F488372

General Info

Members Datasets Scaffolds Average Seq Length
1020 403 2040 187

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0392592|Ga0395905_0392592_582_1208
Length 208
Sequence MVRVLSLRLPAAERLIVTSETDHSHGAHGLGEAVAARIERRWATLSIVIIGVLVGLAAFFGIYHTTMPQGRVETADPTTLHLSGEFVESNLGSALEADGSVTVRAIGQQYSFTPQCLVVPAETPITVRATSADVVHGFLIEGTNINIMLVPGYVSDLPISFKTPGEHMMPCQEFCGIGHQGMWGKVKVVDQATFRNMAASKRRLTCVD

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
102 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
181 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
209 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
213 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
244 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
245 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
246 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
247 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
255 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
256 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
257 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
273 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
276 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
293 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
294 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
295 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
296 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
297 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
300 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
301 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
302 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
303 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
304 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
321 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
322 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
323 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
326 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
329 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
330 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
338 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
339 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
343 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
344 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
345 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
346 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
347 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
348 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
349 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
350 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
354 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
355 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
356 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
357 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
358 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
359 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
360 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
361 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
362 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
363 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
364 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
365 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
366 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
367 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
368 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
369 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
370 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
371 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
372 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
373 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
374 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
375 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
376 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
377 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
378 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
379 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
380 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
381 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
382 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
383 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
384 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
385 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
386 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
387 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
388 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
389 2643221556 Massilia sp. Root1485 Isolate Unclassified
390 2643221684 Massilia sp. Root133 Isolate Unclassified
391 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
392 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
393 2857564685 Duganella sp. R-74599 Isolate Unclassified
394 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
395 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
396 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
397 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
398 2904699407
399 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
400 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
401 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
402 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
403 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.74
Metatranscriptomes 0.1
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.76
Nodule 1.37
Rhizoplane 7.06
Rhizosphere 80.39
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0392592 3300037471 Bacteria 1282
2 JGI25165J46597_1000006 3300003214 Bacteria 529784
3 JGI25404J52841_10000254 3300003659 Bacteria 6695
4 Ga0065165_1010810 3300005262 Bacteria 3891
5 Ga0070658_10068107 3300005327 Bacteria 2909
6 Ga0070658_10547925 3300005327 Bacteria 1001
7 Ga0070658_10852956 3300005327 Bacteria 792
8 Ga0070676_10950368 3300005328 Bacteria 643
9 Ga0070683_100020118 3300005329 Bacteria 5936
10 Ga0070683_100387791 3300005329 Bacteria 1331
11 Ga0070690_100629919 3300005330 Bacteria 817
12 Ga0068869_100017200 3300005334 Bacteria 4895
13 Ga0070680_100043042 3300005336 Bacteria 3667
14 Ga0070682_100042469 3300005337 Bacteria 2807
15 Ga0070682_100157416 3300005337 Bacteria 1565
16 Ga0068868_100006547 3300005338 Bacteria 8248
17 Ga0068868_100069042 3300005338 Bacteria 2815
18 Ga0068868_100203216 3300005338 Bacteria 1652
19 Ga0070660_100228899 3300005339 Bacteria 1512
20 Ga0070660_100386908 3300005339 Bacteria 1155
21 Ga0070660_100824176 3300005339 Bacteria 781
22 Ga0070660_101232277 3300005339 Bacteria 634
23 Ga0070689_100230654 3300005340 Bacteria 1522
24 Ga0070689_100574766 3300005340 Bacteria 973
25 Ga0070691_10111683 3300005341 Bacteria 1368
26 Ga0070661_100149234 3300005344 Bacteria 1766
27 Ga0070661_100189925 3300005344 Bacteria 1566
28 Ga0070668_100045256 3300005347 Bacteria 3377
29 Ga0070668_100104644 3300005347 Bacteria 2246
30 Ga0070668_100182551 3300005347 Bacteria 1715
31 Ga0070668_100409293 3300005347 Bacteria 1159
32 Ga0070668_101059470 3300005347 Bacteria 730
33 Ga0070675_101180122 3300005354 Bacteria 705
34 Ga0070671_100267604 3300005355 Bacteria 1453
35 Ga0070671_101078679 3300005355 Bacteria 705
36 Ga0070674_100021173 3300005356 Bacteria 4169
37 Ga0070674_100142087 3300005356 Bacteria 1802
38 Ga0070688_100518703 3300005365 Bacteria 901
39 Ga0070659_100285174 3300005366 Bacteria 1374
40 Ga0070659_100483469 3300005366 Bacteria 1054
41 Ga0070667_100244921 3300005367 Bacteria 1602
42 Ga0070667_100830546 3300005367 Bacteria 859
43 Ga0070701_10104741 3300005438 Bacteria 1572
44 Ga0070701_10150986 3300005438 Bacteria 1338
45 Ga0070694_100626303 3300005444 Bacteria 869
46 Ga0070663_100016240 3300005455 Bacteria 4829
47 Ga0070663_100020052 3300005455 Bacteria 4419
48 Ga0070663_100020229 3300005455 Bacteria 4403
49 Ga0070663_100123056 3300005455 Bacteria 1961
50 Ga0070678_100003659 3300005456 Bacteria 8584
51 Ga0070678_100017610 3300005456 Bacteria 4607
52 Ga0070678_100037277 3300005456 Bacteria 3412
53 Ga0070678_100067668 3300005456 Bacteria 2659
54 Ga0070678_100596432 3300005456 Bacteria 986
55 Ga0070678_101004192 3300005456 Bacteria 767
56 Ga0070681_10058589 3300005458 Bacteria 3831
57 Ga0068867_100049914 3300005459 Bacteria 3081
58 Ga0070699_100857343 3300005518 Bacteria 832
59 Ga0070679_100021982 3300005530 Bacteria 6232
60 Ga0070679_100897741 3300005530 Bacteria 830
61 Ga0070684_100032764 3300005535 Bacteria 4432
62 Ga0070684_100132369 3300005535 Bacteria 2250
63 Ga0070684_101162130 3300005535 Bacteria 726
64 Ga0068853_100014537 3300005539 Bacteria 6451
65 Ga0068853_100205235 3300005539 Bacteria 1795
66 Ga0068853_100391277 3300005539 Bacteria 1300
67 Ga0068853_100981262 3300005539 Bacteria 813
68 Ga0070672_100215342 3300005543 Bacteria 1610
69 Ga0070672_100670484 3300005543 Bacteria 907
70 Ga0070686_100643605 3300005544 Bacteria 840
71 Ga0070693_100091362 3300005547 Bacteria 1836
72 Ga0070693_100715250 3300005547 Bacteria 735
73 Ga0070665_100044315 3300005548 Bacteria 4468
74 Ga0070665_100075092 3300005548 Bacteria 3387
75 Ga0070665_100356918 3300005548 Bacteria 1467
76 Ga0070704_100137670 3300005549 Bacteria 1902
77 Ga0068855_100014574 3300005563 Bacteria 9470
78 Ga0068855_100066675 3300005563 Bacteria 4196
79 Ga0068855_100511759 3300005563 Bacteria 1303
80 Ga0070664_100010213 3300005564 Bacteria 7614
81 Ga0070664_100021262 3300005564 Bacteria 5346
82 Ga0070664_100338419 3300005564 Bacteria 1366
83 Ga0070664_100360249 3300005564 Bacteria 1324
84 Ga0070664_100603872 3300005564 Bacteria 1018
85 Ga0070664_100656011 3300005564 Bacteria 975
86 Ga0070664_101165996 3300005564 Bacteria 726
87 Ga0068857_100066317 3300005577 Bacteria 3211
88 Ga0068856_100107887 3300005614 Bacteria 2780
89 Ga0068856_100448795 3300005614 Bacteria 1310
90 Ga0070702_100061421 3300005615 Bacteria 2188
91 Ga0068852_100022692 3300005616 Bacteria 5039
92 Ga0068859_100237233 3300005617 Bacteria 1912
93 Ga0068864_100029384 3300005618 Bacteria 4655
94 Ga0068864_100073671 3300005618 Bacteria 2977
95 Ga0068864_100484821 3300005618 Bacteria 1187
96 Ga0068861_100052716 3300005719 Bacteria 3093
97 Ga0068861_100259325 3300005719 Bacteria 1487
98 Ga0068863_100133864 3300005841 Bacteria 2367
99 Ga0068863_100554868 3300005841 Bacteria 1134
100 Ga0068858_100023425 3300005842 Bacteria 5752
101 Ga0068858_100060057 3300005842 Bacteria 3514
102 Ga0068858_100512257 3300005842 Bacteria 1160
103 Ga0068860_100292362 3300005843 Bacteria 1594
104 Ga0068860_101064641 3300005843 Bacteria 828
105 Ga0068862_100744702 3300005844 Bacteria 953
106 Ga0081455_10027227 3300005937 Bacteria 5240
107 Ga0081540_1002053 3300005983 Bacteria 16798
108 Ga0081540_1003838 3300005983 Bacteria 11758
109 Ga0081540_1005208 3300005983 Bacteria 9729
110 Ga0081540_1007807 3300005983 Bacteria 7570
111 Ga0081540_1011448 3300005983 Bacteria 5926
112 Ga0081540_1053737 3300005983 Bacteria 1973
113 Ga0081540_1088971 3300005983 Bacteria 1364
114 Ga0070717_10268386 3300006028 Bacteria 1511
115 Ga0075365_10114109 3300006038 Bacteria 1859
116 Ga0075365_10199133 3300006038 Bacteria 1403
117 Ga0075365_10543491 3300006038 Bacteria 822
118 Ga0075368_10002535 3300006042 Bacteria 5974
119 Ga0075368_10194609 3300006042 Bacteria 857
120 Ga0075363_100070718 3300006048 Bacteria 1895
121 Ga0075363_100084189 3300006048 Bacteria 1743
122 Ga0075364_10180614 3300006051 Bacteria 1428
123 Ga0070716_100286611 3300006173 Bacteria 1139
124 Ga0070716_100564558 3300006173 Bacteria 851
125 Ga0070712_100098016 3300006175 Bacteria 2162
126 Ga0070712_100194272 3300006175 Bacteria 1590
127 Ga0075362_10062304 3300006177 Bacteria 1689
128 Ga0075362_10191086 3300006177 Bacteria 994
129 Ga0075367_10165209 3300006178 Bacteria 1377
130 Ga0075367_10264097 3300006178 Bacteria 1081
131 Ga0075369_10073823 3300006186 Bacteria 1504
132 Ga0075369_10083370 3300006186 Bacteria 1420
133 Ga0075369_10340680 3300006186 Bacteria 703
134 Ga0075366_10173916 3300006195 Bacteria 1307
135 Ga0075366_10460445 3300006195 Bacteria 785
136 Ga0097621_100045438 3300006237 Bacteria 3548
137 Ga0097621_100097225 3300006237 Bacteria 2472
138 Ga0068871_100031318 3300006358 Bacteria 4194
139 Ga0068871_100925971 3300006358 Bacteria 809
140 Ga0068865_100039829 3300006881 Bacteria 3189
141 Ga0068865_100442397 3300006881 Bacteria 1073
142 Ga0097620_100237229 3300006931 Bacteria 1912
143 Ga0075435_100040178 3300007076 Bacteria 3735
144 Ga0099794_10029377 3300007265 Bacteria 2561
145 Ga0099795_10001567 3300007788 Bacteria 5035
146 Ga0105251_10099205 3300009011 Bacteria 1332
147 Ga0105250_10227237 3300009092 Bacteria 793
148 Ga0105240_10245861 3300009093 Bacteria 2072
149 Ga0105245_10027787 3300009098 Bacteria 4985
150 Ga0105245_10186930 3300009098 Bacteria 1982
151 Ga0105245_10266547 3300009098 Bacteria 1669
152 Ga0105245_10642134 3300009098 Bacteria 1091
153 Ga0105247_10160166 3300009101 Bacteria 1489
154 Ga0105243_10011026 3300009148 Bacteria 6835
155 Ga0105243_10194224 3300009148 Bacteria 1775
156 Ga0105241_10022807 3300009174 Bacteria 4640
157 Ga0105242_10056727 3300009176 Bacteria 3205
158 Ga0105242_10214044 3300009176 Bacteria 1719
159 Ga0105248_10034971 3300009177 Bacteria 5622
160 Ga0105248_10578130 3300009177 Bacteria 1267
161 Ga0105248_11586612 3300009177 Bacteria 741
162 Ga0105237_10043449 3300009545 Bacteria 4526
163 Ga0105237_10167236 3300009545 Bacteria 2198
164 Ga0105237_10726337 3300009545 Bacteria 1000
165 Ga0105238_10152073 3300009551 Bacteria 2289
166 Ga0105238_10193575 3300009551 Bacteria 2009
167 Ga0105238_10441350 3300009551 Bacteria 1298
168 Ga0105249_10071994 3300009553 Bacteria 3195
169 Ga0099796_10004654 3300010159 Bacteria 3344
170 Ga0105239_10010954 3300010375 Bacteria 10129
171 Ga0105239_10058369 3300010375 Bacteria 4234
172 Ga0105239_10120429 3300010375 Bacteria 2914
173 Ga0105239_10503863 3300010375 Bacteria 1376
174 Ga0105239_11076959 3300010375 Bacteria 925
175 Ga0105246_10020290 3300011119 Bacteria 4261
176 Ga0105246_10068823 3300011119 Bacteria 2484
177 Ga0157370_10034059 3300013104 Bacteria 4963
178 Ga0157369_10002265 3300013105 Bacteria 23128
179 Ga0157369_10016093 3300013105 Bacteria 8416
180 Ga0157369_10975869 3300013105 Bacteria 868
181 Ga0157374_10003326 3300013296 Bacteria 13512
182 Ga0157378_10260553 3300013297 Bacteria 1663
183 Ga0163162_10015168 3300013306 Bacteria 7526
184 Ga0163162_10055092 3300013306 Bacteria 4002
185 Ga0163162_10116218 3300013306 Bacteria 2776
186 Ga0157372_10041023 3300013307 Bacteria 5116
187 Ga0157372_11140579 3300013307 Bacteria 901
188 Ga0157375_10008539 3300013308 Bacteria 8967
189 Ga0157375_10309505 3300013308 Bacteria 1744
190 Ga0163163_10003792 3300014325 Bacteria 12874
191 Ga0163163_10007553 3300014325 Bacteria 9597
192 Ga0163163_10607263 3300014325 Bacteria 1157
193 Ga0157380_10019544 3300014326 Bacteria 5050
194 Ga0157380_10334323 3300014326 Bacteria 1410
195 Ga0157377_10369375 3300014745 Bacteria 968
196 Ga0157379_10385425 3300014968 Bacteria 1286
197 Ga0157376_10017469 3300014969 Bacteria 5473
198 Ga0157376_10645767 3300014969 Bacteria 1058
199 Ga0163161_10021099 3300017792 Bacteria 4578
200 Ga0213874_10049416 3300021377 Unclassified 1286
201 Ga0209233_1000010 3300025261 Bacteria 1194329
202 Ga0209758_1001532 3300025297 Bacteria 26653
203 Ga0209758_1003142 3300025297 Bacteria 15539
204 Ga0209758_1045817 3300025297 Bacteria 1584
205 Ga0207642_10248740 3300025899 Bacteria 1008
206 Ga0207688_10104915 3300025901 Bacteria 1635
207 Ga0207680_10609889 3300025903 Bacteria 781
208 Ga0207647_10161105 3300025904 Bacteria 1309
209 Ga0207685_10367371 3300025905 Bacteria 730
210 Ga0207699_10464097 3300025906 Bacteria 910
211 Ga0207645_10087751 3300025907 Bacteria 1999
212 Ga0207645_10401305 3300025907 Bacteria 922
213 Ga0207643_10033308 3300025908 Bacteria 2882
214 Ga0207705_10057990 3300025909 Bacteria 2794
215 Ga0207705_10138765 3300025909 Bacteria 1814
216 Ga0207684_10670595 3300025910 Bacteria 883
217 Ga0207695_10137206 3300025913 Bacteria 2398
218 Ga0207671_10192869 3300025914 Bacteria 1589
219 Ga0207693_10050481 3300025915 Bacteria 3267
220 Ga0207693_10066564 3300025915 Bacteria 2821
221 Ga0207660_10163892 3300025917 Bacteria 1717
222 Ga0207662_10115102 3300025918 Bacteria 1680
223 Ga0207657_10036254 3300025919 Bacteria 4416
224 Ga0207657_10240292 3300025919 Bacteria 1446
225 Ga0207657_10321342 3300025919 Bacteria 1224
226 Ga0207652_10068496 3300025921 Bacteria 3080
227 Ga0207652_10156528 3300025921 Bacteria 2042
228 Ga0207652_11039463 3300025921 Bacteria 718
229 Ga0207694_10326021 3300025924 Bacteria 1268
230 Ga0207694_10789944 3300025924 Bacteria 802
231 Ga0207687_10075061 3300025927 Bacteria 2425
232 Ga0207687_10358550 3300025927 Bacteria 1189
233 Ga0207700_11515884 3300025928 Bacteria 595
234 Ga0207644_10119591 3300025931 Bacteria 2004
235 Ga0207644_10496015 3300025931 Bacteria 1007
236 Ga0207644_10837271 3300025931 Bacteria 770
237 Ga0207690_10034215 3300025932 Bacteria 3273
238 Ga0207690_10247079 3300025932 Bacteria 1377
239 Ga0207690_10357911 3300025932 Bacteria 1155
240 Ga0207706_10060448 3300025933 Bacteria 3337
241 Ga0207706_10360749 3300025933 Bacteria 1262
242 Ga0207686_10062197 3300025934 Bacteria 2370
243 Ga0207686_10251825 3300025934 Bacteria 1291
244 Ga0207709_10028413 3300025935 Bacteria 3233
245 Ga0207709_10041029 3300025935 Bacteria 2775
246 Ga0207709_10067476 3300025935 Bacteria 2257
247 Ga0207669_10012350 3300025937 Bacteria 4196
248 Ga0207669_10042118 3300025937 Bacteria 2663
249 Ga0207704_10340194 3300025938 Bacteria 1164
250 Ga0207704_10369105 3300025938 Bacteria 1123
251 Ga0207665_10225069 3300025939 Bacteria 1376
252 Ga0207691_10059924 3300025940 Bacteria 3460
253 Ga0207691_10469567 3300025940 Bacteria 1070
254 Ga0207711_10518245 3300025941 Bacteria 1112
255 Ga0207689_10075529 3300025942 Bacteria 2770
256 Ga0207689_10091812 3300025942 Bacteria 2494
257 Ga0207661_10028832 3300025944 Bacteria 4255
258 Ga0207661_10615357 3300025944 Bacteria 997
259 Ga0207679_10048953 3300025945 Bacteria 3080
260 Ga0207679_10206649 3300025945 Bacteria 1644
261 Ga0207679_10781411 3300025945 Bacteria 870
262 Ga0207667_10010756 3300025949 Bacteria 10672
263 Ga0207667_10015015 3300025949 Bacteria 8810
264 Ga0207667_10074694 3300025949 Bacteria 3521
265 Ga0207667_10596978 3300025949 Bacteria 1114
266 Ga0207667_10810644 3300025949 Bacteria 932
267 Ga0207651_10091652 3300025960 Bacteria 2226
268 Ga0207712_10124192 3300025961 Bacteria 1957
269 Ga0207712_10446352 3300025961 Bacteria 1096
270 Ga0207668_10019967 3300025972 Bacteria 4248
271 Ga0207668_10036022 3300025972 Bacteria 3300
272 Ga0207640_10041183 3300025981 Bacteria 2936
273 Ga0207640_10284821 3300025981 Bacteria 1300
274 Ga0207640_11158955 3300025981 Bacteria 686
275 Ga0207658_10317607 3300025986 Bacteria 1347
276 Ga0207658_10632690 3300025986 Bacteria 963
277 Ga0207677_10011044 3300026023 Bacteria 5132
278 Ga0207677_10091669 3300026023 Bacteria 2211
279 Ga0207703_10400935 3300026035 Bacteria 1273
280 Ga0207639_10085807 3300026041 Bacteria 2505
281 Ga0207639_10127272 3300026041 Bacteria 2103
282 Ga0207639_10203783 3300026041 Bacteria 1698
283 Ga0207678_10010552 3300026067 Bacteria 8114
284 Ga0207678_10022770 3300026067 Bacteria 5486
285 Ga0207678_10130148 3300026067 Bacteria 2146
286 Ga0207678_10162237 3300026067 Bacteria 1909
287 Ga0207678_10203891 3300026067 Bacteria 1691
288 Ga0207678_10585696 3300026067 Bacteria 977
289 Ga0207678_10943429 3300026067 Bacteria 763
290 Ga0207708_10184300 3300026075 Bacteria 1658
291 Ga0207702_10167160 3300026078 Bacteria 2013
292 Ga0207702_10628896 3300026078 Bacteria 1055
293 Ga0207702_11400893 3300026078 Bacteria 693
294 Ga0207641_10062468 3300026088 Bacteria 3179
295 Ga0207641_10630022 3300026088 Bacteria 1052
296 Ga0207648_10197558 3300026089 Bacteria 1784
297 Ga0207676_10388555 3300026095 Bacteria 1301
298 Ga0207674_10048154 3300026116 Bacteria 4364
299 Ga0207674_10111119 3300026116 Bacteria 2715
300 Ga0207675_100101117 3300026118 Bacteria 2716
301 Ga0207675_100111822 3300026118 Bacteria 2577
302 Ga0207675_100199723 3300026118 Bacteria 1920
303 Ga0207683_10014660 3300026121 Bacteria 6675
304 Ga0207683_10044880 3300026121 Bacteria 3864
305 Ga0207683_10055468 3300026121 Bacteria 3474
306 Ga0207683_10872965 3300026121 Unclassified 835
307 Ga0207698_10021492 3300026142 Bacteria 4464
308 Ga0207698_11146487 3300026142 Bacteria 791
309 Ga0268266_10016992 3300028379 Bacteria 6215
310 Ga0268266_10019219 3300028379 Bacteria 5818
311 Ga0268266_10088956 3300028379 Bacteria 2703
312 Ga0268265_10735162 3300028380 Bacteria 956
313 Ga0268264_10917113 3300028381 Bacteria 880
314 Ga0268264_11060705 3300028381 Bacteria 818
315 Ga0265328_10029964 3300031239 Bacteria 2030
316 Ga0265316_10753675 3300031344 Bacteria 684
317 Ga0307513_10193775 3300031456 Bacteria 1881
318 Ga0265342_10079738 3300031712 Bacteria 1893
319 Ga0307516_10213055 3300031730 Bacteria 1645
320 Ga0307405_10229563 3300031731 Bacteria 1367
321 Ga0307405_10389791 3300031731 Bacteria 1087
322 Ga0307406_10067061 3300031901 Bacteria 2338
323 Ga0307407_10874170 3300031903 Bacteria 688
324 Ga0307411_10015152 3300032005 Bacteria 4320
325 Ga0307411_10332095 3300032005 Bacteria 1232
326 Ga0307415_100020263 3300032126 Bacteria 4058
327 Ga0307415_100058419 3300032126 Bacteria 2656
328 Ga0307415_100067328 3300032126 Bacteria 2502
329 Ga0307510_10009746 3300033180 Bacteria 11432
330 Ga0315911_1000009 3300033442 Bacteria 379354
331 Ga0373926_0069057 3300035083 Bacteria 1296
332 Ga0373929_0064173 3300035085 Bacteria 866
333 Ga0373940_0120457 3300035088 Bacteria 814
334 Ga0373923_0000827 3300035111 Bacteria 8121
335 Ga0373923_0017518 3300035111 Bacteria 2742
336 Ga0373932_0105103 3300035112 Bacteria 924
337 Ga0373954_0000634 3300035118 Bacteria 13429
338 Ga0373954_0108046 3300035118 Bacteria 1345
339 Ga0373957_0000200 3300035120 Bacteria 15408
340 Ga0373943_0082196 3300035170 Bacteria 1654
341 Ga0373943_0230692 3300035170 Bacteria 1034
342 Ga0373946_0005979 3300035171 Bacteria 4412
343 Ga0373946_0007758 3300035171 Bacteria 3937
344 Ga0373946_0078970 3300035171 Bacteria 1437
345 Ga0373955_0014279 3300035172 Bacteria 3860
346 Ga0373961_0122618 3300035241 Bacteria 863
347 Ga0373962_0114226 3300035242 Bacteria 855
348 Ga0373924_0047567 3300035410 Bacteria 1770
349 Ga0373924_0052392 3300035410 Bacteria 1694
350 Ga0373931_0050522 3300035691 Bacteria 2212
351 Ga0373935_0021939 3300035692 Bacteria 3910
352 Ga0373935_0103925 3300035692 Bacteria 1877
353 Ga0373927_0001513 3300035695 Bacteria 17491
354 Ga0373927_0023260 3300035695 Bacteria 4059
355 Ga0373927_0026102 3300035695 Bacteria 3817
356 Ga0373927_0044399 3300035695 Bacteria 2876
357 Ga0373927_0054881 3300035695 Bacteria 2577
358 Ga0373933_0002159 3300035724 Bacteria 11266
359 Ga0373933_0055833 3300035724 Bacteria 2370
360 Ga0373947_0014848 3300035725 Bacteria 4469
361 Ga0373947_0019002 3300035725 Bacteria 3960
362 Ga0373947_0137638 3300035725 Bacteria 1564
363 Ga0373937_0014785 3300036401 Bacteria 6891
364 Ga0373937_0035531 3300036401 Bacteria 4537
365 Ga0372808_001672 3300036459 Bacteria 2374
366 Ga0373925_0006671 3300037068 Bacteria 8469
367 Ga0373925_0069441 3300037068 Bacteria 2662
368 Ga0395899_0013951 3300037312 Bacteria 6137
369 Ga0395899_0153576 3300037312 Bacteria 1630
370 Ga0395899_0362797 3300037312 Bacteria 966
371 Ga0395900_0000513 3300037418 Bacteria 54785
372 Ga0395900_0035219 3300037418 Bacteria 5156
373 Ga0395900_0061053 3300037418 Bacteria 3877
374 Ga0395900_0387966 3300037418 Bacteria 1363
375 Ga0395900_0656086 3300037418 Bacteria 985
376 Ga0395900_1109174 3300037418 Bacteria 708
377 Ga0395898_0081232 3300037466 Bacteria 3126
378 Ga0395898_0175025 3300037466 Bacteria 2051
379 Ga0395898_0178184 3300037466 Bacteria 2031
380 Ga0395905_0189218 3300037471 Bacteria 1931
381 Ga0395905_0754576 3300037471 Bacteria 875
382 Ga0395901_0000019 3300038443 Bacteria 317063
383 Ga0395901_0248570 3300038443 Bacteria 1853
384 Ga0395901_0822174 3300038443 Bacteria 916
385 Ga0395901_0835613 3300038443 Bacteria 907
386 Ga0436365_0172063 3300039437 Bacteria 12419
387 Ga0436365_1338213 3300039437 Bacteria 1945
388 Ga0436360_0861292 3300039438 Bacteria 2289
389 Ga0436360_0985690 3300039438 Bacteria 1153
390 Ga0436361_0809888 3300039447 Bacteria 947
391 Ga0436361_1180484 3300039447 Bacteria 2496
392 Ga0436363_0288172 3300039450 Bacteria 2165
393 Ga0436362_0350328 3300039453 Bacteria 2056
394 Ga0451802_1429738 3300041460 Bacteria 762
395 Ga0451853_1746509 3300041512 Bacteria 1980
396 Ga0439449_0006107 3300042007 Bacteria 4604
397 Ga0439458_0099349 3300042157 Bacteria 754
398 Ga0466963_0132864 3300044694 Bacteria 1720
399 Ga0453684_0275687 3300044712 Bacteria 1920
400 Ga0466970_0247224 3300044765 Bacteria 999
401 Ga0466967_0530472 3300045976 Bacteria 1157
402 Ga0495617_000034 3300046452 Bacteria 147232
403 Ga0495617_000099 3300046452 Bacteria 62284
404 Ga0495617_019330 3300046452 Bacteria 2303
405 Ga0495617_067182 3300046452 Bacteria 1181
406 Ga0495627_000208 3300046453 Bacteria 63467
407 Ga0495627_041161 3300046453 Bacteria 1420
408 Ga0495627_052601 3300046453 Bacteria 1221
409 Ga0495627_090729 3300046453 Bacteria 879
410 Ga0495592_0002897 3300046454 Bacteria 12205
411 Ga0495603_0013589 3300046455 Bacteria 4925
412 Ga0495603_0017151 3300046455 Bacteria 4384
413 Ga0495603_0022018 3300046455 Bacteria 3859
414 Ga0495603_0034420 3300046455 Bacteria 3045
415 Ga0495603_0238001 3300046455 Bacteria 1049
416 Ga0495590_0000087 3300046457 Bacteria 60113
417 Ga0495590_0000195 3300046457 Bacteria 34306
418 Ga0495591_000272 3300046458 Bacteria 48725
419 Ga0495629_0002158 3300046459 Bacteria 15190
420 Ga0495629_0004330 3300046459 Bacteria 10642
421 Ga0495629_0012878 3300046459 Bacteria 6049
422 Ga0495629_0051582 3300046459 Bacteria 2879
423 Ga0495629_0368919 3300046459 Bacteria 978
424 Ga0495629_0420767 3300046459 Bacteria 907
425 Ga0495638_0007685 3300046460 Bacteria 7705
426 Ga0495638_0054741 3300046460 Bacteria 2479
427 Ga0495638_0065792 3300046460 Bacteria 2230
428 Ga0495638_0442641 3300046460 Bacteria 665
429 Ga0495641_0019593 3300046461 Bacteria 3455
430 Ga0495653_0017446 3300046463 Bacteria 5838
431 Ga0495653_0029478 3300046463 Bacteria 4380
432 Ga0495650_0008607 3300046471 Bacteria 5922
433 Ga0495580_0006344 3300046472 Bacteria 9647
434 Ga0495580_0011640 3300046472 Bacteria 6803
435 Ga0495580_0210368 3300046472 Bacteria 1338
436 Ga0495582_0005475 3300046473 Bacteria 7075
437 Ga0495582_0201669 3300046473 Bacteria 1136
438 Ga0495605_0000151 3300046474 Bacteria 89442
439 Ga0495605_0016177 3300046474 Bacteria 4041
440 Ga0495605_0044051 3300046474 Bacteria 2208
441 Ga0495605_0064313 3300046474 Bacteria 1747
442 Ga0495639_0000750 3300046475 Bacteria 14821
443 Ga0495639_0047445 3300046475 Bacteria 1946
444 Ga0495639_0076527 3300046475 Bacteria 1552
445 Ga0495639_0189724 3300046475 Bacteria 1003
446 Ga0495662_0002275 3300046476 Bacteria 9684
447 Ga0495664_0136401 3300046477 Bacteria 1487
448 Ga0495584_0000011 3300046491 Bacteria 208322
449 Ga0495584_0000122 3300046491 Bacteria 53611
450 Ga0495584_0000253 3300046491 Bacteria 38533
451 Ga0495584_0001524 3300046491 Bacteria 13773
452 Ga0495584_0031573 3300046491 Bacteria 2681
453 Ga0495584_0062179 3300046491 Bacteria 1876
454 Ga0495584_0096553 3300046491 Bacteria 1492
455 Ga0495584_0266080 3300046491 Bacteria 871
456 Ga0495585_0000106 3300046492 Bacteria 89096
457 Ga0495585_0000970 3300046492 Bacteria 24102
458 Ga0495585_0001684 3300046492 Bacteria 16886
459 Ga0495585_0004203 3300046492 Bacteria 9401
460 Ga0495585_0005123 3300046492 Bacteria 8339
461 Ga0495585_0017233 3300046492 Bacteria 4176
462 Ga0495585_0018938 3300046492 Bacteria 3971
463 Ga0495585_0019025 3300046492 Bacteria 3963
464 Ga0495585_0019036 3300046492 Bacteria 3961
465 Ga0495585_0029478 3300046492 Bacteria 3123
466 Ga0495585_0031323 3300046492 Bacteria 3019
467 Ga0495585_0066304 3300046492 Bacteria 1976
468 Ga0495585_0078345 3300046492 Bacteria 1793
469 Ga0495585_0185981 3300046492 Bacteria 1065
470 Ga0495585_0255932 3300046492 Bacteria 872
471 Ga0495594_0001313 3300046499 Bacteria 12946
472 Ga0495594_0003799 3300046499 Bacteria 7747
473 Ga0495594_0005644 3300046499 Bacteria 6435
474 Ga0495594_0017845 3300046499 Bacteria 3754
475 Ga0495594_0375214 3300046499 Bacteria 809
476 Ga0495594_0424400 3300046499 Bacteria 756
477 Ga0495596_0004070 3300046500 Bacteria 7199
478 Ga0495596_0007869 3300046500 Bacteria 4775
479 Ga0495596_0008479 3300046500 Bacteria 4574
480 Ga0495596_0015995 3300046500 Bacteria 3123
481 Ga0495596_0036879 3300046500 Bacteria 1935
482 Ga0495596_0041152 3300046500 Bacteria 1822
483 Ga0495596_0098748 3300046500 Bacteria 1133
484 Ga0495607_0002166 3300046501 Bacteria 16351
485 Ga0495607_0002563 3300046501 Bacteria 14677
486 Ga0495607_0003376 3300046501 Bacteria 12245
487 Ga0495607_0012182 3300046501 Bacteria 5685
488 Ga0495607_0019414 3300046501 Bacteria 4319
489 Ga0495607_0030467 3300046501 Bacteria 3312
490 Ga0495607_0072805 3300046501 Bacteria 1912
491 Ga0495607_0156498 3300046501 Bacteria 1161
492 Ga0495607_0314709 3300046501 Bacteria 732
493 Ga0495583_0000204 3300046506 Bacteria 99749
494 Ga0495583_0001947 3300046506 Bacteria 19036
495 Ga0495583_0003375 3300046506 Bacteria 12257
496 Ga0495583_0011654 3300046506 Bacteria 5037
497 Ga0495583_0012646 3300046506 Bacteria 4757
498 Ga0495583_0015773 3300046506 Bacteria 4091
499 Ga0495583_0033630 3300046506 Bacteria 2464
500 Ga0495583_0087005 3300046506 Bacteria 1351
501 Ga0495583_0093991 3300046506 Bacteria 1287
502 Ga0495583_0101745 3300046506 Bacteria 1225
503 Ga0495583_0245142 3300046506 Bacteria 719
504 Ga0495606_0003022 3300046507 Bacteria 18402
505 Ga0495606_0009057 3300046507 Bacteria 8493
506 Ga0495606_0037190 3300046507 Bacteria 3307
507 Ga0495606_0042285 3300046507 Bacteria 3048
508 Ga0495606_0061305 3300046507 Bacteria 2406
509 Ga0495606_0070449 3300046507 Bacteria 2205
510 Ga0495606_0073789 3300046507 Bacteria 2139
511 Ga0495606_0078340 3300046507 Bacteria 2061
512 Ga0495606_0089486 3300046507 Bacteria 1896
513 Ga0495606_0104556 3300046507 Bacteria 1718
514 Ga0495606_0189315 3300046507 Bacteria 1180
515 Ga0495608_0002218 3300046511 Bacteria 14020
516 Ga0495608_0364113 3300046511 Bacteria 888
517 Ga0495610_0000010 3300046512 Bacteria 538821
518 Ga0495610_0001106 3300046512 Bacteria 24542
519 Ga0495616_0000557 3300046513 Bacteria 28204
520 Ga0495616_0001082 3300046513 Bacteria 19353
521 Ga0495616_0001767 3300046513 Bacteria 14710
522 Ga0495616_0004439 3300046513 Bacteria 8833
523 Ga0495616_0004788 3300046513 Bacteria 8477
524 Ga0495616_0008025 3300046513 Bacteria 6287
525 Ga0495616_0029968 3300046513 Bacteria 2865
526 Ga0495616_0091184 3300046513 Bacteria 1442
527 Ga0495616_0106768 3300046513 Bacteria 1305
528 Ga0495616_0124937 3300046513 Bacteria 1184
529 Ga0495618_0153370 3300046514 Bacteria 1471
530 Ga0495618_0373451 3300046514 Bacteria 876
531 Ga0495620_0003033 3300046515 Bacteria 9658
532 Ga0495620_0070690 3300046515 Bacteria 1429
533 Ga0495628_0038487 3300046516 Bacteria 3828
534 Ga0495628_0296188 3300046516 Bacteria 1198
535 Ga0495630_0046427 3300046517 Bacteria 3247
536 Ga0495630_0403815 3300046517 Bacteria 1047
537 Ga0495631_0000551 3300046518 Bacteria 25209
538 Ga0495631_0000979 3300046518 Bacteria 17733
539 Ga0495631_0001182 3300046518 Bacteria 16125
540 Ga0495631_0002486 3300046518 Bacteria 10374
541 Ga0495631_0014266 3300046518 Bacteria 3838
542 Ga0495631_0015202 3300046518 Bacteria 3695
543 Ga0495631_0020921 3300046518 Bacteria 3051
544 Ga0495631_0041332 3300046518 Bacteria 2040
545 Ga0495631_0054873 3300046518 Bacteria 1736
546 Ga0495631_0060127 3300046518 Bacteria 1649
547 Ga0495631_0130590 3300046518 Bacteria 1079
548 Ga0495631_0225107 3300046518 Bacteria 800
549 Ga0495632_0000592 3300046519 Bacteria 33698
550 Ga0495632_0001130 3300046519 Bacteria 22838
551 Ga0495632_0002839 3300046519 Bacteria 12805
552 Ga0495632_0005473 3300046519 Bacteria 8388
553 Ga0495637_0000013 3300046520 Bacteria 244837
554 Ga0495637_0000071 3300046520 Bacteria 82633
555 Ga0495637_0032837 3300046520 Bacteria 2284
556 Ga0495637_0149804 3300046520 Bacteria 881
557 Ga0495643_0009062 3300046522 Bacteria 6239
558 Ga0495643_0016864 3300046522 Bacteria 4284
559 Ga0495643_0082769 3300046522 Bacteria 1667
560 Ga0495643_0171529 3300046522 Bacteria 1060
561 Ga0495643_0173629 3300046522 Bacteria 1052
562 Ga0495644_0007520 3300046523 Bacteria 4199
563 Ga0495644_0011332 3300046523 Bacteria 3433
564 Ga0495644_0014082 3300046523 Bacteria 3064
565 Ga0495644_0029663 3300046523 Bacteria 2066
566 Ga0495644_0029840 3300046523 Bacteria 2060
567 Ga0495648_0000410 3300046524 Bacteria 47244
568 Ga0495648_0001182 3300046524 Bacteria 26250
569 Ga0495648_0010568 3300046524 Bacteria 7018
570 Ga0495648_0012573 3300046524 Bacteria 6302
571 Ga0495648_0021834 3300046524 Bacteria 4422
572 Ga0495648_0200071 3300046524 Bacteria 1001
573 Ga0495663_0084016 3300046525 Bacteria 1029
574 Ga0495666_0004146 3300046526 Bacteria 7309
575 Ga0495666_0020165 3300046526 Bacteria 3305
576 Ga0495642_0000127 3300046528 Bacteria 43547
577 Ga0495642_0000327 3300046528 Bacteria 25996
578 Ga0495642_0004101 3300046528 Bacteria 5683
579 Ga0495642_0009709 3300046528 Bacteria 3683
580 Ga0495642_0011532 3300046528 Bacteria 3397
581 Ga0495642_0020857 3300046528 Bacteria 2577
582 Ga0495642_0024380 3300046528 Bacteria 2392
583 Ga0495642_0045565 3300046528 Bacteria 1792
584 Ga0495642_0052619 3300046528 Bacteria 1677
585 Ga0495642_0088070 3300046528 Bacteria 1312
586 Ga0495642_0134778 3300046528 Bacteria 1064
587 Ga0495652_0008518 3300046529 Bacteria 9354
588 Ga0495652_0034244 3300046529 Bacteria 4428
589 Ga0495652_0038809 3300046529 Bacteria 4122
590 Ga0495652_0245712 3300046529 Bacteria 1329
591 Ga0495654_0000002 3300046530 Bacteria 1021205
592 Ga0495654_0017562 3300046530 Bacteria 3758
593 Ga0495654_0022822 3300046530 Bacteria 3245
594 Ga0495654_0277367 3300046530 Bacteria 690
595 Ga0495665_0007507 3300046531 Bacteria 5902
596 Ga0495665_0157783 3300046531 Bacteria 1183
597 Ga0495665_0171516 3300046531 Bacteria 1129
598 Ga0495640_0005616 3300046533 Bacteria 9978
599 Ga0495640_0007861 3300046533 Bacteria 8385
600 Ga0495586_0001930 3300046535 Bacteria 11298
601 Ga0495586_0015457 3300046535 Bacteria 4060
602 Ga0495587_0009572 3300046536 Bacteria 6202
603 Ga0495587_0025519 3300046536 Bacteria 3611
604 Ga0495609_0003245 3300046538 Bacteria 9411
605 Ga0495609_0010758 3300046538 Bacteria 4377
606 Ga0495609_0013376 3300046538 Bacteria 3877
607 Ga0495609_0029965 3300046538 Bacteria 2476
608 Ga0495609_0043776 3300046538 Bacteria 2009
609 Ga0495609_0049508 3300046538 Bacteria 1875
610 Ga0495609_0080498 3300046538 Bacteria 1424
611 Ga0495609_0114220 3300046538 Bacteria 1164
612 Ga0495597_0001550 3300046542 Bacteria 16266
613 Ga0495597_0013576 3300046542 Bacteria 3897
614 Ga0495597_0016559 3300046542 Bacteria 3480
615 Ga0495597_0050686 3300046542 Bacteria 1831
616 Ga0495645_0061188 3300046543 Bacteria 2728
617 Ga0495645_0188451 3300046543 Bacteria 1408
618 Ga0495622_0002234 3300046557 Bacteria 9417
619 Ga0495622_0005946 3300046557 Bacteria 5670
620 Ga0495622_0029071 3300046557 Bacteria 2582
621 Ga0495622_0285102 3300046557 Bacteria 722
622 Ga0495633_0001530 3300046558 Bacteria 17765
623 Ga0495633_0003058 3300046558 Bacteria 11383
624 Ga0495633_0003182 3300046558 Bacteria 11089
625 Ga0495633_0007143 3300046558 Bacteria 6480
626 Ga0495633_0034047 3300046558 Bacteria 2452
627 Ga0495633_0063176 3300046558 Bacteria 1733
628 Ga0495633_0088896 3300046558 Bacteria 1436
629 Ga0495633_0117606 3300046558 Bacteria 1231
630 Ga0495667_0009980 3300046559 Bacteria 6430
631 Ga0495667_0024798 3300046559 Bacteria 4040
632 Ga0495667_0027230 3300046559 Bacteria 3853
633 Ga0495656_0008900 3300046615 Bacteria 3601
634 Ga0495656_0056582 3300046615 Bacteria 1695
635 Ga0495656_0059870 3300046615 Bacteria 1658
636 Ga0495656_0124220 3300046615 Bacteria 1222
637 Ga0495656_0125502 3300046615 Bacteria 1216
638 Ga0495656_0179770 3300046615 Bacteria 1039
639 Ga0495656_0532226 3300046615 Bacteria 625
640 Ga0495668_0000964 3300046616 Bacteria 31929
641 Ga0495668_0001840 3300046616 Bacteria 19132
642 Ga0495668_0006662 3300046616 Bacteria 7523
643 Ga0495668_0009969 3300046616 Bacteria 5787
644 Ga0495668_0022516 3300046616 Bacteria 3601
645 Ga0495668_0032092 3300046616 Bacteria 2957
646 Ga0495668_0036234 3300046616 Bacteria 2764
647 Ga0495668_0076125 3300046616 Bacteria 1843
648 Ga0495668_0167715 3300046616 Bacteria 1203
649 Ga0495668_0203139 3300046616 Bacteria 1085
650 Ga0495668_0334710 3300046616 Bacteria 830
651 Ga0495634_0001188 3300046642 Bacteria 24100
652 Ga0495634_0004312 3300046642 Bacteria 11213
653 Ga0495611_0003108 3300046648 Bacteria 7372
654 Ga0495611_0003333 3300046648 Bacteria 7094
655 Ga0495611_0013929 3300046648 Bacteria 3431
656 Ga0495611_0036925 3300046648 Bacteria 2170
657 Ga0495611_0042537 3300046648 Bacteria 2028
658 Ga0495611_0042733 3300046648 Bacteria 2024
659 Ga0495611_0065509 3300046648 Bacteria 1655
660 Ga0495611_0147430 3300046648 Bacteria 1098
661 Ga0495611_0229269 3300046648 Bacteria 863
662 Ga0495625_0032978 3300046660 Bacteria 3834
663 Ga0495625_0116766 3300046660 Bacteria 1820
664 Ga0495625_0161287 3300046660 Bacteria 1502
665 Ga0495625_0302718 3300046660 Bacteria 1022
666 Ga0495625_0390691 3300046660 Bacteria 871
667 Ga0495635_0001058 3300046663 Bacteria 18230
668 Ga0495635_0034215 3300046663 Bacteria 3524
669 Ga0495661_0000109 3300046665 Bacteria 97921
670 Ga0495661_0000756 3300046665 Bacteria 31283
671 Ga0495661_0003435 3300046665 Bacteria 11691
672 Ga0495661_0009524 3300046665 Bacteria 6664
673 Ga0495661_0012343 3300046665 Bacteria 5768
674 Ga0495661_0029379 3300046665 Bacteria 3509
675 Ga0495661_0065401 3300046665 Bacteria 2142
676 Ga0495661_0130086 3300046665 Bacteria 1380
677 Ga0495661_0132154 3300046665 Bacteria 1366
678 Ga0495661_0366347 3300046665 Bacteria 706
679 Ga0495588_0001308 3300046674 Bacteria 10654
680 Ga0495588_0004018 3300046674 Bacteria 6470
681 Ga0495588_0008498 3300046674 Bacteria 4717
682 Ga0495588_0029430 3300046674 Bacteria 2755
683 Ga0495588_0046506 3300046674 Bacteria 2226
684 Ga0495588_0082244 3300046674 Bacteria 1681
685 Ga0495588_0199455 3300046674 Bacteria 1057
686 Ga0495588_0452624 3300046674 Bacteria 673
687 Ga0495657_0011523 3300046675 Bacteria 6606
688 Ga0495599_0003523 3300046678 Bacteria 9167
689 Ga0495623_0003821 3300046679 Bacteria 9925
690 Ga0495623_0006259 3300046679 Bacteria 7742
691 Ga0495646_0000934 3300046680 Bacteria 16609
692 Ga0495646_0040703 3300046680 Bacteria 2860
693 Ga0495647_0033716 3300046681 Bacteria 1914
694 Ga0495658_0005872 3300046683 Bacteria 6026
695 Ga0495669_0000428 3300046684 Bacteria 19954
696 Ga0495669_0003196 3300046684 Bacteria 6745
697 Ga0495669_0005017 3300046684 Bacteria 5504
698 Ga0495669_0007731 3300046684 Bacteria 4512
699 Ga0495669_0026347 3300046684 Bacteria 2540
700 Ga0495669_0028325 3300046684 Bacteria 2453
701 Ga0495669_0280629 3300046684 Bacteria 801
702 Ga0495613_0023353 3300046689 Bacteria 4607
703 Ga0495613_0048777 3300046689 Bacteria 3127
704 Ga0495624_0025521 3300046690 Bacteria 3878
705 Ga0495670_0000682 3300046691 Bacteria 16132
706 Ga0495670_0002820 3300046691 Bacteria 8599
707 Ga0495670_0004362 3300046691 Bacteria 6938
708 Ga0495670_0049045 3300046691 Bacteria 2112
709 Ga0495670_0052263 3300046691 Bacteria 2045
710 Ga0495670_0092600 3300046691 Bacteria 1548
711 Ga0495670_0095577 3300046691 Bacteria 1524
712 Ga0495670_0175008 3300046691 Bacteria 1131
713 Ga0495670_0194324 3300046691 Bacteria 1073
714 Ga0495670_0211159 3300046691 Bacteria 1029
715 Ga0495671_0000002 3300046692 Bacteria 1136189
716 Ga0495671_0000188 3300046692 Bacteria 54628
717 Ga0495671_0007556 3300046692 Bacteria 6183
718 Ga0495671_0011166 3300046692 Bacteria 4954
719 Ga0495671_0023503 3300046692 Bacteria 3220
720 Ga0495671_0139708 3300046692 Bacteria 1180
721 Ga0495649_0000592 3300046694 Bacteria 30307
722 Ga0495649_0001690 3300046694 Bacteria 16347
723 Ga0495649_0109066 3300046694 Bacteria 1468
724 Ga0495589_0000270 3300046794 Bacteria 42191
725 Ga0495589_0000896 3300046794 Bacteria 18450
726 Ga0495589_0008749 3300046794 Bacteria 5270
727 Ga0495589_0014272 3300046794 Bacteria 4093
728 Ga0495589_0025680 3300046794 Bacteria 2988
729 Ga0495589_0063815 3300046794 Bacteria 1806
730 Ga0495589_0087135 3300046794 Bacteria 1516
731 Ga0495589_0122986 3300046794 Bacteria 1249
732 Ga0495589_0173172 3300046794 Bacteria 1025
733 Ga0495600_0001795 3300046809 Bacteria 11997
734 Ga0495600_0227149 3300046809 Bacteria 1193
735 Ga0495600_0296256 3300046809 Bacteria 1021
736 Ga0495660_0004522 3300046810 Bacteria 8403
737 Ga0495660_0009360 3300046810 Bacteria 5713
738 Ga0495660_0014959 3300046810 Bacteria 4487
739 Ga0495660_0015117 3300046810 Bacteria 4463
740 Ga0495660_0029577 3300046810 Bacteria 3089
741 Ga0495581_0000567 3300047315 Bacteria 19221
742 Ga0495581_0085193 3300047315 Bacteria 1831
743 Ga0495604_0013094 3300047317 Bacteria 6606
744 Ga0495604_0056371 3300047317 Bacteria 3025
745 Ga0495604_0091763 3300047317 Bacteria 2251
746 Ga0495674_0003114 3300047319 Bacteria 16114
747 Ga0495674_0007182 3300047319 Bacteria 10654
748 Ga0495674_0015961 3300047319 Bacteria 7010
749 Ga0495674_0269727 3300047319 Bacteria 1397
750 Ga0495672_0000067 3300047320 Bacteria 190335
751 Ga0495672_0017620 3300047320 Bacteria 4774
752 Ga0495672_0046495 3300047320 Bacteria 2588
753 Ga0495676_0000133 3300047321 Bacteria 56165
754 Ga0495676_0011969 3300047321 Bacteria 7828
755 Ga0495676_0088630 3300047321 Bacteria 2320
756 Ga0495676_0104552 3300047321 Bacteria 2089
757 Ga0495680_0029493 3300047322 Bacteria 4492
758 Ga0495680_0233868 3300047322 Bacteria 1307
759 Ga0495683_0000088 3300047323 Bacteria 92118
760 Ga0495683_0000348 3300047323 Bacteria 38313
761 Ga0495683_0017183 3300047323 Bacteria 3751
762 Ga0495683_0018228 3300047323 Bacteria 3631
763 Ga0495683_0033505 3300047323 Bacteria 2614
764 Ga0495683_0089908 3300047323 Bacteria 1489
765 Ga0495683_0104787 3300047323 Bacteria 1356
766 Ga0495687_000007 3300047443 Bacteria 552679
767 Ga0495687_001998 3300047443 Bacteria 17300
768 Ga0495687_036483 3300047443 Bacteria 2200
769 Ga0495687_045422 3300047443 Bacteria 1902
770 Ga0495675_0001019 3300047444 Bacteria 17022
771 Ga0495675_0002644 3300047444 Bacteria 10732
772 Ga0495675_0026954 3300047444 Bacteria 3663
773 Ga0495677_0000524 3300047445 Bacteria 16031
774 Ga0495677_0005313 3300047445 Bacteria 4885
775 Ga0495677_0007899 3300047445 Bacteria 3956
776 Ga0495677_0012584 3300047445 Bacteria 3085
777 Ga0495677_0018227 3300047445 Bacteria 2544
778 Ga0495677_0023029 3300047445 Bacteria 2260
779 Ga0495677_0028180 3300047445 Bacteria 2039
780 Ga0495677_0054320 3300047445 Bacteria 1477
781 Ga0495677_0138986 3300047445 Bacteria 932
782 Ga0495677_0142559 3300047445 Bacteria 920
783 Ga0495677_0171467 3300047445 Bacteria 839
784 Ga0495677_0303752 3300047445 Bacteria 628
785 Ga0495679_003371 3300047446 Bacteria 7700
786 Ga0495679_005786 3300047446 Bacteria 5441
787 Ga0495679_008614 3300047446 Bacteria 4132
788 Ga0495685_002234 3300047447 Bacteria 6032
789 Ga0495685_010013 3300047447 Bacteria 3174
790 Ga0495685_064187 3300047447 Bacteria 1235
791 Ga0495673_0000005 3300047469 Bacteria 943364
792 Ga0495673_0098160 3300047469 Bacteria 1188
793 Ga0495681_0001742 3300047470 Bacteria 16087
794 Ga0495681_0019307 3300047470 Bacteria 3726
795 Ga0495681_0023218 3300047470 Bacteria 3300
796 Ga0495681_0023251 3300047470 Bacteria 3297
797 Ga0495681_0033497 3300047470 Bacteria 2572
798 Ga0495681_0047331 3300047470 Bacteria 2046
799 Ga0495681_0086936 3300047470 Bacteria 1386
800 Ga0495681_0139715 3300047470 Bacteria 1024
801 Ga0495681_0176531 3300047470 Bacteria 880
802 Ga0495684_0172025 3300047471 Bacteria 1610
803 Ga0495686_0043573 3300047472 Bacteria 2844
804 Ga0495686_0065615 3300047472 Bacteria 2244
805 Ga0495686_0122044 3300047472 Bacteria 1552
806 Ga0495686_0197996 3300047472 Bacteria 1154
807 Ga0495593_0001714 3300047673 Bacteria 12977
808 Ga0495593_0002295 3300047673 Bacteria 11465
809 Ga0495593_0007370 3300047673 Bacteria 6445
810 Ga0495602_0004790 3300048088 Bacteria 14144
811 Ga0495602_0048110 3300048088 Bacteria 3836
812 Ga0495614_0008411 3300048089 Bacteria 4588
813 Ga0495614_0306796 3300048089 Bacteria 734
814 Ga0495615_0018636 3300048090 Bacteria 1531
815 Ga0495615_0062105 3300048090 Bacteria 988
816 Ga0495626_0004702 3300048091 Bacteria 8272
817 Ga0495626_0021843 3300048091 Bacteria 3169
818 Ga0495626_0022616 3300048091 Bacteria 3103
819 Ga0495626_0022823 3300048091 Bacteria 3088
820 Ga0495626_0025279 3300048091 Bacteria 2906
821 Ga0495626_0064476 3300048091 Bacteria 1659
822 Ga0495626_0087048 3300048091 Bacteria 1379
823 Ga0496100_0000756 3300048903 Bacteria 15379
824 Ga0496100_0013579 3300048903 Bacteria 4703
825 Ga0496100_0035542 3300048903 Bacteria 3135
826 Ga0496100_0130104 3300048903 Bacteria 1772
827 Ga0496101_0000383 3300048904 Bacteria 29305
828 Ga0496101_0000875 3300048904 Bacteria 17763
829 Ga0496101_0227712 3300048904 Bacteria 1448
830 Ga0496102_0000200 3300048905 Bacteria 81231
831 Ga0496102_0000313 3300048905 Bacteria 61085
832 Ga0496102_0009695 3300048905 Bacteria 8280
833 Ga0496102_0037392 3300048905 Bacteria 4379
834 Ga0496102_0103898 3300048905 Bacteria 2642
835 Ga0496102_0144879 3300048905 Bacteria 2229
836 Ga0496102_0248458 3300048905 Bacteria 1677
837 Ga0496102_0260370 3300048905 Bacteria 1635
838 Ga0496102_0826319 3300048905 Bacteria 849
839 Ga0496103_0006163 3300048906 Bacteria 7164
840 Ga0496103_0045139 3300048906 Bacteria 2719
841 Ga0496103_0065961 3300048906 Bacteria 2259
842 Ga0496104_0036083 3300048907 Bacteria 4618
843 Ga0496104_0208598 3300048907 Bacteria 1866
844 Ga0496104_0259806 3300048907 Bacteria 1649
845 Ga0496105_0015561 3300048908 Bacteria 6065
846 Ga0496105_0017743 3300048908 Bacteria 5710
847 Ga0496105_0101037 3300048908 Bacteria 2382
848 Ga0496105_0101141 3300048908 Bacteria 2380
849 Ga0496105_0406946 3300048908 Bacteria 1079
850 Ga0496105_0607796 3300048908 Bacteria 848
851 Ga0496106_0016638 3300048909 Bacteria 5441
852 Ga0496106_0132381 3300048909 Bacteria 1956
853 Ga0496106_0375713 3300048909 Bacteria 1142
854 Ga0496106_0520999 3300048909 Bacteria 955
855 Ga0496107_0015387 3300048910 Bacteria 5360
856 Ga0496107_0112310 3300048910 Bacteria 2003
857 Ga0496107_0149477 3300048910 Bacteria 1727
858 Ga0496107_0289462 3300048910 Bacteria 1219
859 Ga0496107_0406021 3300048910 Bacteria 1013
860 Ga0496108_0002192 3300048911 Bacteria 15654
861 Ga0496108_0059917 3300048911 Bacteria 3201
862 Ga0496108_0330641 3300048911 Bacteria 1329
863 Ga0496108_0542880 3300048911 Bacteria 1014
864 Ga0496109_0008485 3300048912 Bacteria 8735
865 Ga0496109_0010462 3300048912 Bacteria 7926
866 Ga0496109_0079860 3300048912 Bacteria 3014
867 Ga0496109_0189821 3300048912 Bacteria 1931
868 Ga0496110_0000024 3300048913 Bacteria 74685
869 Ga0496110_0026863 3300048913 Bacteria 4929
870 Ga0496110_0077327 3300048913 Bacteria 2960
871 Ga0496110_0172316 3300048913 Bacteria 1963
872 Ga0496111_0008455 3300048914 Bacteria 6815
873 Ga0496111_0018238 3300048914 Bacteria 4860
874 Ga0496111_0037599 3300048914 Bacteria 3464
875 Ga0496111_0083541 3300048914 Bacteria 2334
876 Ga0496111_0202373 3300048914 Bacteria 1476
877 Ga0496111_0211959 3300048914 Bacteria 1439
878 Ga0496112_0016391 3300048915 Bacteria 6941
879 Ga0496112_0109577 3300048915 Bacteria 2731
880 Ga0496113_0001312 3300048916 Bacteria 13745
881 Ga0496113_0004620 3300048916 Bacteria 8486
882 Ga0496113_0082648 3300048916 Bacteria 2463
883 Ga0496114_0004461 3300048917 Bacteria 10865
884 Ga0496114_0108754 3300048917 Bacteria 2373
885 Ga0496114_0222284 3300048917 Bacteria 1658
886 Ga0496114_0227293 3300048917 Bacteria 1639
887 Ga0496115_0009478 3300048918 Bacteria 7232
888 Ga0496115_0039849 3300048918 Bacteria 3733
889 Ga0496115_0042842 3300048918 Bacteria 3608
890 Ga0496115_0044759 3300048918 Bacteria 3533
891 Ga0496115_0083769 3300048918 Bacteria 2599
892 Ga0496115_0096445 3300048918 Bacteria 2421
893 Ga0496115_0196427 3300048918 Bacteria 1667
894 Ga0496116_0108802 3300048919 Bacteria 1636
895 Ga0496118_0045574 3300048921 Bacteria 3421
896 Ga0496119_0308491 3300048922 Bacteria 778
897 Ga0496120_0289418 3300048923 Bacteria 754
898 Ga0496121_0000330 3300048924 Bacteria 98687
899 Ga0496121_0118895 3300048924 Bacteria 1999
900 Ga0496121_0143226 3300048924 Bacteria 1770
901 Ga0496121_0228466 3300048924 Bacteria 1305
902 Ga0496121_0236094 3300048924 Bacteria 1277
903 Ga0496122_0001042 3300048925 Bacteria 48555
904 Ga0496122_0011608 3300048925 Bacteria 8893
905 Ga0496123_0113149 3300048926 Bacteria 1546
906 Ga0496123_0115403 3300048926 Bacteria 1524
907 Ga0496124_0011638 3300048927 Bacteria 8780
908 Ga0496124_0300059 3300048927 Bacteria 1161
909 Ga0496125_0159825 3300048928 Bacteria 1532
910 Ga0496126_0003590 3300048929 Bacteria 19439
911 Ga0496126_0004961 3300048929 Bacteria 15521
912 Ga0496126_0011183 3300048929 Bacteria 9314
913 Ga0496126_0014351 3300048929 Bacteria 8012
914 Ga0496126_0038390 3300048929 Bacteria 4457
915 Ga0496126_0066220 3300048929 Bacteria 3230
916 Ga0496126_0141728 3300048929 Bacteria 2068
917 Ga0496126_0221290 3300048929 Bacteria 1590
918 Ga0496126_0421703 3300048929 Bacteria 1079
919 Ga0496126_0508953 3300048929 Bacteria 961
920 Ga0495678_000161 3300049459 Bacteria 79941
921 Ga0495678_000355 3300049459 Bacteria 47179
922 Ga0495678_001988 3300049459 Bacteria 14725
923 Ga0495682_0000875 3300049460 Bacteria 18708
924 Ga0495682_0005708 3300049460 Bacteria 5138
925 Ga0495682_0016993 3300049460 Bacteria 2751
926 Ga0495682_0032460 3300049460 Bacteria 1928
927 Ga0495682_0068855 3300049460 Bacteria 1274
928 Ga0495682_0099785 3300049460 Bacteria 1041
929 Ga0501034_0000624 3300049571 Bacteria 55267
930 Ga0501037_0001018 3300049573 Bacteria 20737
931 Ga0501038_0024748 3300049574 Bacteria 5352
932 Ga0501039_0002397 3300049575 Bacteria 13940
933 Ga0501039_1186841 3300049575 Bacteria 590
934 Ga0501047_0004540 3300049581 Bacteria 13050
935 Ga0501067_0002495 3300049583 Bacteria 10169
936 Ga0501073_0031098 3300049589 Bacteria 3810
937 Ga0501080_0000032 3300049742 Bacteria 86373
938 Ga0501035_0000334 3300049822 Bacteria 54970
939 Ga0501035_0000676 3300049822 Bacteria 37272
940 Ga0501044_0000006 3300049823 Bacteria 291413
941 Ga0501044_0375652 3300049823 Bacteria 1337
942 Ga0501045_0069454 3300049824 Bacteria 2590
943 nmdc:mga03n38_12701_c1 3300050490 Bacteria 3178
944 nmdc:mga03n38_35358_c1 3300050490 Bacteria 2139
945 nmdc:mga00v17_355964_c1 3300050491 Bacteria 952
946 nmdc:mga0yw44_148399_c1 3300050492 Bacteria 1528
947 nmdc:mga0yw44_162553_c1 3300050492 Bacteria 1462
948 nmdc:mga0yw44_259422_c1 3300050492 Bacteria 1158
949 nmdc:mga0k408_107657_c1 3300050493 Bacteria 1646
950 nmdc:mga06z11_160840_c1 3300050494 Bacteria 1283
951 nmdc:mga06z11_5269_c1 3300050494 Bacteria 5174
952 nmdc:mga06z11_531070_c1 3300050494 Bacteria 714
953 nmdc:mga04h51_216655_c1 3300050495 Bacteria 757
954 nmdc:mga07m45_283840_c1 3300050496 Bacteria 963
955 nmdc:mga07m45_53498_c1 3300050496 Bacteria 2281
956 nmdc:mga05p37_58216_c1 3300050507 Bacteria 4759
957 nmdc:mga0n895_76791_c1 3300050512 Bacteria 3321
958 nmdc:mga0rr50_497561_c1 3300050513 Bacteria 1036
959 nmdc:mga0sz30_248060_c1 3300050516 Bacteria 792
960 Ga0495601_0016288 3300053077 Bacteria 4504
961 Ga0495601_0177990 3300053077 Bacteria 1391
962 Ga0500635_0027844 3300053080 Bacteria 1800
963 Ga0495655_0004786 3300053083 Bacteria 2344
964 Ga0495655_0095203 3300053083 Bacteria 874
965 Ga0495595_0000335 3300053084 Bacteria 18133
966 Ga0495619_0001292 3300053085 Bacteria 16456
967 Ga0500647_0014839 3300053091 Bacteria 3551
968 Ga0500583_0068458 3300053092 Bacteria 1693
969 Ga0500651_0004019 3300053093 Bacteria 8166
970 Ga0500566_0011427 3300053094 Bacteria 5229
971 Ga0500641_0076732 3300053096 Bacteria 1413
972 Ga0500650_0131221 3300053098 Bacteria 1165
973 Ga0500554_018197 3300053102 Bacteria 1892
974 Ga0500554_131659 3300053102 Bacteria 845
975 Ga0500556_0047237 3300053104 Bacteria 1544
976 Ga0500562_063611 3300053108 Bacteria 992
977 Ga0500592_027325 3300053116 Bacteria 920
978 Ga0500595_000468 3300053119 Bacteria 24982
979 Ga0500595_005272 3300053119 Bacteria 5666
980 Ga0500595_013495 3300053119 Bacteria 3128
981 Ga0500595_025974 3300053119 Bacteria 2023
982 Ga0500595_035010 3300053119 Bacteria 1657
983 Ga0500597_205653 3300053120 Bacteria 825
984 Ga0500618_000419 3300053125 Bacteria 28610
985 Ga0500658_0130238 3300053134 Bacteria 1121
986 Ga0500568_0003017 3300053139 Bacteria 9628
987 Ga0500579_190500 3300053143 Bacteria 783
988 Ga0500589_111338 3300053147 Bacteria 1173
989 Ga0500604_0056262 3300053151 Bacteria 1225
990 Ga0500604_0105218 3300053151 Bacteria 933
991 Ga0500622_0041926 3300053156 Bacteria 2380
992 Ga0500622_0217827 3300053156 Bacteria 858
993 Ga0500633_0094403 3300053160 Bacteria 1096
994 Ga0500638_002107 3300053162 Bacteria 6750
995 Ga0500638_068294 3300053162 Bacteria 1702
996 Ga0500637_0000546 3300053178 Bacteria 14728
997 Ga0500661_000782 3300055283 Bacteria 5933
998 2513659354 2513237096 Bacteria 8722461
999 2513672836 2513237098 Bacteria 9902361
1000 2513861725 2513237137 Bacteria 9558895
1001 2513921384 2513237145 Bacteria 8979722
1002 2517893702 2517572143 Bacteria 9484767
1003 2524469935 2524023210 Bacteria 9029266
1004 2524535897 2524023228 Bacteria 10118060
1005 2643801567 2643221556 Bacteria 7251154
1006 2644471372 2643221684 Bacteria 7145183
1007 2671693986 2671180139 Bacteria 4196045
1008 2728752844 2728368998 Bacteria 8720350
1009 2857568876 2857564685 Bacteria 6290584
1010 2885389614 2885383462 Bacteria 9473874
1011 2902409270 2902405164 Bacteria 6784948
1012 2903756283 2903748898 Bacteria 9972761
1013 2903756677 2903748898 Bacteria 9972761
1014 2903774319 2903768456 Bacteria 9749579
1015 2904701399
1016 2906641898 2906635258 Bacteria 8601019
1017 2906666089 2906660503 Bacteria 8595048
1018 3005478882 3005474847 Bacteria 9259049
1019 643592634 643348564 Bacteria 8839022
1020 8056687755 8056681323 Bacteria 8472857
1021 Ga0395905_0392592
1022 JGI25165J46597_1000006
1023 JGI25404J52841_10000254
1024 Ga0065165_1010810
1025 Ga0070658_10068107
1026 Ga0070658_10547925
1027 Ga0070658_10852956
1028 Ga0070676_10950368
1029 Ga0070683_100020118
1030 Ga0070683_100387791
1031 Ga0070690_100629919
1032 Ga0068869_100017200
1033 Ga0070680_100043042
1034 Ga0070682_100042469
1035 Ga0070682_100157416
1036 Ga0068868_100006547
1037 Ga0068868_100069042
1038 Ga0068868_100203216
1039 Ga0070660_100228899
1040 Ga0070660_100386908
1041 Ga0070660_100824176
1042 Ga0070660_101232277
1043 Ga0070689_100230654
1044 Ga0070689_100574766
1045 Ga0070691_10111683
1046 Ga0070661_100149234
1047 Ga0070661_100189925
1048 Ga0070668_100045256
1049 Ga0070668_100104644
1050 Ga0070668_100182551
1051 Ga0070668_100409293
1052 Ga0070668_101059470
1053 Ga0070675_101180122
1054 Ga0070671_100267604
1055 Ga0070671_101078679
1056 Ga0070674_100021173
1057 Ga0070674_100142087
1058 Ga0070688_100518703
1059 Ga0070659_100285174
1060 Ga0070659_100483469
1061 Ga0070667_100244921
1062 Ga0070667_100830546
1063 Ga0070701_10104741
1064 Ga0070701_10150986
1065 Ga0070694_100626303
1066 Ga0070663_100016240
1067 Ga0070663_100020052
1068 Ga0070663_100020229
1069 Ga0070663_100123056
1070 Ga0070678_100003659
1071 Ga0070678_100017610
1072 Ga0070678_100037277
1073 Ga0070678_100067668
1074 Ga0070678_100596432
1075 Ga0070678_101004192
1076 Ga0070681_10058589
1077 Ga0068867_100049914
1078 Ga0070699_100857343
1079 Ga0070679_100021982
1080 Ga0070679_100897741
1081 Ga0070684_100032764
1082 Ga0070684_100132369
1083 Ga0070684_101162130
1084 Ga0068853_100014537
1085 Ga0068853_100205235
1086 Ga0068853_100391277
1087 Ga0068853_100981262
1088 Ga0070672_100215342
1089 Ga0070672_100670484
1090 Ga0070686_100643605
1091 Ga0070693_100091362
1092 Ga0070693_100715250
1093 Ga0070665_100044315
1094 Ga0070665_100075092
1095 Ga0070665_100356918
1096 Ga0070704_100137670
1097 Ga0068855_100014574
1098 Ga0068855_100066675
1099 Ga0068855_100511759
1100 Ga0070664_100010213
1101 Ga0070664_100021262
1102 Ga0070664_100338419
1103 Ga0070664_100360249
1104 Ga0070664_100603872
1105 Ga0070664_100656011
1106 Ga0070664_101165996
1107 Ga0068857_100066317
1108 Ga0068856_100107887
1109 Ga0068856_100448795
1110 Ga0070702_100061421
1111 Ga0068852_100022692
1112 Ga0068859_100237233
1113 Ga0068864_100029384
1114 Ga0068864_100073671
1115 Ga0068864_100484821
1116 Ga0068861_100052716
1117 Ga0068861_100259325
1118 Ga0068863_100133864
1119 Ga0068863_100554868
1120 Ga0068858_100023425
1121 Ga0068858_100060057
1122 Ga0068858_100512257
1123 Ga0068860_100292362
1124 Ga0068860_101064641
1125 Ga0068862_100744702
1126 Ga0081455_10027227
1127 Ga0081540_1002053
1128 Ga0081540_1003838
1129 Ga0081540_1005208
1130 Ga0081540_1007807
1131 Ga0081540_1011448
1132 Ga0081540_1053737
1133 Ga0081540_1088971
1134 Ga0070717_10268386
1135 Ga0075365_10114109
1136 Ga0075365_10199133
1137 Ga0075365_10543491
1138 Ga0075368_10002535
1139 Ga0075368_10194609
1140 Ga0075363_100070718
1141 Ga0075363_100084189
1142 Ga0075364_10180614
1143 Ga0070716_100286611
1144 Ga0070716_100564558
1145 Ga0070712_100098016
1146 Ga0070712_100194272
1147 Ga0075362_10062304
1148 Ga0075362_10191086
1149 Ga0075367_10165209
1150 Ga0075367_10264097
1151 Ga0075369_10073823
1152 Ga0075369_10083370
1153 Ga0075369_10340680
1154 Ga0075366_10173916
1155 Ga0075366_10460445
1156 Ga0097621_100045438
1157 Ga0097621_100097225
1158 Ga0068871_100031318
1159 Ga0068871_100925971
1160 Ga0068865_100039829
1161 Ga0068865_100442397
1162 Ga0097620_100237229
1163 Ga0075435_100040178
1164 Ga0099794_10029377
1165 Ga0099795_10001567
1166 Ga0105251_10099205
1167 Ga0105250_10227237
1168 Ga0105240_10245861
1169 Ga0105245_10027787
1170 Ga0105245_10186930
1171 Ga0105245_10266547
1172 Ga0105245_10642134
1173 Ga0105247_10160166
1174 Ga0105243_10011026
1175 Ga0105243_10194224
1176 Ga0105241_10022807
1177 Ga0105242_10056727
1178 Ga0105242_10214044
1179 Ga0105248_10034971
1180 Ga0105248_10578130
1181 Ga0105248_11586612
1182 Ga0105237_10043449
1183 Ga0105237_10167236
1184 Ga0105237_10726337
1185 Ga0105238_10152073
1186 Ga0105238_10193575
1187 Ga0105238_10441350
1188 Ga0105249_10071994
1189 Ga0099796_10004654
1190 Ga0105239_10010954
1191 Ga0105239_10058369
1192 Ga0105239_10120429
1193 Ga0105239_10503863
1194 Ga0105239_11076959
1195 Ga0105246_10020290
1196 Ga0105246_10068823
1197 Ga0157370_10034059
1198 Ga0157369_10002265
1199 Ga0157369_10016093
1200 Ga0157369_10975869
1201 Ga0157374_10003326
1202 Ga0157378_10260553
1203 Ga0163162_10015168
1204 Ga0163162_10055092
1205 Ga0163162_10116218
1206 Ga0157372_10041023
1207 Ga0157372_11140579
1208 Ga0157375_10008539
1209 Ga0157375_10309505
1210 Ga0163163_10003792
1211 Ga0163163_10007553
1212 Ga0163163_10607263
1213 Ga0157380_10019544
1214 Ga0157380_10334323
1215 Ga0157377_10369375
1216 Ga0157379_10385425
1217 Ga0157376_10017469
1218 Ga0157376_10645767
1219 Ga0163161_10021099
1220 Ga0213874_10049416
1221 Ga0209233_1000010
1222 Ga0209758_1001532
1223 Ga0209758_1003142
1224 Ga0209758_1045817
1225 Ga0207642_10248740
1226 Ga0207688_10104915
1227 Ga0207680_10609889
1228 Ga0207647_10161105
1229 Ga0207685_10367371
1230 Ga0207699_10464097
1231 Ga0207645_10087751
1232 Ga0207645_10401305
1233 Ga0207643_10033308
1234 Ga0207705_10057990
1235 Ga0207705_10138765
1236 Ga0207684_10670595
1237 Ga0207695_10137206
1238 Ga0207671_10192869
1239 Ga0207693_10050481
1240 Ga0207693_10066564
1241 Ga0207660_10163892
1242 Ga0207662_10115102
1243 Ga0207657_10036254
1244 Ga0207657_10240292
1245 Ga0207657_10321342
1246 Ga0207652_10068496
1247 Ga0207652_10156528
1248 Ga0207652_11039463
1249 Ga0207694_10326021
1250 Ga0207694_10789944
1251 Ga0207687_10075061
1252 Ga0207687_10358550
1253 Ga0207700_11515884
1254 Ga0207644_10119591
1255 Ga0207644_10496015
1256 Ga0207644_10837271
1257 Ga0207690_10034215
1258 Ga0207690_10247079
1259 Ga0207690_10357911
1260 Ga0207706_10060448
1261 Ga0207706_10360749
1262 Ga0207686_10062197
1263 Ga0207686_10251825
1264 Ga0207709_10028413
1265 Ga0207709_10041029
1266 Ga0207709_10067476
1267 Ga0207669_10012350
1268 Ga0207669_10042118
1269 Ga0207704_10340194
1270 Ga0207704_10369105
1271 Ga0207665_10225069
1272 Ga0207691_10059924
1273 Ga0207691_10469567
1274 Ga0207711_10518245
1275 Ga0207689_10075529
1276 Ga0207689_10091812
1277 Ga0207661_10028832
1278 Ga0207661_10615357
1279 Ga0207679_10048953
1280 Ga0207679_10206649
1281 Ga0207679_10781411
1282 Ga0207667_10010756
1283 Ga0207667_10015015
1284 Ga0207667_10074694
1285 Ga0207667_10596978
1286 Ga0207667_10810644
1287 Ga0207651_10091652
1288 Ga0207712_10124192
1289 Ga0207712_10446352
1290 Ga0207668_10019967
1291 Ga0207668_10036022
1292 Ga0207640_10041183
1293 Ga0207640_10284821
1294 Ga0207640_11158955
1295 Ga0207658_10317607
1296 Ga0207658_10632690
1297 Ga0207677_10011044
1298 Ga0207677_10091669
1299 Ga0207703_10400935
1300 Ga0207639_10085807
1301 Ga0207639_10127272
1302 Ga0207639_10203783
1303 Ga0207678_10010552
1304 Ga0207678_10022770
1305 Ga0207678_10130148
1306 Ga0207678_10162237
1307 Ga0207678_10203891
1308 Ga0207678_10585696
1309 Ga0207678_10943429
1310 Ga0207708_10184300
1311 Ga0207702_10167160
1312 Ga0207702_10628896
1313 Ga0207702_11400893
1314 Ga0207641_10062468
1315 Ga0207641_10630022
1316 Ga0207648_10197558
1317 Ga0207676_10388555
1318 Ga0207674_10048154
1319 Ga0207674_10111119
1320 Ga0207675_100101117
1321 Ga0207675_100111822
1322 Ga0207675_100199723
1323 Ga0207683_10014660
1324 Ga0207683_10044880
1325 Ga0207683_10055468
1326 Ga0207683_10872965
1327 Ga0207698_10021492
1328 Ga0207698_11146487
1329 Ga0268266_10016992
1330 Ga0268266_10019219
1331 Ga0268266_10088956
1332 Ga0268265_10735162
1333 Ga0268264_10917113
1334 Ga0268264_11060705
1335 Ga0265328_10029964
1336 Ga0265316_10753675
1337 Ga0307513_10193775
1338 Ga0265342_10079738
1339 Ga0307516_10213055
1340 Ga0307405_10229563
1341 Ga0307405_10389791
1342 Ga0307406_10067061
1343 Ga0307407_10874170
1344 Ga0307411_10015152
1345 Ga0307411_10332095
1346 Ga0307415_100020263
1347 Ga0307415_100058419
1348 Ga0307415_100067328
1349 Ga0307510_10009746
1350 Ga0315911_1000009
1351 Ga0373926_0069057
1352 Ga0373929_0064173
1353 Ga0373940_0120457
1354 Ga0373923_0000827
1355 Ga0373923_0017518
1356 Ga0373932_0105103
1357 Ga0373954_0000634
1358 Ga0373954_0108046
1359 Ga0373957_0000200
1360 Ga0373943_0082196
1361 Ga0373943_0230692
1362 Ga0373946_0005979
1363 Ga0373946_0007758
1364 Ga0373946_0078970
1365 Ga0373955_0014279
1366 Ga0373961_0122618
1367 Ga0373962_0114226
1368 Ga0373924_0047567
1369 Ga0373924_0052392
1370 Ga0373931_0050522
1371 Ga0373935_0021939
1372 Ga0373935_0103925
1373 Ga0373927_0001513
1374 Ga0373927_0023260
1375 Ga0373927_0026102
1376 Ga0373927_0044399
1377 Ga0373927_0054881
1378 Ga0373933_0002159
1379 Ga0373933_0055833
1380 Ga0373947_0014848
1381 Ga0373947_0019002
1382 Ga0373947_0137638
1383 Ga0373937_0014785
1384 Ga0373937_0035531
1385 Ga0372808_001672
1386 Ga0373925_0006671
1387 Ga0373925_0069441
1388 Ga0395899_0013951
1389 Ga0395899_0153576
1390 Ga0395899_0362797
1391 Ga0395900_0000513
1392 Ga0395900_0035219
1393 Ga0395900_0061053
1394 Ga0395900_0387966
1395 Ga0395900_0656086
1396 Ga0395900_1109174
1397 Ga0395898_0081232
1398 Ga0395898_0175025
1399 Ga0395898_0178184
1400 Ga0395905_0189218
1401 Ga0395905_0754576
1402 Ga0395901_0000019
1403 Ga0395901_0248570
1404 Ga0395901_0822174
1405 Ga0395901_0835613
1406 Ga0436365_0172063
1407 Ga0436365_1338213
1408 Ga0436360_0861292
1409 Ga0436360_0985690
1410 Ga0436361_0809888
1411 Ga0436361_1180484
1412 Ga0436363_0288172
1413 Ga0436362_0350328
1414 Ga0451802_1429738
1415 Ga0451853_1746509
1416 Ga0439449_0006107
1417 Ga0439458_0099349
1418 Ga0466963_0132864
1419 Ga0453684_0275687
1420 Ga0466970_0247224
1421 Ga0466967_0530472
1422 Ga0495617_000034
1423 Ga0495617_000099
1424 Ga0495617_019330
1425 Ga0495617_067182
1426 Ga0495627_000208
1427 Ga0495627_041161
1428 Ga0495627_052601
1429 Ga0495627_090729
1430 Ga0495592_0002897
1431 Ga0495603_0013589
1432 Ga0495603_0017151
1433 Ga0495603_0022018
1434 Ga0495603_0034420
1435 Ga0495603_0238001
1436 Ga0495590_0000087
1437 Ga0495590_0000195
1438 Ga0495591_000272
1439 Ga0495629_0002158
1440 Ga0495629_0004330
1441 Ga0495629_0012878
1442 Ga0495629_0051582
1443 Ga0495629_0368919
1444 Ga0495629_0420767
1445 Ga0495638_0007685
1446 Ga0495638_0054741
1447 Ga0495638_0065792
1448 Ga0495638_0442641
1449 Ga0495641_0019593
1450 Ga0495653_0017446
1451 Ga0495653_0029478
1452 Ga0495650_0008607
1453 Ga0495580_0006344
1454 Ga0495580_0011640
1455 Ga0495580_0210368
1456 Ga0495582_0005475
1457 Ga0495582_0201669
1458 Ga0495605_0000151
1459 Ga0495605_0016177
1460 Ga0495605_0044051
1461 Ga0495605_0064313
1462 Ga0495639_0000750
1463 Ga0495639_0047445
1464 Ga0495639_0076527
1465 Ga0495639_0189724
1466 Ga0495662_0002275
1467 Ga0495664_0136401
1468 Ga0495584_0000011
1469 Ga0495584_0000122
1470 Ga0495584_0000253
1471 Ga0495584_0001524
1472 Ga0495584_0031573
1473 Ga0495584_0062179
1474 Ga0495584_0096553
1475 Ga0495584_0266080
1476 Ga0495585_0000106
1477 Ga0495585_0000970
1478 Ga0495585_0001684
1479 Ga0495585_0004203
1480 Ga0495585_0005123
1481 Ga0495585_0017233
1482 Ga0495585_0018938
1483 Ga0495585_0019025
1484 Ga0495585_0019036
1485 Ga0495585_0029478
1486 Ga0495585_0031323
1487 Ga0495585_0066304
1488 Ga0495585_0078345
1489 Ga0495585_0185981
1490 Ga0495585_0255932
1491 Ga0495594_0001313
1492 Ga0495594_0003799
1493 Ga0495594_0005644
1494 Ga0495594_0017845
1495 Ga0495594_0375214
1496 Ga0495594_0424400
1497 Ga0495596_0004070
1498 Ga0495596_0007869
1499 Ga0495596_0008479
1500 Ga0495596_0015995
1501 Ga0495596_0036879
1502 Ga0495596_0041152
1503 Ga0495596_0098748
1504 Ga0495607_0002166
1505 Ga0495607_0002563
1506 Ga0495607_0003376
1507 Ga0495607_0012182
1508 Ga0495607_0019414
1509 Ga0495607_0030467
1510 Ga0495607_0072805
1511 Ga0495607_0156498
1512 Ga0495607_0314709
1513 Ga0495583_0000204
1514 Ga0495583_0001947
1515 Ga0495583_0003375
1516 Ga0495583_0011654
1517 Ga0495583_0012646
1518 Ga0495583_0015773
1519 Ga0495583_0033630
1520 Ga0495583_0087005
1521 Ga0495583_0093991
1522 Ga0495583_0101745
1523 Ga0495583_0245142
1524 Ga0495606_0003022
1525 Ga0495606_0009057
1526 Ga0495606_0037190
1527 Ga0495606_0042285
1528 Ga0495606_0061305
1529 Ga0495606_0070449
1530 Ga0495606_0073789
1531 Ga0495606_0078340
1532 Ga0495606_0089486
1533 Ga0495606_0104556
1534 Ga0495606_0189315
1535 Ga0495608_0002218
1536 Ga0495608_0364113
1537 Ga0495610_0000010
1538 Ga0495610_0001106
1539 Ga0495616_0000557
1540 Ga0495616_0001082
1541 Ga0495616_0001767
1542 Ga0495616_0004439
1543 Ga0495616_0004788
1544 Ga0495616_0008025
1545 Ga0495616_0029968
1546 Ga0495616_0091184
1547 Ga0495616_0106768
1548 Ga0495616_0124937
1549 Ga0495618_0153370
1550 Ga0495618_0373451
1551 Ga0495620_0003033
1552 Ga0495620_0070690
1553 Ga0495628_0038487
1554 Ga0495628_0296188
1555 Ga0495630_0046427
1556 Ga0495630_0403815
1557 Ga0495631_0000551
1558 Ga0495631_0000979
1559 Ga0495631_0001182
1560 Ga0495631_0002486
1561 Ga0495631_0014266
1562 Ga0495631_0015202
1563 Ga0495631_0020921
1564 Ga0495631_0041332
1565 Ga0495631_0054873
1566 Ga0495631_0060127
1567 Ga0495631_0130590
1568 Ga0495631_0225107
1569 Ga0495632_0000592
1570 Ga0495632_0001130
1571 Ga0495632_0002839
1572 Ga0495632_0005473
1573 Ga0495637_0000013
1574 Ga0495637_0000071
1575 Ga0495637_0032837
1576 Ga0495637_0149804
1577 Ga0495643_0009062
1578 Ga0495643_0016864
1579 Ga0495643_0082769
1580 Ga0495643_0171529
1581 Ga0495643_0173629
1582 Ga0495644_0007520
1583 Ga0495644_0011332
1584 Ga0495644_0014082
1585 Ga0495644_0029663
1586 Ga0495644_0029840
1587 Ga0495648_0000410
1588 Ga0495648_0001182
1589 Ga0495648_0010568
1590 Ga0495648_0012573
1591 Ga0495648_0021834
1592 Ga0495648_0200071
1593 Ga0495663_0084016
1594 Ga0495666_0004146
1595 Ga0495666_0020165
1596 Ga0495642_0000127
1597 Ga0495642_0000327
1598 Ga0495642_0004101
1599 Ga0495642_0009709
1600 Ga0495642_0011532
1601 Ga0495642_0020857
1602 Ga0495642_0024380
1603 Ga0495642_0045565
1604 Ga0495642_0052619
1605 Ga0495642_0088070
1606 Ga0495642_0134778
1607 Ga0495652_0008518
1608 Ga0495652_0034244
1609 Ga0495652_0038809
1610 Ga0495652_0245712
1611 Ga0495654_0000002
1612 Ga0495654_0017562
1613 Ga0495654_0022822
1614 Ga0495654_0277367
1615 Ga0495665_0007507
1616 Ga0495665_0157783
1617 Ga0495665_0171516
1618 Ga0495640_0005616
1619 Ga0495640_0007861
1620 Ga0495586_0001930
1621 Ga0495586_0015457
1622 Ga0495587_0009572
1623 Ga0495587_0025519
1624 Ga0495609_0003245
1625 Ga0495609_0010758
1626 Ga0495609_0013376
1627 Ga0495609_0029965
1628 Ga0495609_0043776
1629 Ga0495609_0049508
1630 Ga0495609_0080498
1631 Ga0495609_0114220
1632 Ga0495597_0001550
1633 Ga0495597_0013576
1634 Ga0495597_0016559
1635 Ga0495597_0050686
1636 Ga0495645_0061188
1637 Ga0495645_0188451
1638 Ga0495622_0002234
1639 Ga0495622_0005946
1640 Ga0495622_0029071
1641 Ga0495622_0285102
1642 Ga0495633_0001530
1643 Ga0495633_0003058
1644 Ga0495633_0003182
1645 Ga0495633_0007143
1646 Ga0495633_0034047
1647 Ga0495633_0063176
1648 Ga0495633_0088896
1649 Ga0495633_0117606
1650 Ga0495667_0009980
1651 Ga0495667_0024798
1652 Ga0495667_0027230
1653 Ga0495656_0008900
1654 Ga0495656_0056582
1655 Ga0495656_0059870
1656 Ga0495656_0124220
1657 Ga0495656_0125502
1658 Ga0495656_0179770
1659 Ga0495656_0532226
1660 Ga0495668_0000964
1661 Ga0495668_0001840
1662 Ga0495668_0006662
1663 Ga0495668_0009969
1664 Ga0495668_0022516
1665 Ga0495668_0032092
1666 Ga0495668_0036234
1667 Ga0495668_0076125
1668 Ga0495668_0167715
1669 Ga0495668_0203139
1670 Ga0495668_0334710
1671 Ga0495634_0001188
1672 Ga0495634_0004312
1673 Ga0495611_0003108
1674 Ga0495611_0003333
1675 Ga0495611_0013929
1676 Ga0495611_0036925
1677 Ga0495611_0042537
1678 Ga0495611_0042733
1679 Ga0495611_0065509
1680 Ga0495611_0147430
1681 Ga0495611_0229269
1682 Ga0495625_0032978
1683 Ga0495625_0116766
1684 Ga0495625_0161287
1685 Ga0495625_0302718
1686 Ga0495625_0390691
1687 Ga0495635_0001058
1688 Ga0495635_0034215
1689 Ga0495661_0000109
1690 Ga0495661_0000756
1691 Ga0495661_0003435
1692 Ga0495661_0009524
1693 Ga0495661_0012343
1694 Ga0495661_0029379
1695 Ga0495661_0065401
1696 Ga0495661_0130086
1697 Ga0495661_0132154
1698 Ga0495661_0366347
1699 Ga0495588_0001308
1700 Ga0495588_0004018
1701 Ga0495588_0008498
1702 Ga0495588_0029430
1703 Ga0495588_0046506
1704 Ga0495588_0082244
1705 Ga0495588_0199455
1706 Ga0495588_0452624
1707 Ga0495657_0011523
1708 Ga0495599_0003523
1709 Ga0495623_0003821
1710 Ga0495623_0006259
1711 Ga0495646_0000934
1712 Ga0495646_0040703
1713 Ga0495647_0033716
1714 Ga0495658_0005872
1715 Ga0495669_0000428
1716 Ga0495669_0003196
1717 Ga0495669_0005017
1718 Ga0495669_0007731
1719 Ga0495669_0026347
1720 Ga0495669_0028325
1721 Ga0495669_0280629
1722 Ga0495613_0023353
1723 Ga0495613_0048777
1724 Ga0495624_0025521
1725 Ga0495670_0000682
1726 Ga0495670_0002820
1727 Ga0495670_0004362
1728 Ga0495670_0049045
1729 Ga0495670_0052263
1730 Ga0495670_0092600
1731 Ga0495670_0095577
1732 Ga0495670_0175008
1733 Ga0495670_0194324
1734 Ga0495670_0211159
1735 Ga0495671_0000002
1736 Ga0495671_0000188
1737 Ga0495671_0007556
1738 Ga0495671_0011166
1739 Ga0495671_0023503
1740 Ga0495671_0139708
1741 Ga0495649_0000592
1742 Ga0495649_0001690
1743 Ga0495649_0109066
1744 Ga0495589_0000270
1745 Ga0495589_0000896
1746 Ga0495589_0008749
1747 Ga0495589_0014272
1748 Ga0495589_0025680
1749 Ga0495589_0063815
1750 Ga0495589_0087135
1751 Ga0495589_0122986
1752 Ga0495589_0173172
1753 Ga0495600_0001795
1754 Ga0495600_0227149
1755 Ga0495600_0296256
1756 Ga0495660_0004522
1757 Ga0495660_0009360
1758 Ga0495660_0014959
1759 Ga0495660_0015117
1760 Ga0495660_0029577
1761 Ga0495581_0000567
1762 Ga0495581_0085193
1763 Ga0495604_0013094
1764 Ga0495604_0056371
1765 Ga0495604_0091763
1766 Ga0495674_0003114
1767 Ga0495674_0007182
1768 Ga0495674_0015961
1769 Ga0495674_0269727
1770 Ga0495672_0000067
1771 Ga0495672_0017620
1772 Ga0495672_0046495
1773 Ga0495676_0000133
1774 Ga0495676_0011969
1775 Ga0495676_0088630
1776 Ga0495676_0104552
1777 Ga0495680_0029493
1778 Ga0495680_0233868
1779 Ga0495683_0000088
1780 Ga0495683_0000348
1781 Ga0495683_0017183
1782 Ga0495683_0018228
1783 Ga0495683_0033505
1784 Ga0495683_0089908
1785 Ga0495683_0104787
1786 Ga0495687_000007
1787 Ga0495687_001998
1788 Ga0495687_036483
1789 Ga0495687_045422
1790 Ga0495675_0001019
1791 Ga0495675_0002644
1792 Ga0495675_0026954
1793 Ga0495677_0000524
1794 Ga0495677_0005313
1795 Ga0495677_0007899
1796 Ga0495677_0012584
1797 Ga0495677_0018227
1798 Ga0495677_0023029
1799 Ga0495677_0028180
1800 Ga0495677_0054320
1801 Ga0495677_0138986
1802 Ga0495677_0142559
1803 Ga0495677_0171467
1804 Ga0495677_0303752
1805 Ga0495679_003371
1806 Ga0495679_005786
1807 Ga0495679_008614
1808 Ga0495685_002234
1809 Ga0495685_010013
1810 Ga0495685_064187
1811 Ga0495673_0000005
1812 Ga0495673_0098160
1813 Ga0495681_0001742
1814 Ga0495681_0019307
1815 Ga0495681_0023218
1816 Ga0495681_0023251
1817 Ga0495681_0033497
1818 Ga0495681_0047331
1819 Ga0495681_0086936
1820 Ga0495681_0139715
1821 Ga0495681_0176531
1822 Ga0495684_0172025
1823 Ga0495686_0043573
1824 Ga0495686_0065615
1825 Ga0495686_0122044
1826 Ga0495686_0197996
1827 Ga0495593_0001714
1828 Ga0495593_0002295
1829 Ga0495593_0007370
1830 Ga0495602_0004790
1831 Ga0495602_0048110
1832 Ga0495614_0008411
1833 Ga0495614_0306796
1834 Ga0495615_0018636
1835 Ga0495615_0062105
1836 Ga0495626_0004702
1837 Ga0495626_0021843
1838 Ga0495626_0022616
1839 Ga0495626_0022823
1840 Ga0495626_0025279
1841 Ga0495626_0064476
1842 Ga0495626_0087048
1843 Ga0496100_0000756
1844 Ga0496100_0013579
1845 Ga0496100_0035542
1846 Ga0496100_0130104
1847 Ga0496101_0000383
1848 Ga0496101_0000875
1849 Ga0496101_0227712
1850 Ga0496102_0000200
1851 Ga0496102_0000313
1852 Ga0496102_0009695
1853 Ga0496102_0037392
1854 Ga0496102_0103898
1855 Ga0496102_0144879
1856 Ga0496102_0248458
1857 Ga0496102_0260370
1858 Ga0496102_0826319
1859 Ga0496103_0006163
1860 Ga0496103_0045139
1861 Ga0496103_0065961
1862 Ga0496104_0036083
1863 Ga0496104_0208598
1864 Ga0496104_0259806
1865 Ga0496105_0015561
1866 Ga0496105_0017743
1867 Ga0496105_0101037
1868 Ga0496105_0101141
1869 Ga0496105_0406946
1870 Ga0496105_0607796
1871 Ga0496106_0016638
1872 Ga0496106_0132381
1873 Ga0496106_0375713
1874 Ga0496106_0520999
1875 Ga0496107_0015387
1876 Ga0496107_0112310
1877 Ga0496107_0149477
1878 Ga0496107_0289462
1879 Ga0496107_0406021
1880 Ga0496108_0002192
1881 Ga0496108_0059917
1882 Ga0496108_0330641
1883 Ga0496108_0542880
1884 Ga0496109_0008485
1885 Ga0496109_0010462
1886 Ga0496109_0079860
1887 Ga0496109_0189821
1888 Ga0496110_0000024
1889 Ga0496110_0026863
1890 Ga0496110_0077327
1891 Ga0496110_0172316
1892 Ga0496111_0008455
1893 Ga0496111_0018238
1894 Ga0496111_0037599
1895 Ga0496111_0083541
1896 Ga0496111_0202373
1897 Ga0496111_0211959
1898 Ga0496112_0016391
1899 Ga0496112_0109577
1900 Ga0496113_0001312
1901 Ga0496113_0004620
1902 Ga0496113_0082648
1903 Ga0496114_0004461
1904 Ga0496114_0108754
1905 Ga0496114_0222284
1906 Ga0496114_0227293
1907 Ga0496115_0009478
1908 Ga0496115_0039849
1909 Ga0496115_0042842
1910 Ga0496115_0044759
1911 Ga0496115_0083769
1912 Ga0496115_0096445
1913 Ga0496115_0196427
1914 Ga0496116_0108802
1915 Ga0496118_0045574
1916 Ga0496119_0308491
1917 Ga0496120_0289418
1918 Ga0496121_0000330
1919 Ga0496121_0118895
1920 Ga0496121_0143226
1921 Ga0496121_0228466
1922 Ga0496121_0236094
1923 Ga0496122_0001042
1924 Ga0496122_0011608
1925 Ga0496123_0113149
1926 Ga0496123_0115403
1927 Ga0496124_0011638
1928 Ga0496124_0300059
1929 Ga0496125_0159825
1930 Ga0496126_0003590
1931 Ga0496126_0004961
1932 Ga0496126_0011183
1933 Ga0496126_0014351
1934 Ga0496126_0038390
1935 Ga0496126_0066220
1936 Ga0496126_0141728
1937 Ga0496126_0221290
1938 Ga0496126_0421703
1939 Ga0496126_0508953
1940 Ga0495678_000161
1941 Ga0495678_000355
1942 Ga0495678_001988
1943 Ga0495682_0000875
1944 Ga0495682_0005708
1945 Ga0495682_0016993
1946 Ga0495682_0032460
1947 Ga0495682_0068855
1948 Ga0495682_0099785
1949 Ga0501034_0000624
1950 Ga0501037_0001018
1951 Ga0501038_0024748
1952 Ga0501039_0002397
1953 Ga0501039_1186841
1954 Ga0501047_0004540
1955 Ga0501067_0002495
1956 Ga0501073_0031098
1957 Ga0501080_0000032
1958 Ga0501035_0000334
1959 Ga0501035_0000676
1960 Ga0501044_0000006
1961 Ga0501044_0375652
1962 Ga0501045_0069454
1963 nmdc:mga03n38_12701_c1
1964 nmdc:mga03n38_35358_c1
1965 nmdc:mga00v17_355964_c1
1966 nmdc:mga0yw44_148399_c1
1967 nmdc:mga0yw44_162553_c1
1968 nmdc:mga0yw44_259422_c1
1969 nmdc:mga0k408_107657_c1
1970 nmdc:mga06z11_160840_c1
1971 nmdc:mga06z11_5269_c1
1972 nmdc:mga06z11_531070_c1
1973 nmdc:mga04h51_216655_c1
1974 nmdc:mga07m45_283840_c1
1975 nmdc:mga07m45_53498_c1
1976 nmdc:mga05p37_58216_c1
1977 nmdc:mga0n895_76791_c1
1978 nmdc:mga0rr50_497561_c1
1979 nmdc:mga0sz30_248060_c1
1980 Ga0495601_0016288
1981 Ga0495601_0177990
1982 Ga0500635_0027844
1983 Ga0495655_0004786
1984 Ga0495655_0095203
1985 Ga0495595_0000335
1986 Ga0495619_0001292
1987 Ga0500647_0014839
1988 Ga0500583_0068458
1989 Ga0500651_0004019
1990 Ga0500566_0011427
1991 Ga0500641_0076732
1992 Ga0500650_0131221
1993 Ga0500554_018197
1994 Ga0500554_131659
1995 Ga0500556_0047237
1996 Ga0500562_063611
1997 Ga0500592_027325
1998 Ga0500595_000468
1999 Ga0500595_005272
2000 Ga0500595_013495
2001 Ga0500595_025974
2002 Ga0500595_035010
2003 Ga0500597_205653
2004 Ga0500618_000419
2005 Ga0500658_0130238
2006 Ga0500568_0003017
2007 Ga0500579_190500
2008 Ga0500589_111338
2009 Ga0500604_0056262
2010 Ga0500604_0105218
2011 Ga0500622_0041926
2012 Ga0500622_0217827
2013 Ga0500633_0094403
2014 Ga0500638_002107
2015 Ga0500638_068294
2016 Ga0500637_0000546
2017 Ga0500661_000782
2018 2513659354
2019 2513672836
2020 2513861725
2021 2513921384
2022 2517893702
2023 2524469935
2024 2524535897
2025 2643801567
2026 2644471372
2027 2671693986
2028 2728752844
2029 2857568876
2030 2885389614
2031 2902409270
2032 2903756283
2033 2903756677
2034 2903774319
2035 2904701399
2036 2906641898
2037 2906666089
2038 3005478882
2039 643592634
2040 8056687755

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00116

COX2

Cytochrome C oxidase subunit II, periplasmic domain

107

189

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tk2-assembly3.cif.gz_C crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis 0.9021 79 166
4hcf-assembly2.cif.gz_B crystal structure of uncharacterized cupredoxin-like domain protein cupredoxin_1 with copper bound from bacillus anthracis 0.8931 79 166
5tk2-assembly3.cif.gz_C crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis 0.8731 79 166
4w9z-assembly1.cif.gz_A crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum 0.8643 79 177
5u7n-assembly7.cif.gz_G crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop 0.863 53 167
ID Description Score Start End Superfamily
af_Q8I6V2_60_165_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9022 95 173 2.60.40.420
af_A0A1D6ED90_406_498_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8956 93 174 2.60.40.420
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8801 79 166 2.60.40.420
5wehH02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8764 93 178 2.60.40.420
5u7nF00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8729 54 167 2.60.40.420
ID Description Score Start End GO Terms
AF-A0A658J8J6-F1-model_v4 deleted 0.9405 82 167
AF-A0A1G1JPU9-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9379 79 167 GO:0004129
GO:0005507
GO:0005886
AF-A0A838V9E3-F1-model_v4 Cupredoxin domain-containing protein 0.9338 79 167 GO:0004129
GO:0005507
GO:0016020
GO:0030313
AF-A0A4R1LBV1-F1-model_v4 Cytochrome c oxidase subunit 2 0.9316 79 167 GO:0004129
GO:0005507
GO:0016020
GO:0042773
AF-A0A6I7WQ91-F1-model_v4 Cytochrome oxidase subunit II copper A binding domain-containing protein 0.9308 81 177 GO:0004129
GO:0005507
GO:0016020
GO:0030313

Map