F488371

General Info

Members Datasets Scaffolds Average Seq Length
1020 338 2040 372

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0000838|Ga0395900_0000838_30449_31699
Length 416
Sequence LALRTLQLSLSLTQFPVVLAELFRRRAGSSPRCQDRLVQRPGWAPDALSLFVELAALPSPSGEERAVADRVLDYLRALGLEVDEDDTGARIGSTMGNLLCRLEPRGNGDGAPLFFCAHLDTVPPEGPIEPVVGEDGIVRNGAGTILGADDKSAVAAMLEAAARLVEDGRPHAGVELLFTPKEEVGLVGAAAFDENRLAARLGYVYDHAGPVGEVIVGAPYQQKLDVHFRGRAAHAGMYPEEGRSAIAAAARAIADLRLGRLDEETSANVGRIEGGTARNVIPEHCRLAAEARSHDERKLADLVQEMLDTVTFAASLAECEVETQVAPASRGYRFRRDAEAVELAASALARVGREPSFVLSGGGADANVFNERGLQCVNLANGMTDIHTPDERIAVDDLEAMVDVTLALVDEAARRA

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
184 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
206 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
207 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
208 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
209 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
210 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
211 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
242 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
248 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
249 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
282 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
283 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
284 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
285 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
288 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
289 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
290 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
291 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
292 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
317 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
328 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
329 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
330 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 11.37
Rhizosphere 87.75
Stem 0
Stem Tuber 0
Unclassified 5.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0000838 3300037418 Bacteria 40475
2 JGI24740J21852_10001919 3300001979 Bacteria 9526
3 Ga0070658_10001917 3300005327 Bacteria 17524
4 Ga0070658_10009008 3300005327 Bacteria 8024
5 Ga0070658_10010832 3300005327 Bacteria 7310
6 Ga0070683_100122099 3300005329 Bacteria 2461
7 Ga0070683_100166019 3300005329 Bacteria 2095
8 Ga0070690_100021377 3300005330 Bacteria 3950
9 Ga0068869_100102301 3300005334 Bacteria 2168
10 Ga0070680_100079285 3300005336 Bacteria 2706
11 Ga0070680_100115905 3300005336 Bacteria 2233
12 Ga0070680_100212999 3300005336 Bacteria 1630
13 Ga0070682_100013796 3300005337 Bacteria 4659
14 Ga0070682_100015285 3300005337 Bacteria 4445
15 Ga0070682_100024483 3300005337 Bacteria 3593
16 Ga0070682_100029174 3300005337 Bacteria 3320
17 Ga0070682_100036730 3300005337 Bacteria 2996
18 Ga0068868_100034278 3300005338 Bacteria 3918
19 Ga0068868_100238440 3300005338 Bacteria 1527
20 Ga0070660_100005923 3300005339 Bacteria 8454
21 Ga0070660_100060376 3300005339 Bacteria 2943
22 Ga0070660_100177538 3300005339 Bacteria 1722
23 Ga0070689_100045899 3300005340 Bacteria 3366
24 Ga0070691_10015848 3300005341 Bacteria 3465
25 Ga0070691_10051621 3300005341 Bacteria 1964
26 Ga0070661_100005675 3300005344 Bacteria 8596
27 Ga0070668_100054366 3300005347 Bacteria 3088
28 Ga0070668_100088205 3300005347 Bacteria 2442
29 Ga0070669_100258523 3300005353 Bacteria 1389
30 Ga0070688_100015520 3300005365 Bacteria 4337
31 Ga0070659_100050496 3300005366 Bacteria 3269
32 Ga0070659_100071877 3300005366 Bacteria 2752
33 Ga0070659_100165228 3300005366 Unclassified 1811
34 Ga0070667_100009302 3300005367 Bacteria 8145
35 Ga0070667_100178778 3300005367 Bacteria 1876
36 Ga0070709_10095217 3300005434 Bacteria 1972
37 Ga0070714_100029254 3300005435 Bacteria 4580
38 Ga0070714_100030412 3300005435 Bacteria 4494
39 Ga0070714_100058112 3300005435 Bacteria 3313
40 Ga0070714_100067633 3300005435 Bacteria 3081
41 Ga0070714_100099389 3300005435 Bacteria 2561
42 Ga0070714_100244341 3300005435 Bacteria 1658
43 Ga0070713_100043207 3300005436 Bacteria 3683
44 Ga0070713_100058191 3300005436 Bacteria 3223
45 Ga0070713_100089869 3300005436 Bacteria 2639
46 Ga0070713_100224591 3300005436 Unclassified 1705
47 Ga0070710_10012734 3300005437 Bacteria 4186
48 Ga0070701_10001955 3300005438 Bacteria 7806
49 Ga0070711_100005352 3300005439 Bacteria 7672
50 Ga0070711_100041981 3300005439 Bacteria 3090
51 Ga0070711_100051343 3300005439 Bacteria 2831
52 Ga0070705_100016734 3300005440 Bacteria 3815
53 Ga0070705_100052306 3300005440 Bacteria 2385
54 Ga0070705_100081776 3300005440 Bacteria 1985
55 Ga0070705_100083922 3300005440 Bacteria 1964
56 Ga0070705_100161429 3300005440 Bacteria 1499
57 Ga0070700_100003711 3300005441 Bacteria 7892
58 Ga0070700_100060336 3300005441 Bacteria 2390
59 Ga0070700_100070126 3300005441 Bacteria 2234
60 Ga0070694_100040078 3300005444 Bacteria 3121
61 Ga0070694_100075706 3300005444 Bacteria 2328
62 Ga0070708_100030358 3300005445 Bacteria 4672
63 Ga0070708_100073080 3300005445 Bacteria 3091
64 Ga0070678_100027211 3300005456 Bacteria 3881
65 Ga0070678_100083046 3300005456 Bacteria 2434
66 Ga0070678_100237318 3300005456 Bacteria 1523
67 Ga0070678_100240063 3300005456 Bacteria 1515
68 Ga0070662_100056188 3300005457 Bacteria 2857
69 Ga0070681_10019656 3300005458 Bacteria 6764
70 Ga0070681_10027044 3300005458 Bacteria 5768
71 Ga0070681_10042356 3300005458 Bacteria 4563
72 Ga0070681_10045320 3300005458 Bacteria 4400
73 Ga0070681_10071810 3300005458 Bacteria 3426
74 Ga0070681_10103021 3300005458 Bacteria 2799
75 Ga0070681_10150198 3300005458 Unclassified 2256
76 Ga0070681_10174749 3300005458 Bacteria 2069
77 Ga0070681_10212509 3300005458 Bacteria 1850
78 Ga0070681_10321332 3300005458 Bacteria 1457
79 Ga0068867_100028094 3300005459 Bacteria 4048
80 Ga0070706_100036466 3300005467 Bacteria 4541
81 Ga0070706_100122830 3300005467 Unclassified 2421
82 Ga0070706_100124960 3300005467 Unclassified 2398
83 Ga0070706_100361788 3300005467 Bacteria 1352
84 Ga0070707_100000736 3300005468 Bacteria 32520
85 Ga0070707_100001917 3300005468 Bacteria 19935
86 Ga0070707_100108476 3300005468 Bacteria 2693
87 Ga0070707_100227414 3300005468 Bacteria 1817
88 Ga0070707_100346107 3300005468 Bacteria 1444
89 Ga0070698_100017893 3300005471 Bacteria 7466
90 Ga0070698_100053947 3300005471 Bacteria 4083
91 Ga0070698_100062959 3300005471 Bacteria 3741
92 Ga0070698_100151900 3300005471 Bacteria 2263
93 Ga0070698_100163311 3300005471 Bacteria 2170
94 Ga0070698_100192258 3300005471 Bacteria 1978
95 Ga0070699_100005711 3300005518 Bacteria 10897
96 Ga0070699_100012784 3300005518 Bacteria 7236
97 Ga0070699_100192617 3300005518 Bacteria 1812
98 Ga0070679_100013238 3300005530 Bacteria 7895
99 Ga0070679_100046291 3300005530 Bacteria 4335
100 Ga0070679_100064484 3300005530 Bacteria 3651
101 Ga0070679_100093351 3300005530 Bacteria 2997
102 Ga0070679_100130555 3300005530 Bacteria 2494
103 Ga0070679_100159956 3300005530 Bacteria 2227
104 Ga0070684_100000304 3300005535 Bacteria 34144
105 Ga0070684_100005611 3300005535 Bacteria 9644
106 Ga0070684_100013149 3300005535 Bacteria 6661
107 Ga0070684_100033850 3300005535 Bacteria 4365
108 Ga0070684_100048627 3300005535 Bacteria 3679
109 Ga0070697_100185522 3300005536 Unclassified 1764
110 Ga0068853_100022302 3300005539 Bacteria 5287
111 Ga0070686_100029186 3300005544 Bacteria 3353
112 Ga0070695_100019884 3300005545 Bacteria 4095
113 Ga0070696_100042589 3300005546 Bacteria 3138
114 Ga0070696_100094204 3300005546 Bacteria 2137
115 Ga0070696_100232270 3300005546 Bacteria 1388
116 Ga0070693_100015911 3300005547 Bacteria 3882
117 Ga0070693_100039488 3300005547 Bacteria 2644
118 Ga0070665_100017345 3300005548 Bacteria 7227
119 Ga0070665_100062268 3300005548 Bacteria 3741
120 Ga0070704_100132297 3300005549 Bacteria 1935
121 Ga0070704_100174758 3300005549 Bacteria 1712
122 Ga0068855_100015558 3300005563 Bacteria 9158
123 Ga0068855_100061321 3300005563 Bacteria 4394
124 Ga0068855_100065248 3300005563 Bacteria 4245
125 Ga0068855_100083393 3300005563 Bacteria 3702
126 Ga0068855_100117266 3300005563 Bacteria 3050
127 Ga0070664_100034719 3300005564 Bacteria 4231
128 Ga0070664_100143570 3300005564 Bacteria 2104
129 Ga0070664_100180277 3300005564 Bacteria 1877
130 Ga0070664_100239925 3300005564 Unclassified 1627
131 Ga0070664_100261620 3300005564 Bacteria 1557
132 Ga0068857_100006535 3300005577 Bacteria 10005
133 Ga0068857_100095260 3300005577 Bacteria 2667
134 Ga0068856_100063236 3300005614 Bacteria 3656
135 Ga0068856_100076900 3300005614 Bacteria 3307
136 Ga0068856_100102573 3300005614 Bacteria 2854
137 Ga0068856_100196648 3300005614 Bacteria 2030
138 Ga0068856_100200382 3300005614 Bacteria 2010
139 Ga0068856_100235155 3300005614 Bacteria 1848
140 Ga0070702_100004559 3300005615 Bacteria 6341
141 Ga0070702_100074984 3300005615 Unclassified 2009
142 Ga0068852_100035447 3300005616 Bacteria 4162
143 Ga0068864_100303951 3300005618 Bacteria 1494
144 Ga0068864_100339051 3300005618 Bacteria 1416
145 Ga0068866_10001213 3300005718 Bacteria 11206
146 Ga0068861_100007901 3300005719 Bacteria 7319
147 Ga0068861_100107071 3300005719 Bacteria 2234
148 Ga0068861_100110309 3300005719 Bacteria 2203
149 Ga0068863_100464763 3300005841 Unclassified 1243
150 Ga0068862_100001367 3300005844 Bacteria 22660
151 Ga0068862_100140681 3300005844 Bacteria 2141
152 Ga0068862_100201484 3300005844 Bacteria 1795
153 Ga0081455_10005820 3300005937 Bacteria 13416
154 Ga0081455_10014238 3300005937 Bacteria 7805
155 Ga0081455_10014350 3300005937 Bacteria 7773
156 Ga0081455_10035655 3300005937 Bacteria 4441
157 Ga0081538_10053605 3300005981 Bacteria 2396
158 Ga0081540_1003071 3300005983 Bacteria 13377
159 Ga0081540_1015602 3300005983 Bacteria 4802
160 Ga0081539_10006606 3300005985 Bacteria 11012
161 Ga0070717_10037914 3300006028 Bacteria 3915
162 Ga0070717_10101499 3300006028 Bacteria 2443
163 Ga0070717_10115892 3300006028 Bacteria 2290
164 Ga0070717_10301524 3300006028 Bacteria 1424
165 Ga0075365_10019759 3300006038 Bacteria 4165
166 Ga0070715_10020079 3300006163 Bacteria 2571
167 Ga0070715_10052854 3300006163 Bacteria 1754
168 Ga0070712_100039286 3300006175 Bacteria 3238
169 Ga0070712_100090282 3300006175 Bacteria 2243
170 Ga0070712_100268046 3300006175 Bacteria 1371
171 Ga0068871_100035915 3300006358 Bacteria 3941
172 Ga0068871_100129862 3300006358 Bacteria 2135
173 Ga0068871_100182559 3300006358 Bacteria 1804
174 Ga0075428_100000381 3300006844 Bacteria 43984
175 Ga0075431_100023773 3300006847 Bacteria 6273
176 Ga0075431_100188313 3300006847 Bacteria 2115
177 Ga0075433_10069829 3300006852 Bacteria 3086
178 Ga0075433_10168459 3300006852 Bacteria 1949
179 Ga0075433_10322230 3300006852 Bacteria 1367
180 Ga0075434_100001557 3300006871 Bacteria 19447
181 Ga0075434_100010132 3300006871 Bacteria 8828
182 Ga0075434_100075961 3300006871 Bacteria 3354
183 Ga0075434_100175550 3300006871 Bacteria 2162
184 Ga0075434_100181318 3300006871 Bacteria 2126
185 Ga0075429_100216747 3300006880 Bacteria 1677
186 Ga0068865_100007982 3300006881 Bacteria 6535
187 Ga0075436_100003007 3300006914 Bacteria 11549
188 Ga0075436_100003937 3300006914 Bacteria 10181
189 Ga0075436_100022390 3300006914 Bacteria 4340
190 Ga0075436_100050943 3300006914 Bacteria 2857
191 Ga0075435_100012038 3300007076 Bacteria 6391
192 Ga0075435_100017412 3300007076 Bacteria 5441
193 Ga0075435_100021362 3300007076 Bacteria 4977
194 Ga0075435_100064189 3300007076 Bacteria 2983
195 Ga0075435_100180082 3300007076 Bacteria 1786
196 Ga0105240_10092787 3300009093 Bacteria 3685
197 Ga0105240_10175155 3300009093 Bacteria 2536
198 Ga0111539_10012314 3300009094 Bacteria 10718
199 Ga0111539_10051846 3300009094 Bacteria 4885
200 Ga0111539_10056650 3300009094 Bacteria 4657
201 Ga0111539_10252067 3300009094 Unclassified 2055
202 Ga0105245_10003086 3300009098 Bacteria 14908
203 Ga0105245_10046270 3300009098 Bacteria 3888
204 Ga0105245_10073970 3300009098 Bacteria 3100
205 Ga0105245_10326822 3300009098 Bacteria 1512
206 Ga0105247_10002698 3300009101 Bacteria 11915
207 Ga0105247_10014196 3300009101 Bacteria 4779
208 Ga0114129_10001661 3300009147 Bacteria 30289
209 Ga0114129_10005673 3300009147 Bacteria 17670
210 Ga0114129_10012739 3300009147 Bacteria 11971
211 Ga0114129_10117688 3300009147 Bacteria 3661
212 Ga0114129_10134627 3300009147 Bacteria 3391
213 Ga0114129_10153050 3300009147 Bacteria 3156
214 Ga0114129_10181523 3300009147 Bacteria 2863
215 Ga0114129_10569990 3300009147 Bacteria 1470
216 Ga0105243_10017876 3300009148 Bacteria 5364
217 Ga0105243_10040745 3300009148 Bacteria 3629
218 Ga0105243_10127544 3300009148 Bacteria 2154
219 Ga0105243_10183473 3300009148 Bacteria 1822
220 Ga0105243_10225101 3300009148 Bacteria 1660
221 Ga0105241_10039315 3300009174 Bacteria 3568
222 Ga0105242_10006738 3300009176 Bacteria 8859
223 Ga0105242_10059277 3300009176 Bacteria 3140
224 Ga0105248_10386638 3300009177 Bacteria 1575
225 Ga0105237_10250757 3300009545 Bacteria 1772
226 Ga0105238_10150945 3300009551 Bacteria 2299
227 Ga0105238_10181417 3300009551 Bacteria 2082
228 Ga0105238_10216597 3300009551 Bacteria 1891
229 Ga0105249_10034961 3300009553 Bacteria 4556
230 Ga0105239_10041625 3300010375 Bacteria 5034
231 Ga0105239_10279800 3300010375 Unclassified 1878
232 Ga0105246_10039168 3300011119 Bacteria 3191
233 Ga0105246_10196366 3300011119 Unclassified 1565
234 Ga0157373_10145747 3300013100 Unclassified 1665
235 Ga0157371_10162431 3300013102 Bacteria 1595
236 Ga0157370_10027005 3300013104 Bacteria 5663
237 Ga0157370_10116274 3300013104 Bacteria 2499
238 Ga0157369_10002618 3300013105 Bacteria 21517
239 Ga0157369_10039852 3300013105 Bacteria 5132
240 Ga0157369_10051221 3300013105 Bacteria 4468
241 Ga0157369_10101401 3300013105 Bacteria 3067
242 Ga0157369_10131514 3300013105 Bacteria 2651
243 Ga0157374_10108469 3300013296 Bacteria 2668
244 Ga0157378_10044141 3300013297 Bacteria 3958
245 Ga0157378_10108371 3300013297 Bacteria 2543
246 Ga0157378_10200593 3300013297 Bacteria 1887
247 Ga0163162_10026922 3300013306 Bacteria 5686
248 Ga0163162_10056437 3300013306 Bacteria 3955
249 Ga0163162_10154367 3300013306 Bacteria 2415
250 Ga0157372_10481927 3300013307 Bacteria 1446
251 Ga0157375_10036207 3300013308 Bacteria 4719
252 Ga0157375_10047453 3300013308 Bacteria 4195
253 Ga0157380_10006605 3300014326 Bacteria 8181
254 Ga0157380_10010760 3300014326 Bacteria 6592
255 Ga0182008_10005743 3300014497 Bacteria 7025
256 Ga0182008_10041945 3300014497 Bacteria 2281
257 Ga0182008_10053067 3300014497 Bacteria 2008
258 Ga0157377_10073642 3300014745 Bacteria 1980
259 Ga0157379_10258274 3300014968 Bacteria 1583
260 Ga0157376_10062443 3300014969 Bacteria 3134
261 Ga0157376_10125268 3300014969 Bacteria 2284
262 Ga0163161_10166119 3300017792 Bacteria 1685
263 Ga0206356_10687371 3300020070 Bacteria 2795
264 Ga0206356_11158095 3300020070 Bacteria 1283
265 Ga0206356_11233245 3300020070 Bacteria 1369
266 Ga0206356_11875873 3300020070 Unclassified 1893
267 Ga0206354_10192413 3300020081 Bacteria 3483
268 Ga0206354_10778318 3300020081 Bacteria 3765
269 Ga0206354_10900364 3300020081 Bacteria 1794
270 Ga0206353_10422956 3300020082 Bacteria 8342
271 Ga0206353_11663111 3300020082 Bacteria 4091
272 Ga0206353_11831078 3300020082 Bacteria 2926
273 Ga0213871_10006336 3300021441 Bacteria 2500
274 Ga0207692_10074254 3300025898 Bacteria 1801
275 Ga0207642_10014554 3300025899 Bacteria 2905
276 Ga0207710_10000179 3300025900 Bacteria 64100
277 Ga0207688_10151160 3300025901 Bacteria 1371
278 Ga0207647_10154597 3300025904 Unclassified 1340
279 Ga0207699_10081352 3300025906 Bacteria 2009
280 Ga0207645_10057178 3300025907 Bacteria 2490
281 Ga0207705_10026437 3300025909 Bacteria 4139
282 Ga0207705_10038063 3300025909 Bacteria 3443
283 Ga0207705_10063948 3300025909 Bacteria 2659
284 Ga0207684_10056353 3300025910 Bacteria 3334
285 Ga0207684_10080852 3300025910 Bacteria 2765
286 Ga0207684_10165453 3300025910 Bacteria 1905
287 Ga0207684_10312577 3300025910 Bacteria 1354
288 Ga0207684_10348716 3300025910 Bacteria 1274
289 Ga0207654_10188351 3300025911 Unclassified 1351
290 Ga0207707_10017134 3300025912 Bacteria 6312
291 Ga0207707_10106547 3300025912 Bacteria 2450
292 Ga0207707_10108903 3300025912 Bacteria 2422
293 Ga0207707_10143050 3300025912 Bacteria 2091
294 Ga0207693_10000319 3300025915 Bacteria 44749
295 Ga0207693_10000945 3300025915 Bacteria 26054
296 Ga0207693_10004123 3300025915 Bacteria 12338
297 Ga0207693_10033836 3300025915 Bacteria 4032
298 Ga0207693_10038611 3300025915 Bacteria 3759
299 Ga0207693_10047648 3300025915 Bacteria 3367
300 Ga0207693_10112782 3300025915 Bacteria 2133
301 Ga0207693_10126291 3300025915 Bacteria 2010
302 Ga0207693_10307813 3300025915 Bacteria 1241
303 Ga0207663_10004268 3300025916 Bacteria 7094
304 Ga0207663_10010470 3300025916 Bacteria 4938
305 Ga0207663_10190443 3300025916 Bacteria 1472
306 Ga0207660_10031455 3300025917 Bacteria 3655
307 Ga0207660_10176254 3300025917 Bacteria 1658
308 Ga0207662_10054435 3300025918 Bacteria 2386
309 Ga0207657_10003731 3300025919 Bacteria 16188
310 Ga0207657_10005756 3300025919 Bacteria 12928
311 Ga0207657_10027056 3300025919 Bacteria 5258
312 Ga0207657_10029230 3300025919 Bacteria 5019
313 Ga0207657_10042806 3300025919 Bacteria 3992
314 Ga0207649_10033516 3300025920 Bacteria 3069
315 Ga0207652_10008054 3300025921 Bacteria 8458
316 Ga0207652_10048618 3300025921 Bacteria 3626
317 Ga0207652_10065363 3300025921 Bacteria 3150
318 Ga0207652_10105455 3300025921 Bacteria 2494
319 Ga0207652_10231005 3300025921 Unclassified 1667
320 Ga0207646_10002421 3300025922 Bacteria 22033
321 Ga0207646_10022827 3300025922 Bacteria 5754
322 Ga0207694_10064076 3300025924 Bacteria 2864
323 Ga0207659_10284173 3300025926 Bacteria 1354
324 Ga0207687_10003599 3300025927 Bacteria 10432
325 Ga0207687_10024282 3300025927 Bacteria 4048
326 Ga0207687_10042776 3300025927 Bacteria 3119
327 Ga0207687_10049497 3300025927 Bacteria 2922
328 Ga0207687_10066707 3300025927 Bacteria 2558
329 Ga0207687_10116444 3300025927 Bacteria 1992
330 Ga0207687_10166619 3300025927 Bacteria 1696
331 Ga0207687_10206638 3300025927 Bacteria 1538
332 Ga0207700_10062381 3300025928 Unclassified 2831
333 Ga0207700_10064336 3300025928 Bacteria 2793
334 Ga0207700_10169436 3300025928 Bacteria 1821
335 Ga0207664_10008572 3300025929 Bacteria 7143
336 Ga0207664_10060285 3300025929 Bacteria 3024
337 Ga0207664_10073207 3300025929 Bacteria 2764
338 Ga0207664_10083264 3300025929 Bacteria 2608
339 Ga0207664_10091349 3300025929 Bacteria 2497
340 Ga0207664_10247239 3300025929 Bacteria 1555
341 Ga0207664_10394379 3300025929 Unclassified 1230
342 Ga0207690_10142744 3300025932 Bacteria 1766
343 Ga0207706_10003832 3300025933 Bacteria 14329
344 Ga0207706_10029343 3300025933 Bacteria 4910
345 Ga0207706_10045280 3300025933 Bacteria 3899
346 Ga0207706_10073803 3300025933 Bacteria 3000
347 Ga0207686_10002316 3300025934 Bacteria 10426
348 Ga0207709_10003771 3300025935 Bacteria 8904
349 Ga0207709_10010998 3300025935 Bacteria 4988
350 Ga0207709_10056466 3300025935 Bacteria 2430
351 Ga0207670_10014593 3300025936 Bacteria 4670
352 Ga0207704_10118584 3300025938 Bacteria 1805
353 Ga0207665_10002255 3300025939 Bacteria 13013
354 Ga0207665_10007220 3300025939 Bacteria 7352
355 Ga0207665_10008529 3300025939 Bacteria 6747
356 Ga0207665_10073671 3300025939 Bacteria 2336
357 Ga0207691_10009218 3300025940 Bacteria 9472
358 Ga0207691_10195473 3300025940 Bacteria 1763
359 Ga0207711_10028596 3300025941 Bacteria 4693
360 Ga0207661_10003070 3300025944 Bacteria 11557
361 Ga0207661_10101276 3300025944 Bacteria 2419
362 Ga0207661_10125684 3300025944 Unclassified 2190
363 Ga0207679_10138480 3300025945 Bacteria 1964
364 Ga0207679_10140877 3300025945 Bacteria 1949
365 Ga0207667_10083906 3300025949 Bacteria 3298
366 Ga0207667_10288750 3300025949 Bacteria 1676
367 Ga0207651_10187263 3300025960 Unclassified 1648
368 Ga0207712_10024209 3300025961 Bacteria 4018
369 Ga0207668_10039579 3300025972 Bacteria 3175
370 Ga0207668_10101007 3300025972 Bacteria 2143
371 Ga0207668_10179823 3300025972 Bacteria 1667
372 Ga0207658_10045246 3300025986 Bacteria 3208
373 Ga0207708_10008089 3300026075 Bacteria 7794
374 Ga0207708_10048525 3300026075 Bacteria 3232
375 Ga0207708_10143876 3300026075 Bacteria 1873
376 Ga0207702_10019118 3300026078 Bacteria 5669
377 Ga0207702_10055641 3300026078 Bacteria 3356
378 Ga0207702_10075448 3300026078 Bacteria 2913
379 Ga0207702_10096587 3300026078 Bacteria 2599
380 Ga0207702_10105669 3300026078 Bacteria 2494
381 Ga0207702_10224622 3300026078 Bacteria 1751
382 Ga0207641_10292795 3300026088 Bacteria 1535
383 Ga0207648_10002132 3300026089 Bacteria 21520
384 Ga0207648_10011231 3300026089 Bacteria 8445
385 Ga0207676_10045001 3300026095 Bacteria 3408
386 Ga0207674_10011029 3300026116 Bacteria 10164
387 Ga0207674_10026840 3300026116 Bacteria 6109
388 Ga0207675_100005440 3300026118 Bacteria 12206
389 Ga0207675_100008915 3300026118 Bacteria 9412
390 Ga0207675_100052680 3300026118 Bacteria 3797
391 Ga0207675_100092869 3300026118 Bacteria 2838
392 Ga0207675_100147604 3300026118 Bacteria 2237
393 Ga0207683_10002939 3300026121 Bacteria 14868
394 Ga0207683_10012321 3300026121 Bacteria 7298
395 Ga0207683_10027994 3300026121 Bacteria 4872
396 Ga0207683_10028451 3300026121 Bacteria 4832
397 Ga0207683_10029373 3300026121 Bacteria 4760
398 Ga0207683_10032077 3300026121 Bacteria 4562
399 Ga0207683_10085471 3300026121 Bacteria 2804
400 Ga0207683_10137693 3300026121 Bacteria 2198
401 Ga0207698_10066827 3300026142 Bacteria 2832
402 Ga0207698_10083164 3300026142 Bacteria 2590
403 Ga0207428_10005252 3300027907 Bacteria 12103
404 Ga0207428_10008826 3300027907 Bacteria 9088
405 Ga0207428_10030367 3300027907 Bacteria 4468
406 Ga0268265_10003678 3300028380 Bacteria 10943
407 Ga0268265_10311239 3300028380 Bacteria 1422
408 Ga0268264_10284109 3300028381 Unclassified 1551
409 Ga0265337_1025219 3300028556 Bacteria 1811
410 Ga0265326_10011074 3300028558 Bacteria 2667
411 Ga0265319_1000592 3300028563 Bacteria 24262
412 Ga0265319_1005217 3300028563 Bacteria 6270
413 Ga0265318_10000219 3300028577 Bacteria 49788
414 Ga0265318_10005482 3300028577 Bacteria 5954
415 Ga0265318_10043101 3300028577 Bacteria 1711
416 Ga0265322_10016444 3300028654 Bacteria 2135
417 Ga0265338_10003307 3300028800 Bacteria 22846
418 Ga0265338_10007029 3300028800 Bacteria 14125
419 Ga0265338_10016091 3300028800 Bacteria 8162
420 Ga0265338_10034817 3300028800 Bacteria 4855
421 Ga0265338_10175213 3300028800 Bacteria 1640
422 Ga0265330_10000479 3300031235 Bacteria 26766
423 Ga0265328_10000790 3300031239 Bacteria 14638
424 Ga0265320_10051332 3300031240 Bacteria 2001
425 Ga0265320_10058686 3300031240 Bacteria 1841
426 Ga0265325_10000443 3300031241 Bacteria 29809
427 Ga0265329_10000472 3300031242 Bacteria 20927
428 Ga0265340_10068279 3300031247 Unclassified 1688
429 Ga0265339_10101055 3300031249 Bacteria 1501
430 Ga0265331_10020343 3300031250 Bacteria 3410
431 Ga0265327_10009052 3300031251 Bacteria 7275
432 Ga0265316_10004053 3300031344 Bacteria 14658
433 Ga0265316_10012119 3300031344 Bacteria 7742
434 Ga0307408_100171924 3300031548 Bacteria 1731
435 Ga0265313_10006992 3300031595 Bacteria 7824
436 Ga0265314_10003422 3300031711 Bacteria 15353
437 Ga0265314_10031419 3300031711 Bacteria 3919
438 Ga0265342_10045680 3300031712 Bacteria 2635
439 Ga0265342_10097936 3300031712 Unclassified 1674
440 Ga0307406_10230486 3300031901 Bacteria 1383
441 Ga0307409_100293301 3300031995 Bacteria 1509
442 Ga0307416_100106261 3300032002 Bacteria 2460
443 Ga0373938_0010324 3300034957 Bacteria 1714
444 Ga0373952_0015557 3300035092 Bacteria 1537
445 Ga0373939_0027186 3300035114 Bacteria 1618
446 Ga0373941_0006820 3300035115 Bacteria 2768
447 Ga0373941_0011420 3300035115 Bacteria 2295
448 Ga0373945_0003511 3300035116 Bacteria 4939
449 Ga0373960_0018728 3300035121 Bacteria 1810
450 Ga0373943_0005293 3300035170 Bacteria 5802
451 Ga0373943_0011525 3300035170 Bacteria 3979
452 Ga0373943_0034514 3300035170 Bacteria 2413
453 Ga0373943_0065060 3300035170 Bacteria 1832
454 Ga0373946_0014769 3300035171 Bacteria 2950
455 Ga0373955_0024397 3300035172 Bacteria 3093
456 Ga0373961_0011677 3300035241 Bacteria 2183
457 Ga0373962_0003254 3300035242 Bacteria 3906
458 Ga0373931_0006393 3300035691 Bacteria 5503
459 Ga0373935_0072020 3300035692 Bacteria 2231
460 Ga0373927_0045554 3300035695 Unclassified 2837
461 Ga0373927_0158836 3300035695 Bacteria 1481
462 Ga0373947_0000237 3300035725 Bacteria 31058
463 Ga0373937_0000548 3300036401 Bacteria 33475
464 Ga0373937_0025305 3300036401 Bacteria 5358
465 Ga0373937_0338739 3300036401 Bacteria 1424
466 Ga0373925_0002356 3300037068 Bacteria 15161
467 Ga0373925_0055357 3300037068 Bacteria 2969
468 Ga0373925_0093770 3300037068 Bacteria 2298
469 Ga0373925_0107961 3300037068 Bacteria 2147
470 Ga0395899_0010815 3300037312 Bacteria 6996
471 Ga0395899_0012610 3300037312 Bacteria 6480
472 Ga0395899_0016341 3300037312 Bacteria 5656
473 Ga0395899_0026219 3300037312 Bacteria 4398
474 Ga0395899_0030436 3300037312 Bacteria 4060
475 Ga0395899_0046995 3300037312 Bacteria 3214
476 Ga0395899_0058758 3300037312 Bacteria 2836
477 Ga0395899_0073691 3300037312 Bacteria 2496
478 Ga0395899_0075024 3300037312 Bacteria 2470
479 Ga0395899_0076944 3300037312 Bacteria 2435
480 Ga0395899_0114276 3300037312 Bacteria 1938
481 Ga0395899_0123955 3300037312 Bacteria 1848
482 Ga0395900_0003636 3300037418 Bacteria 16572
483 Ga0395900_0003913 3300037418 Bacteria 15910
484 Ga0395900_0006681 3300037418 Bacteria 11985
485 Ga0395900_0008263 3300037418 Bacteria 10716
486 Ga0395900_0013052 3300037418 Bacteria 8492
487 Ga0395900_0050121 3300037418 Bacteria 4301
488 Ga0395900_0070002 3300037418 Bacteria 3607
489 Ga0395900_0093511 3300037418 Bacteria 3088
490 Ga0395900_0106472 3300037418 Bacteria 2880
491 Ga0395900_0112371 3300037418 Bacteria 2797
492 Ga0395900_0143369 3300037418 Bacteria 2445
493 Ga0395900_0196645 3300037418 Unclassified 2042
494 Ga0395900_0227670 3300037418 Bacteria 1877
495 Ga0395900_0248532 3300037418 Bacteria 1781
496 Ga0395898_0001212 3300037466 Bacteria 38943
497 Ga0395898_0003410 3300037466 Bacteria 17802
498 Ga0395898_0007007 3300037466 Bacteria 11978
499 Ga0395898_0007049 3300037466 Bacteria 11941
500 Ga0395898_0007790 3300037466 Bacteria 11368
501 Ga0395898_0011394 3300037466 Bacteria 9234
502 Ga0395898_0015434 3300037466 Bacteria 7832
503 Ga0395898_0024102 3300037466 Bacteria 6142
504 Ga0395898_0031435 3300037466 Bacteria 5304
505 Ga0395898_0033701 3300037466 Bacteria 5108
506 Ga0395898_0039393 3300037466 Bacteria 4677
507 Ga0395898_0057873 3300037466 Bacteria 3775
508 Ga0395898_0058510 3300037466 Bacteria 3751
509 Ga0395898_0097804 3300037466 Bacteria 2818
510 Ga0395898_0116142 3300037466 Bacteria 2564
511 Ga0395898_0127735 3300037466 Bacteria 2435
512 Ga0395898_0157977 3300037466 Bacteria 2168
513 Ga0395898_0171389 3300037466 Bacteria 2075
514 Ga0395898_0346758 3300037466 Bacteria 1416
515 Ga0395898_0481221 3300037466 Bacteria 1181
516 Ga0395898_0600040 3300037466 Unclassified 1044
517 Ga0395905_0001601 3300037471 Bacteria 26910
518 Ga0395905_0001928 3300037471 Bacteria 23814
519 Ga0395905_0004549 3300037471 Bacteria 14360
520 Ga0395905_0010973 3300037471 Bacteria 8769
521 Ga0395905_0011189 3300037471 Bacteria 8676
522 Ga0395905_0012746 3300037471 Bacteria 8086
523 Ga0395905_0019921 3300037471 Bacteria 6357
524 Ga0395905_0026059 3300037471 Bacteria 5513
525 Ga0395905_0105086 3300037471 Bacteria 2651
526 Ga0395905_0122043 3300037471 Bacteria 2450
527 Ga0395905_0126128 3300037471 Bacteria 2407
528 Ga0395901_0000858 3300038443 Bacteria 33469
529 Ga0395901_0001826 3300038443 Bacteria 21982
530 Ga0395901_0003205 3300038443 Bacteria 16466
531 Ga0395901_0003231 3300038443 Bacteria 16388
532 Ga0395901_0003420 3300038443 Bacteria 15996
533 Ga0395901_0006476 3300038443 Bacteria 11854
534 Ga0395901_0010878 3300038443 Bacteria 9221
535 Ga0395901_0013196 3300038443 Bacteria 8390
536 Ga0395901_0024220 3300038443 Bacteria 6228
537 Ga0395901_0033692 3300038443 Bacteria 5288
538 Ga0395901_0037382 3300038443 Bacteria 5021
539 Ga0395901_0041928 3300038443 Bacteria 4744
540 Ga0395901_0055287 3300038443 Bacteria 4128
541 Ga0395901_0064877 3300038443 Bacteria 3801
542 Ga0395901_0076162 3300038443 Bacteria 3500
543 Ga0395901_0080971 3300038443 Bacteria 3391
544 Ga0395901_0117180 3300038443 Bacteria 2798
545 Ga0395901_0138446 3300038443 Bacteria 2558
546 Ga0395901_0146551 3300038443 Bacteria 2481
547 Ga0395901_0157899 3300038443 Bacteria 2382
548 Ga0395901_0161945 3300038443 Bacteria 2350
549 Ga0395901_0241094 3300038443 Unclassified 1886
550 Ga0395901_0244308 3300038443 Bacteria 1871
551 Ga0395901_0306200 3300038443 Unclassified 1646
552 Ga0395901_0320598 3300038443 Bacteria 1603
553 Ga0436365_1070781 3300039437 Bacteria 2419
554 Ga0436360_0887170 3300039438 Bacteria 4748
555 Ga0451789_0528223 3300041443 Unclassified 1836
556 Ga0451789_0919425 3300041443 Bacteria 1404
557 Ga0451800_1267821 3300041459 Bacteria 2221
558 Ga0451835_0383021 3300041492 Bacteria 3443
559 Ga0451839_0194646 3300041496 Bacteria 2270
560 Ga0451849_0045844 3300041505 Bacteria 4176
561 Ga0451851_0849119 3300041507 Bacteria 2791
562 Ga0451853_3599974 3300041512 Bacteria 2150
563 Ga0439464_0036941 3300042439 Bacteria 1384
564 Ga0466965_0004578 3300044683 Bacteria 6158
565 Ga0466965_0085556 3300044683 Bacteria 1598
566 Ga0466966_0020499 3300044684 Bacteria 4346
567 Ga0466966_0038817 3300044684 Bacteria 3066
568 Ga0466961_0002675 3300044693 Bacteria 11056
569 Ga0466961_0004260 3300044693 Bacteria 8954
570 Ga0466961_0083012 3300044693 Bacteria 2026
571 Ga0466961_0099484 3300044693 Bacteria 1833
572 Ga0466963_0000261 3300044694 Bacteria 23150
573 Ga0466963_0000768 3300044694 Bacteria 15875
574 Ga0466963_0002376 3300044694 Bacteria 10515
575 Ga0466963_0002868 3300044694 Bacteria 9735
576 Ga0466963_0004245 3300044694 Bacteria 8313
577 Ga0466963_0011880 3300044694 Bacteria 5315
578 Ga0466963_0024908 3300044694 Bacteria 3811
579 Ga0466963_0035060 3300044694 Bacteria 3267
580 Ga0466963_0044167 3300044694 Bacteria 2933
581 Ga0466963_0076363 3300044694 Unclassified 2262
582 Ga0466963_0081131 3300044694 Bacteria 2196
583 Ga0466963_0083860 3300044694 Bacteria 2161
584 Ga0466964_0000352 3300044706 Bacteria 13785
585 Ga0466964_0004673 3300044706 Bacteria 5062
586 Ga0466964_0008804 3300044706 Bacteria 3794
587 Ga0466964_0017735 3300044706 Bacteria 2726
588 Ga0466964_0026000 3300044706 Bacteria 2289
589 Ga0466964_0030830 3300044706 Bacteria 2124
590 Ga0466964_0063959 3300044706 Bacteria 1538
591 Ga0466968_0003161 3300044735 Bacteria 6077
592 Ga0466968_0008909 3300044735 Bacteria 3852
593 Ga0466968_0031417 3300044735 Bacteria 2203
594 Ga0466968_0041575 3300044735 Bacteria 1941
595 Ga0466970_0014312 3300044765 Bacteria 4071
596 Ga0466970_0160736 3300044765 Bacteria 1242
597 Ga0466957_0006127 3300044842 Bacteria 6787
598 Ga0466957_0030739 3300044842 Bacteria 3207
599 Ga0466960_0003012 3300044901 Bacteria 6433
600 Ga0466959_0025227 3300045049 Bacteria 4404
601 Ga0466959_0025914 3300045049 Bacteria 4348
602 Ga0451576_0022984 3300045051 Bacteria 6757
603 Ga0466958_0000988 3300045836 Bacteria 12856
604 Ga0466958_0002635 3300045836 Bacteria 9070
605 Ga0466958_0031646 3300045836 Unclassified 3145
606 Ga0466958_0121919 3300045836 Bacteria 1633
607 Ga0466967_0002587 3300045976 Bacteria 11369
608 Ga0466967_0013294 3300045976 Bacteria 6353
609 Ga0466967_0013473 3300045976 Bacteria 6321
610 Ga0466967_0015101 3300045976 Bacteria 6044
611 Ga0466967_0021409 3300045976 Bacteria 5250
612 Ga0466967_0022717 3300045976 Bacteria 5126
613 Ga0466967_0027600 3300045976 Bacteria 4724
614 Ga0466967_0031057 3300045976 Bacteria 4492
615 Ga0466967_0031978 3300045976 Bacteria 4438
616 Ga0466967_0038321 3300045976 Bacteria 4110
617 Ga0466967_0053417 3300045976 Bacteria 3551
618 Ga0466967_0054362 3300045976 Bacteria 3523
619 Ga0466967_0055137 3300045976 Bacteria 3501
620 Ga0466967_0074837 3300045976 Bacteria 3042
621 Ga0466967_0111660 3300045976 Bacteria 2512
622 Ga0466967_0122613 3300045976 Bacteria 2404
623 Ga0466967_0141492 3300045976 Bacteria 2241
624 Ga0466967_0187418 3300045976 Bacteria 1954
625 Ga0466967_0226508 3300045976 Bacteria 1779
626 Ga0466967_0242022 3300045976 Bacteria 1721
627 Ga0466967_0440315 3300045976 Unclassified 1272
628 Ga0495592_0000100 3300046454 Bacteria 76535
629 Ga0495592_0060169 3300046454 Bacteria 2794
630 Ga0495603_0001231 3300046455 Bacteria 14938
631 Ga0495603_0013603 3300046455 Bacteria 4923
632 Ga0495603_0014127 3300046455 Bacteria 4831
633 Ga0495603_0041622 3300046455 Bacteria 2746
634 Ga0495603_0047923 3300046455 Bacteria 2544
635 Ga0495603_0104510 3300046455 Bacteria 1653
636 Ga0495629_0002746 3300046459 Bacteria 13466
637 Ga0495629_0030475 3300046459 Bacteria 3824
638 Ga0495641_0002482 3300046461 Bacteria 14526
639 Ga0495641_0004633 3300046461 Bacteria 9613
640 Ga0495641_0043455 3300046461 Bacteria 2078
641 Ga0495641_0055610 3300046461 Bacteria 1796
642 Ga0495641_0056804 3300046461 Bacteria 1773
643 Ga0495641_0057609 3300046461 Bacteria 1760
644 Ga0495641_0064745 3300046461 Bacteria 1646
645 Ga0495651_0000008 3300046462 Bacteria 156989
646 Ga0495651_0035623 3300046462 Bacteria 3874
647 Ga0495651_0042861 3300046462 Bacteria 3512
648 Ga0495651_0056623 3300046462 Bacteria 3011
649 Ga0495653_0032335 3300046463 Bacteria 4155
650 Ga0495653_0035380 3300046463 Bacteria 3941
651 Ga0495653_0047434 3300046463 Bacteria 3322
652 Ga0495653_0170490 3300046463 Bacteria 1502
653 Ga0495582_0001422 3300046473 Bacteria 13508
654 Ga0495582_0014295 3300046473 Bacteria 4366
655 Ga0495582_0016729 3300046473 Bacteria 4016
656 Ga0495582_0044924 3300046473 Bacteria 2433
657 Ga0495582_0100123 3300046473 Bacteria 1622
658 Ga0495582_0130800 3300046473 Unclassified 1418
659 Ga0495582_0172744 3300046473 Unclassified 1230
660 Ga0495605_0019449 3300046474 Bacteria 3627
661 Ga0495605_0019926 3300046474 Bacteria 3571
662 Ga0495639_0001181 3300046475 Bacteria 11798
663 Ga0495639_0004850 3300046475 Bacteria 5769
664 Ga0495639_0047663 3300046475 Bacteria 1942
665 Ga0495639_0066254 3300046475 Unclassified 1662
666 Ga0495662_0003046 3300046476 Bacteria 8451
667 Ga0495662_0037839 3300046476 Bacteria 2331
668 Ga0495664_0027095 3300046477 Bacteria 3341
669 Ga0495584_0010544 3300046491 Bacteria 4747
670 Ga0495584_0072938 3300046491 Bacteria 1725
671 Ga0495585_0131686 3300046492 Unclassified 1316
672 Ga0495594_0001036 3300046499 Bacteria 14468
673 Ga0495596_0071510 3300046500 Unclassified 1347
674 Ga0495596_0073991 3300046500 Unclassified 1323
675 Ga0495607_0088451 3300046501 Bacteria 1684
676 Ga0495608_0002626 3300046511 Bacteria 12905
677 Ga0495608_0011259 3300046511 Bacteria 6227
678 Ga0495608_0039772 3300046511 Bacteria 3151
679 Ga0495608_0115164 3300046511 Bacteria 1726
680 Ga0495618_0006703 3300046514 Bacteria 6977
681 Ga0495618_0032144 3300046514 Bacteria 3287
682 Ga0495618_0117810 3300046514 Unclassified 1700
683 Ga0495628_0000105 3300046516 Bacteria 68159
684 Ga0495628_0001154 3300046516 Bacteria 24083
685 Ga0495628_0005946 3300046516 Bacteria 10677
686 Ga0495628_0028966 3300046516 Bacteria 4494
687 Ga0495628_0172847 3300046516 Bacteria 1638
688 Ga0495630_0003323 3300046517 Bacteria 11203
689 Ga0495630_0014105 3300046517 Bacteria 5815
690 Ga0495630_0024498 3300046517 Bacteria 4460
691 Ga0495630_0031468 3300046517 Bacteria 3951
692 Ga0495630_0143569 3300046517 Bacteria 1815
693 Ga0495630_0155911 3300046517 Bacteria 1738
694 Ga0495631_0071338 3300046518 Bacteria 1501
695 Ga0495644_0004305 3300046523 Bacteria 5592
696 Ga0495644_0032726 3300046523 Unclassified 1965
697 Ga0495663_0011150 3300046525 Bacteria 2501
698 Ga0495666_0099635 3300046526 Bacteria 1369
699 Ga0495652_0000588 3300046529 Bacteria 42490
700 Ga0495652_0007715 3300046529 Bacteria 9909
701 Ga0495652_0077392 3300046529 Bacteria 2757
702 Ga0495652_0124915 3300046529 Bacteria 2046
703 Ga0495652_0124966 3300046529 Bacteria 2045
704 Ga0495665_0002651 3300046531 Bacteria 9656
705 Ga0495665_0020951 3300046531 Bacteria 3513
706 Ga0495665_0036519 3300046531 Bacteria 2623
707 Ga0495640_0012819 3300046533 Bacteria 6396
708 Ga0495640_0026363 3300046533 Bacteria 4201
709 Ga0495586_0057494 3300046535 Bacteria 2110
710 Ga0495586_0070615 3300046535 Bacteria 1907
711 Ga0495587_0000048 3300046536 Bacteria 105358
712 Ga0495587_0019872 3300046536 Bacteria 4151
713 Ga0495609_0014755 3300046538 Bacteria 3668
714 Ga0495609_0037234 3300046538 Bacteria 2195
715 Ga0495609_0064070 3300046538 Bacteria 1622
716 Ga0495645_0000029 3300046543 Bacteria 113119
717 Ga0495645_0018139 3300046543 Bacteria 5051
718 Ga0495645_0057702 3300046543 Bacteria 2817
719 Ga0495667_0005882 3300046559 Bacteria 8306
720 Ga0495667_0016319 3300046559 Bacteria 5018
721 Ga0495667_0037446 3300046559 Bacteria 3233
722 Ga0495667_0048893 3300046559 Bacteria 2792
723 Ga0495667_0081797 3300046559 Bacteria 2099
724 Ga0495656_0017608 3300046615 Bacteria 2729
725 Ga0495656_0058104 3300046615 Bacteria 1677
726 Ga0495656_0096626 3300046615 Bacteria 1360
727 Ga0495656_0103930 3300046615 Bacteria 1318
728 Ga0495656_0113038 3300046615 Bacteria 1273
729 Ga0495634_0021634 3300046642 Bacteria 4543
730 Ga0495634_0029224 3300046642 Bacteria 3817
731 Ga0495634_0048784 3300046642 Bacteria 2849
732 Ga0495634_0071929 3300046642 Bacteria 2275
733 Ga0495611_0123291 3300046648 Bacteria 1208
734 Ga0495635_0047792 3300046663 Bacteria 2950
735 Ga0495635_0074004 3300046663 Bacteria 2333
736 Ga0495635_0105734 3300046663 Unclassified 1923
737 Ga0495635_0126439 3300046663 Bacteria 1743
738 Ga0495659_0042609 3300046664 Bacteria 1625
739 Ga0495588_0000812 3300046674 Bacteria 13938
740 Ga0495588_0041339 3300046674 Bacteria 2354
741 Ga0495588_0056635 3300046674 Bacteria 2024
742 Ga0495588_0063506 3300046674 Bacteria 1915
743 Ga0495588_0122311 3300046674 Bacteria 1372
744 Ga0495657_0015166 3300046675 Bacteria 5645
745 Ga0495657_0033676 3300046675 Bacteria 3565
746 Ga0495657_0046320 3300046675 Bacteria 2945
747 Ga0495657_0107380 3300046675 Bacteria 1771
748 Ga0495599_0000110 3300046678 Bacteria 55240
749 Ga0495599_0000519 3300046678 Bacteria 22125
750 Ga0495599_0011820 3300046678 Bacteria 5368
751 Ga0495599_0093113 3300046678 Bacteria 1880
752 Ga0495599_0177620 3300046678 Bacteria 1313
753 Ga0495623_0005997 3300046679 Bacteria 7905
754 Ga0495623_0033141 3300046679 Bacteria 3316
755 Ga0495646_0005674 3300046680 Bacteria 7904
756 Ga0495646_0009733 3300046680 Bacteria 6104
757 Ga0495646_0022232 3300046680 Bacteria 4001
758 Ga0495646_0094316 3300046680 Bacteria 1723
759 Ga0495647_0013829 3300046681 Bacteria 2803
760 Ga0495647_0041893 3300046681 Bacteria 1746
761 Ga0495658_0000794 3300046683 Bacteria 17003
762 Ga0495658_0017927 3300046683 Bacteria 3670
763 Ga0495658_0069108 3300046683 Bacteria 2047
764 Ga0495658_0117328 3300046683 Bacteria 1606
765 Ga0495669_0015201 3300046684 Bacteria 3295
766 Ga0495613_0014803 3300046689 Bacteria 5789
767 Ga0495613_0048055 3300046689 Bacteria 3151
768 Ga0495613_0117332 3300046689 Bacteria 1914
769 Ga0495613_0169103 3300046689 Bacteria 1552
770 Ga0495624_0010504 3300046690 Bacteria 6383
771 Ga0495624_0013790 3300046690 Bacteria 5504
772 Ga0495624_0019028 3300046690 Bacteria 4587
773 Ga0495624_0031523 3300046690 Bacteria 3444
774 Ga0495624_0087499 3300046690 Bacteria 1924
775 Ga0495589_0008261 3300046794 Bacteria 5436
776 Ga0495581_0000542 3300047315 Bacteria 19446
777 Ga0495581_0002109 3300047315 Bacteria 11206
778 Ga0495581_0017160 3300047315 Bacteria 4207
779 Ga0495581_0037888 3300047315 Bacteria 2790
780 Ga0495581_0088403 3300047315 Unclassified 1796
781 Ga0495604_0000238 3300047317 Bacteria 49191
782 Ga0495604_0060369 3300047317 Bacteria 2904
783 Ga0495604_0089930 3300047317 Bacteria 2281
784 Ga0495604_0098303 3300047317 Bacteria 2157
785 Ga0495674_0000010 3300047319 Bacteria 285794
786 Ga0495674_0004125 3300047319 Bacteria 14022
787 Ga0495674_0128255 3300047319 Bacteria 2138
788 Ga0495674_0161788 3300047319 Bacteria 1872
789 Ga0495674_0192849 3300047319 Bacteria 1692
790 Ga0495674_0224870 3300047319 Bacteria 1550
791 Ga0495676_0000583 3300047321 Bacteria 30065
792 Ga0495676_0006975 3300047321 Bacteria 10367
793 Ga0495676_0037005 3300047321 Bacteria 4068
794 Ga0495676_0039278 3300047321 Bacteria 3922
795 Ga0495676_0138506 3300047321 Bacteria 1746
796 Ga0495676_0243398 3300047321 Unclassified 1230
797 Ga0495680_0008735 3300047322 Bacteria 9180
798 Ga0495680_0009703 3300047322 Bacteria 8640
799 Ga0495680_0013633 3300047322 Bacteria 7081
800 Ga0495680_0015897 3300047322 Bacteria 6478
801 Ga0495680_0036403 3300047322 Bacteria 3951
802 Ga0495680_0045794 3300047322 Bacteria 3452
803 Ga0495680_0071934 3300047322 Bacteria 2631
804 Ga0495675_0000262 3300047444 Bacteria 38243
805 Ga0495675_0040368 3300047444 Bacteria 2974
806 Ga0495675_0059149 3300047444 Bacteria 2430
807 Ga0495685_006549 3300047447 Bacteria 3819
808 Ga0495684_0025947 3300047471 Bacteria 4503
809 Ga0495684_0049834 3300047471 Bacteria 3199
810 Ga0495684_0104422 3300047471 Bacteria 2141
811 Ga0495684_0136233 3300047471 Unclassified 1842
812 Ga0495684_0140403 3300047471 Bacteria 1811
813 Ga0495593_0003361 3300047673 Bacteria 9583
814 Ga0495593_0034402 3300047673 Bacteria 2756
815 Ga0495602_0010209 3300048088 Bacteria 9746
816 Ga0495602_0011469 3300048088 Bacteria 9161
817 Ga0495602_0113494 3300048088 Bacteria 2196
818 Ga0495614_0010208 3300048089 Bacteria 4142
819 Ga0495614_0025966 3300048089 Bacteria 2524
820 Ga0496100_0106876 3300048903 Bacteria 1938
821 Ga0496100_0194447 3300048903 Bacteria 1475
822 Ga0496100_0266603 3300048903 Bacteria 1272
823 Ga0496101_0026233 3300048904 Bacteria 4050
824 Ga0496101_0028279 3300048904 Bacteria 3913
825 Ga0496101_0065408 3300048904 Bacteria 2650
826 Ga0496101_0091491 3300048904 Bacteria 2264
827 Ga0496101_0119174 3300048904 Bacteria 1994
828 Ga0496101_0153046 3300048904 Bacteria 1765
829 Ga0496101_0163244 3300048904 Bacteria 1710
830 Ga0496102_0005140 3300048905 Bacteria 11098
831 Ga0496102_0023351 3300048905 Bacteria 5492
832 Ga0496102_0070584 3300048905 Bacteria 3207
833 Ga0496103_0009187 3300048906 Bacteria 5854
834 Ga0496103_0031627 3300048906 Bacteria 3226
835 Ga0496103_0041804 3300048906 Bacteria 2819
836 Ga0496103_0087976 3300048906 Bacteria 1959
837 Ga0496104_0000015 3300048907 Bacteria 374530
838 Ga0496104_0000133 3300048907 Bacteria 69099
839 Ga0496104_0000699 3300048907 Bacteria 28859
840 Ga0496104_0001337 3300048907 Bacteria 21325
841 Ga0496104_0003803 3300048907 Bacteria 13056
842 Ga0496104_0004726 3300048907 Bacteria 11856
843 Ga0496104_0005710 3300048907 Bacteria 10887
844 Ga0496104_0012539 3300048907 Bacteria 7625
845 Ga0496104_0018592 3300048907 Bacteria 6342
846 Ga0496104_0058648 3300048907 Bacteria 3644
847 Ga0496104_0062778 3300048907 Bacteria 3523
848 Ga0496104_0093560 3300048907 Bacteria 2875
849 Ga0496105_0000004 3300048908 Bacteria 475798
850 Ga0496105_0000148 3300048908 Bacteria 46239
851 Ga0496105_0000595 3300048908 Bacteria 24079
852 Ga0496105_0003041 3300048908 Bacteria 12333
853 Ga0496105_0005142 3300048908 Bacteria 9921
854 Ga0496105_0020909 3300048908 Bacteria 5292
855 Ga0496105_0027281 3300048908 Bacteria 4663
856 Ga0496105_0031958 3300048908 Bacteria 4316
857 Ga0496105_0084535 3300048908 Bacteria 2621
858 Ga0496106_0006351 3300048909 Bacteria 8756
859 Ga0496106_0016234 3300048909 Bacteria 5508
860 Ga0496106_0026150 3300048909 Bacteria 4343
861 Ga0496106_0070837 3300048909 Bacteria 2663
862 Ga0496106_0113253 3300048909 Bacteria 2114
863 Ga0496106_0160270 3300048909 Bacteria 1779
864 Ga0496107_0004496 3300048910 Bacteria 9458
865 Ga0496107_0017662 3300048910 Bacteria 5018
866 Ga0496107_0059618 3300048910 Bacteria 2762
867 Ga0496107_0066587 3300048910 Bacteria 2612
868 Ga0496108_0000272 3300048911 Bacteria 44414
869 Ga0496108_0012780 3300048911 Bacteria 6836
870 Ga0496108_0037741 3300048911 Bacteria 4025
871 Ga0496108_0067233 3300048911 Bacteria 3022
872 Ga0496108_0096255 3300048911 Bacteria 2521
873 Ga0496108_0104882 3300048911 Bacteria 2413
874 Ga0496108_0121102 3300048911 Bacteria 2244
875 Ga0496109_0000578 3300048912 Bacteria 30715
876 Ga0496109_0000993 3300048912 Bacteria 23393
877 Ga0496109_0001933 3300048912 Bacteria 17222
878 Ga0496109_0022810 3300048912 Bacteria 5546
879 Ga0496109_0024331 3300048912 Bacteria 5383
880 Ga0496109_0039781 3300048912 Bacteria 4257
881 Ga0496109_0057043 3300048912 Bacteria 3563
882 Ga0496109_0093185 3300048912 Bacteria 2787
883 Ga0496109_0198673 3300048912 Bacteria 1885
884 Ga0496109_0346906 3300048912 Unclassified 1402
885 Ga0496110_0000746 3300048913 Bacteria 22474
886 Ga0496110_0002158 3300048913 Bacteria 14684
887 Ga0496110_0011829 3300048913 Bacteria 7165
888 Ga0496110_0056199 3300048913 Bacteria 3463
889 Ga0496110_0076452 3300048913 Bacteria 2977
890 Ga0496110_0111152 3300048913 Bacteria 2463
891 Ga0496110_0174667 3300048913 Unclassified 1950
892 Ga0496110_0211495 3300048913 Unclassified 1763
893 Ga0496110_0392667 3300048913 Bacteria 1265
894 Ga0496111_0000499 3300048914 Bacteria 20270
895 Ga0496111_0016234 3300048914 Bacteria 5130
896 Ga0496111_0027056 3300048914 Bacteria 4054
897 Ga0496111_0033102 3300048914 Bacteria 3686
898 Ga0496111_0058869 3300048914 Bacteria 2782
899 Ga0496111_0062583 3300048914 Bacteria 2699
900 Ga0496111_0161895 3300048914 Bacteria 1662
901 Ga0496112_0001182 3300048915 Bacteria 19571
902 Ga0496112_0020408 3300048915 Bacteria 6281
903 Ga0496112_0021074 3300048915 Bacteria 6191
904 Ga0496112_0028772 3300048915 Bacteria 5368
905 Ga0496112_0060665 3300048915 Bacteria 3727
906 Ga0496112_0096105 3300048915 Bacteria 2933
907 Ga0496112_0137566 3300048915 Bacteria 2412
908 Ga0496112_0161566 3300048915 Bacteria 2207
909 Ga0496112_0264118 3300048915 Bacteria 1670
910 Ga0496112_0488156 3300048915 Bacteria 1168
911 Ga0496113_0000040 3300048916 Bacteria 55517
912 Ga0496113_0004976 3300048916 Bacteria 8237
913 Ga0496113_0029360 3300048916 Bacteria 3970
914 Ga0496113_0037313 3300048916 Bacteria 3565
915 Ga0496113_0047236 3300048916 Bacteria 3199
916 Ga0496113_0118181 3300048916 Bacteria 2070
917 Ga0496113_0178938 3300048916 Bacteria 1681
918 Ga0496113_0219786 3300048916 Bacteria 1514
919 Ga0496114_0003196 3300048917 Bacteria 12564
920 Ga0496114_0003379 3300048917 Bacteria 12253
921 Ga0496114_0030568 3300048917 Bacteria 4432
922 Ga0496114_0039640 3300048917 Bacteria 3898
923 Ga0496114_0071680 3300048917 Bacteria 2912
924 Ga0496114_0072002 3300048917 Bacteria 2906
925 Ga0496114_0132058 3300048917 Bacteria 2157
926 Ga0496114_0174442 3300048917 Unclassified 1875
927 Ga0496114_0251776 3300048917 Unclassified 1554
928 Ga0496115_0017242 3300048918 Bacteria 5514
929 Ga0496115_0057656 3300048918 Bacteria 3124
930 Ga0496115_0069990 3300048918 Bacteria 2843
931 Ga0496115_0070347 3300048918 Bacteria 2836
932 Ga0496115_0183991 3300048918 Bacteria 1726
933 Ga0496119_0019718 3300048922 Bacteria 4950
934 Ga0501031_0027314 3300049568 Bacteria 3721
935 Ga0501039_0016924 3300049575 Bacteria 5588
936 Ga0501040_0022023 3300049576 Bacteria 4262
937 Ga0501040_0155730 3300049576 Bacteria 1613
938 Ga0501041_0164474 3300049577 Bacteria 1387
939 Ga0501043_0009300 3300049579 Bacteria 7720
940 Ga0501046_0110657 3300049580 Bacteria 2098
941 Ga0501067_0003396 3300049583 Bacteria 8761
942 Ga0501067_0016859 3300049583 Bacteria 4034
943 Ga0501067_0087822 3300049583 Bacteria 1725
944 Ga0501067_0096979 3300049583 Unclassified 1637
945 Ga0501068_0001181 3300049584 Bacteria 13899
946 Ga0501069_0002399 3300049585 Bacteria 9513
947 Ga0501069_0016467 3300049585 Bacteria 3973
948 Ga0501069_0016640 3300049585 Bacteria 3952
949 Ga0501069_0022584 3300049585 Bacteria 3424
950 Ga0501069_0027636 3300049585 Bacteria 3109
951 Ga0501070_0008509 3300049586 Bacteria 8672
952 Ga0501070_0010395 3300049586 Bacteria 7867
953 Ga0501070_0014204 3300049586 Bacteria 6700
954 Ga0501070_0089951 3300049586 Bacteria 2541
955 Ga0501071_0018729 3300049587 Bacteria 4800
956 Ga0501071_0127219 3300049587 Bacteria 1891
957 Ga0501072_0083731 3300049588 Bacteria 2528
958 Ga0501072_0150155 3300049588 Bacteria 1858
959 Ga0501074_0017874 3300049590 Bacteria 5152
960 Ga0501076_0011754 3300049592 Bacteria 6535
961 Ga0501077_0043666 3300049593 Bacteria 2848
962 Ga0501079_0021128 3300049741 Bacteria 4976
963 Ga0501081_0004576 3300049743 Bacteria 8880
964 Ga0501083_0025552 3300049744 Bacteria 4089
965 Ga0501045_0010111 3300049824 Bacteria 6603
966 Ga0501045_0093128 3300049824 Bacteria 2228
967 nmdc:mga05p37_148675_c1 3300050507 Bacteria 2867
968 nmdc:mga05p37_1648_c1 3300050507 Bacteria 25906
969 nmdc:mga05p37_4144_c2 3300050507 Bacteria 16203
970 nmdc:mga05p37_45059_c1 3300050507 Bacteria 5426
971 nmdc:mga05p37_53795_c1 3300050507 Bacteria 4952
972 nmdc:mga09592_135586_c1 3300050508 Bacteria 2120
973 nmdc:mga09592_195461_c1 3300050508 Bacteria 1751
974 nmdc:mga0qj67_65425_c1 3300050509 Bacteria 2894
975 nmdc:mga06r32_11086_c1 3300050510 Bacteria 8114
976 nmdc:mga08y16_141052_c1 3300050511 Unclassified 2505
977 nmdc:mga08y16_19969_c1 3300050511 Bacteria 7070
978 nmdc:mga08y16_284641_c1 3300050511 Bacteria 1705
979 nmdc:mga0n895_13560_c1 3300050512 Bacteria 7362
980 nmdc:mga0n895_144310_c1 3300050512 Bacteria 2410
981 nmdc:mga0n895_217996_c1 3300050512 Bacteria 1938
982 nmdc:mga0n895_29458_c1 3300050512 Bacteria 5237
983 nmdc:mga0rr50_12711_c1 3300050513 Bacteria 5453
984 nmdc:mga0rr50_13489_c1 3300050513 Bacteria 5322
985 nmdc:mga0rr50_38904_c1 3300050513 Bacteria 3446
986 nmdc:mga0rr50_55552_c1 3300050513 Bacteria 2955
987 nmdc:mga0rr50_78467_c1 3300050513 Bacteria 2541
988 nmdc:mga08x19_2647_c1 3300050514 Bacteria 10831
989 nmdc:mga0a205_120264_c1 3300050515 Bacteria 2526
990 nmdc:mga0a205_247804_c1 3300050515 Bacteria 1661
991 nmdc:mga0a205_252300_c1 3300050515 Bacteria 1643
992 nmdc:mga0a205_55410_c1 3300050515 Bacteria 3830
993 nmdc:mga0a205_68871_c1 3300050515 Bacteria 3418
994 nmdc:mga0a205_89899_c1 3300050515 Bacteria 2968
995 nmdc:mga0a205_9936_c1 3300050515 Bacteria 8729
996 Ga0495601_0007612 3300053077 Bacteria 6360
997 Ga0495601_0007870 3300053077 Bacteria 6276
998 Ga0495601_0039693 3300053077 Bacteria 2948
999 Ga0495601_0041154 3300053077 Bacteria 2896
1000 Ga0495601_0108271 3300053077 Bacteria 1798
1001 Ga0495601_0140940 3300053077 Bacteria 1572
1002 Ga0495612_0012979 3300053078 Bacteria 3356
1003 Ga0495612_0021217 3300053078 Unclassified 2606
1004 Ga0495612_0021410 3300053078 Bacteria 2594
1005 Ga0495595_0004929 3300053084 Bacteria 5384
1006 Ga0495595_0022765 3300053084 Bacteria 2753
1007 Ga0495595_0026387 3300053084 Bacteria 2581
1008 Ga0495619_0000507 3300053085 Bacteria 25923
1009 Ga0495619_0001017 3300053085 Bacteria 18372
1010 Ga0495619_0002571 3300053085 Bacteria 11864
1011 Ga0495619_0007865 3300053085 Bacteria 6745
1012 Ga0495619_0012980 3300053085 Bacteria 5249
1013 Ga0495619_0034749 3300053085 Bacteria 3277
1014 Ga0500566_0045228 3300053094 Bacteria 2535
1015 Ga0501084_0151623 3300054114 Unclassified 1954
1016 Ga0501084_0222004 3300054114 Bacteria 1594
1017 Ga0466962_0004473 3300061719 Bacteria 6699
1018 Ga0466962_0021951 3300061719 Bacteria 3065
1019 Ga0530510_0030809 3300061734 Bacteria 3854
1020 Ga0530510_0113514 3300061734 Bacteria 1986
1021 Ga0395900_0000838
1022 JGI24740J21852_10001919
1023 Ga0070658_10001917
1024 Ga0070658_10009008
1025 Ga0070658_10010832
1026 Ga0070683_100122099
1027 Ga0070683_100166019
1028 Ga0070690_100021377
1029 Ga0068869_100102301
1030 Ga0070680_100079285
1031 Ga0070680_100115905
1032 Ga0070680_100212999
1033 Ga0070682_100013796
1034 Ga0070682_100015285
1035 Ga0070682_100024483
1036 Ga0070682_100029174
1037 Ga0070682_100036730
1038 Ga0068868_100034278
1039 Ga0068868_100238440
1040 Ga0070660_100005923
1041 Ga0070660_100060376
1042 Ga0070660_100177538
1043 Ga0070689_100045899
1044 Ga0070691_10015848
1045 Ga0070691_10051621
1046 Ga0070661_100005675
1047 Ga0070668_100054366
1048 Ga0070668_100088205
1049 Ga0070669_100258523
1050 Ga0070688_100015520
1051 Ga0070659_100050496
1052 Ga0070659_100071877
1053 Ga0070659_100165228
1054 Ga0070667_100009302
1055 Ga0070667_100178778
1056 Ga0070709_10095217
1057 Ga0070714_100029254
1058 Ga0070714_100030412
1059 Ga0070714_100058112
1060 Ga0070714_100067633
1061 Ga0070714_100099389
1062 Ga0070714_100244341
1063 Ga0070713_100043207
1064 Ga0070713_100058191
1065 Ga0070713_100089869
1066 Ga0070713_100224591
1067 Ga0070710_10012734
1068 Ga0070701_10001955
1069 Ga0070711_100005352
1070 Ga0070711_100041981
1071 Ga0070711_100051343
1072 Ga0070705_100016734
1073 Ga0070705_100052306
1074 Ga0070705_100081776
1075 Ga0070705_100083922
1076 Ga0070705_100161429
1077 Ga0070700_100003711
1078 Ga0070700_100060336
1079 Ga0070700_100070126
1080 Ga0070694_100040078
1081 Ga0070694_100075706
1082 Ga0070708_100030358
1083 Ga0070708_100073080
1084 Ga0070678_100027211
1085 Ga0070678_100083046
1086 Ga0070678_100237318
1087 Ga0070678_100240063
1088 Ga0070662_100056188
1089 Ga0070681_10019656
1090 Ga0070681_10027044
1091 Ga0070681_10042356
1092 Ga0070681_10045320
1093 Ga0070681_10071810
1094 Ga0070681_10103021
1095 Ga0070681_10150198
1096 Ga0070681_10174749
1097 Ga0070681_10212509
1098 Ga0070681_10321332
1099 Ga0068867_100028094
1100 Ga0070706_100036466
1101 Ga0070706_100122830
1102 Ga0070706_100124960
1103 Ga0070706_100361788
1104 Ga0070707_100000736
1105 Ga0070707_100001917
1106 Ga0070707_100108476
1107 Ga0070707_100227414
1108 Ga0070707_100346107
1109 Ga0070698_100017893
1110 Ga0070698_100053947
1111 Ga0070698_100062959
1112 Ga0070698_100151900
1113 Ga0070698_100163311
1114 Ga0070698_100192258
1115 Ga0070699_100005711
1116 Ga0070699_100012784
1117 Ga0070699_100192617
1118 Ga0070679_100013238
1119 Ga0070679_100046291
1120 Ga0070679_100064484
1121 Ga0070679_100093351
1122 Ga0070679_100130555
1123 Ga0070679_100159956
1124 Ga0070684_100000304
1125 Ga0070684_100005611
1126 Ga0070684_100013149
1127 Ga0070684_100033850
1128 Ga0070684_100048627
1129 Ga0070697_100185522
1130 Ga0068853_100022302
1131 Ga0070686_100029186
1132 Ga0070695_100019884
1133 Ga0070696_100042589
1134 Ga0070696_100094204
1135 Ga0070696_100232270
1136 Ga0070693_100015911
1137 Ga0070693_100039488
1138 Ga0070665_100017345
1139 Ga0070665_100062268
1140 Ga0070704_100132297
1141 Ga0070704_100174758
1142 Ga0068855_100015558
1143 Ga0068855_100061321
1144 Ga0068855_100065248
1145 Ga0068855_100083393
1146 Ga0068855_100117266
1147 Ga0070664_100034719
1148 Ga0070664_100143570
1149 Ga0070664_100180277
1150 Ga0070664_100239925
1151 Ga0070664_100261620
1152 Ga0068857_100006535
1153 Ga0068857_100095260
1154 Ga0068856_100063236
1155 Ga0068856_100076900
1156 Ga0068856_100102573
1157 Ga0068856_100196648
1158 Ga0068856_100200382
1159 Ga0068856_100235155
1160 Ga0070702_100004559
1161 Ga0070702_100074984
1162 Ga0068852_100035447
1163 Ga0068864_100303951
1164 Ga0068864_100339051
1165 Ga0068866_10001213
1166 Ga0068861_100007901
1167 Ga0068861_100107071
1168 Ga0068861_100110309
1169 Ga0068863_100464763
1170 Ga0068862_100001367
1171 Ga0068862_100140681
1172 Ga0068862_100201484
1173 Ga0081455_10005820
1174 Ga0081455_10014238
1175 Ga0081455_10014350
1176 Ga0081455_10035655
1177 Ga0081538_10053605
1178 Ga0081540_1003071
1179 Ga0081540_1015602
1180 Ga0081539_10006606
1181 Ga0070717_10037914
1182 Ga0070717_10101499
1183 Ga0070717_10115892
1184 Ga0070717_10301524
1185 Ga0075365_10019759
1186 Ga0070715_10020079
1187 Ga0070715_10052854
1188 Ga0070712_100039286
1189 Ga0070712_100090282
1190 Ga0070712_100268046
1191 Ga0068871_100035915
1192 Ga0068871_100129862
1193 Ga0068871_100182559
1194 Ga0075428_100000381
1195 Ga0075431_100023773
1196 Ga0075431_100188313
1197 Ga0075433_10069829
1198 Ga0075433_10168459
1199 Ga0075433_10322230
1200 Ga0075434_100001557
1201 Ga0075434_100010132
1202 Ga0075434_100075961
1203 Ga0075434_100175550
1204 Ga0075434_100181318
1205 Ga0075429_100216747
1206 Ga0068865_100007982
1207 Ga0075436_100003007
1208 Ga0075436_100003937
1209 Ga0075436_100022390
1210 Ga0075436_100050943
1211 Ga0075435_100012038
1212 Ga0075435_100017412
1213 Ga0075435_100021362
1214 Ga0075435_100064189
1215 Ga0075435_100180082
1216 Ga0105240_10092787
1217 Ga0105240_10175155
1218 Ga0111539_10012314
1219 Ga0111539_10051846
1220 Ga0111539_10056650
1221 Ga0111539_10252067
1222 Ga0105245_10003086
1223 Ga0105245_10046270
1224 Ga0105245_10073970
1225 Ga0105245_10326822
1226 Ga0105247_10002698
1227 Ga0105247_10014196
1228 Ga0114129_10001661
1229 Ga0114129_10005673
1230 Ga0114129_10012739
1231 Ga0114129_10117688
1232 Ga0114129_10134627
1233 Ga0114129_10153050
1234 Ga0114129_10181523
1235 Ga0114129_10569990
1236 Ga0105243_10017876
1237 Ga0105243_10040745
1238 Ga0105243_10127544
1239 Ga0105243_10183473
1240 Ga0105243_10225101
1241 Ga0105241_10039315
1242 Ga0105242_10006738
1243 Ga0105242_10059277
1244 Ga0105248_10386638
1245 Ga0105237_10250757
1246 Ga0105238_10150945
1247 Ga0105238_10181417
1248 Ga0105238_10216597
1249 Ga0105249_10034961
1250 Ga0105239_10041625
1251 Ga0105239_10279800
1252 Ga0105246_10039168
1253 Ga0105246_10196366
1254 Ga0157373_10145747
1255 Ga0157371_10162431
1256 Ga0157370_10027005
1257 Ga0157370_10116274
1258 Ga0157369_10002618
1259 Ga0157369_10039852
1260 Ga0157369_10051221
1261 Ga0157369_10101401
1262 Ga0157369_10131514
1263 Ga0157374_10108469
1264 Ga0157378_10044141
1265 Ga0157378_10108371
1266 Ga0157378_10200593
1267 Ga0163162_10026922
1268 Ga0163162_10056437
1269 Ga0163162_10154367
1270 Ga0157372_10481927
1271 Ga0157375_10036207
1272 Ga0157375_10047453
1273 Ga0157380_10006605
1274 Ga0157380_10010760
1275 Ga0182008_10005743
1276 Ga0182008_10041945
1277 Ga0182008_10053067
1278 Ga0157377_10073642
1279 Ga0157379_10258274
1280 Ga0157376_10062443
1281 Ga0157376_10125268
1282 Ga0163161_10166119
1283 Ga0206356_10687371
1284 Ga0206356_11158095
1285 Ga0206356_11233245
1286 Ga0206356_11875873
1287 Ga0206354_10192413
1288 Ga0206354_10778318
1289 Ga0206354_10900364
1290 Ga0206353_10422956
1291 Ga0206353_11663111
1292 Ga0206353_11831078
1293 Ga0213871_10006336
1294 Ga0207692_10074254
1295 Ga0207642_10014554
1296 Ga0207710_10000179
1297 Ga0207688_10151160
1298 Ga0207647_10154597
1299 Ga0207699_10081352
1300 Ga0207645_10057178
1301 Ga0207705_10026437
1302 Ga0207705_10038063
1303 Ga0207705_10063948
1304 Ga0207684_10056353
1305 Ga0207684_10080852
1306 Ga0207684_10165453
1307 Ga0207684_10312577
1308 Ga0207684_10348716
1309 Ga0207654_10188351
1310 Ga0207707_10017134
1311 Ga0207707_10106547
1312 Ga0207707_10108903
1313 Ga0207707_10143050
1314 Ga0207693_10000319
1315 Ga0207693_10000945
1316 Ga0207693_10004123
1317 Ga0207693_10033836
1318 Ga0207693_10038611
1319 Ga0207693_10047648
1320 Ga0207693_10112782
1321 Ga0207693_10126291
1322 Ga0207693_10307813
1323 Ga0207663_10004268
1324 Ga0207663_10010470
1325 Ga0207663_10190443
1326 Ga0207660_10031455
1327 Ga0207660_10176254
1328 Ga0207662_10054435
1329 Ga0207657_10003731
1330 Ga0207657_10005756
1331 Ga0207657_10027056
1332 Ga0207657_10029230
1333 Ga0207657_10042806
1334 Ga0207649_10033516
1335 Ga0207652_10008054
1336 Ga0207652_10048618
1337 Ga0207652_10065363
1338 Ga0207652_10105455
1339 Ga0207652_10231005
1340 Ga0207646_10002421
1341 Ga0207646_10022827
1342 Ga0207694_10064076
1343 Ga0207659_10284173
1344 Ga0207687_10003599
1345 Ga0207687_10024282
1346 Ga0207687_10042776
1347 Ga0207687_10049497
1348 Ga0207687_10066707
1349 Ga0207687_10116444
1350 Ga0207687_10166619
1351 Ga0207687_10206638
1352 Ga0207700_10062381
1353 Ga0207700_10064336
1354 Ga0207700_10169436
1355 Ga0207664_10008572
1356 Ga0207664_10060285
1357 Ga0207664_10073207
1358 Ga0207664_10083264
1359 Ga0207664_10091349
1360 Ga0207664_10247239
1361 Ga0207664_10394379
1362 Ga0207690_10142744
1363 Ga0207706_10003832
1364 Ga0207706_10029343
1365 Ga0207706_10045280
1366 Ga0207706_10073803
1367 Ga0207686_10002316
1368 Ga0207709_10003771
1369 Ga0207709_10010998
1370 Ga0207709_10056466
1371 Ga0207670_10014593
1372 Ga0207704_10118584
1373 Ga0207665_10002255
1374 Ga0207665_10007220
1375 Ga0207665_10008529
1376 Ga0207665_10073671
1377 Ga0207691_10009218
1378 Ga0207691_10195473
1379 Ga0207711_10028596
1380 Ga0207661_10003070
1381 Ga0207661_10101276
1382 Ga0207661_10125684
1383 Ga0207679_10138480
1384 Ga0207679_10140877
1385 Ga0207667_10083906
1386 Ga0207667_10288750
1387 Ga0207651_10187263
1388 Ga0207712_10024209
1389 Ga0207668_10039579
1390 Ga0207668_10101007
1391 Ga0207668_10179823
1392 Ga0207658_10045246
1393 Ga0207708_10008089
1394 Ga0207708_10048525
1395 Ga0207708_10143876
1396 Ga0207702_10019118
1397 Ga0207702_10055641
1398 Ga0207702_10075448
1399 Ga0207702_10096587
1400 Ga0207702_10105669
1401 Ga0207702_10224622
1402 Ga0207641_10292795
1403 Ga0207648_10002132
1404 Ga0207648_10011231
1405 Ga0207676_10045001
1406 Ga0207674_10011029
1407 Ga0207674_10026840
1408 Ga0207675_100005440
1409 Ga0207675_100008915
1410 Ga0207675_100052680
1411 Ga0207675_100092869
1412 Ga0207675_100147604
1413 Ga0207683_10002939
1414 Ga0207683_10012321
1415 Ga0207683_10027994
1416 Ga0207683_10028451
1417 Ga0207683_10029373
1418 Ga0207683_10032077
1419 Ga0207683_10085471
1420 Ga0207683_10137693
1421 Ga0207698_10066827
1422 Ga0207698_10083164
1423 Ga0207428_10005252
1424 Ga0207428_10008826
1425 Ga0207428_10030367
1426 Ga0268265_10003678
1427 Ga0268265_10311239
1428 Ga0268264_10284109
1429 Ga0265337_1025219
1430 Ga0265326_10011074
1431 Ga0265319_1000592
1432 Ga0265319_1005217
1433 Ga0265318_10000219
1434 Ga0265318_10005482
1435 Ga0265318_10043101
1436 Ga0265322_10016444
1437 Ga0265338_10003307
1438 Ga0265338_10007029
1439 Ga0265338_10016091
1440 Ga0265338_10034817
1441 Ga0265338_10175213
1442 Ga0265330_10000479
1443 Ga0265328_10000790
1444 Ga0265320_10051332
1445 Ga0265320_10058686
1446 Ga0265325_10000443
1447 Ga0265329_10000472
1448 Ga0265340_10068279
1449 Ga0265339_10101055
1450 Ga0265331_10020343
1451 Ga0265327_10009052
1452 Ga0265316_10004053
1453 Ga0265316_10012119
1454 Ga0307408_100171924
1455 Ga0265313_10006992
1456 Ga0265314_10003422
1457 Ga0265314_10031419
1458 Ga0265342_10045680
1459 Ga0265342_10097936
1460 Ga0307406_10230486
1461 Ga0307409_100293301
1462 Ga0307416_100106261
1463 Ga0373938_0010324
1464 Ga0373952_0015557
1465 Ga0373939_0027186
1466 Ga0373941_0006820
1467 Ga0373941_0011420
1468 Ga0373945_0003511
1469 Ga0373960_0018728
1470 Ga0373943_0005293
1471 Ga0373943_0011525
1472 Ga0373943_0034514
1473 Ga0373943_0065060
1474 Ga0373946_0014769
1475 Ga0373955_0024397
1476 Ga0373961_0011677
1477 Ga0373962_0003254
1478 Ga0373931_0006393
1479 Ga0373935_0072020
1480 Ga0373927_0045554
1481 Ga0373927_0158836
1482 Ga0373947_0000237
1483 Ga0373937_0000548
1484 Ga0373937_0025305
1485 Ga0373937_0338739
1486 Ga0373925_0002356
1487 Ga0373925_0055357
1488 Ga0373925_0093770
1489 Ga0373925_0107961
1490 Ga0395899_0010815
1491 Ga0395899_0012610
1492 Ga0395899_0016341
1493 Ga0395899_0026219
1494 Ga0395899_0030436
1495 Ga0395899_0046995
1496 Ga0395899_0058758
1497 Ga0395899_0073691
1498 Ga0395899_0075024
1499 Ga0395899_0076944
1500 Ga0395899_0114276
1501 Ga0395899_0123955
1502 Ga0395900_0003636
1503 Ga0395900_0003913
1504 Ga0395900_0006681
1505 Ga0395900_0008263
1506 Ga0395900_0013052
1507 Ga0395900_0050121
1508 Ga0395900_0070002
1509 Ga0395900_0093511
1510 Ga0395900_0106472
1511 Ga0395900_0112371
1512 Ga0395900_0143369
1513 Ga0395900_0196645
1514 Ga0395900_0227670
1515 Ga0395900_0248532
1516 Ga0395898_0001212
1517 Ga0395898_0003410
1518 Ga0395898_0007007
1519 Ga0395898_0007049
1520 Ga0395898_0007790
1521 Ga0395898_0011394
1522 Ga0395898_0015434
1523 Ga0395898_0024102
1524 Ga0395898_0031435
1525 Ga0395898_0033701
1526 Ga0395898_0039393
1527 Ga0395898_0057873
1528 Ga0395898_0058510
1529 Ga0395898_0097804
1530 Ga0395898_0116142
1531 Ga0395898_0127735
1532 Ga0395898_0157977
1533 Ga0395898_0171389
1534 Ga0395898_0346758
1535 Ga0395898_0481221
1536 Ga0395898_0600040
1537 Ga0395905_0001601
1538 Ga0395905_0001928
1539 Ga0395905_0004549
1540 Ga0395905_0010973
1541 Ga0395905_0011189
1542 Ga0395905_0012746
1543 Ga0395905_0019921
1544 Ga0395905_0026059
1545 Ga0395905_0105086
1546 Ga0395905_0122043
1547 Ga0395905_0126128
1548 Ga0395901_0000858
1549 Ga0395901_0001826
1550 Ga0395901_0003205
1551 Ga0395901_0003231
1552 Ga0395901_0003420
1553 Ga0395901_0006476
1554 Ga0395901_0010878
1555 Ga0395901_0013196
1556 Ga0395901_0024220
1557 Ga0395901_0033692
1558 Ga0395901_0037382
1559 Ga0395901_0041928
1560 Ga0395901_0055287
1561 Ga0395901_0064877
1562 Ga0395901_0076162
1563 Ga0395901_0080971
1564 Ga0395901_0117180
1565 Ga0395901_0138446
1566 Ga0395901_0146551
1567 Ga0395901_0157899
1568 Ga0395901_0161945
1569 Ga0395901_0241094
1570 Ga0395901_0244308
1571 Ga0395901_0306200
1572 Ga0395901_0320598
1573 Ga0436365_1070781
1574 Ga0436360_0887170
1575 Ga0451789_0528223
1576 Ga0451789_0919425
1577 Ga0451800_1267821
1578 Ga0451835_0383021
1579 Ga0451839_0194646
1580 Ga0451849_0045844
1581 Ga0451851_0849119
1582 Ga0451853_3599974
1583 Ga0439464_0036941
1584 Ga0466965_0004578
1585 Ga0466965_0085556
1586 Ga0466966_0020499
1587 Ga0466966_0038817
1588 Ga0466961_0002675
1589 Ga0466961_0004260
1590 Ga0466961_0083012
1591 Ga0466961_0099484
1592 Ga0466963_0000261
1593 Ga0466963_0000768
1594 Ga0466963_0002376
1595 Ga0466963_0002868
1596 Ga0466963_0004245
1597 Ga0466963_0011880
1598 Ga0466963_0024908
1599 Ga0466963_0035060
1600 Ga0466963_0044167
1601 Ga0466963_0076363
1602 Ga0466963_0081131
1603 Ga0466963_0083860
1604 Ga0466964_0000352
1605 Ga0466964_0004673
1606 Ga0466964_0008804
1607 Ga0466964_0017735
1608 Ga0466964_0026000
1609 Ga0466964_0030830
1610 Ga0466964_0063959
1611 Ga0466968_0003161
1612 Ga0466968_0008909
1613 Ga0466968_0031417
1614 Ga0466968_0041575
1615 Ga0466970_0014312
1616 Ga0466970_0160736
1617 Ga0466957_0006127
1618 Ga0466957_0030739
1619 Ga0466960_0003012
1620 Ga0466959_0025227
1621 Ga0466959_0025914
1622 Ga0451576_0022984
1623 Ga0466958_0000988
1624 Ga0466958_0002635
1625 Ga0466958_0031646
1626 Ga0466958_0121919
1627 Ga0466967_0002587
1628 Ga0466967_0013294
1629 Ga0466967_0013473
1630 Ga0466967_0015101
1631 Ga0466967_0021409
1632 Ga0466967_0022717
1633 Ga0466967_0027600
1634 Ga0466967_0031057
1635 Ga0466967_0031978
1636 Ga0466967_0038321
1637 Ga0466967_0053417
1638 Ga0466967_0054362
1639 Ga0466967_0055137
1640 Ga0466967_0074837
1641 Ga0466967_0111660
1642 Ga0466967_0122613
1643 Ga0466967_0141492
1644 Ga0466967_0187418
1645 Ga0466967_0226508
1646 Ga0466967_0242022
1647 Ga0466967_0440315
1648 Ga0495592_0000100
1649 Ga0495592_0060169
1650 Ga0495603_0001231
1651 Ga0495603_0013603
1652 Ga0495603_0014127
1653 Ga0495603_0041622
1654 Ga0495603_0047923
1655 Ga0495603_0104510
1656 Ga0495629_0002746
1657 Ga0495629_0030475
1658 Ga0495641_0002482
1659 Ga0495641_0004633
1660 Ga0495641_0043455
1661 Ga0495641_0055610
1662 Ga0495641_0056804
1663 Ga0495641_0057609
1664 Ga0495641_0064745
1665 Ga0495651_0000008
1666 Ga0495651_0035623
1667 Ga0495651_0042861
1668 Ga0495651_0056623
1669 Ga0495653_0032335
1670 Ga0495653_0035380
1671 Ga0495653_0047434
1672 Ga0495653_0170490
1673 Ga0495582_0001422
1674 Ga0495582_0014295
1675 Ga0495582_0016729
1676 Ga0495582_0044924
1677 Ga0495582_0100123
1678 Ga0495582_0130800
1679 Ga0495582_0172744
1680 Ga0495605_0019449
1681 Ga0495605_0019926
1682 Ga0495639_0001181
1683 Ga0495639_0004850
1684 Ga0495639_0047663
1685 Ga0495639_0066254
1686 Ga0495662_0003046
1687 Ga0495662_0037839
1688 Ga0495664_0027095
1689 Ga0495584_0010544
1690 Ga0495584_0072938
1691 Ga0495585_0131686
1692 Ga0495594_0001036
1693 Ga0495596_0071510
1694 Ga0495596_0073991
1695 Ga0495607_0088451
1696 Ga0495608_0002626
1697 Ga0495608_0011259
1698 Ga0495608_0039772
1699 Ga0495608_0115164
1700 Ga0495618_0006703
1701 Ga0495618_0032144
1702 Ga0495618_0117810
1703 Ga0495628_0000105
1704 Ga0495628_0001154
1705 Ga0495628_0005946
1706 Ga0495628_0028966
1707 Ga0495628_0172847
1708 Ga0495630_0003323
1709 Ga0495630_0014105
1710 Ga0495630_0024498
1711 Ga0495630_0031468
1712 Ga0495630_0143569
1713 Ga0495630_0155911
1714 Ga0495631_0071338
1715 Ga0495644_0004305
1716 Ga0495644_0032726
1717 Ga0495663_0011150
1718 Ga0495666_0099635
1719 Ga0495652_0000588
1720 Ga0495652_0007715
1721 Ga0495652_0077392
1722 Ga0495652_0124915
1723 Ga0495652_0124966
1724 Ga0495665_0002651
1725 Ga0495665_0020951
1726 Ga0495665_0036519
1727 Ga0495640_0012819
1728 Ga0495640_0026363
1729 Ga0495586_0057494
1730 Ga0495586_0070615
1731 Ga0495587_0000048
1732 Ga0495587_0019872
1733 Ga0495609_0014755
1734 Ga0495609_0037234
1735 Ga0495609_0064070
1736 Ga0495645_0000029
1737 Ga0495645_0018139
1738 Ga0495645_0057702
1739 Ga0495667_0005882
1740 Ga0495667_0016319
1741 Ga0495667_0037446
1742 Ga0495667_0048893
1743 Ga0495667_0081797
1744 Ga0495656_0017608
1745 Ga0495656_0058104
1746 Ga0495656_0096626
1747 Ga0495656_0103930
1748 Ga0495656_0113038
1749 Ga0495634_0021634
1750 Ga0495634_0029224
1751 Ga0495634_0048784
1752 Ga0495634_0071929
1753 Ga0495611_0123291
1754 Ga0495635_0047792
1755 Ga0495635_0074004
1756 Ga0495635_0105734
1757 Ga0495635_0126439
1758 Ga0495659_0042609
1759 Ga0495588_0000812
1760 Ga0495588_0041339
1761 Ga0495588_0056635
1762 Ga0495588_0063506
1763 Ga0495588_0122311
1764 Ga0495657_0015166
1765 Ga0495657_0033676
1766 Ga0495657_0046320
1767 Ga0495657_0107380
1768 Ga0495599_0000110
1769 Ga0495599_0000519
1770 Ga0495599_0011820
1771 Ga0495599_0093113
1772 Ga0495599_0177620
1773 Ga0495623_0005997
1774 Ga0495623_0033141
1775 Ga0495646_0005674
1776 Ga0495646_0009733
1777 Ga0495646_0022232
1778 Ga0495646_0094316
1779 Ga0495647_0013829
1780 Ga0495647_0041893
1781 Ga0495658_0000794
1782 Ga0495658_0017927
1783 Ga0495658_0069108
1784 Ga0495658_0117328
1785 Ga0495669_0015201
1786 Ga0495613_0014803
1787 Ga0495613_0048055
1788 Ga0495613_0117332
1789 Ga0495613_0169103
1790 Ga0495624_0010504
1791 Ga0495624_0013790
1792 Ga0495624_0019028
1793 Ga0495624_0031523
1794 Ga0495624_0087499
1795 Ga0495589_0008261
1796 Ga0495581_0000542
1797 Ga0495581_0002109
1798 Ga0495581_0017160
1799 Ga0495581_0037888
1800 Ga0495581_0088403
1801 Ga0495604_0000238
1802 Ga0495604_0060369
1803 Ga0495604_0089930
1804 Ga0495604_0098303
1805 Ga0495674_0000010
1806 Ga0495674_0004125
1807 Ga0495674_0128255
1808 Ga0495674_0161788
1809 Ga0495674_0192849
1810 Ga0495674_0224870
1811 Ga0495676_0000583
1812 Ga0495676_0006975
1813 Ga0495676_0037005
1814 Ga0495676_0039278
1815 Ga0495676_0138506
1816 Ga0495676_0243398
1817 Ga0495680_0008735
1818 Ga0495680_0009703
1819 Ga0495680_0013633
1820 Ga0495680_0015897
1821 Ga0495680_0036403
1822 Ga0495680_0045794
1823 Ga0495680_0071934
1824 Ga0495675_0000262
1825 Ga0495675_0040368
1826 Ga0495675_0059149
1827 Ga0495685_006549
1828 Ga0495684_0025947
1829 Ga0495684_0049834
1830 Ga0495684_0104422
1831 Ga0495684_0136233
1832 Ga0495684_0140403
1833 Ga0495593_0003361
1834 Ga0495593_0034402
1835 Ga0495602_0010209
1836 Ga0495602_0011469
1837 Ga0495602_0113494
1838 Ga0495614_0010208
1839 Ga0495614_0025966
1840 Ga0496100_0106876
1841 Ga0496100_0194447
1842 Ga0496100_0266603
1843 Ga0496101_0026233
1844 Ga0496101_0028279
1845 Ga0496101_0065408
1846 Ga0496101_0091491
1847 Ga0496101_0119174
1848 Ga0496101_0153046
1849 Ga0496101_0163244
1850 Ga0496102_0005140
1851 Ga0496102_0023351
1852 Ga0496102_0070584
1853 Ga0496103_0009187
1854 Ga0496103_0031627
1855 Ga0496103_0041804
1856 Ga0496103_0087976
1857 Ga0496104_0000015
1858 Ga0496104_0000133
1859 Ga0496104_0000699
1860 Ga0496104_0001337
1861 Ga0496104_0003803
1862 Ga0496104_0004726
1863 Ga0496104_0005710
1864 Ga0496104_0012539
1865 Ga0496104_0018592
1866 Ga0496104_0058648
1867 Ga0496104_0062778
1868 Ga0496104_0093560
1869 Ga0496105_0000004
1870 Ga0496105_0000148
1871 Ga0496105_0000595
1872 Ga0496105_0003041
1873 Ga0496105_0005142
1874 Ga0496105_0020909
1875 Ga0496105_0027281
1876 Ga0496105_0031958
1877 Ga0496105_0084535
1878 Ga0496106_0006351
1879 Ga0496106_0016234
1880 Ga0496106_0026150
1881 Ga0496106_0070837
1882 Ga0496106_0113253
1883 Ga0496106_0160270
1884 Ga0496107_0004496
1885 Ga0496107_0017662
1886 Ga0496107_0059618
1887 Ga0496107_0066587
1888 Ga0496108_0000272
1889 Ga0496108_0012780
1890 Ga0496108_0037741
1891 Ga0496108_0067233
1892 Ga0496108_0096255
1893 Ga0496108_0104882
1894 Ga0496108_0121102
1895 Ga0496109_0000578
1896 Ga0496109_0000993
1897 Ga0496109_0001933
1898 Ga0496109_0022810
1899 Ga0496109_0024331
1900 Ga0496109_0039781
1901 Ga0496109_0057043
1902 Ga0496109_0093185
1903 Ga0496109_0198673
1904 Ga0496109_0346906
1905 Ga0496110_0000746
1906 Ga0496110_0002158
1907 Ga0496110_0011829
1908 Ga0496110_0056199
1909 Ga0496110_0076452
1910 Ga0496110_0111152
1911 Ga0496110_0174667
1912 Ga0496110_0211495
1913 Ga0496110_0392667
1914 Ga0496111_0000499
1915 Ga0496111_0016234
1916 Ga0496111_0027056
1917 Ga0496111_0033102
1918 Ga0496111_0058869
1919 Ga0496111_0062583
1920 Ga0496111_0161895
1921 Ga0496112_0001182
1922 Ga0496112_0020408
1923 Ga0496112_0021074
1924 Ga0496112_0028772
1925 Ga0496112_0060665
1926 Ga0496112_0096105
1927 Ga0496112_0137566
1928 Ga0496112_0161566
1929 Ga0496112_0264118
1930 Ga0496112_0488156
1931 Ga0496113_0000040
1932 Ga0496113_0004976
1933 Ga0496113_0029360
1934 Ga0496113_0037313
1935 Ga0496113_0047236
1936 Ga0496113_0118181
1937 Ga0496113_0178938
1938 Ga0496113_0219786
1939 Ga0496114_0003196
1940 Ga0496114_0003379
1941 Ga0496114_0030568
1942 Ga0496114_0039640
1943 Ga0496114_0071680
1944 Ga0496114_0072002
1945 Ga0496114_0132058
1946 Ga0496114_0174442
1947 Ga0496114_0251776
1948 Ga0496115_0017242
1949 Ga0496115_0057656
1950 Ga0496115_0069990
1951 Ga0496115_0070347
1952 Ga0496115_0183991
1953 Ga0496119_0019718
1954 Ga0501031_0027314
1955 Ga0501039_0016924
1956 Ga0501040_0022023
1957 Ga0501040_0155730
1958 Ga0501041_0164474
1959 Ga0501043_0009300
1960 Ga0501046_0110657
1961 Ga0501067_0003396
1962 Ga0501067_0016859
1963 Ga0501067_0087822
1964 Ga0501067_0096979
1965 Ga0501068_0001181
1966 Ga0501069_0002399
1967 Ga0501069_0016467
1968 Ga0501069_0016640
1969 Ga0501069_0022584
1970 Ga0501069_0027636
1971 Ga0501070_0008509
1972 Ga0501070_0010395
1973 Ga0501070_0014204
1974 Ga0501070_0089951
1975 Ga0501071_0018729
1976 Ga0501071_0127219
1977 Ga0501072_0083731
1978 Ga0501072_0150155
1979 Ga0501074_0017874
1980 Ga0501076_0011754
1981 Ga0501077_0043666
1982 Ga0501079_0021128
1983 Ga0501081_0004576
1984 Ga0501083_0025552
1985 Ga0501045_0010111
1986 Ga0501045_0093128
1987 nmdc:mga05p37_148675_c1
1988 nmdc:mga05p37_1648_c1
1989 nmdc:mga05p37_4144_c2
1990 nmdc:mga05p37_45059_c1
1991 nmdc:mga05p37_53795_c1
1992 nmdc:mga09592_135586_c1
1993 nmdc:mga09592_195461_c1
1994 nmdc:mga0qj67_65425_c1
1995 nmdc:mga06r32_11086_c1
1996 nmdc:mga08y16_141052_c1
1997 nmdc:mga08y16_19969_c1
1998 nmdc:mga08y16_284641_c1
1999 nmdc:mga0n895_13560_c1
2000 nmdc:mga0n895_144310_c1
2001 nmdc:mga0n895_217996_c1
2002 nmdc:mga0n895_29458_c1
2003 nmdc:mga0rr50_12711_c1
2004 nmdc:mga0rr50_13489_c1
2005 nmdc:mga0rr50_38904_c1
2006 nmdc:mga0rr50_55552_c1
2007 nmdc:mga0rr50_78467_c1
2008 nmdc:mga08x19_2647_c1
2009 nmdc:mga0a205_120264_c1
2010 nmdc:mga0a205_247804_c1
2011 nmdc:mga0a205_252300_c1
2012 nmdc:mga0a205_55410_c1
2013 nmdc:mga0a205_68871_c1
2014 nmdc:mga0a205_89899_c1
2015 nmdc:mga0a205_9936_c1
2016 Ga0495601_0007612
2017 Ga0495601_0007870
2018 Ga0495601_0039693
2019 Ga0495601_0041154
2020 Ga0495601_0108271
2021 Ga0495601_0140940
2022 Ga0495612_0012979
2023 Ga0495612_0021217
2024 Ga0495612_0021410
2025 Ga0495595_0004929
2026 Ga0495595_0022765
2027 Ga0495595_0026387
2028 Ga0495619_0000507
2029 Ga0495619_0001017
2030 Ga0495619_0002571
2031 Ga0495619_0007865
2032 Ga0495619_0012980
2033 Ga0495619_0034749
2034 Ga0500566_0045228
2035 Ga0501084_0151623
2036 Ga0501084_0222004
2037 Ga0466962_0004473
2038 Ga0466962_0021951
2039 Ga0530510_0030809
2040 Ga0530510_0113514

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

221

315

0.93

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

114

411

0.82

PF04389

Peptidase_M28

Peptidase family M28

97

223

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rza-assembly1.cif.gz_B crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. aureus mu50 at 2.10 a resolution 0.9269 3 367
3rza-assembly1.cif.gz_B crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. aureus mu50 at 2.10 a resolution 0.9057 3 367
3gb0-assembly1.cif.gz_A-2 crystal structure of aminopeptidase pept (np_980509.1) from bacillus cereus atcc 10987 at 2.04 a resolution 0.8748 3 363
3gb0-assembly1.cif.gz_A-2 crystal structure of aminopeptidase pept (np_980509.1) from bacillus cereus atcc 10987 at 2.04 a resolution 0.8468 3 363
1fno-assembly1.cif.gz_A-2 peptidase t (tripeptidase) 0.8278 1 367
ID Description Score Start End Superfamily
3gb0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9545 174 281 3.30.70.360
3gb0A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9426 3 363 3.40.630.10
3gb0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9202 174 281 3.30.70.360
3gb0A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9032 3 363 3.40.630.10
3io1B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8801 174 281 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A7W0TJG2-F1-model_v4 Peptidase dimerization domain-containing protein 0.9825 151 367
AF-A0A1F5BLI0-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.9753 3 362 GO:0004177
GO:0046872
AF-A0A7W0APW2-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9679 52 371 GO:0006508
GO:0008237
AF-A0A7W7MJ24-F1-model_v4 Tripeptide aminopeptidase (EC 3.4.11.4) 0.9666 3 365 GO:0045148
GO:0046872
AF-A0A0T6A5U6-F1-model_v4 Peptidase T-like protein 0.966 3 367 GO:0004177
GO:0046872

Map