767 3300005347 Bacteria 1833
72 Ga0070669_100002667 3300005353 Bacteria 12852
73 Ga0070669_100102382 3300005353 Bacteria 2162
74 Ga0070675_100003214 3300005354 Bacteria 12377
75 Ga0070675_100220489 3300005354 Bacteria 1652
76 Ga0070671_100003818 3300005355 Bacteria 11829
77 Ga0070671_100135757 3300005355 Bacteria 2074
78 Ga0070671_100205454 3300005355 Bacteria 1670
79 Ga0070674_100003265 3300005356 Bacteria 9061
80 Ga0070673_100005122 3300005364 Bacteria 8358
81 Ga0070673_100048608 3300005364 Bacteria 3308
82 Ga0070688_100000196 3300005365 Bacteria 32063
83 Ga0070688_100007034 3300005365 Bacteria 6050
84 Ga0070688_100077346 3300005365 Bacteria 2144
85 Ga0070659_100005334 3300005366 Bacteria 9223
86 Ga0070659_100011916 3300005366 Bacteria 6437
87 Ga0070667_100001157 3300005367 Bacteria 23956
88 Ga0070667_100023226 3300005367 Bacteria 5145
89 Ga0070667_100276601 3300005367 Bacteria 1507
90 Ga0070667_100350889 3300005367 Bacteria 1336
91 Ga0070709_10003295 3300005434 Bacteria 8687
92 Ga0070709_10003520 3300005434 Bacteria 8414
93 Ga0070714_100006005 3300005435 Bacteria 9324
94 Ga0070714_100058536 3300005435 Bacteria 3301
95 Ga0070714_100156314 3300005435 Bacteria 2059
96 Ga0070713_100005513 3300005436 Bacteria 8663
97 Ga0070713_100077628 3300005436 Bacteria 2824
98 Ga0070713_100271396 3300005436 Bacteria 1553
99 Ga0070710_10003606 3300005437 Bacteria 7331
100 Ga0070710_10033131 3300005437 Bacteria 2804
101 Ga0070701_10001542 3300005438 Bacteria 8549
102 Ga0070701_10041269 3300005438 Bacteria 2350
103 Ga0070711_100067897 3300005439 Bacteria 2503
104 Ga0070711_100090595 3300005439 Bacteria 2203
105 Ga0070711_100143784 3300005439 Bacteria 1791
106 Ga0070711_100171400 3300005439 Bacteria 1654
107 Ga0070711_100228706 3300005439 Bacteria 1449
108 Ga0070705_100013342 3300005440 Bacteria 4199
109 Ga0070700_100002190 3300005441 Bacteria 9932
110 Ga0070700_100034842 3300005441 Bacteria 3042
111 Ga0070694_100008562 3300005444 Bacteria 6261
112 Ga0070694_100011023 3300005444 Bacteria 5593
113 Ga0070708_100527740 3300005445 Bacteria 1114
114 Ga0070663_100006630 3300005455 Bacteria 6980
115 Ga0070663_100234758 3300005455 Bacteria 1445
116 Ga0070662_100015790 3300005457 Bacteria 5063
117 Ga0070681_10003089 3300005458 Bacteria 15461
118 Ga0070681_10005185 3300005458 Bacteria 12578
119 Ga0070681_10096066 3300005458 Bacteria 2912
120 Ga0070681_10118248 3300005458 Bacteria 2587
121 Ga0068867_100007041 3300005459 Bacteria 7945
122 Ga0068867_100313316 3300005459 Bacteria 1297
123 Ga0070685_10004138 3300005466 Bacteria 7320
124 Ga0070685_10107297 3300005466 Bacteria 1715
125 Ga0070706_100314634 3300005467 Bacteria 1460
126 Ga0070707_100019827 3300005468 Bacteria 6339
127 Ga0070707_100068982 3300005468 Bacteria 3404
128 Ga0070707_100142133 3300005468 Bacteria 2336
129 Ga0070707_100169398 3300005468 Bacteria 2128
130 Ga0070698_100002604 3300005471 Bacteria 19881
131 Ga0070699_100010837 3300005518 Bacteria 7889
132 Ga0070699_100252828 3300005518 Bacteria 1575
133 Ga0070699_100399696 3300005518 Bacteria 1242
134 Ga0070679_100022319 3300005530 Bacteria 6186
135 Ga0070679_100069216 3300005530 Bacteria 3520
136 Ga0070679_100101367 3300005530 Bacteria 2866
137 Ga0070679_100115337 3300005530 Bacteria 2672
138 Ga0070679_100125270 3300005530 Bacteria 2552
139 Ga0070679_100173463 3300005530 Bacteria 2129
140 Ga0070679_100244129 3300005530 Bacteria 1753
141 Ga0070684_100005283 3300005535 Bacteria 9882
142 Ga0070684_100075569 3300005535 Bacteria 2972
143 Ga0070684_100078438 3300005535 Bacteria 2918
144 Ga0070697_100000922 3300005536 Bacteria 22107
145 Ga0068853_100007403 3300005539 Bacteria 8780
146 Ga0070672_100003202 3300005543 Bacteria 10594
147 Ga0070686_100001904 3300005544 Bacteria 11614
148 Ga0070686_100111025 3300005544 Bacteria 1868
149 Ga0070686_100114499 3300005544 Bacteria 1842
150 Ga0070695_100004009 3300005545 Bacteria 8608
151 Ga0070695_100012010 3300005545 Bacteria 5188
152 Ga0070696_100011552 3300005546 Bacteria 5916
153 Ga0070696_100025402 3300005546 Bacteria 4028
154 Ga0070696_100101583 3300005546 Bacteria 2061
155 Ga0070696_100293152 3300005546 Bacteria 1243
156 Ga0070693_100001415 3300005547 Bacteria 10826
157 Ga0070693_100167530 3300005547 Bacteria 1404
158 Ga0070665_100033372 3300005548 Bacteria 5179
159 Ga0070665_100184052 3300005548 Bacteria 2090
160 Ga0070704_100212712 3300005549 Bacteria 1568
161 Ga0068855_100023429 3300005563 Bacteria 7394
162 Ga0068855_100026702 3300005563 Bacteria 6909
163 Ga0068855_100184084 3300005563 Bacteria 2360
164 Ga0068855_100265405 3300005563 Bacteria 1911
165 Ga0068855_100309001 3300005563 Bacteria 1750
166 Ga0068855_100554614 3300005563 Bacteria 1243
167 Ga0070664_100005578 3300005564 Bacteria 10113
168 Ga0070664_100105612 3300005564 Bacteria 2453
169 Ga0070664_100471296 3300005564 Bacteria 1155
170 Ga0068857_100003700 3300005577 Bacteria 12829
171 Ga0068854_100005149 3300005578 Bacteria 8242
172 Ga0068854_100049880 3300005578 Bacteria 2992
173 Ga0068856_100062644 3300005614 Bacteria 3674
174 Ga0068856_100085483 3300005614 Bacteria 3134
175 Ga0068856_100108184 3300005614 Bacteria 2776
176 Ga0068856_100108264 3300005614 Bacteria 2775
177 Ga0068856_100415741 3300005614 Bacteria 1365
178 Ga0070702_100024377 3300005615 Bacteria 3227
179 Ga0070702_100087656 3300005615 Bacteria 1880
180 Ga0068852_100003095 3300005616 Bacteria 11583
181 Ga0068852_100011531 3300005616 Bacteria 6659
182 Ga0068852_100655031 3300005616 Bacteria 1058
183 Ga0068859_100013731 3300005617 Bacteria 8120
184 Ga0068859_100126913 3300005617 Bacteria 2621
185 Ga0068859_100398843 3300005617 Bacteria 1471
186 Ga0068864_100004616 3300005618 Bacteria 11301
187 Ga0068866_10000805 3300005718 Bacteria 13998
188 Ga0068866_10175450 3300005718 Bacteria 1261
189 Ga0068861_100003522 3300005719 Bacteria 10404
190 Ga0068870_10000414 3300005840 Bacteria 16043
191 Ga0068863_100004632 3300005841 Bacteria 13552
192 Ga0068863_100607235 3300005841 Bacteria 1083
193 Ga0068858_100001573 3300005842 Bacteria 23400
194 Ga0068858_100021262 3300005842 Bacteria 6060
195 Ga0068858_100136544 3300005842 Bacteria 2301
196 Ga0068858_100163156 3300005842 Bacteria 2099
197 Ga0068860_100011587 3300005843 Bacteria 8694
198 Ga0068860_100168980 3300005843 Bacteria 2112
199 Ga0068860_100339213 3300005843 Bacteria 1477
200 Ga0068862_100010270 3300005844 Bacteria 7725
201 Ga0068862_100018526 3300005844 Bacteria 5799
202 Ga0081455_10001269 3300005937 Bacteria 31519
203 Ga0081455_10024762 3300005937 Bacteria 5549
204 Ga0081455_10138904 3300005937 Bacteria 1890
205 Ga0081455_10356718 3300005937 Bacteria 1029
206 Ga0081538_10005636 3300005981 Bacteria 11233
207 Ga0081538_10026613 3300005981 Bacteria 4040
208 Ga0081539_10000115 3300005985 Bacteria 188623
209 Ga0081539_10001357 3300005985 Bacteria 42598
210 Ga0081539_10015315 3300005985 Bacteria 5583
211 Ga0070717_10000230 3300006028 Bacteria 38578
212 Ga0075365_10001374 3300006038 Bacteria 10940
213 Ga0075364_10163182 3300006051 Bacteria 1504
214 Ga0070715_10005041 3300006163 Bacteria 4378
215 Ga0070715_10108946 3300006163 Bacteria 1304
216 Ga0070716_100003237 3300006173 Bacteria 7645
217 Ga0070716_100014532 3300006173 Bacteria 4033
218 Ga0070716_100221113 3300006173 Bacteria 1272
219 Ga0070712_100000431 3300006175 Bacteria 23938
220 Ga0070712_100009409 3300006175 Bacteria 6158
221 Ga0070712_100023648 3300006175 Bacteria 4062
222 Ga0070712_100029920 3300006175 Bacteria 3654
223 Ga0070712_100120327 3300006175 Bacteria 1975
224 Ga0070712_100242649 3300006175 Bacteria 1436
225 Ga0075362_10106101 3300006177 Bacteria 1318
226 Ga0075369_10023630 3300006186 Bacteria 2542
227 Ga0075427_10000546 3300006194 Bacteria 4347
228 Ga0075366_10158023 3300006195 Bacteria 1373
229 Ga0097621_100000432 3300006237 Bacteria 29159
230 Ga0097621_100017374 3300006237 Bacteria 5461
231 Ga0097621_100082967 3300006237 Bacteria 2670
232 Ga0075370_10031031 3300006353 Bacteria 2983
233 Ga0068871_100001626 3300006358 Bacteria 15134
234 Ga0068871_100010210 3300006358 Bacteria 6839
235 Ga0068871_100144502 3300006358 Bacteria 2024
236 Ga0068871_100255427 3300006358 Bacteria 1528
237 Ga0075428_100033719 3300006844 Bacteria 5650
238 Ga0075428_100065761 3300006844 Bacteria 3971
239 Ga0075430_100000312 3300006846 Bacteria 34556
240 Ga0075431_100004142 3300006847 Bacteria 14157
241 Ga0075431_100009808 3300006847 Bacteria 9616
242 Ga0075433_10000217 3300006852 Bacteria 32575
243 Ga0075433_10071485 3300006852 Bacteria 3050
244 Ga0075434_100000482 3300006871 Bacteria 29922
245 Ga0075434_100018131 3300006871 Bacteria 6794
246 Ga0075434_100025778 3300006871 Bacteria 5755
247 Ga0075434_100047122 3300006871 Bacteria 4278
248 Ga0075434_100140061 3300006871 Bacteria 2438
249 Ga0075434_100167534 3300006871 Bacteria 2217
250 Ga0075429_100005934 3300006880 Bacteria 10543
251 Ga0068865_100001764 3300006881 Bacteria 12696
252 Ga0068865_100008848 3300006881 Bacteria 6227
253 Ga0068865_100048210 3300006881 Bacteria 2931
254 Ga0075436_100205572 3300006914 Bacteria 1395
255 Ga0097620_100013731 3300006931 Bacteria 8120
256 Ga0097620_100126907 3300006931 Bacteria 2621
257 Ga0097620_100398827 3300006931 Bacteria 1471
258 Ga0075435_100022837 3300007076 Bacteria 4830
259 Ga0075435_100031001 3300007076 Bacteria 4209
260 Ga0075435_100069473 3300007076 Bacteria 2872
261 Ga0075435_100086830 3300007076 Bacteria 2577
262 Ga0099794_10021200 3300007265 Bacteria 2950
263 Ga0105251_10052350 3300009011 Bacteria 1944
264 Ga0105250_10031284 3300009092 Bacteria 2137
265 Ga0105240_10028942 3300009093 Bacteria 7226
266 Ga0111539_10001938 3300009094 Bacteria 27600
267 Ga0111539_10003842 3300009094 Bacteria 19781
268 Ga0111539_10004907 3300009094 Bacteria 17409
269 Ga0111539_10029777 3300009094 Bacteria 6644
270 Ga0111539_10080586 3300009094 Bacteria 3829
271 Ga0105245_10000534 3300009098 Bacteria 34896
272 Ga0105245_10005575 3300009098 Bacteria 11062
273 Ga0114129_10004108 3300009147 Bacteria 20574
274 Ga0114129_10132378 3300009147 Bacteria 3424
275 Ga0114129_10196053 3300009147 Bacteria 2738
276 Ga0105243_10003508 3300009148 Bacteria 12668
277 Ga0105243_10173381 3300009148 Bacteria 1870
278 Ga0105241_10002008 3300009174 Bacteria 15393
279 Ga0105241_10214633 3300009174 Bacteria 1614
280 Ga0105241_10353554 3300009174 Bacteria 1276
281 Ga0105242_10004301 3300009176 Bacteria 11098
282 Ga0105242_10004986 3300009176 Bacteria 10269
283 Ga0105242_10213004 3300009176 Bacteria 1723
284 Ga0105242_10402279 3300009176 Bacteria 1278
285 Ga0105248_10003814 3300009177 Bacteria 16715
286 Ga0105248_10012337 3300009177 Bacteria 9429
287 Ga0105248_10071076 3300009177 Bacteria 3909
288 Ga0105248_10296134 3300009177 Bacteria 1822
289 Ga0105248_10640719 3300009177 Bacteria 1199
290 Ga0105237_10004785 3300009545 Bacteria 15562
291 Ga0105237_10079240 3300009545 Bacteria 3275
292 Ga0105237_10183774 3300009545 Bacteria 2091
293 Ga0105238_10046828 3300009551 Bacteria 4361
294 Ga0105238_10070748 3300009551 Bacteria 3487
295 Ga0105249_10004067 3300009553 Bacteria 12616
296 Ga0105249_10170337 3300009553 Bacteria 2111
297 Ga0105249_10447589 3300009553 Bacteria 1330
298 Ga0105249_10723447 3300009553 Bacteria 1056
299 Ga0105028_101643 3300009993 Bacteria 2342
300 Ga0105239_10039798 3300010375 Bacteria 5150
301 Ga0105239_10063264 3300010375 Bacteria 4062
302 Ga0105239_10655203 3300010375 Bacteria 1199
303 Ga0105246_10001160 3300011119 Bacteria 15299
304 Ga0157335_1002551 3300012492 Bacteria 1107
305 Ga0157342_1002325 3300012507 Bacteria 1533
306 Ga0157373_10004563 3300013100 Bacteria 10416
307 Ga0157373_10037254 3300013100 Bacteria 3487
308 Ga0157371_10028973 3300013102 Bacteria 4008
309 Ga0157370_10259250 3300013104 Bacteria 1607
310 Ga0157374_10006040 3300013296 Bacteria 10246
311 Ga0157374_10036266 3300013296 Bacteria 4515
312 Ga0157378_10006408 3300013297 Bacteria 10289
313 Ga0163162_10018687 3300013306 Bacteria 6791
314 Ga0163162_10303417 3300013306 Bacteria 1729
315 Ga0163162_10372966 3300013306 Bacteria 1560
316 Ga0157372_10003634 3300013307 Bacteria 16595
317 Ga0157372_10058724 3300013307 Bacteria 4301
318 Ga0157372_10080440 3300013307 Bacteria 3686
319 Ga0157372_10084628 3300013307 Bacteria 3595
320 Ga0157375_10002653 3300013308 Bacteria 15489
321 Ga0157375_10013985 3300013308 Bacteria 7155
322 Ga0163163_10003304 3300014325 Bacteria 13677
323 Ga0163163_10006181 3300014325 Bacteria 10441
324 Ga0163163_10288779 3300014325 Bacteria 1692
325 Ga0157380_10000558 3300014326 Bacteria 22893
326 Ga0157377_10000819 3300014745 Bacteria 12893
327 Ga0157377_10213289 3300014745 Bacteria 1232
328 Ga0157379_10004333 3300014968 Bacteria 12139
329 Ga0157379_10034106 3300014968 Bacteria 4536
330 Ga0157379_10174036 3300014968 Bacteria 1943
331 Ga0157379_10410544 3300014968 Bacteria 1246
332 Ga0157376_10001412 3300014969 Bacteria 15800
333 Ga0157376_10093425 3300014969 Bacteria 2611
334 Ga0157376_10315777 3300014969 Bacteria 1484
335 Ga0157376_10464822 3300014969 Bacteria 1237
336 Ga0163161_10001783 3300017792 Bacteria 15700
337 Ga0213873_10020551 3300021358 Bacteria 1544
338 Ga0213876_10000046 3300021384 Bacteria 150327
339 Ga0213875_10001127 3300021388 Bacteria 18428
340 Ga0224712_10007388 3300022467 Bacteria 3198
341 Ga0224712_10117528 3300022467 Bacteria 1148
342 Ga0207666_1000030 3300025271 Bacteria 31103
343 Ga0207666_1001056 3300025271 Bacteria 3266
344 Ga0207673_1000110 3300025290 Bacteria 7515
345 Ga0209676_1000089 3300025292 Bacteria 260196
346 Ga0209050_1008351 3300025298 Bacteria 5556
347 Ga0207697_10000225 3300025315 Bacteria 30578
348 Ga0207697_10007510 3300025315 Bacteria 4858
349 Ga0207697_10033038 3300025315 Bacteria 2118
350 Ga0207713_1054500 3300025735 Bacteria 1567
351 Ga0207653_10025601 3300025885 Bacteria 1887
352 Ga0207682_10000009 3300025893 Bacteria 86366
353 Ga0207692_10043097 3300025898 Bacteria 2243
354 Ga0207642_10000959 3300025899 Bacteria 9022
355 Ga0207642_10153554 3300025899 Bacteria 1228
356 Ga0207688_10000060 3300025901 Bacteria 40194
357 Ga0207680_10001548 3300025903 Bacteria 10831
358 Ga0207680_10116073 3300025903 Bacteria 1744
359 Ga0207680_10296261 3300025903 Bacteria 1127
360 Ga0207647_10000172 3300025904 Bacteria 51724
361 Ga0207647_10001510 3300025904 Bacteria 17885
362 Ga0207685_10135589 3300025905 Bacteria 1098
363 Ga0207699_10029344 3300025906 Bacteria 3067
364 Ga0207699_10072924 3300025906 Bacteria 2104
365 Ga0207699_10078156 3300025906 Bacteria 2043
366 Ga0207645_10001895 3300025907 Bacteria 16883
367 Ga0207643_10000244 3300025908 Bacteria 37860
368 Ga0207705_10160120 3300025909 Bacteria 1691
369 Ga0207684_10049512 3300025910 Bacteria 3564
370 Ga0207707_10003182 3300025912 Bacteria 14574
371 Ga0207707_10032559 3300025912 Bacteria 4563
372 Ga0207707_10045776 3300025912 Bacteria 3812
373 Ga0207707_10075788 3300025912 Bacteria 2936
374 Ga0207707_10105071 3300025912 Bacteria 2468
375 Ga0207707_10146362 3300025912 Bacteria 2065
376 Ga0207695_10037556 3300025913 Bacteria 5225
377 Ga0207671_10003102 3300025914 Bacteria 16915
378 Ga0207671_10044311 3300025914 Bacteria 3290
379 Ga0207671_10197972 3300025914 Bacteria 1568
380 Ga0207693_10000460 3300025915 Bacteria 37218
381 Ga0207693_10001247 3300025915 Bacteria 22646
382 Ga0207693_10002491 3300025915 Bacteria 16018
383 Ga0207693_10008813 3300025915 Bacteria 8242
384 Ga0207693_10136257 3300025915 Bacteria 1930
385 Ga0207663_10055510 3300025916 Bacteria 2486
386 Ga0207660_10000179 3300025917 Bacteria 40457
387 Ga0207660_10013904 3300025917 Bacteria 5282
388 Ga0207660_10052000 3300025917 Bacteria 2915
389 Ga0207662_10000025 3300025918 Bacteria 70078
390 Ga0207662_10224241 3300025918 Bacteria 1225
391 Ga0207657_10001867 3300025919 Bacteria 22796
392 Ga0207657_10016175 3300025919 Bacteria 7202
393 Ga0207649_10002794 3300025920 Bacteria 9638
394 Ga0207649_10201578 3300025920 Bacteria 1406
395 Ga0207652_10032575 3300025921 Bacteria 4384
396 Ga0207652_10035880 3300025921 Bacteria 4188
397 Ga0207652_10107867 3300025921 Bacteria 2467
398 Ga0207652_10194803 3300025921 Bacteria 1823
399 Ga0207652_10335470 3300025921 Bacteria 1365
400 Ga0207652_10343068 3300025921 Bacteria 1348
401 Ga0207646_10005518 3300025922 Bacteria 13295
402 Ga0207646_10457608 3300025922 Bacteria 1151
403 Ga0207681_10000419 3300025923 Bacteria 29502
404 Ga0207694_10019282 3300025924 Bacteria 5156
405 Ga0207694_10049888 3300025924 Bacteria 3240
406 Ga0207650_10015411 3300025925 Bacteria 5322
407 Ga0207650_10033937 3300025925 Bacteria 3699
408 Ga0207659_10000283 3300025926 Bacteria 30879
409 Ga0207659_10148369 3300025926 Bacteria 1829
410 Ga0207687_10004337 3300025927 Bacteria 9469
411 Ga0207687_10016909 3300025927 Bacteria 4795
412 Ga0207700_10002145 3300025928 Bacteria 11291
413 Ga0207700_10015075 3300025928 Bacteria 5085
414 Ga0207700_10092585 3300025928 Bacteria 2390
415 Ga0207664_10011719 3300025929 Bacteria 6248
416 Ga0207664_10068431 3300025929 Bacteria 2852
417 Ga0207664_10082275 3300025929 Bacteria 2622
418 Ga0207664_10123088 3300025929 Bacteria 2173
419 Ga0207664_10171048 3300025929 Bacteria 1859
420 Ga0207644_10004405 3300025931 Bacteria 9136
421 Ga0207644_10044351 3300025931 Bacteria 3159
422 Ga0207644_10059673 3300025931 Bacteria 2759
423 Ga0207644_10130507 3300025931 Bacteria 1923
424 Ga0207690_10000808 3300025932 Bacteria 20084
425 Ga0207690_10060972 3300025932 Bacteria 2563
426 Ga0207690_10155973 3300025932 Bacteria 1697
427 Ga0207690_10361985 3300025932 Bacteria 1149
428 Ga0207706_10000734 3300025933 Bacteria 34159
429 Ga0207706_10030769 3300025933 Bacteria 4787
430 Ga0207706_10075490 3300025933 Bacteria 2964
431 Ga0207686_10000879 3300025934 Bacteria 18161
432 Ga0207686_10012514 3300025934 Bacteria 4666
433 Ga0207709_10005908 3300025935 Bacteria 6905
434 Ga0207709_10021837 3300025935 Bacteria 3625
435 Ga0207670_10001927 3300025936 Bacteria 10861
436 Ga0207670_10008819 3300025936 Bacteria 5714
437 Ga0207670_10296777 3300025936 Bacteria 1264
438 Ga0207669_10000204 3300025937 Bacteria 27121
439 Ga0207669_10044660 3300025937 Bacteria 2605
440 Ga0207704_10002129 3300025938 Bacteria 8876
441 Ga0207704_10012427 3300025938 Bacteria 4226
442 Ga0207704_10147842 3300025938 Bacteria 1653
443 Ga0207665_10001684 3300025939 Bacteria 14866
444 Ga0207665_10005925 3300025939 Bacteria 8135
445 Ga0207665_10014670 3300025939 Bacteria 5156
446 Ga0207665_10090953 3300025939 Bacteria 2115
447 Ga0207691_10000309 3300025940 Bacteria 48592
448 Ga0207711_10003227 3300025941 Bacteria 14209
449 Ga0207711_10009863 3300025941 Bacteria 7942
450 Ga0207711_10013666 3300025941 Bacteria 6741
451 Ga0207711_10034929 3300025941 Bacteria 4259
452 Ga0207711_10066720 3300025941 Bacteria 3112
453 Ga0207689_10000893 3300025942 Bacteria 28654
454 Ga0207689_10039885 3300025942 Bacteria 3887
455 Ga0207689_10050215 3300025942 Bacteria 3440
456 Ga0207689_10116082 3300025942 Bacteria 2200
457 Ga0207661_10003381 3300025944 Bacteria 11085
458 Ga0207661_10119353 3300025944 Bacteria 2243
459 Ga0207661_10543156 3300025944 Bacteria 1064
460 Ga0207679_10000128 3300025945 Bacteria 61823
461 Ga0207679_10098406 3300025945 Bacteria 2281
462 Ga0207679_10352196 3300025945 Bacteria 1284
463 Ga0207667_10015642 3300025949 Bacteria 8606
464 Ga0207667_10025294 3300025949 Bacteria 6501
465 Ga0207651_10003175 3300025960 Bacteria 8020
466 Ga0207651_10042390 3300025960 Bacteria 3029
467 Ga0207712_10003264 3300025961 Bacteria 10289
468 Ga0207712_10156181 3300025961 Bacteria 1768
469 Ga0207668_10002555 3300025972 Bacteria 10632
470 Ga0207668_10359020 3300025972 Bacteria 1220
471 Ga0207640_10005063 3300025981 Bacteria 7172
472 Ga0207658_10005664 3300025986 Bacteria 8547
473 Ga0207658_10027783 3300025986 Bacteria 3979
474 Ga0207677_10008643 3300026023 Bacteria 5701
475 Ga0207703_10007507 3300026035 Bacteria 8654
476 Ga0207703_10040655 3300026035 Bacteria 3722
477 Ga0207703_10063935 3300026035 Bacteria 3019
478 Ga0207703_10254754 3300026035 Bacteria 1584
479 Ga0207703_10390262 3300026035 Bacteria 1289
480 Ga0207639_10007584 3300026041 Bacteria 7402
481 Ga0207678_10000759 3300026067 Bacteria 29491
482 Ga0207678_10020189 3300026067 Bacteria 5850
483 Ga0207678_10026240 3300026067 Bacteria 5083
484 Ga0207678_10094566 3300026067 Bacteria 2554
485 Ga0207708_10000391 3300026075 Bacteria 34446
486 Ga0207708_10098573 3300026075 Bacteria 2259
487 Ga0207702_10008180 3300026078 Bacteria 8842
488 Ga0207702_10174970 3300026078 Bacteria 1971
489 Ga0207702_10547262 3300026078 Bacteria 1132
490 Ga0207641_10006199 3300026088 Bacteria 10116
491 Ga0207648_10000862 3300026089 Bacteria 34173
492 Ga0207676_10003505 3300026095 Bacteria 11102
493 Ga0207676_10024007 3300026095 Bacteria 4508
494 Ga0207676_10281156 3300026095 Bacteria 1511
495 Ga0207674_10000806 3300026116 Bacteria 40763
496 Ga0207675_100000637 3300026118 Bacteria 34408
497 Ga0207675_100041675 3300026118 Bacteria 4287
498 Ga0207683_10000330 3300026121 Bacteria 43106
499 Ga0207683_10006268 3300026121 Bacteria 10192
500 Ga0207683_10030655 3300026121 Bacteria 4662
501 Ga0207698_10002562 3300026142 Bacteria 10790
502 Ga0207698_10183727 3300026142 Bacteria 1855
503 Ga0210002_1001079 3300027617 Bacteria 3781
504 Ga0209983_1006352 3300027665 Bacteria 2429
505 Ga0209971_1008242 3300027682 Bacteria 2471
506 Ga0209966_1001959 3300027695 Bacteria 3449
507 Ga0209998_10001428 3300027717 Bacteria 5782
508 Ga0209998_10002841 3300027717 Bacteria 3892
509 Ga0209974_10000230 3300027876 Bacteria 18079
510 Ga0207428_10000096 3300027907 Bacteria 123081
511 Ga0207428_10000164 3300027907 Bacteria 91968
512 Ga0207428_10000815 3300027907 Bacteria 35204
513 Ga0207428_10001706 3300027907 Bacteria 22544
514 Ga0268266_10070826 3300028379 Bacteria 3021
515 Ga0268265_10002566 3300028380 Bacteria 13577
516 Ga0268265_10038962 3300028380 Bacteria 3499
517 Ga0268264_10006412 3300028381 Bacteria 9911
518 Ga0268264_10248040 3300028381 Bacteria 1653
519 Ga0268264_10370132 3300028381 Bacteria 1369
520 Ga0265337_1000796 3300028556 Bacteria 16604
521 Ga0265334_10017368 3300028573 Bacteria 2973
522 Ga0265338_10023559 3300028800 Bacteria 6325
523 Ga0265330_10009674 3300031235 Bacteria 4570
524 Ga0265325_10000305 3300031241 Bacteria 34555
525 Ga0265325_10000442 3300031241 Bacteria 29810
526 Ga0265325_10004813 3300031241 Bacteria 8451
527 Ga0265325_10010337 3300031241 Bacteria 5411
528 Ga0265325_10022863 3300031241 Bacteria 3421
529 Ga0265325_10035033 3300031241 Bacteria 2667
530 Ga0265340_10008715 3300031247 Bacteria 5471
531 Ga0265340_10018445 3300031247 Bacteria 3599
532 Ga0265339_10002069 3300031249 Bacteria 14716
533 Ga0265339_10039970 3300031249 Bacteria 2608
534 Ga0265339_10081188 3300031249 Bacteria 1714
535 Ga0265339_10100771 3300031249 Bacteria 1503
536 Ga0265327_10021801 3300031251 Bacteria 3854
537 Ga0265316_10107177 3300031344 Bacteria 2119
538 Ga0265313_10000305 3300031595 Bacteria 53305
539 Ga0265313_10001505 3300031595 Bacteria 21710
540 Ga0265313_10013856 3300031595 Bacteria 4805
541 Ga0265313_10025172 3300031595 Bacteria 3161
542 Ga0316575_10018835 3300031665 Bacteria 2636
543 Ga0265314_10001589 3300031711 Bacteria 24969
544 Ga0265314_10016519 3300031711 Bacteria 5823
545 Ga0265314_10109110 3300031711 Bacteria 1762
546 Ga0265342_10000321 3300031712 Bacteria 54074
547 Ga0265342_10002243 3300031712 Bacteria 16899
548 Ga0265342_10056655 3300031712 Bacteria 2322
549 Ga0316576_10163537 3300031727 Bacteria 1679
550 Ga0307416_100236268 3300032002 Bacteria 1767
551 Ga0307414_10011115 3300032004 Bacteria 5265
552 Ga0316583_10000092 3300032133 Bacteria 19607
553 Ga0373930_0000057 3300034816 Bacteria 10456
554 Ga0373948_0001657 3300034817 Bacteria 3146
555 Ga0373948_0009265 3300034817 Bacteria 1695
556 Ga0373950_0004566 3300034818 Bacteria 2031
557 Ga0373950_0004808 3300034818 Bacteria 1991
558 Ga0373958_0006518 3300034819 Bacteria 1822
559 Ga0373959_0002313 3300034820 Bacteria 3032
560 Ga0373959_0006569 3300034820 Bacteria 1935
561 Ga0373938_0003139 3300034957 Bacteria 2684
562 Ga0373928_0002217 3300035084 Bacteria 3783
563 Ga0373928_0009085 3300035084 Bacteria 1939
564 Ga0373929_0003213 3300035085 Bacteria 2962
565 Ga0373934_0098298 3300035086 Bacteria 1183
566 Ga0373944_0002521 3300035089 Bacteria 4653
567 Ga0373949_0004678 3300035090 Bacteria 3111
568 Ga0373949_0005109 3300035090 Bacteria 2950
569 Ga0373951_0000341 3300035091 Bacteria 14347
570 Ga0373952_0001033 3300035092 Bacteria 5085
571 Ga0373952_0001903 3300035092 Bacteria 3787
572 Ga0373923_0034403 3300035111 Bacteria 2056
573 Ga0373932_0003901 3300035112 Bacteria 3557
574 Ga0373932_0019013 3300035112 Bacteria 1785
575 Ga0373936_0020827 3300035113 Bacteria 2550
576 Ga0373936_0029771 3300035113 Bacteria 2151
577 Ga0373939_0001163 3300035114 Bacteria 6446
578 Ga0373939_0001797 3300035114 Bacteria 5161
579 Ga0373939_0007281 3300035114 Bacteria 2685
580 Ga0373939_0051546 3300035114 Bacteria 1280
581 Ga0373941_0000752 3300035115 Bacteria 6633
582 Ga0373941_0001091 3300035115 Bacteria 5653
583 Ga0373953_0042816 3300035117 Bacteria 1806
584 Ga0373954_0022731 3300035118 Bacteria 2847
585 Ga0373956_0015149 3300035119 Bacteria 3226
586 Ga0373956_0020919 3300035119 Bacteria 2789
587 Ga0373956_0104901 3300035119 Bacteria 1313
588 Ga0373957_0012274 3300035120 Bacteria 2880
589 Ga0373960_0000509 3300035121 Bacteria 7759
590 Ga0373943_0006224 3300035170 Bacteria 5360
591 Ga0373946_0018601 3300035171 Bacteria 2670
592 Ga0373955_0000998 3300035172 Bacteria 12004
593 Ga0373955_0001557 3300035172 Bacteria 9800
594 Ga0373942_0002104 3300035207 Bacteria 4942
595 Ga0373942_0020612 3300035207 Bacteria 1657
596 Ga0373961_0001381 3300035241 Bacteria 7261
597 Ga0373961_0038624 3300035241 Bacteria 1368
598 Ga0373962_0000553 3300035242 Bacteria 8421
599 Ga0373962_0004172 3300035242 Bacteria 3482
600 Ga0373962_0019285 3300035242 Bacteria 1783
601 Ga0373924_0001412 3300035410 Bacteria 7777
602 Ga0373924_0009677 3300035410 Bacteria 3541
603 Ga0373931_0002430 3300035691 Bacteria 8241
604 Ga0373931_0021545 3300035691 Bacteria 3234
605 Ga0373931_0089167 3300035691 Bacteria 1715
606 Ga0373931_0101336 3300035691 Bacteria 1620
607 Ga0373931_0153675 3300035691 Bacteria 1343
608 Ga0373935_0016753 3300035692 Bacteria 4435
609 Ga0373935_0046383 3300035692 Bacteria 2745
610 Ga0373935_0101018 3300035692 Bacteria 1902
611 Ga0373927_0048155 3300035695 Bacteria 2757
612 Ga0373927_0139121 3300035695 Bacteria 1587
613 Ga0373933_0019278 3300035724 Bacteria 3850
614 Ga0373947_0001287 3300035725 Bacteria 15461
615 Ga0373947_0117761 3300035725 Bacteria 1685
616 Ga0373937_0001774 3300036401 Bacteria 18124
617 Ga0373937_0002866 3300036401 Bacteria 14408
618 Ga0373937_0106442 3300036401 Bacteria 2607
619 Ga0373937_0177517 3300036401 Bacteria 1999
620 Ga0316582_0144556 3300036647 Bacteria 1605
621 Ga0316582_0168321 3300036647 Bacteria 1487
622 Ga0316584_0033354 3300036712 Bacteria 3813
623 Ga0373925_0057368 3300037068 Bacteria 2917
624 Ga0373925_0064177 3300037068 Bacteria 2764
625 Ga0373925_0071936 3300037068 Bacteria 2616
626 Ga0395900_0082006 3300037418 Bacteria 3313
627 Ga0395898_0136879 3300037466 Bacteria 2345
628 Ga0436364_0022735 3300037853 Bacteria 162985
629 Ga0436364_0326872 3300037853 Bacteria 1141
630 Ga0436364_1355609 3300037853 Bacteria 12679
631 Ga0400483_019258 3300039062 Bacteria 10917
632 Ga0400483_118863 3300039062 Bacteria 1891
633 Ga0400483_136500 3300039062 Bacteria 13362
634 Ga0400483_179075 3300039062 Bacteria 12620
635 Ga0400483_199061 3300039062 Bacteria 5704
636 Ga0400483_220307 3300039062 Bacteria 7187
637 Ga0436365_0858460 3300039437 Bacteria 1568
638 Ga0436365_1061189 3300039437 Bacteria 6054
639 Ga0436365_1136139 3300039437 Bacteria 1683
640 Ga0436365_1389092 3300039437 Bacteria 2778
641 Ga0436365_1437456 3300039437 Bacteria 5526
642 Ga0436365_1658434 3300039437 Bacteria 42037
643 Ga0436365_1708732 3300039437 Bacteria 2302
644 Ga0436360_0547038 3300039438 Bacteria 1925
645 Ga0436360_1260651 3300039438 Bacteria 3052
646 Ga0436361_0128609 3300039447 Bacteria 3552
647 Ga0436361_0546261 3300039447 Bacteria 8206
648 Ga0436361_0673711 3300039447 Bacteria 1308
649 Ga0436363_0532621 3300039450 Bacteria 5002
650 Ga0436363_1390095 3300039450 Bacteria 1431
651 Ga0451839_1410856 3300041496 Bacteria 994
652 Ga0439463_008198 3300042016 Bacteria 2575
653 Ga0451577_0067584 3300042876 Bacteria 3188
654 Ga0466961_0195839 3300044693 Bacteria 1251
655 Ga0466963_0051199 3300044694 Bacteria 2736
656 Ga0466957_0040658 3300044842 Bacteria 2809
657 Ga0466960_0051950 3300044901 Bacteria 1982
658 Ga0451576_0281917 3300045051 Bacteria 1737
659 Ga0466967_0210469 3300045976 Bacteria 1844
660 Ga0495592_0017778 3300046454 Bacteria 5404
661 Ga0495592_0023319 3300046454 Bacteria 4706
662 Ga0495592_0029219 3300046454 Bacteria 4174
663 Ga0495592_0129180 3300046454 Bacteria 1769
664 Ga0495603_0010286 3300046455 Bacteria 5663
665 Ga0495629_0063552 3300046459 Bacteria 2578
666 Ga0495629_0134926 3300046459 Bacteria 1718
667 Ga0495629_0271185 3300046459 Bacteria 1165
668 Ga0495638_0059425 3300046460 Bacteria 2367
669 Ga0495651_0008162 3300046462 Bacteria 8029
670 Ga0495651_0009584 3300046462 Bacteria 7440
671 Ga0495651_0027137 3300046462 Bacteria 4460
672 Ga0495653_0019240 3300046463 Bacteria 5537
673 Ga0495653_0032847 3300046463 Bacteria 4116
674 Ga0495580_0017021 3300046472 Bacteria 5446
675 Ga0495582_0010775 3300046473 Bacteria 5032
676 Ga0495639_0065883 3300046475 Bacteria 1666
677 Ga0495639_0134523 3300046475 Bacteria 1185
678 Ga0495662_0032617 3300046476 Bacteria 2516
679 Ga0495664_0001573 3300046477 Bacteria 12102
680 Ga0495664_0013502 3300046477 Bacteria 4631
681 Ga0495664_0020642 3300046477 Bacteria 3801
682 Ga0495584_0109421 3300046491 Bacteria 1398
683 Ga0495585_0023565 3300046492 Bacteria 3532
684 Ga0495594_0032856 3300046499 Bacteria 2818
685 Ga0495594_0067084 3300046499 Bacteria 1991
686 Ga0495607_0008175 3300046501 Bacteria 7171
687 Ga0495608_0010527 3300046511 Bacteria 6453
688 Ga0495608_0013659 3300046511 Bacteria 5635
689 Ga0495608_0073807 3300046511 Bacteria 2224
690 Ga0495618_0004210 3300046514 Bacteria 8880
691 Ga0495618_0065107 3300046514 Bacteria 2316
692 Ga0495618_0065214 3300046514 Bacteria 2315
693 Ga0495628_0003455 3300046516 Bacteria 14149
694 Ga0495628_0036997 3300046516 Bacteria 3914
695 Ga0495628_0048386 3300046516 Bacteria 3370
696 Ga0495630_0061516 3300046517 Bacteria 2819
697 Ga0495630_0222646 3300046517 Bacteria 1440
698 Ga0495643_0054324 3300046522 Bacteria 2145
699 Ga0495644_0001086 3300046523 Bacteria 11264
700 Ga0495666_0083998 3300046526 Bacteria 1504
701 Ga0495652_0013724 3300046529 Bacteria 7287
702 Ga0495652_0022189 3300046529 Bacteria 5636
703 Ga0495652_0040814 3300046529 Bacteria 4010
704 Ga0495652_0225300 3300046529 Bacteria 1406
705 Ga0495665_0073438 3300046531 Bacteria 1801
706 Ga0495640_0025674 3300046533 Bacteria 4268
707 Ga0495640_0203025 3300046533 Bacteria 1255
708 Ga0495586_0013594 3300046535 Bacteria 4318
709 Ga0495587_0004856 3300046536 Bacteria 8823
710 Ga0495587_0028036 3300046536 Bacteria 3428
711 Ga0495645_0001639 3300046543 Bacteria 15179
712 Ga0495645_0005664 3300046543 Bacteria 8601
713 Ga0495645_0074217 3300046543 Bacteria 2450
714 Ga0495622_0010042 3300046557 Bacteria 4379
715 Ga0495622_0130847 3300046557 Bacteria 1143
716 Ga0495633_0011736 3300046558 Bacteria 4704
717 Ga0495667_0005288 3300046559 Bacteria 8726
718 Ga0495667_0011244 3300046559 Bacteria 6059
719 Ga0495667_0031399 3300046559 Bacteria 3566
720 Ga0495667_0040965 3300046559 Bacteria 3073
721 Ga0495656_0001089 3300046615 Bacteria 8801
722 Ga0495634_0016364 3300046642 Bacteria 5304
723 Ga0495635_0000337 3300046663 Bacteria 30021
724 Ga0495635_0007593 3300046663 Bacteria 7566
725 Ga0495635_0035522 3300046663 Bacteria 3455
726 Ga0495635_0036181 3300046663 Bacteria 3422
727 Ga0495659_0001476 3300046664 Bacteria 7976
728 Ga0495661_0007028 3300046665 Bacteria 7869
729 Ga0495588_0013858 3300046674 Bacteria 3848
730 Ga0495657_0001580 3300046675 Bacteria 19584
731 Ga0495657_0030152 3300046675 Bacteria 3800
732 Ga0495657_0207652 3300046675 Bacteria 1191
733 Ga0495599_0018494 3300046678 Bacteria 4341
734 Ga0495599_0019711 3300046678 Bacteria 4204
735 Ga0495623_0000723 3300046679 Bacteria 22059
736 Ga0495623_0078996 3300046679 Bacteria 2039
737 Ga0495646_0002017 3300046680 Bacteria 12292
738 Ga0495646_0028777 3300046680 Bacteria 3476
739 Ga0495647_0016555 3300046681 Bacteria 2596
740 Ga0495658_0000221 3300046683 Bacteria 32569
741 Ga0495658_0038807 3300046683 Bacteria 2638
742 Ga0495613_0112336 3300046689 Bacteria 1962
743 Ga0495624_0041634 3300046690 Bacteria 2937
744 Ga0495624_0066693 3300046690 Bacteria 2246
745 Ga0495670_0001346 3300046691 Bacteria 12002
746 Ga0495600_0000619 3300046809 Bacteria 18337
747 Ga0495600_0000936 3300046809 Bacteria 15687
748 Ga0495600_0004078 3300046809 Bacteria 8688
749 Ga0495660_0105716 3300046810 Bacteria 1443
750 Ga0495581_0014587 3300047315 Bacteria 4556
751 Ga0495581_0028658 3300047315 Bacteria 3228
752 Ga0495604_0008572 3300047317 Bacteria 8077
753 Ga0495604_0009858 3300047317 Bacteria 7560
754 Ga0495604_0023992 3300047317 Bacteria 4869
755 Ga0495604_0037657 3300047317 Bacteria 3808
756 Ga0495604_0110796 3300047317 Bacteria 2002
757 Ga0495674_0001395 3300047319 Bacteria 23609
758 Ga0495674_0010509 3300047319 Bacteria 8761
759 Ga0495674_0303528 3300047319 Bacteria 1303
760 Ga0495680_0002033 3300047322 Bacteria 21172
761 Ga0495680_0007002 3300047322 Bacteria 10400
762 Ga0495680_0019881 3300047322 Bacteria 5660
763 Ga0495680_0024415 3300047322 Bacteria 5015
764 Ga0495680_0026609 3300047322 Bacteria 4765
765 Ga0495675_0000716 3300047444 Bacteria 20715
766 Ga0495675_0190095 3300047444 Bacteria 1254
767 Ga0495684_0008600 3300047471 Bacteria 7900
768 Ga0495684_0095331 3300047471 Bacteria 2252
769 Ga0495593_0020521 3300047673 Bacteria 3701
770 Ga0495593_0023727 3300047673 Bacteria 3406
771 Ga0495593_0036543 3300047673 Bacteria 2663
772 Ga0495602_0010114 3300048088 Bacteria 9793
773 Ga0495602_0025010 3300048088 Bacteria 5785
774 Ga0495614_0049400 3300048089 Bacteria 1803
775 Ga0495614_0115959 3300048089 Bacteria 1178
776 Ga0496100_0001614 3300048903 Bacteria 11145
777 Ga0496100_0002013 3300048903 Bacteria 10167
778 Ga0496100_0005202 3300048903 Bacteria 6984
779 Ga0496101_0002338 3300048904 Bacteria 11626
780 Ga0496101_0006083 3300048904 Bacteria 7748
781 Ga0496101_0121203 3300048904 Bacteria 1977
782 Ga0496102_0009896 3300048905 Bacteria 8198
783 Ga0496102_0070151 3300048905 Bacteria 3218
784 Ga0496102_0076321 3300048905 Bacteria 3082
785 Ga0496102_0230921 3300048905 Bacteria 1744
786 Ga0496103_0001271 3300048906 Bacteria 17190
787 Ga0496103_0159084 3300048906 Bacteria 1448
788 Ga0496104_0013151 3300048907 Bacteria 7460
789 Ga0496104_0120433 3300048907 Bacteria 2519
790 Ga0496104_0240792 3300048907 Bacteria 1721
791 Ga0496104_0398623 3300048907 Bacteria 1288
792 Ga0496105_0001594 3300048908 Bacteria 16062
793 Ga0496105_0036464 3300048908 Bacteria 4051
794 Ga0496105_0089643 3300048908 Bacteria 2540
795 Ga0496106_0004028 3300048909 Bacteria 10985
796 Ga0496106_0045330 3300048909 Bacteria 3302
797 Ga0496106_0090801 3300048909 Bacteria 2357
798 Ga0496106_0140721 3300048909 Bacteria 1898
799 Ga0496106_0149281 3300048909 Bacteria 1843
800 Ga0496106_0160876 3300048909 Bacteria 1775
801 Ga0496106_0363003 3300048909 Bacteria 1163
802 Ga0496107_0006617 3300048910 Bacteria 7978
803 Ga0496107_0020151 3300048910 Bacteria 4709
804 Ga0496107_0062685 3300048910 Bacteria 2693
805 Ga0496107_0150293 3300048910 Bacteria 1722
806 Ga0496108_0000693 3300048911 Bacteria 26096
807 Ga0496108_0005626 3300048911 Bacteria 10143
808 Ga0496109_0006483 3300048912 Bacteria 9854
809 Ga0496109_0007782 3300048912 Bacteria 9073
810 Ga0496109_0017400 3300048912 Bacteria 6302
811 Ga0496109_0061612 3300048912 Bacteria 3430
812 Ga0496109_0091481 3300048912 Bacteria 2814
813 Ga0496109_0172714 3300048912 Bacteria 2028
814 Ga0496110_0001702 3300048913 Bacteria 16176
815 Ga0496110_0002745 3300048913 Bacteria 13292
816 Ga0496110_0051870 3300048913 Bacteria 3605
817 Ga0496110_0090904 3300048913 Bacteria 2730
818 Ga0496110_0093264 3300048913 Bacteria 2695
819 Ga0496110_0141793 3300048913 Bacteria 2172
820 Ga0496111_0004679 3300048914 Bacteria 8675
821 Ga0496111_0142288 3300048914 Bacteria 1778
822 Ga0496112_0001842 3300048915 Bacteria 16684
823 Ga0496112_0099336 3300048915 Bacteria 2880
824 Ga0496112_0255817 3300048915 Bacteria 1701
825 Ga0496112_0258616 3300048915 Bacteria 1691
826 Ga0496113_0009047 3300048916 Bacteria 6523
827 Ga0496113_0039278 3300048916 Bacteria 3483
828 Ga0496113_0071201 3300048916 Bacteria 2645
829 Ga0496113_0198002 3300048916 Bacteria 1596
830 Ga0496114_0002210 3300048917 Bacteria 14814
831 Ga0496114_0047239 3300048917 Bacteria 3580
832 Ga0496114_0053250 3300048917 Bacteria 3373
833 Ga0496114_0415992 3300048917 Bacteria 1191
834 Ga0496115_0005059 3300048918 Bacteria 9585
835 Ga0496115_0042697 3300048918 Bacteria 3613
836 Ga0496115_0052320 3300048918 Bacteria 3276
837 Ga0496115_0151627 3300048918 Bacteria 1914
838 Ga0496115_0206468 3300048918 Bacteria 1623
839 Ga0496115_0268618 3300048918 Bacteria 1402
840 Ga0496126_0446933 3300048929 Bacteria 1041
841 Ga0501031_0008594 3300049568 Bacteria 6645
842 Ga0501031_0170117 3300049568 Bacteria 1424
843 Ga0501032_0033829 3300049569 Bacteria 3501
844 Ga0501032_0050173 3300049569 Bacteria 2814
845 Ga0501032_0190710 3300049569 Bacteria 1340
846 Ga0501033_0008039 3300049570 Bacteria 8171
847 Ga0501034_0000593 3300049571 Bacteria 57233
848 Ga0501034_0003500 3300049571 Bacteria 17827
849 Ga0501034_0013580 3300049571 Bacteria 8380
850 Ga0501034_0038501 3300049571 Bacteria 4841
851 Ga0501034_0057995 3300049571 Bacteria 3892
852 Ga0501034_0122679 3300049571 Bacteria 2584
853 Ga0501034_0351777 3300049571 Bacteria 1401
854 Ga0501034_0426869 3300049571 Bacteria 1246
855 Ga0501036_0009653 3300049572 Bacteria 7940
856 Ga0501036_0012201 3300049572 Bacteria 7119
857 Ga0501036_0092836 3300049572 Bacteria 2550
858 Ga0501037_0010535 3300049573 Bacteria 6790
859 Ga0501037_0012851 3300049573 Bacteria 6171
860 Ga0501037_0046114 3300049573 Bacteria 3197
861 Ga0501037_0047700 3300049573 Bacteria 3138
862 Ga0501037_0049652 3300049573 Bacteria 3072
863 Ga0501038_0008716 3300049574 Bacteria 9308
864 Ga0501038_0054702 3300049574 Bacteria 3431
865 Ga0501038_0055563 3300049574 Bacteria 3400
866 Ga0501038_0086495 3300049574 Bacteria 2633
867 Ga0501038_0171469 3300049574 Bacteria 1756
868 Ga0501038_0212993 3300049574 Bacteria 1545
869 Ga0501038_0215001 3300049574 Bacteria 1536
870 Ga0501039_0016524 3300049575 Bacteria 5652
871 Ga0501040_0151938 3300049576 Bacteria 1634
872 Ga0501041_0032275 3300049577 Bacteria 3165
873 Ga0501042_0225216 3300049578 Bacteria 1353
874 Ga0501043_0005751 3300049579 Bacteria 9990
875 Ga0501043_0008613 3300049579 Bacteria 8038
876 Ga0501043_0127088 3300049579 Bacteria 1999
877 Ga0501043_0383726 3300049579 Bacteria 1063
878 Ga0501046_0027172 3300049580 Bacteria 4672
879 Ga0501046_0153731 3300049580 Bacteria 1735
880 Ga0501047_0010766 3300049581 Bacteria 8644
881 Ga0501047_0019566 3300049581 Bacteria 6495
882 Ga0501047_0079851 3300049581 Bacteria 3145
883 Ga0501047_0094930 3300049581 Bacteria 2861
884 Ga0501047_0220107 3300049581 Bacteria 1755
885 Ga0501047_0236914 3300049581 Bacteria 1677
886 Ga0501047_0366331 3300049581 Bacteria 1276
887 Ga0501048_0005729 3300049582 Bacteria 9442
888 Ga0501048_0287479 3300049582 Bacteria 1169
889 Ga0501067_0006118 3300049583 Bacteria 6673
890 Ga0501067_0057298 3300049583 Bacteria 2158
891 Ga0501068_0005466 3300049584 Bacteria 6958
892 Ga0501068_0061389 3300049584 Bacteria 2284
893 Ga0501068_0117101 3300049584 Bacteria 1659
894 Ga0501069_0011787 3300049585 Bacteria 4636
895 Ga0501069_0137945 3300049585 Bacteria 1398
896 Ga0501069_0212107 3300049585 Bacteria 1124
897 Ga0501070_0017280 3300049586 Bacteria 6057
898 Ga0501070_0039667 3300049586 Bacteria 3926
899 Ga0501070_0048612 3300049586 Bacteria 3522
900 Ga0501070_0055929 3300049586 Bacteria 3271
901 Ga0501070_0097662 3300049586 Bacteria 2429
902 Ga0501070_0116611 3300049586 Bacteria 2205
903 Ga0501070_0241723 3300049586 Bacteria 1478
904 Ga0501070_0260795 3300049586 Bacteria 1416
905 Ga0501071_0011718 3300049587 Bacteria 5917
906 Ga0501071_0033606 3300049587 Bacteria 3644
907 Ga0501071_0092462 3300049587 Bacteria 2223
908 Ga0501073_0010149 3300049589 Bacteria 6919
909 Ga0501073_0079612 3300049589 Bacteria 2280
910 Ga0501073_0082127 3300049589 Bacteria 2241
911 Ga0501073_0138779 3300049589 Bacteria 1684
912 Ga0501073_0235968 3300049589 Bacteria 1263
913 Ga0501073_0301621 3300049589 Bacteria 1105
914 Ga0501073_0304516 3300049589 Bacteria 1099
915 Ga0501074_0009969 3300049590 Bacteria 6901
916 Ga0501074_0025531 3300049590 Bacteria 4289
917 Ga0501074_0072194 3300049590 Bacteria 2480
918 Ga0501074_0333346 3300049590 Bacteria 1077
919 Ga0501076_0037021 3300049592 Bacteria 3824
920 Ga0501079_0122851 3300049741 Bacteria 2019
921 Ga0501079_0132194 3300049741 Bacteria 1942
922 Ga0501080_0000953 3300049742 Bacteria 23696
923 Ga0501080_0027894 3300049742 Bacteria 5250
924 Ga0501080_0041071 3300049742 Bacteria 4312
925 Ga0501080_0042019 3300049742 Bacteria 4259
926 Ga0501080_0043365 3300049742 Bacteria 4189
927 Ga0501080_0139005 3300049742 Bacteria 2246
928 Ga0501080_0236398 3300049742 Bacteria 1669
929 Ga0501083_0001052 3300049744 Bacteria 18390
930 Ga0501083_0018436 3300049744 Bacteria 4864
931 Ga0501083_0031534 3300049744 Bacteria 3638
932 Ga0501083_0262086 3300049744 Bacteria 1124
933 Ga0501035_0000745 3300049822 Bacteria 35086
934 Ga0501035_0043901 3300049822 Bacteria 4027
935 Ga0501035_0066829 3300049822 Bacteria 3190
936 Ga0501035_0081308 3300049822 Bacteria 2859
937 Ga0501035_0143535 3300049822 Bacteria 2074
938 Ga0501044_0016146 3300049823 Bacteria 8026
939 Ga0501044_0052404 3300049823 Bacteria 4204
940 Ga0501044_0062443 3300049823 Bacteria 3808
941 Ga0501044_0068690 3300049823 Bacteria 3609
942 Ga0501044_0092338 3300049823 Bacteria 3053
943 Ga0501044_0185224 3300049823 Bacteria 2047
944 Ga0501044_0249781 3300049823 Bacteria 1715
945 Ga0501044_0352224 3300049823 Bacteria 1392
946 Ga0501045_0079364 3300049824 Bacteria 2420
947 Ga0501045_0112175 3300049824 Bacteria 2022
948 Ga0501045_0128437 3300049824 Bacteria 1884
949 nmdc:mga03n38_53175_c1 3300050490 Bacteria 1815
950 nmdc:mga0yw44_4808_c1 3300050492 Bacteria 6266
951 nmdc:mga06z11_33586_c1 3300050494 Bacteria 2511
952 nmdc:mga06z11_8879_c1 3300050494 Bacteria 4213
953 nmdc:mga07m45_25315_c1 3300050496 Bacteria 3254
954 nmdc:mga05p37_117053_c1 3300050507 Bacteria 3275
955 nmdc:mga05p37_1375_c1 3300050507 Bacteria 28284
956 nmdc:mga09592_4676_c1 3300050508 Bacteria 11079
957 nmdc:mga0qj67_959_c1 3300050509 Bacteria 19847
958 nmdc:mga06r32_167782_c1 3300050510 Bacteria 2178
959 nmdc:mga06r32_40373_c1 3300050510 Bacteria 4429
960 nmdc:mga06r32_592_c1 3300050510 Bacteria 31540
961 nmdc:mga08y16_108_c1 3300050511 Bacteria 69804
962 nmdc:mga08y16_19155_c1 3300050511 Bacteria 7212
963 nmdc:mga08y16_4119_c1 3300050511 Bacteria 15172
964 nmdc:mga08y16_447745_c1 3300050511 Bacteria 1317
965 nmdc:mga08y16_568_c1 3300050511 Bacteria 34301
966 nmdc:mga0n895_104_c1 3300050512 Bacteria 49584
967 nmdc:mga0n895_148662_c1 3300050512 Bacteria 2372
968 nmdc:mga0n895_337_c1 3300050512 Bacteria 31380
969 nmdc:mga0n895_436576_c1 3300050512 Bacteria 1323
970 nmdc:mga0n895_57644_c1 3300050512 Bacteria 3829
971 nmdc:mga0n895_84342_c1 3300050512 Bacteria 3170
972 nmdc:mga0rr50_1110_c1 3300050513 Bacteria 14607
973 nmdc:mga0rr50_17098_c1 3300050513 Bacteria 4832
974 nmdc:mga0rr50_340097_c1 3300050513 Bacteria 1261
975 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
976 nmdc:mga08x19_95882_c1 3300050514 Bacteria 1963
977 nmdc:mga0a205_2128_c1 3300050515 Bacteria 17383
978 nmdc:mga0a205_2355_c2 3300050515 Bacteria 7021
979 nmdc:mga0a205_492444_c1 3300050515 Bacteria 1083
980 Ga0495601_0000280 3300053077 Bacteria 27384
981 Ga0495601_0001337 3300053077 Bacteria 13545
982 Ga0495601_0015893 3300053077 Bacteria 4554
983 Ga0495601_0017450 3300053077 Bacteria 4357
984 Ga0495601_0074515 3300053077 Bacteria 2171
985 Ga0495612_0000501 3300053078 Bacteria 15645
986 Ga0495612_0010034 3300053078 Bacteria 3832
987 Ga0495612_0010083 3300053078 Bacteria 3821
988 Ga0495612_0012382 3300053078 Bacteria 3438
989 Ga0495612_0030723 3300053078 Bacteria 2164
990 Ga0495595_0000612 3300053084 Bacteria 13580
991 Ga0495595_0002010 3300053084 Bacteria 7899
992 Ga0495595_0003562 3300053084 Bacteria 6182
993 Ga0495595_0009498 3300053084 Bacteria 4025
994 Ga0495619_0000048 3300053085 Bacteria 102117
995 Ga0495619_0000314 3300053085 Bacteria 33926
996 Ga0495619_0000459 3300053085 Bacteria 27482
997 Ga0495619_0002080 3300053085 Bacteria 13304
998 Ga0495619_0002348 3300053085 Bacteria 12455
999 Ga0495619_0028684 3300053085 Bacteria 3591
1000 Ga0495619_0127919 3300053085 Bacteria 1744
1001 Ga0500643_005961 3300053087 Bacteria 5165
1002 Ga0500651_0074070 3300053093 Bacteria 2116
1003 Ga0500566_0058957 3300053094 Bacteria 2178
1004 Ga0500595_000003 3300053119 Bacteria 419332
1005 Ga0500595_050791 3300053119 Bacteria 1286
1006 Ga0500652_000010 3300053131 Bacteria 162810
1007 Ga0500616_0000002 3300053153 Bacteria 1611257
1008 Ga0500645_000217 3300053730 Bacteria 43911
1009 Ga0501084_0045310 3300054114 Bacteria 3683
1010 Ga0501084_0407720 3300054114 Bacteria 1149
1011 Ga0501082_0004160 3300060353 Bacteria 12646
1012 Ga0501082_0120968 3300060353 Bacteria 2269
1013 Ga0501082_0226016 3300060353 Bacteria 1629
1014 Ga0501082_0382965 3300060353 Bacteria 1227
1015 Ga0530510_0284098 3300061734 Bacteria 1236

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041496 Ga0451839_1410856 Ga0451839_1410856_56_931 279
2 3300003203 JGI25406J46586_10032468 JGI25406J46586_100324682 281
3 3300005985 Ga0081539_10000115 Ga0081539_100001152 281
4 3300009147 Ga0114129_10196053 Ga0114129_101960532 281
5 3300039437 Ga0436365_1389092 Ga0436365_1389092_1424_2404 281
6 3300050510 nmdc:mga06r32_40373_c1 nmdc:mga06r32_40373_c1_3331_4344 281
7 3300025905 Ga0207685_10135589 Ga0207685_101355892 282
8 3300006173 Ga0070716_100221113 Ga0070716_1002211132 283
9 3300048929 Ga0496126_0446933 Ga0496126_0446933_141_1028 286
10 3300005458 Ga0070681_10003089 Ga0070681_1000308914 287
11 3300009148 Ga0105243_10173381 Ga0105243_101733811 287
12 3300025912 Ga0207707_10032559 Ga0207707_100325593 287
13 3300037853 Ga0436364_0326872 Ga0436364_0326872_71_1036 288
14 3300025942 Ga0207689_10116082 Ga0207689_101160822 289
15 3300027907 Ga0207428_10000096 Ga0207428_10000096111 289
16 3300050511 nmdc:mga08y16_568_c1 nmdc:mga08y16_568_c1_16310_17314 289
17 3300005458 Ga0070681_10118248 Ga0070681_101182483 291
18 3300005985 Ga0081539_10001357 Ga0081539_1000135715 291
19 3300025921 Ga0207652_10335470 Ga0207652_103354702 291
20 3300009176 Ga0105242_10213004 Ga0105242_102130042 292
21 3300031249 Ga0265339_10081188 Ga0265339_100811882 292
22 3300031251 Ga0265327_10021801 Ga0265327_100218012 292
23 3300031344 Ga0265316_10107177 Ga0265316_101071772 292
24 3300050490 nmdc:mga03n38_53175_c1 nmdc:mga03n38_53175_c1_782_1741 292
25 3300049742 Ga0501080_0042019 Ga0501080_0042019_2552_3526 293
26 3300028556 Ga0265337_1000796 Ga0265337_10007967 294
27 3300028573 Ga0265334_10017368 Ga0265334_100173682 294
28 3300003203 JGI25406J46586_10017341 JGI25406J46586_100173413 295
29 iso_pu_bacteria 2842775625 2842776261 295
30 3300005329 Ga0070683_100075385 Ga0070683_1000753852 296
31 3300009551 Ga0105238_10070748 Ga0105238_100707482 296
32 3300013307 Ga0157372_10084628 Ga0157372_100846284 296
33 3300025924 Ga0207694_10049888 Ga0207694_100498882 296
34 3300025944 Ga0207661_10119353 Ga0207661_101193531 296
35 3300039437 Ga0436365_0858460 Ga0436365_0858460_462_1433 296
36 3300048918 Ga0496115_0268618 Ga0496115_0268618_100_1071 296
37 3300005458 Ga0070681_10096066 Ga0070681_100960663 297
38 3300021384 Ga0213876_10000046 Ga0213876_1000004637 297
39 3300022467 Ga0224712_10007388 Ga0224712_100073882 297
40 3300025912 Ga0207707_10075788 Ga0207707_100757882 297
41 3300025918 Ga0207662_10224241 Ga0207662_102242411 297
42 3300039437 Ga0436365_1658434 Ga0436365_1658434_23456_24442 297
43 3300039437 Ga0436365_1061189 Ga0436365_1061189_2823_3782 298
44 3300049744 Ga0501083_0018436 Ga0501083_0018436_2740_3708 298
45 3300031711 Ga0265314_10016519 Ga0265314_100165194 299
46 3300039450 Ga0436363_1390095 Ga0436363_1390095_260_1237 299
47 3300005518 Ga0070699_100010837 Ga0070699_1000108375 300
48 3300025292 Ga0209676_1000089 Ga0209676_1000089232 300
49 3300025298 Ga0209050_1008351 Ga0209050_10083515 300
50 3300014745 Ga0157377_10213289 Ga0157377_102132891 301
51 3300025937 Ga0207669_10044660 Ga0207669_100446601 301
52 3300031247 Ga0265340_10008715 Ga0265340_100087152 301
53 3300037466 Ga0395898_0136879 Ga0395898_0136879_743_1708 301
54 3300039438 Ga0436360_1260651 Ga0436360_1260651_612_1586 301
55 3300039450 Ga0436363_0532621 Ga0436363_0532621_2574_3626 301
56 3300047444 Ga0495675_0190095 Ga0495675_0190095_132_1103 301
57 3300005355 Ga0070671_100205454 Ga0070671_1002054542 302
58 3300005365 Ga0070688_100077346 Ga0070688_1000773462 302
59 3300005564 Ga0070664_100471296 Ga0070664_1004712961 302
60 3300005617 Ga0068859_100126913 Ga0068859_1001269131 302
61 3300005718 Ga0068866_10175450 Ga0068866_101754501 302
62 3300005843 Ga0068860_100339213 Ga0068860_1003392132 302
63 3300005981 Ga0081538_10005636 Ga0081538_100056364 302
64 3300006931 Ga0097620_100126907 Ga0097620_1001269071 302
65 3300009177 Ga0105248_10640719 Ga0105248_106407191 302
66 3300025315 Ga0207697_10033038 Ga0207697_100330382 302
67 3300025931 Ga0207644_10059673 Ga0207644_100596732 302
68 3300025936 Ga0207670_10008819 Ga0207670_100088195 302
69 3300026095 Ga0207676_10024007 Ga0207676_100240073 302
70 3300028381 Ga0268264_10248040 Ga0268264_102480401 302
71 3300035691 Ga0373931_0021545 Ga0373931_0021545_1743_2711 302
72 3300044901 Ga0466960_0051950 Ga0466960_0051950_593_1537 302
73 3300009094 Ga0111539_10080586 Ga0111539_100805864 303
74 3300026118 Ga0207675_100041675 Ga0207675_1000416753 303
75 3300032002 Ga0307416_100236268 Ga0307416_1002362682 303
76 3300006847 Ga0075431_100009808 Ga0075431_1000098085 304
77 3300036401 Ga0373937_0106442 Ga0373937_0106442_595_1557 304
78 3300049571 Ga0501034_0122679 Ga0501034_0122679_1032_1985 304
79 iso_pu_bacteria 2842694124 2842695407 304
80 3300039438 Ga0436360_0547038 Ga0436360_0547038_560_1522 305
81 3300046522 Ga0495643_0054324 Ga0495643_0054324_745_1701 305
82 3300049583 Ga0501067_0006118 Ga0501067_0006118_1475_2449 305
83 3300054114 Ga0501084_0045310 Ga0501084_0045310_1625_2599 305
84 iso_pu_bacteria 2883291878 2883292898 305
85 iso_pu_bacteria 2917554339 2917556729 305
86 3300005355 Ga0070671_100135757 Ga0070671_1001357572 306
87 3300009993 Ga0105028_101643 Ga0105028_1016432 306
88 3300031249 Ga0265339_10002069 Ga0265339_100020694 306
89 3300031595 Ga0265313_10001505 Ga0265313_1000150515 306
90 3300031712 Ga0265342_10002243 Ga0265342_100022439 306
91 3300031727 Ga0316576_10163537 Ga0316576_101635372 306
92 3300036712 Ga0316584_0033354 Ga0316584_0033354_468_1442 306
93 3300037068 Ga0373925_0064177 Ga0373925_0064177_1326_2288 306
94 3300039062 Ga0400483_019258 Ga0400483_019258_6461_7435 306
95 3300039062 Ga0400483_118863 Ga0400483_118863_159_1133 306
96 3300039062 Ga0400483_179075 Ga0400483_179075_381_1355 306
97 3300039062 Ga0400483_199061 Ga0400483_199061_4427_5461 306
98 3300039437 Ga0436365_1136139 Ga0436365_1136139_160_1125 306
99 3300049569 Ga0501032_0190710 Ga0501032_0190710_231_1202 306
100 3300049581 Ga0501047_0366331 Ga0501047_0366331_236_1207 306
101 3300049589 Ga0501073_0079612 Ga0501073_0079612_629_1600 306
102 3300049589 Ga0501073_0082127 Ga0501073_0082127_1059_2024 306
103 3300049741 Ga0501079_0132194 Ga0501079_0132194_604_1575 306
104 3300049744 Ga0501083_0031534 Ga0501083_0031534_1392_2363 306
105 3300049823 Ga0501044_0249781 Ga0501044_0249781_509_1480 306
106 3300060353 Ga0501082_0004160 Ga0501082_0004160_67_1038 306
107 3300005329 Ga0070683_100077513 Ga0070683_1000775132 307
108 3300005467 Ga0070706_100314634 Ga0070706_1003146341 307
109 3300005468 Ga0070707_100019827 Ga0070707_1000198273 307
110 3300005535 Ga0070684_100078438 Ga0070684_1000784383 307
111 3300005536 Ga0070697_100000922 Ga0070697_10000092216 307
112 3300005614 Ga0068856_100108184 Ga0068856_1001081842 307
113 3300005614 Ga0068856_100415741 Ga0068856_1004157412 307
114 3300005841 Ga0068863_100607235 Ga0068863_1006072351 307
115 3300006871 Ga0075434_100018131 Ga0075434_1000181314 307
116 3300009147 Ga0114129_10004108 Ga0114129_1000410816 307
117 3300021388 Ga0213875_10001127 Ga0213875_1000112717 307
118 3300022467 Ga0224712_10117528 Ga0224712_101175281 307
119 3300025906 Ga0207699_10078156 Ga0207699_100781562 307
120 3300025915 Ga0207693_10000460 Ga0207693_100004603 307
121 3300025922 Ga0207646_10005518 Ga0207646_100055186 307
122 3300025928 Ga0207700_10015075 Ga0207700_100150752 307
123 3300025929 Ga0207664_10068431 Ga0207664_100684313 307
124 3300025939 Ga0207665_10014670 Ga0207665_100146702 307
125 3300025939 Ga0207665_10090953 Ga0207665_100909532 307
126 3300025944 Ga0207661_10543156 Ga0207661_105431561 307
127 3300026035 Ga0207703_10254754 Ga0207703_102547542 307
128 3300026078 Ga0207702_10174970 Ga0207702_101749702 307
129 3300026095 Ga0207676_10281156 Ga0207676_102811562 307
130 3300031247 Ga0265340_10018445 Ga0265340_100184452 307
131 3300037853 Ga0436364_0022735 Ga0436364_0022735_144476_145441 307
132 3300039062 Ga0400483_136500 Ga0400483_136500_2964_3953 307
133 3300039062 Ga0400483_220307 Ga0400483_220307_4879_5868 307
134 3300039437 Ga0436365_1708732 Ga0436365_1708732_1041_1994 307
135 3300048909 Ga0496106_0160876 Ga0496106_0160876_745_1716 307
136 3300048912 Ga0496109_0091481 Ga0496109_0091481_939_1910 307
137 3300048913 Ga0496110_0093264 Ga0496110_0093264_988_1953 307
138 3300049572 Ga0501036_0092836 Ga0501036_0092836_1023_2000 307
139 3300049574 Ga0501038_0171469 Ga0501038_0171469_393_1370 307
140 3300049576 Ga0501040_0151938 Ga0501040_0151938_417_1394 307
141 3300049577 Ga0501041_0032275 Ga0501041_0032275_219_1196 307
142 3300049580 Ga0501046_0027172 Ga0501046_0027172_3061_4038 307
143 3300049584 Ga0501068_0061389 Ga0501068_0061389_347_1324 307
144 3300049587 Ga0501071_0092462 Ga0501071_0092462_497_1474 307
145 3300049592 Ga0501076_0037021 Ga0501076_0037021_2571_3548 307
146 3300049741 Ga0501079_0122851 Ga0501079_0122851_219_1196 307
147 3300049742 Ga0501080_0236398 Ga0501080_0236398_603_1580 307
148 3300050512 nmdc:mga0n895_57644_c1 nmdc:mga0n895_57644_c1_1189_2208 307
149 3300050513 nmdc:mga0rr50_340097_c1 nmdc:mga0rr50_340097_c1_289_1242 307
150 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_31469_32422 307
151 3300060353 Ga0501082_0382965 Ga0501082_0382965_110_1087 307
152 3300032004 Ga0307414_10011115 Ga0307414_100111153 308
153 3300035119 Ga0373956_0104901 Ga0373956_0104901_101_1135 308
154 3300039437 Ga0436365_1437456 Ga0436365_1437456_65_1033 308
155 3300046454 Ga0495592_0129180 Ga0495592_0129180_576_1610 308
156 3300046514 Ga0495618_0065214 Ga0495618_0065214_910_1944 308
157 3300046559 Ga0495667_0011244 Ga0495667_0011244_4701_5735 308
158 3300049589 Ga0501073_0304516 Ga0501073_0304516_15_1007 308
159 3300049823 Ga0501044_0092338 Ga0501044_0092338_1388_2380 308
160 3300053077 Ga0495601_0017450 Ga0495601_0017450_906_1940 308
161 3300054114 Ga0501084_0407720 Ga0501084_0407720_151_1119 308
162 3300005340 Ga0070689_100106691 Ga0070689_1001066911 309
163 3300005468 Ga0070707_100068982 Ga0070707_1000689821 309
164 3300005471 Ga0070698_100002604 Ga0070698_10000260410 309
165 3300005518 Ga0070699_100399696 Ga0070699_1003996962 309
166 3300005937 Ga0081455_10356718 Ga0081455_103567181 309
167 3300005985 Ga0081539_10015315 Ga0081539_100153152 309
168 3300006028 Ga0070717_10000230 Ga0070717_1000023026 309
169 3300021358 Ga0213873_10020551 Ga0213873_100205512 309
170 3300025922 Ga0207646_10457608 Ga0207646_104576081 309
171 3300025936 Ga0207670_10296777 Ga0207670_102967771 309
172 3300031665 Ga0316575_10018835 Ga0316575_100188351 309
173 3300032133 Ga0316583_10000092 Ga0316583_1000009216 309
174 3300035112 Ga0373932_0019013 Ga0373932_0019013_704_1711 309
175 3300036647 Ga0316582_0168321 Ga0316582_0168321_347_1315 309
176 3300037853 Ga0436364_1355609 Ga0436364_1355609_6821_7804 309
177 3300039447 Ga0436361_0128609 Ga0436361_0128609_110_1072 309
178 3300039447 Ga0436361_0673711 Ga0436361_0673711_299_1261 309
179 3300049581 Ga0501047_0220107 Ga0501047_0220107_613_1605 309
180 3300005937 Ga0081455_10138904 Ga0081455_101389043 310
181 3300031241 Ga0265325_10000305 Ga0265325_1000030524 310
182 3300044694 Ga0466963_0051199 Ga0466963_0051199_1157_2110 310
183 3300049585 Ga0501069_0011787 Ga0501069_0011787_1048_2025 311
184 3300049585 Ga0501069_0137945 Ga0501069_0137945_149_1126 311
185 3300049586 Ga0501070_0017280 Ga0501070_0017280_2176_3153 311
186 3300049586 Ga0501070_0039667 Ga0501070_0039667_2522_3499 311
187 3300049590 Ga0501074_0072194 Ga0501074_0072194_793_1770 311
188 3300049742 Ga0501080_0041071 Ga0501080_0041071_2941_3918 311
189 3300049742 Ga0501080_0043365 Ga0501080_0043365_1536_2513 311
190 3300049822 Ga0501035_0000745 Ga0501035_0000745_16734_17711 311
191 3300050494 nmdc:mga06z11_33586_c1 nmdc:mga06z11_33586_c1_1439_2398 311
192 3300005338 Ga0068868_100076695 Ga0068868_1000766953 312
193 3300005434 Ga0070709_10003295 Ga0070709_100032959 312
194 3300005435 Ga0070714_100006005 Ga0070714_1000060054 312
195 3300005435 Ga0070714_100156314 Ga0070714_1001563142 312
196 3300005436 Ga0070713_100005513 Ga0070713_1000055137 312
197 3300005436 Ga0070713_100271396 Ga0070713_1002713962 312
198 3300005439 Ga0070711_100067897 Ga0070711_1000678972 312
199 3300005439 Ga0070711_100228706 Ga0070711_1002287062 312
200 3300005468 Ga0070707_100169398 Ga0070707_1001693982 312
201 3300005546 Ga0070696_100293152 Ga0070696_1002931521 312
202 3300005842 Ga0068858_100136544 Ga0068858_1001365442 312
203 3300005981 Ga0081538_10026613 Ga0081538_100266134 312
204 3300006038 Ga0075365_10001374 Ga0075365_100013747 312
205 3300006163 Ga0070715_10005041 Ga0070715_100050414 312
206 3300006173 Ga0070716_100014532 Ga0070716_1000145322 312
207 3300006175 Ga0070712_100000431 Ga0070712_10000043123 312
208 3300006175 Ga0070712_100120327 Ga0070712_1001203272 312
209 3300006237 Ga0097621_100082967 Ga0097621_1000829672 312
210 3300006358 Ga0068871_100255427 Ga0068871_1002554271 312
211 3300006844 Ga0075428_100065761 Ga0075428_1000657616 312
212 3300006871 Ga0075434_100047122 Ga0075434_1000471223 312
213 3300006871 Ga0075434_100140061 Ga0075434_1001400613 312
214 3300007076 Ga0075435_100069473 Ga0075435_1000694732 312
215 3300007265 Ga0099794_10021200 Ga0099794_100212003 312
216 3300009098 Ga0105245_10005575 Ga0105245_100055759 312
217 3300013306 Ga0163162_10372966 Ga0163162_103729662 312
218 3300025903 Ga0207680_10116073 Ga0207680_101160732 312
219 3300025906 Ga0207699_10029344 Ga0207699_100293442 312
220 3300025910 Ga0207684_10049512 Ga0207684_100495122 312
221 3300025915 Ga0207693_10001247 Ga0207693_100012473 312
222 3300025915 Ga0207693_10008813 Ga0207693_100088134 312
223 3300025915 Ga0207693_10136257 Ga0207693_101362572 312
224 3300025916 Ga0207663_10055510 Ga0207663_100555102 312
225 3300025927 Ga0207687_10016909 Ga0207687_100169093 312
226 3300025928 Ga0207700_10002145 Ga0207700_100021457 312
227 3300025929 Ga0207664_10011719 Ga0207664_100117196 312
228 3300025929 Ga0207664_10082275 Ga0207664_100822752 312
229 3300025939 Ga0207665_10005925 Ga0207665_100059252 312
230 3300026035 Ga0207703_10040655 Ga0207703_100406552 312
231 3300035695 Ga0373927_0048155 Ga0373927_0048155_1550_2515 312
232 3300039447 Ga0436361_0546261 Ga0436361_0546261_5734_6717 312
233 3300045976 Ga0466967_0210469 Ga0466967_0210469_498_1457 312
234 3300046459 Ga0495629_0063552 Ga0495629_0063552_798_1763 312
235 3300048904 Ga0496101_0006083 Ga0496101_0006083_6473_7441 312
236 3300048905 Ga0496102_0070151 Ga0496102_0070151_565_1530 312
237 3300048905 Ga0496102_0230921 Ga0496102_0230921_308_1276 312
238 3300048908 Ga0496105_0036464 Ga0496105_0036464_865_1833 312
239 3300048909 Ga0496106_0149281 Ga0496106_0149281_372_1337 312
240 3300048912 Ga0496109_0017400 Ga0496109_0017400_4608_5576 312
241 3300048913 Ga0496110_0002745 Ga0496110_0002745_12059_13024 312
242 3300048915 Ga0496112_0258616 Ga0496112_0258616_236_1201 312
243 3300048917 Ga0496114_0002210 Ga0496114_0002210_11524_12492 312
244 3300048918 Ga0496115_0005059 Ga0496115_0005059_5558_6526 312
245 3300048918 Ga0496115_0206468 Ga0496115_0206468_631_1596 312
246 3300049574 Ga0501038_0212993 Ga0501038_0212993_73_1038 312
247 3300049579 Ga0501043_0127088 Ga0501043_0127088_291_1259 312
248 3300049579 Ga0501043_0383726 Ga0501043_0383726_73_1038 312
249 3300049587 Ga0501071_0033606 Ga0501071_0033606_1956_2924 312
250 3300049590 Ga0501074_0333346 Ga0501074_0333346_82_1047 312
251 3300049824 Ga0501045_0079364 Ga0501045_0079364_211_1176 312
252 3300050510 nmdc:mga06r32_167782_c1 nmdc:mga06r32_167782_c1_92_1114 312
253 3300050512 nmdc:mga0n895_436576_c1 nmdc:mga0n895_436576_c1_250_1215 312
254 3300050512 nmdc:mga0n895_84342_c1 nmdc:mga0n895_84342_c1_1172_2137 312
255 3300050515 nmdc:mga0a205_492444_c1 nmdc:mga0a205_492444_c1_43_1008 312
256 3300061734 Ga0530510_0284098 Ga0530510_0284098_148_1113 312
257 iso_pu_bacteria 2643221547 2643757545 312
258 3300005339 Ga0070660_100030377 Ga0070660_1000303772 313
259 3300005340 Ga0070689_100145194 Ga0070689_1001451942 313
260 3300005563 Ga0068855_100265405 Ga0068855_1002654052 313
261 3300006051 Ga0075364_10163182 Ga0075364_101631822 313
262 3300006177 Ga0075362_10106101 Ga0075362_101061012 313
263 3300006186 Ga0075369_10023630 Ga0075369_100236301 313
264 3300006195 Ga0075366_10158023 Ga0075366_101580232 313
265 3300009147 Ga0114129_10132378 Ga0114129_101323782 313
266 3300009177 Ga0105248_10296134 Ga0105248_102961342 313
267 3300013306 Ga0163162_10303417 Ga0163162_103034172 313
268 3300014968 Ga0157379_10174036 Ga0157379_101740362 313
269 3300025899 Ga0207642_10153554 Ga0207642_101535541 313
270 3300025917 Ga0207660_10052000 Ga0207660_100520003 313
271 3300025921 Ga0207652_10035880 Ga0207652_100358802 313
272 3300025931 Ga0207644_10044351 Ga0207644_100443511 313
273 3300025941 Ga0207711_10003227 Ga0207711_100032273 313
274 3300031241 Ga0265325_10035033 Ga0265325_100350332 313
275 3300031249 Ga0265339_10039970 Ga0265339_100399702 313
276 3300031595 Ga0265313_10025172 Ga0265313_100251724 313
277 3300031711 Ga0265314_10109110 Ga0265314_101091102 313
278 3300035114 Ga0373939_0051546 Ga0373939_0051546_64_1035 313
279 3300035691 Ga0373931_0153675 Ga0373931_0153675_28_999 313
280 3300035692 Ga0373935_0101018 Ga0373935_0101018_890_1891 313
281 3300036401 Ga0373937_0002866 Ga0373937_0002866_3849_4853 313
282 3300048903 Ga0496100_0005202 Ga0496100_0005202_3059_4030 313
283 3300048907 Ga0496104_0120433 Ga0496104_0120433_989_1960 313
284 3300048909 Ga0496106_0090801 Ga0496106_0090801_45_1016 313
285 3300048910 Ga0496107_0020151 Ga0496107_0020151_2096_3067 313
286 3300048913 Ga0496110_0001702 Ga0496110_0001702_736_1707 313
287 3300048915 Ga0496112_0255817 Ga0496112_0255817_552_1523 313
288 3300048916 Ga0496113_0039278 Ga0496113_0039278_392_1363 313
289 3300049568 Ga0501031_0008594 Ga0501031_0008594_2077_3048 313
290 3300049569 Ga0501032_0050173 Ga0501032_0050173_1615_2586 313
291 3300049570 Ga0501033_0008039 Ga0501033_0008039_1245_2216 313
292 3300049571 Ga0501034_0057995 Ga0501034_0057995_1909_2880 313
293 3300049571 Ga0501034_0426869 Ga0501034_0426869_241_1209 313
294 3300049572 Ga0501036_0009653 Ga0501036_0009653_356_1327 313
295 3300049573 Ga0501037_0047700 Ga0501037_0047700_1289_2260 313
296 3300049580 Ga0501046_0153731 Ga0501046_0153731_154_1125 313
297 3300049581 Ga0501047_0079851 Ga0501047_0079851_1869_2840 313
298 3300049581 Ga0501047_0236914 Ga0501047_0236914_397_1365 313
299 3300049822 Ga0501035_0066829 Ga0501035_0066829_1634_2605 313
300 3300049823 Ga0501044_0062443 Ga0501044_0062443_1566_2537 313
301 3300050492 nmdc:mga0yw44_4808_c1 nmdc:mga0yw44_4808_c1_5128_6096 313
302 3300050507 nmdc:mga05p37_117053_c1 nmdc:mga05p37_117053_c1_1326_2294 313
303 3300053119 Ga0500595_050791 Ga0500595_050791_173_1141 313
304 3300053131 Ga0500652_000010 Ga0500652_000010_6147_7115 313
305 3300005439 Ga0070711_100090595 Ga0070711_1000905952 314
306 3300006175 Ga0070712_100242649 Ga0070712_1002426491 314
307 3300025929 Ga0207664_10171048 Ga0207664_101710481 314
308 3300031241 Ga0265325_10022863 Ga0265325_100228633 314
309 3300031711 Ga0265314_10001589 Ga0265314_1000158922 314
310 3300049824 Ga0501045_0112175 Ga0501045_0112175_869_1834 314
311 3300005327 Ga0070658_10016082 Ga0070658_100160824 315
312 3300005327 Ga0070658_10186969 Ga0070658_101869692 315
313 3300005329 Ga0070683_100026317 Ga0070683_1000263174 315
314 3300005336 Ga0070680_100086684 Ga0070680_1000866842 315
315 3300005336 Ga0070680_100128125 Ga0070680_1001281252 315
316 3300005339 Ga0070660_100005069 Ga0070660_1000050698 315
317 3300005435 Ga0070714_100058536 Ga0070714_1000585364 315
318 3300005437 Ga0070710_10033131 Ga0070710_100331313 315
319 3300005439 Ga0070711_100143784 Ga0070711_1001437842 315
320 3300005530 Ga0070679_100101367 Ga0070679_1001013672 315
321 3300005530 Ga0070679_100115337 Ga0070679_1001153372 315
322 3300005530 Ga0070679_100173463 Ga0070679_1001734632 315
323 3300005535 Ga0070684_100075569 Ga0070684_1000755693 315
324 3300005563 Ga0068855_100026702 Ga0068855_1000267023 315
325 3300005563 Ga0068855_100184084 Ga0068855_1001840843 315
326 3300005563 Ga0068855_100554614 Ga0068855_1005546142 315
327 3300005578 Ga0068854_100049880 Ga0068854_1000498802 315
328 3300005614 Ga0068856_100108264 Ga0068856_1001082642 315
329 3300005616 Ga0068852_100011531 Ga0068852_1000115316 315
330 3300006175 Ga0070712_100023648 Ga0070712_1000236481 315
331 3300009174 Ga0105241_10214633 Ga0105241_102146332 315
332 3300009551 Ga0105238_10046828 Ga0105238_100468284 315
333 3300013307 Ga0157372_10058724 Ga0157372_100587242 315
334 3300013307 Ga0157372_10080440 Ga0157372_100804404 315
335 3300025909 Ga0207705_10160120 Ga0207705_101601202 315
336 3300025912 Ga0207707_10045776 Ga0207707_100457762 315
337 3300025912 Ga0207707_10105071 Ga0207707_101050712 315
338 3300025919 Ga0207657_10016175 Ga0207657_100161754 315
339 3300025921 Ga0207652_10194803 Ga0207652_101948031 315
340 3300025921 Ga0207652_10343068 Ga0207652_103430682 315
341 3300025924 Ga0207694_10019282 Ga0207694_100192823 315
342 3300025932 Ga0207690_10060972 Ga0207690_100609722 315
343 3300025949 Ga0207667_10025294 Ga0207667_100252943 315
344 3300026142 Ga0207698_10183727 Ga0207698_101837273 315
345 3300028800 Ga0265338_10023559 Ga0265338_100235596 315
346 3300031235 Ga0265330_10009674 Ga0265330_100096744 315
347 3300031241 Ga0265325_10000442 Ga0265325_1000044229 315
348 3300031241 Ga0265325_10010337 Ga0265325_100103375 315
349 3300031249 Ga0265339_10100771 Ga0265339_101007712 315
350 3300031595 Ga0265313_10000305 Ga0265313_1000030534 315
351 3300031595 Ga0265313_10013856 Ga0265313_100138562 315
352 3300031712 Ga0265342_10000321 Ga0265342_1000032121 315
353 3300031712 Ga0265342_10056655 Ga0265342_100566552 315
354 3300037418 Ga0395900_0082006 Ga0395900_0082006_1491_2585 315
355 3300044693 Ga0466961_0195839 Ga0466961_0195839_36_1004 315
356 3300044842 Ga0466957_0040658 Ga0466957_0040658_20_988 315
357 3300049568 Ga0501031_0170117 Ga0501031_0170117_376_1344 315
358 3300049569 Ga0501032_0033829 Ga0501032_0033829_883_1938 315
359 3300049571 Ga0501034_0000593 Ga0501034_0000593_13978_14946 315
360 3300049571 Ga0501034_0003500 Ga0501034_0003500_16254_17222 315
361 3300049571 Ga0501034_0013580 Ga0501034_0013580_34_1005 315
362 3300049571 Ga0501034_0038501 Ga0501034_0038501_959_2014 315
363 3300049571 Ga0501034_0351777 Ga0501034_0351777_98_1066 315
364 3300049572 Ga0501036_0012201 Ga0501036_0012201_6052_7020 315
365 3300049573 Ga0501037_0010535 Ga0501037_0010535_4335_5390 315
366 3300049573 Ga0501037_0012851 Ga0501037_0012851_222_1190 315
367 3300049573 Ga0501037_0046114 Ga0501037_0046114_1237_2208 315
368 3300049574 Ga0501038_0008716 Ga0501038_0008716_7217_8272 315
369 3300049574 Ga0501038_0054702 Ga0501038_0054702_1284_2255 315
370 3300049575 Ga0501039_0016524 Ga0501039_0016524_684_1655 315
371 3300049579 Ga0501043_0005751 Ga0501043_0005751_1904_2959 315
372 3300049579 Ga0501043_0008613 Ga0501043_0008613_5519_6487 315
373 3300049581 Ga0501047_0010766 Ga0501047_0010766_2790_3758 315
374 3300049581 Ga0501047_0019566 Ga0501047_0019566_4113_5168 315
375 3300049582 Ga0501048_0005729 Ga0501048_0005729_1221_2189 315
376 3300049583 Ga0501067_0057298 Ga0501067_0057298_717_1688 315
377 3300049584 Ga0501068_0005466 Ga0501068_0005466_5681_6652 315
378 3300049586 Ga0501070_0097662 Ga0501070_0097662_732_1700 315
379 3300049586 Ga0501070_0116611 Ga0501070_0116611_334_1305 315
380 3300049586 Ga0501070_0241723 Ga0501070_0241723_465_1433 315
381 3300049586 Ga0501070_0260795 Ga0501070_0260795_77_1132 315
382 3300049589 Ga0501073_0010149 Ga0501073_0010149_705_1676 315
383 3300049589 Ga0501073_0235968 Ga0501073_0235968_95_1063 315
384 3300049589 Ga0501073_0301621 Ga0501073_0301621_73_1056 315
385 3300049590 Ga0501074_0009969 Ga0501074_0009969_380_1348 315
386 3300049590 Ga0501074_0025531 Ga0501074_0025531_34_1005 315
387 3300049742 Ga0501080_0000953 Ga0501080_0000953_6875_7843 315
388 3300049742 Ga0501080_0027894 Ga0501080_0027894_1273_2328 315
389 3300049742 Ga0501080_0139005 Ga0501080_0139005_148_1119 315
390 3300049744 Ga0501083_0001052 Ga0501083_0001052_1575_2543 315
391 3300049822 Ga0501035_0043901 Ga0501035_0043901_724_1695 315
392 3300049823 Ga0501044_0016146 Ga0501044_0016146_5699_6754 315
393 3300049823 Ga0501044_0052404 Ga0501044_0052404_38_1009 315
394 3300049823 Ga0501044_0068690 Ga0501044_0068690_613_1581 315
395 3300049823 Ga0501044_0185224 Ga0501044_0185224_607_1575 315
396 3300049824 Ga0501045_0128437 Ga0501045_0128437_456_1511 315
397 2209111006 2214586617 2213627035 316
398 2209111006 2214745204 2213754670 316
399 3300000042 ARSoilYngRDRAFT_c00018 ARSoilYngRDRAFT_0001817 316
400 3300000043 ARcpr5yngRDRAFT_c000071 ARcpr5yngRDRAFT_00007110 316
401 3300000044 ARSoilOldRDRAFT_c000005 ARSoilOldRDRAFT_00000553 316
402 3300000045 ARCol0oldRDRAFT_c00312 ARCol0oldRDRAFT_003123 316
403 3300000652 ARCol0yngRDRAFT_1000166 ARCol0yngRDRAFT_10001663 316
404 3300001430 JGI24032J14994_100069 JGI24032J14994_1000692 316
405 3300001976 JGI24752J21851_1001285 JGI24752J21851_10012853 316
406 3300001977 JGI24746J21847_1002142 JGI24746J21847_10021423 316
407 3300001978 JGI24747J21853_1000415 JGI24747J21853_10004153 316
408 3300001990 JGI24737J22298_10000309 JGI24737J22298_100003096 316
409 3300001990 JGI24737J22298_10002334 JGI24737J22298_100023345 316
410 3300001991 JGI24743J22301_10001195 JGI24743J22301_100011952 316
411 3300002070 JGI24750J21931_1000368 JGI24750J21931_10003683 316
412 3300002075 JGI24738J21930_10000219 JGI24738J21930_1000021915 316
413 3300002076 JGI24749J21850_1000528 JGI24749J21850_10005283 316
414 3300002077 JGI24744J21845_10010135 JGI24744J21845_100101351 316
415 3300002126 JGI24035J26624_1000067 JGI24035J26624_10000677 316
416 3300003911 JGI25405J52794_10008119 JGI25405J52794_100081192 316
417 3300005277 Ga0065716_1001582 Ga0065716_10015826 316
418 3300005289 Ga0065704_10077656 Ga0065704_100776561 316
419 3300005290 Ga0065712_10005999 Ga0065712_100059997 316
420 3300005290 Ga0065712_10071612 Ga0065712_100716123 316
421 3300005293 Ga0065715_10001902 Ga0065715_100019022 316
422 3300005293 Ga0065715_10089334 Ga0065715_100893349 316
423 3300005295 Ga0065707_10107519 Ga0065707_101075191 316
424 3300005295 Ga0065707_10156336 Ga0065707_101563362 316
425 3300005328 Ga0070676_10002258 Ga0070676_100022587 316
426 3300005329 Ga0070683_100006961 Ga0070683_1000069617 316
427 3300005330 Ga0070690_100110159 Ga0070690_1001101591 316
428 3300005330 Ga0070690_100163494 Ga0070690_1001634942 316
429 3300005331 Ga0070670_100002178 Ga0070670_1000021785 316
430 3300005333 Ga0070677_10001477 Ga0070677_100014772 316
431 3300005334 Ga0068869_100001327 Ga0068869_1000013277 316
432 3300005335 Ga0070666_10006983 Ga0070666_100069833 316
433 3300005335 Ga0070666_10042637 Ga0070666_100426372 316
434 3300005335 Ga0070666_10090928 Ga0070666_100909281 316
435 3300005335 Ga0070666_10232003 Ga0070666_102320032 316
436 3300005336 Ga0070680_100010314 Ga0070680_1000103142 316
437 3300005336 Ga0070680_100028504 Ga0070680_1000285043 316
438 3300005337 Ga0070682_100004337 Ga0070682_1000043372 316
439 3300005337 Ga0070682_100076349 Ga0070682_1000763492 316
440 3300005338 Ga0068868_100003112 Ga0068868_1000031122 316
441 3300005339 Ga0070660_100028339 Ga0070660_1000283393 316
442 3300005339 Ga0070660_100207633 Ga0070660_1002076332 316
443 3300005340 Ga0070689_100002417 Ga0070689_1000024175 316
444 3300005340 Ga0070689_100046491 Ga0070689_1000464912 316
445 3300005340 Ga0070689_100119533 Ga0070689_1001195332 316
446 3300005341 Ga0070691_10057825 Ga0070691_100578251 316
447 3300005343 Ga0070687_100000334 Ga0070687_10000033411 316
448 3300005343 Ga0070687_100029805 Ga0070687_1000298052 316
449 3300005344 Ga0070661_100004209 Ga0070661_1000042093 316
450 3300005344 Ga0070661_100034218 Ga0070661_1000342182 316
451 3300005345 Ga0070692_10000022 Ga0070692_100000224 316
452 3300005347 Ga0070668_100000947 Ga0070668_1000009475 316
453 3300005347 Ga0070668_100158767 Ga0070668_1001587672 316
454 3300005353 Ga0070669_100002667 Ga0070669_1000026676 316
455 3300005353 Ga0070669_100102382 Ga0070669_1001023822 316
456 3300005354 Ga0070675_100003214 Ga0070675_1000032145 316
457 3300005354 Ga0070675_100220489 Ga0070675_1002204892 316
458 3300005355 Ga0070671_100003818 Ga0070671_1000038186 316
459 3300005356 Ga0070674_100003265 Ga0070674_1000032654 316
460 3300005364 Ga0070673_100005122 Ga0070673_1000051225 316
461 3300005364 Ga0070673_100048608 Ga0070673_1000486082 316
462 3300005365 Ga0070688_100000196 Ga0070688_10000019628 316
463 3300005365 Ga0070688_100007034 Ga0070688_1000070343 316
464 3300005366 Ga0070659_100005334 Ga0070659_1000053343 316
465 3300005366 Ga0070659_100011916 Ga0070659_1000119162 316
466 3300005367 Ga0070667_100001157 Ga0070667_1000011573 316
467 3300005367 Ga0070667_100023226 Ga0070667_1000232264 316
468 3300005367 Ga0070667_100276601 Ga0070667_1002766012 316
469 3300005367 Ga0070667_100350889 Ga0070667_1003508891 316
470 3300005434 Ga0070709_10003520 Ga0070709_100035203 316
471 3300005436 Ga0070713_100077628 Ga0070713_1000776282 316
472 3300005437 Ga0070710_10003606 Ga0070710_100036064 316
473 3300005438 Ga0070701_10001542 Ga0070701_100015425 316
474 3300005438 Ga0070701_10041269 Ga0070701_100412692 316
475 3300005439 Ga0070711_100171400 Ga0070711_1001714002 316
476 3300005440 Ga0070705_100013342 Ga0070705_1000133423 316
477 3300005441 Ga0070700_100002190 Ga0070700_1000021903 316
478 3300005441 Ga0070700_100034842 Ga0070700_1000348422 316
479 3300005444 Ga0070694_100008562 Ga0070694_1000085626 316
480 3300005444 Ga0070694_100011023 Ga0070694_1000110233 316
481 3300005445 Ga0070708_100527740 Ga0070708_1005277401 316
482 3300005455 Ga0070663_100006630 Ga0070663_1000066303 316
483 3300005455 Ga0070663_100234758 Ga0070663_1002347581 316
484 3300005457 Ga0070662_100015790 Ga0070662_1000157902 316
485 3300005458 Ga0070681_10005185 Ga0070681_100051857 316
486 3300005459 Ga0068867_100007041 Ga0068867_1000070417 316
487 3300005459 Ga0068867_100313316 Ga0068867_1003133161 316
488 3300005466 Ga0070685_10004138 Ga0070685_100041385 316
489 3300005466 Ga0070685_10107297 Ga0070685_101072972 316
490 3300005468 Ga0070707_100142133 Ga0070707_1001421333 316
491 3300005518 Ga0070699_100252828 Ga0070699_1002528282 316
492 3300005530 Ga0070679_100022319 Ga0070679_1000223194 316
493 3300005530 Ga0070679_100069216 Ga0070679_1000692162 316
494 3300005530 Ga0070679_100125270 Ga0070679_1001252702 316
495 3300005530 Ga0070679_100244129 Ga0070679_1002441292 316
496 3300005535 Ga0070684_100005283 Ga0070684_1000052833 316
497 3300005539 Ga0068853_100007403 Ga0068853_1000074033 316
498 3300005543 Ga0070672_100003202 Ga0070672_1000032027 316
499 3300005544 Ga0070686_100001904 Ga0070686_1000019045 316
500 3300005544 Ga0070686_100111025 Ga0070686_1001110252 316
501 3300005544 Ga0070686_100114499 Ga0070686_1001144992 316
502 3300005545 Ga0070695_100004009 Ga0070695_1000040093 316
503 3300005545 Ga0070695_100012010 Ga0070695_1000120103 316
504 3300005546 Ga0070696_100011552 Ga0070696_1000115522 316
505 3300005546 Ga0070696_100025402 Ga0070696_1000254021 316
506 3300005546 Ga0070696_100101583 Ga0070696_1001015833 316
507 3300005547 Ga0070693_100001415 Ga0070693_1000014154 316
508 3300005547 Ga0070693_100167530 Ga0070693_1001675302 316
509 3300005548 Ga0070665_100033372 Ga0070665_1000333723 316
510 3300005548 Ga0070665_100184052 Ga0070665_1001840522 316
511 3300005549 Ga0070704_100212712 Ga0070704_1002127122 316
512 3300005563 Ga0068855_100023429 Ga0068855_1000234292 316
513 3300005563 Ga0068855_100309001 Ga0068855_1003090011 316
514 3300005564 Ga0070664_100005578 Ga0070664_1000055786 316
515 3300005564 Ga0070664_100105612 Ga0070664_1001056123 316
516 3300005577 Ga0068857_100003700 Ga0068857_1000037005 316
517 3300005578 Ga0068854_100005149 Ga0068854_1000051493 316
518 3300005614 Ga0068856_100062644 Ga0068856_1000626443 316
519 3300005614 Ga0068856_100085483 Ga0068856_1000854832 316
520 3300005615 Ga0070702_100024377 Ga0070702_1000243772 316
521 3300005615 Ga0070702_100087656 Ga0070702_1000876561 316
522 3300005616 Ga0068852_100003095 Ga0068852_1000030956 316
523 3300005616 Ga0068852_100655031 Ga0068852_1006550311 316
524 3300005617 Ga0068859_100013731 Ga0068859_1000137312 316
525 3300005617 Ga0068859_100398843 Ga0068859_1003988431 316
526 3300005618 Ga0068864_100004616 Ga0068864_1000046163 316
527 3300005718 Ga0068866_10000805 Ga0068866_100008053 316
528 3300005719 Ga0068861_100003522 Ga0068861_1000035223 316
529 3300005840 Ga0068870_10000414 Ga0068870_1000041411 316
530 3300005841 Ga0068863_100004632 Ga0068863_10000463211 316
531 3300005842 Ga0068858_100001573 Ga0068858_1000015733 316
532 3300005842 Ga0068858_100021262 Ga0068858_1000212624 316
533 3300005842 Ga0068858_100163156 Ga0068858_1001631562 316
534 3300005843 Ga0068860_100011587 Ga0068860_1000115873 316
535 3300005843 Ga0068860_100168980 Ga0068860_1001689802 316
536 3300005844 Ga0068862_100010270 Ga0068862_1000102704 316
537 3300005844 Ga0068862_100018526 Ga0068862_1000185266 316
538 3300005937 Ga0081455_10001269 Ga0081455_1000126915 316
539 3300005937 Ga0081455_10024762 Ga0081455_100247624 316
540 3300006163 Ga0070715_10108946 Ga0070715_101089461 316
541 3300006173 Ga0070716_100003237 Ga0070716_1000032371 316
542 3300006175 Ga0070712_100009409 Ga0070712_1000094092 316
543 3300006175 Ga0070712_100029920 Ga0070712_1000299202 316
544 3300006194 Ga0075427_10000546 Ga0075427_100005462 316
545 3300006237 Ga0097621_100000432 Ga0097621_1000004326 316
546 3300006237 Ga0097621_100017374 Ga0097621_1000173745 316
547 3300006353 Ga0075370_10031031 Ga0075370_100310313 316
548 3300006358 Ga0068871_100001626 Ga0068871_1000016265 316
549 3300006358 Ga0068871_100010210 Ga0068871_1000102106 316
550 3300006358 Ga0068871_100144502 Ga0068871_1001445021 316
551 3300006844 Ga0075428_100033719 Ga0075428_1000337196 316
552 3300006846 Ga0075430_100000312 Ga0075430_1000003126 316
553 3300006847 Ga0075431_100004142 Ga0075431_1000041429 316
554 3300006852 Ga0075433_10000217 Ga0075433_1000021721 316
555 3300006852 Ga0075433_10071485 Ga0075433_100714853 316
556 3300006871 Ga0075434_100000482 Ga0075434_1000004825 316
557 3300006871 Ga0075434_100025778 Ga0075434_1000257782 316
558 3300006871 Ga0075434_100167534 Ga0075434_1001675342 316
559 3300006880 Ga0075429_100005934 Ga0075429_1000059345 316
560 3300006881 Ga0068865_100001764 Ga0068865_1000017647 316
561 3300006881 Ga0068865_100008848 Ga0068865_1000088484 316
562 3300006881 Ga0068865_100048210 Ga0068865_1000482102 316
563 3300006914 Ga0075436_100205572 Ga0075436_1002055722 316
564 3300006931 Ga0097620_100013731 Ga0097620_1000137312 316
565 3300006931 Ga0097620_100398827 Ga0097620_1003988271 316
566 3300007076 Ga0075435_100022837 Ga0075435_1000228373 316
567 3300007076 Ga0075435_100031001 Ga0075435_1000310013 316
568 3300007076 Ga0075435_100086830 Ga0075435_1000868302 316
569 3300009011 Ga0105251_10052350 Ga0105251_100523502 316
570 3300009092 Ga0105250_10031284 Ga0105250_100312841 316
571 3300009093 Ga0105240_10028942 Ga0105240_100289423 316
572 3300009094 Ga0111539_10001938 Ga0111539_1000193824 316
573 3300009094 Ga0111539_10003842 Ga0111539_1000384215 316
574 3300009094 Ga0111539_10004907 Ga0111539_100049077 316
575 3300009094 Ga0111539_10029777 Ga0111539_100297773 316
576 3300009098 Ga0105245_10000534 Ga0105245_100005346 316
577 3300009148 Ga0105243_10003508 Ga0105243_1000350811 316
578 3300009174 Ga0105241_10002008 Ga0105241_100020085 316
579 3300009174 Ga0105241_10353554 Ga0105241_103535542 316
580 3300009176 Ga0105242_10004301 Ga0105242_100043016 316
581 3300009176 Ga0105242_10004986 Ga0105242_100049863 316
582 3300009176 Ga0105242_10402279 Ga0105242_104022791 316
583 3300009177 Ga0105248_10003814 Ga0105248_100038146 316
584 3300009177 Ga0105248_10012337 Ga0105248_100123375 316
585 3300009177 Ga0105248_10071076 Ga0105248_100710762 316
586 3300009545 Ga0105237_10004785 Ga0105237_1000478511 316
587 3300009545 Ga0105237_10079240 Ga0105237_100792402 316
588 3300009545 Ga0105237_10183774 Ga0105237_101837742 316
589 3300009553 Ga0105249_10004067 Ga0105249_100040673 316
590 3300009553 Ga0105249_10170337 Ga0105249_101703372 316
591 3300009553 Ga0105249_10447589 Ga0105249_104475891 316
592 3300009553 Ga0105249_10723447 Ga0105249_107234471 316
593 3300010375 Ga0105239_10039798 Ga0105239_100397982 316
594 3300010375 Ga0105239_10063264 Ga0105239_100632643 316
595 3300010375 Ga0105239_10655203 Ga0105239_106552031 316
596 3300011119 Ga0105246_10001160 Ga0105246_100011605 316
597 3300012492 Ga0157335_1002551 Ga0157335_10025511 316
598 3300012507 Ga0157342_1002325 Ga0157342_10023252 316
599 3300013100 Ga0157373_10004563 Ga0157373_100045633 316
600 3300013100 Ga0157373_10037254 Ga0157373_100372542 316
601 3300013102 Ga0157371_10028973 Ga0157371_100289733 316
602 3300013104 Ga0157370_10259250 Ga0157370_102592501 316
603 3300013296 Ga0157374_10006040 Ga0157374_100060403 316
604 3300013296 Ga0157374_10036266 Ga0157374_100362663 316
605 3300013297 Ga0157378_10006408 Ga0157378_100064086 316
606 3300013306 Ga0163162_10018687 Ga0163162_100186875 316
607 3300013307 Ga0157372_10003634 Ga0157372_1000363417 316
608 3300013308 Ga0157375_10002653 Ga0157375_100026535 316
609 3300013308 Ga0157375_10013985 Ga0157375_100139852 316
610 3300014325 Ga0163163_10003304 Ga0163163_1000330410 316
611 3300014325 Ga0163163_10006181 Ga0163163_100061815 316
612 3300014325 Ga0163163_10288779 Ga0163163_102887792 316
613 3300014326 Ga0157380_10000558 Ga0157380_1000055817 316
614 3300014745 Ga0157377_10000819 Ga0157377_100008196 316
615 3300014968 Ga0157379_10004333 Ga0157379_1000433311 316
616 3300014968 Ga0157379_10034106 Ga0157379_100341063 316
617 3300014968 Ga0157379_10410544 Ga0157379_104105442 316
618 3300014969 Ga0157376_10001412 Ga0157376_1000141211 316
619 3300014969 Ga0157376_10093425 Ga0157376_100934252 316
620 3300014969 Ga0157376_10315777 Ga0157376_103157771 316
621 3300014969 Ga0157376_10464822 Ga0157376_104648222 316
622 3300017792 Ga0163161_10001783 Ga0163161_100017835 316
623 3300025271 Ga0207666_1000030 Ga0207666_100003027 316
624 3300025271 Ga0207666_1001056 Ga0207666_10010563 316
625 3300025290 Ga0207673_1000110 Ga0207673_10001102 316
626 3300025315 Ga0207697_10000225 Ga0207697_1000022529 316
627 3300025315 Ga0207697_10007510 Ga0207697_100075106 316
628 3300025735 Ga0207713_1054500 Ga0207713_10545002 316
629 3300025885 Ga0207653_10025601 Ga0207653_100256013 316
630 3300025893 Ga0207682_10000009 Ga0207682_1000000920 316
631 3300025898 Ga0207692_10043097 Ga0207692_100430971 316
632 3300025899 Ga0207642_10000959 Ga0207642_100009594 316
633 3300025901 Ga0207688_10000060 Ga0207688_100000605 316
634 3300025903 Ga0207680_10001548 Ga0207680_100015485 316
635 3300025903 Ga0207680_10296261 Ga0207680_102962611 316
636 3300025904 Ga0207647_10000172 Ga0207647_1000017227 316
637 3300025904 Ga0207647_10001510 Ga0207647_100015103 316
638 3300025906 Ga0207699_10072924 Ga0207699_100729242 316
639 3300025907 Ga0207645_10001895 Ga0207645_100018956 316
640 3300025908 Ga0207643_10000244 Ga0207643_100002445 316
641 3300025912 Ga0207707_10003182 Ga0207707_1000318212 316
642 3300025912 Ga0207707_10146362 Ga0207707_101463623 316
643 3300025913 Ga0207695_10037556 Ga0207695_100375564 316
644 3300025914 Ga0207671_10003102 Ga0207671_1000310215 316
645 3300025914 Ga0207671_10044311 Ga0207671_100443113 316
646 3300025914 Ga0207671_10197972 Ga0207671_101979722 316
647 3300025915 Ga0207693_10002491 Ga0207693_100024919 316
648 3300025917 Ga0207660_10000179 Ga0207660_1000017935 316
649 3300025917 Ga0207660_10013904 Ga0207660_100139042 316
650 3300025918 Ga0207662_10000025 Ga0207662_1000002519 316
651 3300025919 Ga0207657_10001867 Ga0207657_1000186719 316
652 3300025920 Ga0207649_10002794 Ga0207649_100027942 316
653 3300025920 Ga0207649_10201578 Ga0207649_102015782 316
654 3300025921 Ga0207652_10032575 Ga0207652_100325752 316
655 3300025921 Ga0207652_10107867 Ga0207652_101078672 316
656 3300025923 Ga0207681_10000419 Ga0207681_1000041924 316
657 3300025925 Ga0207650_10015411 Ga0207650_100154113 316
658 3300025925 Ga0207650_10033937 Ga0207650_100339373 316
659 3300025926 Ga0207659_10000283 Ga0207659_100002836 316
660 3300025926 Ga0207659_10148369 Ga0207659_101483691 316
661 3300025927 Ga0207687_10004337 Ga0207687_100043376 316
662 3300025928 Ga0207700_10092585 Ga0207700_100925852 316
663 3300025929 Ga0207664_10123088 Ga0207664_101230882 316
664 3300025931 Ga0207644_10004405 Ga0207644_100044056 316
665 3300025931 Ga0207644_10130507 Ga0207644_101305072 316
666 3300025932 Ga0207690_10000808 Ga0207690_1000080815 316
667 3300025932 Ga0207690_10155973 Ga0207690_101559732 316
668 3300025932 Ga0207690_10361985 Ga0207690_103619851 316
669 3300025933 Ga0207706_10000734 Ga0207706_100007345 316
670 3300025933 Ga0207706_10030769 Ga0207706_100307693 316
671 3300025933 Ga0207706_10075490 Ga0207706_100754903 316
672 3300025934 Ga0207686_10000879 Ga0207686_1000087911 316
673 3300025934 Ga0207686_10012514 Ga0207686_100125143 316
674 3300025935 Ga0207709_10005908 Ga0207709_100059086 316
675 3300025935 Ga0207709_10021837 Ga0207709_100218373 316
676 3300025936 Ga0207670_10001927 Ga0207670_100019273 316
677 3300025937 Ga0207669_10000204 Ga0207669_100002046 316
678 3300025938 Ga0207704_10002129 Ga0207704_100021296 316
679 3300025938 Ga0207704_10012427 Ga0207704_100124273 316
680 3300025938 Ga0207704_10147842 Ga0207704_101478421 316
681 3300025939 Ga0207665_10001684 Ga0207665_1000168410 316
682 3300025940 Ga0207691_10000309 Ga0207691_1000030929 316
683 3300025941 Ga0207711_10009863 Ga0207711_100098634 316
684 3300025941 Ga0207711_10013666 Ga0207711_100136665 316
685 3300025941 Ga0207711_10034929 Ga0207711_100349291 316
686 3300025941 Ga0207711_10066720 Ga0207711_100667203 316
687 3300025942 Ga0207689_10000893 Ga0207689_100008935 316
688 3300025942 Ga0207689_10039885 Ga0207689_100398853 316
689 3300025942 Ga0207689_10050215 Ga0207689_100502154 316
690 3300025944 Ga0207661_10003381 Ga0207661_100033813 316
691 3300025945 Ga0207679_10000128 Ga0207679_1000012826 316
692 3300025945 Ga0207679_10098406 Ga0207679_100984062 316
693 3300025945 Ga0207679_10352196 Ga0207679_103521961 316
694 3300025949 Ga0207667_10015642 Ga0207667_100156425 316
695 3300025960 Ga0207651_10003175 Ga0207651_100031752 316
696 3300025960 Ga0207651_10042390 Ga0207651_100423903 316
697 3300025961 Ga0207712_10003264 Ga0207712_100032644 316
698 3300025961 Ga0207712_10156181 Ga0207712_101561812 316
699 3300025972 Ga0207668_10002555 Ga0207668_100025555 316
700 3300025972 Ga0207668_10359020 Ga0207668_103590201 316
701 3300025981 Ga0207640_10005063 Ga0207640_100050635 316
702 3300025986 Ga0207658_10005664 Ga0207658_100056644 316
703 3300025986 Ga0207658_10027783 Ga0207658_100277832 316
704 3300026023 Ga0207677_10008643 Ga0207677_100086434 316
705 3300026035 Ga0207703_10007507 Ga0207703_100075073 316
706 3300026035 Ga0207703_10063935 Ga0207703_100639353 316
707 3300026035 Ga0207703_10390262 Ga0207703_103902621 316
708 3300026041 Ga0207639_10007584 Ga0207639_100075843 316
709 3300026067 Ga0207678_10000759 Ga0207678_100007595 316
710 3300026067 Ga0207678_10020189 Ga0207678_100201893 316
711 3300026067 Ga0207678_10026240 Ga0207678_100262403 316
712 3300026067 Ga0207678_10094566 Ga0207678_100945662 316
713 3300026075 Ga0207708_10000391 Ga0207708_100003915 316
714 3300026075 Ga0207708_10098573 Ga0207708_100985733 316
715 3300026078 Ga0207702_10008180 Ga0207702_100081803 316
716 3300026078 Ga0207702_10547262 Ga0207702_105472621 316
717 3300026088 Ga0207641_10006199 Ga0207641_100061996 316
718 3300026089 Ga0207648_10000862 Ga0207648_100008625 316
719 3300026095 Ga0207676_10003505 Ga0207676_100035053 316
720 3300026116 Ga0207674_10000806 Ga0207674_1000080635 316
721 3300026118 Ga0207675_100000637 Ga0207675_10000063729 316
722 3300026121 Ga0207683_10000330 Ga0207683_1000033025 316
723 3300026121 Ga0207683_10006268 Ga0207683_100062685 316
724 3300026121 Ga0207683_10030655 Ga0207683_100306552 316
725 3300026142 Ga0207698_10002562 Ga0207698_100025625 316
726 3300027617 Ga0210002_1001079 Ga0210002_10010792 316
727 3300027665 Ga0209983_1006352 Ga0209983_10063522 316
728 3300027682 Ga0209971_1008242 Ga0209971_10082422 316
729 3300027695 Ga0209966_1001959 Ga0209966_10019593 316
730 3300027717 Ga0209998_10001428 Ga0209998_100014283 316
731 3300027717 Ga0209998_10002841 Ga0209998_100028413 316
732 3300027876 Ga0209974_10000230 Ga0209974_1000023017 316
733 3300027907 Ga0207428_10000164 Ga0207428_1000016491 316
734 3300027907 Ga0207428_10000815 Ga0207428_1000081518 316
735 3300027907 Ga0207428_10001706 Ga0207428_1000170619 316
736 3300028379 Ga0268266_10070826 Ga0268266_100708263 316
737 3300028380 Ga0268265_10002566 Ga0268265_100025669 316
738 3300028380 Ga0268265_10038962 Ga0268265_100389621 316
739 3300028381 Ga0268264_10006412 Ga0268264_100064123 316
740 3300028381 Ga0268264_10370132 Ga0268264_103701322 316
741 3300031241 Ga0265325_10004813 Ga0265325_100048134 316
742 3300034816 Ga0373930_0000057 Ga0373930_0000057_9063_10034 316
743 3300034817 Ga0373948_0001657 Ga0373948_0001657_2161_3132 316
744 3300034817 Ga0373948_0009265 Ga0373948_0009265_24_995 316
745 3300034818 Ga0373950_0004566 Ga0373950_0004566_91_1062 316
746 3300034818 Ga0373950_0004808 Ga0373950_0004808_677_1648 316
747 3300034819 Ga0373958_0006518 Ga0373958_0006518_719_1690 316
748 3300034820 Ga0373959_0002313 Ga0373959_0002313_1146_2117 316
749 3300034820 Ga0373959_0006569 Ga0373959_0006569_466_1437 316
750 3300034957 Ga0373938_0003139 Ga0373938_0003139_1439_2410 316
751 3300035084 Ga0373928_0002217 Ga0373928_0002217_577_1548 316
752 3300035084 Ga0373928_0009085 Ga0373928_0009085_704_1675 316
753 3300035085 Ga0373929_0003213 Ga0373929_0003213_1562_2533 316
754 3300035086 Ga0373934_0098298 Ga0373934_0098298_50_1021 316
755 3300035089 Ga0373944_0002521 Ga0373944_0002521_619_1590 316
756 3300035090 Ga0373949_0004678 Ga0373949_0004678_1717_2688 316
757 3300035090 Ga0373949_0005109 Ga0373949_0005109_1464_2435 316
758 3300035091 Ga0373951_0000341 Ga0373951_0000341_10847_11818 316
759 3300035092 Ga0373952_0001033 Ga0373952_0001033_1926_2897 316
760 3300035092 Ga0373952_0001903 Ga0373952_0001903_780_1751 316
761 3300035111 Ga0373923_0034403 Ga0373923_0034403_92_1063 316
762 3300035112 Ga0373932_0003901 Ga0373932_0003901_1850_2821 316
763 3300035113 Ga0373936_0020827 Ga0373936_0020827_947_2032 316
764 3300035113 Ga0373936_0029771 Ga0373936_0029771_131_1102 316
765 3300035114 Ga0373939_0001163 Ga0373939_0001163_4495_5466 316
766 3300035114 Ga0373939_0001797 Ga0373939_0001797_3488_4459 316
767 3300035114 Ga0373939_0007281 Ga0373939_0007281_1051_2022 316
768 3300035115 Ga0373941_0000752 Ga0373941_0000752_5541_6512 316
769 3300035115 Ga0373941_0001091 Ga0373941_0001091_3470_4441 316
770 3300035117 Ga0373953_0042816 Ga0373953_0042816_496_1581 316
771 3300035118 Ga0373954_0022731 Ga0373954_0022731_1676_2761 316
772 3300035119 Ga0373956_0015149 Ga0373956_0015149_1850_2935 316
773 3300035119 Ga0373956_0020919 Ga0373956_0020919_373_1344 316
774 3300035120 Ga0373957_0012274 Ga0373957_0012274_975_2060 316
775 3300035121 Ga0373960_0000509 Ga0373960_0000509_1050_2021 316
776 3300035170 Ga0373943_0006224 Ga0373943_0006224_3808_4779 316
777 3300035171 Ga0373946_0018601 Ga0373946_0018601_730_1701 316
778 3300035172 Ga0373955_0000998 Ga0373955_0000998_292_1263 316
779 3300035172 Ga0373955_0001557 Ga0373955_0001557_1986_3071 316
780 3300035207 Ga0373942_0002104 Ga0373942_0002104_2525_3496 316
781 3300035207 Ga0373942_0020612 Ga0373942_0020612_340_1311 316
782 3300035241 Ga0373961_0001381 Ga0373961_0001381_134_1105 316
783 3300035241 Ga0373961_0038624 Ga0373961_0038624_295_1266 316
784 3300035242 Ga0373962_0000553 Ga0373962_0000553_2394_3365 316
785 3300035242 Ga0373962_0004172 Ga0373962_0004172_551_1522 316
786 3300035242 Ga0373962_0019285 Ga0373962_0019285_353_1324 316
787 3300035410 Ga0373924_0001412 Ga0373924_0001412_4262_5233 316
788 3300035410 Ga0373924_0009677 Ga0373924_0009677_986_1957 316
789 3300035691 Ga0373931_0002430 Ga0373931_0002430_5135_6106 316
790 3300035691 Ga0373931_0089167 Ga0373931_0089167_340_1311 316
791 3300035691 Ga0373931_0101336 Ga0373931_0101336_223_1299 316
792 3300035692 Ga0373935_0016753 Ga0373935_0016753_2400_3371 316
793 3300035692 Ga0373935_0046383 Ga0373935_0046383_1357_2328 316
794 3300035695 Ga0373927_0139121 Ga0373927_0139121_165_1136 316
795 3300035724 Ga0373933_0019278 Ga0373933_0019278_550_1635 316
796 3300035725 Ga0373947_0001287 Ga0373947_0001287_5456_6427 316
797 3300035725 Ga0373947_0117761 Ga0373947_0117761_268_1239 316
798 3300036401 Ga0373937_0001774 Ga0373937_0001774_10420_11391 316
799 3300036401 Ga0373937_0177517 Ga0373937_0177517_923_1894 316
800 3300036647 Ga0316582_0144556 Ga0316582_0144556_10_1143 316
801 3300037068 Ga0373925_0057368 Ga0373925_0057368_562_1533 316
802 3300037068 Ga0373925_0071936 Ga0373925_0071936_1112_2083 316
803 3300042016 Ga0439463_008198 Ga0439463_008198_292_1263 316
804 3300042876 Ga0451577_0067584 Ga0451577_0067584_254_1225 316
805 3300045051 Ga0451576_0281917 Ga0451576_0281917_215_1186 316
806 3300046454 Ga0495592_0017778 Ga0495592_0017778_2017_2988 316
807 3300046454 Ga0495592_0023319 Ga0495592_0023319_2980_3951 316
808 3300046454 Ga0495592_0029219 Ga0495592_0029219_2667_3752 316
809 3300046455 Ga0495603_0010286 Ga0495603_0010286_775_1746 316
810 3300046459 Ga0495629_0134926 Ga0495629_0134926_521_1492 316
811 3300046459 Ga0495629_0271185 Ga0495629_0271185_164_1135 316
812 3300046460 Ga0495638_0059425 Ga0495638_0059425_832_1803 316
813 3300046462 Ga0495651_0008162 Ga0495651_0008162_1003_1974 316
814 3300046462 Ga0495651_0009584 Ga0495651_0009584_1519_2490 316
815 3300046462 Ga0495651_0027137 Ga0495651_0027137_1186_2271 316
816 3300046463 Ga0495653_0019240 Ga0495653_0019240_1113_2084 316
817 3300046463 Ga0495653_0032847 Ga0495653_0032847_492_1577 316
818 3300046472 Ga0495580_0017021 Ga0495580_0017021_2076_3047 316
819 3300046473 Ga0495582_0010775 Ga0495582_0010775_1993_2964 316
820 3300046475 Ga0495639_0065883 Ga0495639_0065883_310_1281 316
821 3300046475 Ga0495639_0134523 Ga0495639_0134523_169_1140 316
822 3300046476 Ga0495662_0032617 Ga0495662_0032617_134_1105 316
823 3300046477 Ga0495664_0001573 Ga0495664_0001573_10215_11300 316
824 3300046477 Ga0495664_0013502 Ga0495664_0013502_1866_2837 316
825 3300046477 Ga0495664_0020642 Ga0495664_0020642_703_1674 316
826 3300046491 Ga0495584_0109421 Ga0495584_0109421_86_1057 316
827 3300046492 Ga0495585_0023565 Ga0495585_0023565_1785_2756 316
828 3300046499 Ga0495594_0032856 Ga0495594_0032856_1692_2663 316
829 3300046499 Ga0495594_0067084 Ga0495594_0067084_640_1611 316
830 3300046501 Ga0495607_0008175 Ga0495607_0008175_1722_2693 316
831 3300046511 Ga0495608_0010527 Ga0495608_0010527_2765_3850 316
832 3300046511 Ga0495608_0013659 Ga0495608_0013659_2433_3404 316
833 3300046511 Ga0495608_0073807 Ga0495608_0073807_510_1481 316
834 3300046514 Ga0495618_0004210 Ga0495618_0004210_1984_3069 316
835 3300046514 Ga0495618_0065107 Ga0495618_0065107_106_1077 316
836 3300046516 Ga0495628_0003455 Ga0495628_0003455_6800_7771 316
837 3300046516 Ga0495628_0036997 Ga0495628_0036997_2348_3319 316
838 3300046516 Ga0495628_0048386 Ga0495628_0048386_2088_3173 316
839 3300046517 Ga0495630_0061516 Ga0495630_0061516_230_1201 316
840 3300046517 Ga0495630_0222646 Ga0495630_0222646_97_1068 316
841 3300046523 Ga0495644_0001086 Ga0495644_0001086_9663_10634 316
842 3300046526 Ga0495666_0083998 Ga0495666_0083998_29_1000 316
843 3300046529 Ga0495652_0013724 Ga0495652_0013724_2666_3637 316
844 3300046529 Ga0495652_0022189 Ga0495652_0022189_198_1283 316
845 3300046529 Ga0495652_0040814 Ga0495652_0040814_1883_2854 316
846 3300046529 Ga0495652_0225300 Ga0495652_0225300_251_1222 316
847 3300046531 Ga0495665_0073438 Ga0495665_0073438_172_1143 316
848 3300046533 Ga0495640_0025674 Ga0495640_0025674_2584_3669 316
849 3300046533 Ga0495640_0203025 Ga0495640_0203025_58_1029 316
850 3300046535 Ga0495586_0013594 Ga0495586_0013594_2176_3261 316
851 3300046536 Ga0495587_0004856 Ga0495587_0004856_7541_8626 316
852 3300046536 Ga0495587_0028036 Ga0495587_0028036_272_1243 316
853 3300046543 Ga0495645_0001639 Ga0495645_0001639_13544_14629 316
854 3300046543 Ga0495645_0005664 Ga0495645_0005664_1482_2453 316
855 3300046543 Ga0495645_0074217 Ga0495645_0074217_353_1324 316
856 3300046557 Ga0495622_0010042 Ga0495622_0010042_2305_3276 316
857 3300046557 Ga0495622_0130847 Ga0495622_0130847_57_1028 316
858 3300046558 Ga0495633_0011736 Ga0495633_0011736_3684_4655 316
859 3300046559 Ga0495667_0005288 Ga0495667_0005288_5038_6123 316
860 3300046559 Ga0495667_0031399 Ga0495667_0031399_182_1153 316
861 3300046559 Ga0495667_0040965 Ga0495667_0040965_1715_2686 316
862 3300046615 Ga0495656_0001089 Ga0495656_0001089_1747_2718 316
863 3300046642 Ga0495634_0016364 Ga0495634_0016364_3132_4217 316
864 3300046663 Ga0495635_0000337 Ga0495635_0000337_3806_4891 316
865 3300046663 Ga0495635_0007593 Ga0495635_0007593_4212_5183 316
866 3300046663 Ga0495635_0035522 Ga0495635_0035522_34_1005 316
867 3300046663 Ga0495635_0036181 Ga0495635_0036181_2011_2982 316
868 3300046664 Ga0495659_0001476 Ga0495659_0001476_6127_7098 316
869 3300046665 Ga0495661_0007028 Ga0495661_0007028_6593_7564 316
870 3300046674 Ga0495588_0013858 Ga0495588_0013858_837_1808 316
871 3300046675 Ga0495657_0001580 Ga0495657_0001580_14067_15038 316
872 3300046675 Ga0495657_0030152 Ga0495657_0030152_1236_2207 316
873 3300046675 Ga0495657_0207652 Ga0495657_0207652_110_1081 316
874 3300046678 Ga0495599_0018494 Ga0495599_0018494_3266_4237 316
875 3300046678 Ga0495599_0019711 Ga0495599_0019711_2962_3933 316
876 3300046679 Ga0495623_0000723 Ga0495623_0000723_3592_4677 316
877 3300046679 Ga0495623_0078996 Ga0495623_0078996_876_1847 316
878 3300046680 Ga0495646_0002017 Ga0495646_0002017_2604_3689 316
879 3300046680 Ga0495646_0028777 Ga0495646_0028777_584_1555 316
880 3300046681 Ga0495647_0016555 Ga0495647_0016555_1121_2092 316
881 3300046683 Ga0495658_0000221 Ga0495658_0000221_3624_4595 316
882 3300046683 Ga0495658_0038807 Ga0495658_0038807_1163_2134 316
883 3300046689 Ga0495613_0112336 Ga0495613_0112336_11_982 316
884 3300046690 Ga0495624_0041634 Ga0495624_0041634_442_1413 316
885 3300046690 Ga0495624_0066693 Ga0495624_0066693_971_2056 316
886 3300046691 Ga0495670_0001346 Ga0495670_0001346_5145_6116 316
887 3300046809 Ga0495600_0000619 Ga0495600_0000619_6559_7530 316
888 3300046809 Ga0495600_0000936 Ga0495600_0000936_786_1871 316
889 3300046809 Ga0495600_0004078 Ga0495600_0004078_5482_6453 316
890 3300046810 Ga0495660_0105716 Ga0495660_0105716_347_1318 316
891 3300047315 Ga0495581_0014587 Ga0495581_0014587_1407_2378 316
892 3300047315 Ga0495581_0028658 Ga0495581_0028658_1967_2938 316
893 3300047317 Ga0495604_0008572 Ga0495604_0008572_1346_2317 316
894 3300047317 Ga0495604_0009858 Ga0495604_0009858_1957_3042 316
895 3300047317 Ga0495604_0023992 Ga0495604_0023992_3240_4211 316
896 3300047317 Ga0495604_0037657 Ga0495604_0037657_1682_2653 316
897 3300047317 Ga0495604_0110796 Ga0495604_0110796_296_1267 316
898 3300047319 Ga0495674_0001395 Ga0495674_0001395_1761_2846 316
899 3300047319 Ga0495674_0010509 Ga0495674_0010509_6157_7128 316
900 3300047319 Ga0495674_0303528 Ga0495674_0303528_227_1198 316
901 3300047322 Ga0495680_0002033 Ga0495680_0002033_17484_18569 316
902 3300047322 Ga0495680_0007002 Ga0495680_0007002_7055_8026 316
903 3300047322 Ga0495680_0019881 Ga0495680_0019881_3528_4499 316
904 3300047322 Ga0495680_0024415 Ga0495680_0024415_2519_3490 316
905 3300047322 Ga0495680_0026609 Ga0495680_0026609_1476_2447 316
906 3300047444 Ga0495675_0000716 Ga0495675_0000716_4029_5114 316
907 3300047471 Ga0495684_0008600 Ga0495684_0008600_5691_6662 316
908 3300047471 Ga0495684_0095331 Ga0495684_0095331_447_1532 316
909 3300047673 Ga0495593_0020521 Ga0495593_0020521_452_1423 316
910 3300047673 Ga0495593_0023727 Ga0495593_0023727_1000_1971 316
911 3300047673 Ga0495593_0036543 Ga0495593_0036543_628_1599 316
912 3300048088 Ga0495602_0010114 Ga0495602_0010114_3249_4220 316
913 3300048088 Ga0495602_0025010 Ga0495602_0025010_4101_5186 316
914 3300048089 Ga0495614_0049400 Ga0495614_0049400_354_1325 316
915 3300048089 Ga0495614_0115959 Ga0495614_0115959_189_1160 316
916 3300048903 Ga0496100_0001614 Ga0496100_0001614_4378_5349 316
917 3300048903 Ga0496100_0002013 Ga0496100_0002013_1911_2987 316
918 3300048904 Ga0496101_0002338 Ga0496101_0002338_4767_5738 316
919 3300048904 Ga0496101_0121203 Ga0496101_0121203_924_1946 316
920 3300048905 Ga0496102_0009896 Ga0496102_0009896_6303_7274 316
921 3300048905 Ga0496102_0076321 Ga0496102_0076321_1692_2768 316
922 3300048906 Ga0496103_0001271 Ga0496103_0001271_9393_10364 316
923 3300048906 Ga0496103_0159084 Ga0496103_0159084_78_1049 316
924 3300048907 Ga0496104_0013151 Ga0496104_0013151_2539_3510 316
925 3300048907 Ga0496104_0240792 Ga0496104_0240792_342_1418 316
926 3300048907 Ga0496104_0398623 Ga0496104_0398623_238_1209 316
927 3300048908 Ga0496105_0001594 Ga0496105_0001594_8318_9289 316
928 3300048908 Ga0496105_0089643 Ga0496105_0089643_1295_2371 316
929 3300048909 Ga0496106_0004028 Ga0496106_0004028_5753_6724 316
930 3300048909 Ga0496106_0045330 Ga0496106_0045330_2273_3244 316
931 3300048909 Ga0496106_0140721 Ga0496106_0140721_503_1474 316
932 3300048909 Ga0496106_0363003 Ga0496106_0363003_117_1088 316
933 3300048910 Ga0496107_0006617 Ga0496107_0006617_2479_3450 316
934 3300048910 Ga0496107_0062685 Ga0496107_0062685_1622_2593 316
935 3300048910 Ga0496107_0150293 Ga0496107_0150293_138_1109 316
936 3300048911 Ga0496108_0000693 Ga0496108_0000693_4436_5407 316
937 3300048911 Ga0496108_0005626 Ga0496108_0005626_6789_7760 316
938 3300048912 Ga0496109_0006483 Ga0496109_0006483_5347_6318 316
939 3300048912 Ga0496109_0007782 Ga0496109_0007782_2479_3450 316
940 3300048912 Ga0496109_0061612 Ga0496109_0061612_849_1925 316
941 3300048912 Ga0496109_0172714 Ga0496109_0172714_387_1358 316
942 3300048913 Ga0496110_0051870 Ga0496110_0051870_738_1709 316
943 3300048913 Ga0496110_0090904 Ga0496110_0090904_1663_2634 316
944 3300048913 Ga0496110_0141793 Ga0496110_0141793_315_1400 316
945 3300048914 Ga0496111_0004679 Ga0496111_0004679_7397_8368 316
946 3300048914 Ga0496111_0142288 Ga0496111_0142288_310_1386 316
947 3300048915 Ga0496112_0001842 Ga0496112_0001842_12250_13221 316
948 3300048915 Ga0496112_0099336 Ga0496112_0099336_1863_2834 316
949 3300048916 Ga0496113_0009047 Ga0496113_0009047_1773_2744 316
950 3300048916 Ga0496113_0071201 Ga0496113_0071201_900_1976 316
951 3300048916 Ga0496113_0198002 Ga0496113_0198002_499_1470 316
952 3300048917 Ga0496114_0047239 Ga0496114_0047239_1128_2099 316
953 3300048917 Ga0496114_0053250 Ga0496114_0053250_943_1971 316
954 3300048917 Ga0496114_0415992 Ga0496114_0415992_207_1178 316
955 3300048918 Ga0496115_0042697 Ga0496115_0042697_1047_2018 316
956 3300048918 Ga0496115_0052320 Ga0496115_0052320_312_1283 316
957 3300048918 Ga0496115_0151627 Ga0496115_0151627_783_1868 316
958 3300049573 Ga0501037_0049652 Ga0501037_0049652_1949_2920 316
959 3300049574 Ga0501038_0055563 Ga0501038_0055563_1695_2666 316
960 3300049574 Ga0501038_0086495 Ga0501038_0086495_153_1124 316
961 3300049574 Ga0501038_0215001 Ga0501038_0215001_454_1428 316
962 3300049578 Ga0501042_0225216 Ga0501042_0225216_223_1194 316
963 3300049581 Ga0501047_0094930 Ga0501047_0094930_244_1215 316
964 3300049582 Ga0501048_0287479 Ga0501048_0287479_85_1056 316
965 3300049584 Ga0501068_0117101 Ga0501068_0117101_505_1476 316
966 3300049585 Ga0501069_0212107 Ga0501069_0212107_66_1037 316
967 3300049586 Ga0501070_0048612 Ga0501070_0048612_124_1095 316
968 3300049586 Ga0501070_0055929 Ga0501070_0055929_1948_2919 316
969 3300049587 Ga0501071_0011718 Ga0501071_0011718_4083_5054 316
970 3300049589 Ga0501073_0138779 Ga0501073_0138779_152_1123 316
971 3300049744 Ga0501083_0262086 Ga0501083_0262086_114_1085 316
972 3300049822 Ga0501035_0081308 Ga0501035_0081308_863_1834 316
973 3300049822 Ga0501035_0143535 Ga0501035_0143535_542_1513 316
974 3300049823 Ga0501044_0352224 Ga0501044_0352224_305_1276 316
975 3300050494 nmdc:mga06z11_8879_c1 nmdc:mga06z11_8879_c1_40_1011 316
976 3300050496 nmdc:mga07m45_25315_c1 nmdc:mga07m45_25315_c1_299_1270 316
977 3300050507 nmdc:mga05p37_1375_c1 nmdc:mga05p37_1375_c1_11348_12319 316
978 3300050508 nmdc:mga09592_4676_c1 nmdc:mga09592_4676_c1_2166_3137 316
979 3300050509 nmdc:mga0qj67_959_c1 nmdc:mga0qj67_959_c1_15509_16480 316
980 3300050510 nmdc:mga06r32_592_c1 nmdc:mga06r32_592_c1_20642_21613 316
981 3300050511 nmdc:mga08y16_108_c1 nmdc:mga08y16_108_c1_5739_6710 316
982 3300050511 nmdc:mga08y16_19155_c1 nmdc:mga08y16_19155_c1_140_1111 316
983 3300050511 nmdc:mga08y16_4119_c1 nmdc:mga08y16_4119_c1_8460_9431 316
984 3300050511 nmdc:mga08y16_447745_c1 nmdc:mga08y16_447745_c1_189_1160 316
985 3300050512 nmdc:mga0n895_104_c1 nmdc:mga0n895_104_c1_46251_47222 316
986 3300050512 nmdc:mga0n895_148662_c1 nmdc:mga0n895_148662_c1_698_1669 316
987 3300050512 nmdc:mga0n895_337_c1 nmdc:mga0n895_337_c1_3531_4502 316
988 3300050513 nmdc:mga0rr50_1110_c1 nmdc:mga0rr50_1110_c1_10055_11026 316
989 3300050513 nmdc:mga0rr50_17098_c1 nmdc:mga0rr50_17098_c1_2212_3183 316
990 3300050514 nmdc:mga08x19_95882_c1 nmdc:mga08x19_95882_c1_770_1741 316
991 3300050515 nmdc:mga0a205_2128_c1 nmdc:mga0a205_2128_c1_12917_13888 316
992 3300050515 nmdc:mga0a205_2355_c2 nmdc:mga0a205_2355_c2_330_1301 316
993 3300053077 Ga0495601_0000280 Ga0495601_0000280_16257_17228 316
994 3300053077 Ga0495601_0001337 Ga0495601_0001337_8612_9583 316
995 3300053077 Ga0495601_0015893 Ga0495601_0015893_931_2016 316
996 3300053077 Ga0495601_0074515 Ga0495601_0074515_837_1808 316
997 3300053078 Ga0495612_0000501 Ga0495612_0000501_6806_7777 316
998 3300053078 Ga0495612_0010034 Ga0495612_0010034_1055_2026 316
999 3300053078 Ga0495612_0010083 Ga0495612_0010083_2539_3624 316
1000 3300053078 Ga0495612_0012382 Ga0495612_0012382_1307_2278 316
1001 3300053078 Ga0495612_0030723 Ga0495612_0030723_1047_2018 316
1002 3300053084 Ga0495595_0000612 Ga0495595_0000612_8007_8978 316
1003 3300053084 Ga0495595_0002010 Ga0495595_0002010_51_1022 316
1004 3300053084 Ga0495595_0003562 Ga0495595_0003562_1832_2917 316
1005 3300053084 Ga0495595_0009498 Ga0495595_0009498_972_1943 316
1006 3300053085 Ga0495619_0000048 Ga0495619_0000048_6628_7599 316
1007 3300053085 Ga0495619_0000314 Ga0495619_0000314_17766_18737 316
1008 3300053085 Ga0495619_0000459 Ga0495619_0000459_16339_17310 316
1009 3300053085 Ga0495619_0002080 Ga0495619_0002080_10034_11005 316
1010 3300053085 Ga0495619_0002348 Ga0495619_0002348_8301_9386 316
1011 3300053085 Ga0495619_0028684 Ga0495619_0028684_227_1198 316
1012 3300053085 Ga0495619_0127919 Ga0495619_0127919_292_1263 316
1013 3300053087 Ga0500643_005961 Ga0500643_005961_3076_4047 316
1014 3300053093 Ga0500651_0074070 Ga0500651_0074070_251_1222 316
1015 3300053094 Ga0500566_0058957 Ga0500566_0058957_727_1698 316
1016 3300053119 Ga0500595_000003 Ga0500595_000003_186283_187254 316
1017 3300053153 Ga0500616_0000002 Ga0500616_0000002_1374673_1375644 316
1018 3300053730 Ga0500645_000217 Ga0500645_000217_27276_28247 316
1019 3300060353 Ga0501082_0120968 Ga0501082_0120968_506_1477 316
1020 3300060353 Ga0501082_0226016 Ga0501082_0226016_82_1053 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

136

298

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9459 65 309
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.9449 66 308
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.8785 66 308
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.8768 65 309
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.8094 104 253
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9564 65 308 3.90.420.10
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8827 65 308 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8083 109 253 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.7399 100 247 3.90.420.10
af_A0A0R4IKF7_192_441_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.7285 104 272 3.90.420.10
ID Description Score Start End GO Terms
AF-D9PGU8-F1-model_v4 Oxidoreductase molybdopterin binding (EC 1.8.2.1) 0.9756 70 172 GO:0050310
AF-A0A258K6M1-F1-model_v4 Mononuclear molybdenum enzyme YedY 0.9696 98 316
AF-A0A162C394-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9673 91 222
AF-A0A388NT57-F1-model_v4 Protein-methionine-sulfoxide reductase catalytic subunit MsrP 0.9648 114 308
AF-A0A7Y3TXV4-F1-model_v4 Protein-methionine-sulfoxide reductase catalytic subunit MsrP (EC 1.8.5.-) 0.9633 76 308 GO:0016491

Feature Viewer

pLDDT pTM Quality
82.17 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map