F488372
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1020 | 403 | 2040 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0392592|Ga0395905_0392592_582_1208 |
| Length | 208 |
| Sequence | MVRVLSLRLPAAERLIVTSETDHSHGAHGLGEAVAARIERRWATLSIVIIGVLVGLAAFFGIYHTTMPQGRVETADPTTLHLSGEFVESNLGSALEADGSVTVRAIGQQYSFTPQCLVVPAETPITVRATSADVVHGFLIEGTNINIMLVPGYVSDLPISFKTPGEHMMPCQEFCGIGHQGMWGKVKVVDQATFRNMAASKRRLTCVD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 101 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 159 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 165 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 168 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 169 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 170 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 171 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 172 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 173 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 174 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 177 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 182 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 203 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 204 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 205 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 206 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 307 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 308 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 321 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 322 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 323 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 326 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 327 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 328 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 329 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 330 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 347 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 348 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 349 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 350 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 354 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 356 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 360 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 361 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 362 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 366 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 367 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 368 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 369 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 370 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 371 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 375 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 376 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 377 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 378 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 379 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 381 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 382 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 383 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 384 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 385 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 386 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 387 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 388 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 389 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 390 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 391 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 392 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 393 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 394 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 395 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 396 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 397 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 398 | 2904699407 | |||
| 399 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 400 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 401 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 402 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 403 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.74 |
| Metatranscriptomes | 0.1 |
| Isolates | 2.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.76 |
| Nodule | 1.37 |
| Rhizoplane | 7.06 |
| Rhizosphere | 80.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0392592 | 3300037471 | Bacteria | 1282 |
| 2 | JGI25165J46597_1000006 | 3300003214 | Bacteria | 529784 |
| 3 | JGI25404J52841_10000254 | 3300003659 | Bacteria | 6695 |
| 4 | Ga0065165_1010810 | 3300005262 | Bacteria | 3891 |
| 5 | Ga0070658_10068107 | 3300005327 | Bacteria | 2909 |
| 6 | Ga0070658_10547925 | 3300005327 | Bacteria | 1001 |
| 7 | Ga0070658_10852956 | 3300005327 | Bacteria | 792 |
| 8 | Ga0070676_10950368 | 3300005328 | Bacteria | 643 |
| 9 | Ga0070683_100020118 | 3300005329 | Bacteria | 5936 |
| 10 | Ga0070683_100387791 | 3300005329 | Bacteria | 1331 |
| 11 | Ga0070690_100629919 | 3300005330 | Bacteria | 817 |
| 12 | Ga0068869_100017200 | 3300005334 | Bacteria | 4895 |
| 13 | Ga0070680_100043042 | 3300005336 | Bacteria | 3667 |
| 14 | Ga0070682_100042469 | 3300005337 | Bacteria | 2807 |
| 15 | Ga0070682_100157416 | 3300005337 | Bacteria | 1565 |
| 16 | Ga0068868_100006547 | 3300005338 | Bacteria | 8248 |
| 17 | Ga0068868_100069042 | 3300005338 | Bacteria | 2815 |
| 18 | Ga0068868_100203216 | 3300005338 | Bacteria | 1652 |
| 19 | Ga0070660_100228899 | 3300005339 | Bacteria | 1512 |
| 20 | Ga0070660_100386908 | 3300005339 | Bacteria | 1155 |
| 21 | Ga0070660_100824176 | 3300005339 | Bacteria | 781 |
| 22 | Ga0070660_101232277 | 3300005339 | Bacteria | 634 |
| 23 | Ga0070689_100230654 | 3300005340 | Bacteria | 1522 |
| 24 | Ga0070689_100574766 | 3300005340 | Bacteria | 973 |
| 25 | Ga0070691_10111683 | 3300005341 | Bacteria | 1368 |
| 26 | Ga0070661_100149234 | 3300005344 | Bacteria | 1766 |
| 27 | Ga0070661_100189925 | 3300005344 | Bacteria | 1566 |
| 28 | Ga0070668_100045256 | 3300005347 | Bacteria | 3377 |
| 29 | Ga0070668_100104644 | 3300005347 | Bacteria | 2246 |
| 30 | Ga0070668_100182551 | 3300005347 | Bacteria | 1715 |
| 31 | Ga0070668_100409293 | 3300005347 | Bacteria | 1159 |
| 32 | Ga0070668_101059470 | 3300005347 | Bacteria | 730 |
| 33 | Ga0070675_101180122 | 3300005354 | Bacteria | 705 |
| 34 | Ga0070671_100267604 | 3300005355 | Bacteria | 1453 |
| 35 | Ga0070671_101078679 | 3300005355 | Bacteria | 705 |
| 36 | Ga0070674_100021173 | 3300005356 | Bacteria | 4169 |
| 37 | Ga0070674_100142087 | 3300005356 | Bacteria | 1802 |
| 38 | Ga0070688_100518703 | 3300005365 | Bacteria | 901 |
| 39 | Ga0070659_100285174 | 3300005366 | Bacteria | 1374 |
| 40 | Ga0070659_100483469 | 3300005366 | Bacteria | 1054 |
| 41 | Ga0070667_100244921 | 3300005367 | Bacteria | 1602 |
| 42 | Ga0070667_100830546 | 3300005367 | Bacteria | 859 |
| 43 | Ga0070701_10104741 | 3300005438 | Bacteria | 1572 |
| 44 | Ga0070701_10150986 | 3300005438 | Bacteria | 1338 |
| 45 | Ga0070694_100626303 | 3300005444 | Bacteria | 869 |
| 46 | Ga0070663_100016240 | 3300005455 | Bacteria | 4829 |
| 47 | Ga0070663_100020052 | 3300005455 | Bacteria | 4419 |
| 48 | Ga0070663_100020229 | 3300005455 | Bacteria | 4403 |
| 49 | Ga0070663_100123056 | 3300005455 | Bacteria | 1961 |
| 50 | Ga0070678_100003659 | 3300005456 | Bacteria | 8584 |
| 51 | Ga0070678_100017610 | 3300005456 | Bacteria | 4607 |
| 52 | Ga0070678_100037277 | 3300005456 | Bacteria | 3412 |
| 53 | Ga0070678_100067668 | 3300005456 | Bacteria | 2659 |
| 54 | Ga0070678_100596432 | 3300005456 | Bacteria | 986 |
| 55 | Ga0070678_101004192 | 3300005456 | Bacteria | 767 |
| 56 | Ga0070681_10058589 | 3300005458 | Bacteria | 3831 |
| 57 | Ga0068867_100049914 | 3300005459 | Bacteria | 3081 |
| 58 | Ga0070699_100857343 | 3300005518 | Bacteria | 832 |
| 59 | Ga0070679_100021982 | 3300005530 | Bacteria | 6232 |
| 60 | Ga0070679_100897741 | 3300005530 | Bacteria | 830 |
| 61 | Ga0070684_100032764 | 3300005535 | Bacteria | 4432 |
| 62 | Ga0070684_100132369 | 3300005535 | Bacteria | 2250 |
| 63 | Ga0070684_101162130 | 3300005535 | Bacteria | 726 |
| 64 | Ga0068853_100014537 | 3300005539 | Bacteria | 6451 |
| 65 | Ga0068853_100205235 | 3300005539 | Bacteria | 1795 |
| 66 | Ga0068853_100391277 | 3300005539 | Bacteria | 1300 |
| 67 | Ga0068853_100981262 | 3300005539 | Bacteria | 813 |
| 68 | Ga0070672_100215342 | 3300005543 | Bacteria | 1610 |
| 69 | Ga0070672_100670484 | 3300005543 | Bacteria | 907 |
| 70 | Ga0070686_100643605 | 3300005544 | Bacteria | 840 |
| 71 | Ga0070693_100091362 | 3300005547 | Bacteria | 1836 |
| 72 | Ga0070693_100715250 | 3300005547 | Bacteria | 735 |
| 73 | Ga0070665_100044315 | 3300005548 | Bacteria | 4468 |
| 74 | Ga0070665_100075092 | 3300005548 | Bacteria | 3387 |
| 75 | Ga0070665_100356918 | 3300005548 | Bacteria | 1467 |
| 76 | Ga0070704_100137670 | 3300005549 | Bacteria | 1902 |
| 77 | Ga0068855_100014574 | 3300005563 | Bacteria | 9470 |
| 78 | Ga0068855_100066675 | 3300005563 | Bacteria | 4196 |
| 79 | Ga0068855_100511759 | 3300005563 | Bacteria | 1303 |
| 80 | Ga0070664_100010213 | 3300005564 | Bacteria | 7614 |
| 81 | Ga0070664_100021262 | 3300005564 | Bacteria | 5346 |
| 82 | Ga0070664_100338419 | 3300005564 | Bacteria | 1366 |
| 83 | Ga0070664_100360249 | 3300005564 | Bacteria | 1324 |
| 84 | Ga0070664_100603872 | 3300005564 | Bacteria | 1018 |
| 85 | Ga0070664_100656011 | 3300005564 | Bacteria | 975 |
| 86 | Ga0070664_101165996 | 3300005564 | Bacteria | 726 |
| 87 | Ga0068857_100066317 | 3300005577 | Bacteria | 3211 |
| 88 | Ga0068856_100107887 | 3300005614 | Bacteria | 2780 |
| 89 | Ga0068856_100448795 | 3300005614 | Bacteria | 1310 |
| 90 | Ga0070702_100061421 | 3300005615 | Bacteria | 2188 |
| 91 | Ga0068852_100022692 | 3300005616 | Bacteria | 5039 |
| 92 | Ga0068859_100237233 | 3300005617 | Bacteria | 1912 |
| 93 | Ga0068864_100029384 | 3300005618 | Bacteria | 4655 |
| 94 | Ga0068864_100073671 | 3300005618 | Bacteria | 2977 |
| 95 | Ga0068864_100484821 | 3300005618 | Bacteria | 1187 |
| 96 | Ga0068861_100052716 | 3300005719 | Bacteria | 3093 |
| 97 | Ga0068861_100259325 | 3300005719 | Bacteria | 1487 |
| 98 | Ga0068863_100133864 | 3300005841 | Bacteria | 2367 |
| 99 | Ga0068863_100554868 | 3300005841 | Bacteria | 1134 |
| 100 | Ga0068858_100023425 | 3300005842 | Bacteria | 5752 |
| 101 | Ga0068858_100060057 | 3300005842 | Bacteria | 3514 |
| 102 | Ga0068858_100512257 | 3300005842 | Bacteria | 1160 |
| 103 | Ga0068860_100292362 | 3300005843 | Bacteria | 1594 |
| 104 | Ga0068860_101064641 | 3300005843 | Bacteria | 828 |
| 105 | Ga0068862_100744702 | 3300005844 | Bacteria | 953 |
| 106 | Ga0081455_10027227 | 3300005937 | Bacteria | 5240 |
| 107 | Ga0081540_1002053 | 3300005983 | Bacteria | 16798 |
| 108 | Ga0081540_1003838 | 3300005983 | Bacteria | 11758 |
| 109 | Ga0081540_1005208 | 3300005983 | Bacteria | 9729 |
| 110 | Ga0081540_1007807 | 3300005983 | Bacteria | 7570 |
| 111 | Ga0081540_1011448 | 3300005983 | Bacteria | 5926 |
| 112 | Ga0081540_1053737 | 3300005983 | Bacteria | 1973 |
| 113 | Ga0081540_1088971 | 3300005983 | Bacteria | 1364 |
| 114 | Ga0070717_10268386 | 3300006028 | Bacteria | 1511 |
| 115 | Ga0075365_10114109 | 3300006038 | Bacteria | 1859 |
| 116 | Ga0075365_10199133 | 3300006038 | Bacteria | 1403 |
| 117 | Ga0075365_10543491 | 3300006038 | Bacteria | 822 |
| 118 | Ga0075368_10002535 | 3300006042 | Bacteria | 5974 |
| 119 | Ga0075368_10194609 | 3300006042 | Bacteria | 857 |
| 120 | Ga0075363_100070718 | 3300006048 | Bacteria | 1895 |
| 121 | Ga0075363_100084189 | 3300006048 | Bacteria | 1743 |
| 122 | Ga0075364_10180614 | 3300006051 | Bacteria | 1428 |
| 123 | Ga0070716_100286611 | 3300006173 | Bacteria | 1139 |
| 124 | Ga0070716_100564558 | 3300006173 | Bacteria | 851 |
| 125 | Ga0070712_100098016 | 3300006175 | Bacteria | 2162 |
| 126 | Ga0070712_100194272 | 3300006175 | Bacteria | 1590 |
| 127 | Ga0075362_10062304 | 3300006177 | Bacteria | 1689 |
| 128 | Ga0075362_10191086 | 3300006177 | Bacteria | 994 |
| 129 | Ga0075367_10165209 | 3300006178 | Bacteria | 1377 |
| 130 | Ga0075367_10264097 | 3300006178 | Bacteria | 1081 |
| 131 | Ga0075369_10073823 | 3300006186 | Bacteria | 1504 |
| 132 | Ga0075369_10083370 | 3300006186 | Bacteria | 1420 |
| 133 | Ga0075369_10340680 | 3300006186 | Bacteria | 703 |
| 134 | Ga0075366_10173916 | 3300006195 | Bacteria | 1307 |
| 135 | Ga0075366_10460445 | 3300006195 | Bacteria | 785 |
| 136 | Ga0097621_100045438 | 3300006237 | Bacteria | 3548 |
| 137 | Ga0097621_100097225 | 3300006237 | Bacteria | 2472 |
| 138 | Ga0068871_100031318 | 3300006358 | Bacteria | 4194 |
| 139 | Ga0068871_100925971 | 3300006358 | Bacteria | 809 |
| 140 | Ga0068865_100039829 | 3300006881 | Bacteria | 3189 |
| 141 | Ga0068865_100442397 | 3300006881 | Bacteria | 1073 |
| 142 | Ga0097620_100237229 | 3300006931 | Bacteria | 1912 |
| 143 | Ga0075435_100040178 | 3300007076 | Bacteria | 3735 |
| 144 | Ga0099794_10029377 | 3300007265 | Bacteria | 2561 |
| 145 | Ga0099795_10001567 | 3300007788 | Bacteria | 5035 |
| 146 | Ga0105251_10099205 | 3300009011 | Bacteria | 1332 |
| 147 | Ga0105250_10227237 | 3300009092 | Bacteria | 793 |
| 148 | Ga0105240_10245861 | 3300009093 | Bacteria | 2072 |
| 149 | Ga0105245_10027787 | 3300009098 | Bacteria | 4985 |
| 150 | Ga0105245_10186930 | 3300009098 | Bacteria | 1982 |
| 151 | Ga0105245_10266547 | 3300009098 | Bacteria | 1669 |
| 152 | Ga0105245_10642134 | 3300009098 | Bacteria | 1091 |
| 153 | Ga0105247_10160166 | 3300009101 | Bacteria | 1489 |
| 154 | Ga0105243_10011026 | 3300009148 | Bacteria | 6835 |
| 155 | Ga0105243_10194224 | 3300009148 | Bacteria | 1775 |
| 156 | Ga0105241_10022807 | 3300009174 | Bacteria | 4640 |
| 157 | Ga0105242_10056727 | 3300009176 | Bacteria | 3205 |
| 158 | Ga0105242_10214044 | 3300009176 | Bacteria | 1719 |
| 159 | Ga0105248_10034971 | 3300009177 | Bacteria | 5622 |
| 160 | Ga0105248_10578130 | 3300009177 | Bacteria | 1267 |
| 161 | Ga0105248_11586612 | 3300009177 | Bacteria | 741 |
| 162 | Ga0105237_10043449 | 3300009545 | Bacteria | 4526 |
| 163 | Ga0105237_10167236 | 3300009545 | Bacteria | 2198 |
| 164 | Ga0105237_10726337 | 3300009545 | Bacteria | 1000 |
| 165 | Ga0105238_10152073 | 3300009551 | Bacteria | 2289 |
| 166 | Ga0105238_10193575 | 3300009551 | Bacteria | 2009 |
| 167 | Ga0105238_10441350 | 3300009551 | Bacteria | 1298 |
| 168 | Ga0105249_10071994 | 3300009553 | Bacteria | 3195 |
| 169 | Ga0099796_10004654 | 3300010159 | Bacteria | 3344 |
| 170 | Ga0105239_10010954 | 3300010375 | Bacteria | 10129 |
| 171 | Ga0105239_10058369 | 3300010375 | Bacteria | 4234 |
| 172 | Ga0105239_10120429 | 3300010375 | Bacteria | 2914 |
| 173 | Ga0105239_10503863 | 3300010375 | Bacteria | 1376 |
| 174 | Ga0105239_11076959 | 3300010375 | Bacteria | 925 |
| 175 | Ga0105246_10020290 | 3300011119 | Bacteria | 4261 |
| 176 | Ga0105246_10068823 | 3300011119 | Bacteria | 2484 |
| 177 | Ga0157370_10034059 | 3300013104 | Bacteria | 4963 |
| 178 | Ga0157369_10002265 | 3300013105 | Bacteria | 23128 |
| 179 | Ga0157369_10016093 | 3300013105 | Bacteria | 8416 |
| 180 | Ga0157369_10975869 | 3300013105 | Bacteria | 868 |
| 181 | Ga0157374_10003326 | 3300013296 | Bacteria | 13512 |
| 182 | Ga0157378_10260553 | 3300013297 | Bacteria | 1663 |
| 183 | Ga0163162_10015168 | 3300013306 | Bacteria | 7526 |
| 184 | Ga0163162_10055092 | 3300013306 | Bacteria | 4002 |
| 185 | Ga0163162_10116218 | 3300013306 | Bacteria | 2776 |
| 186 | Ga0157372_10041023 | 3300013307 | Bacteria | 5116 |
| 187 | Ga0157372_11140579 | 3300013307 | Bacteria | 901 |
| 188 | Ga0157375_10008539 | 3300013308 | Bacteria | 8967 |
| 189 | Ga0157375_10309505 | 3300013308 | Bacteria | 1744 |
| 190 | Ga0163163_10003792 | 3300014325 | Bacteria | 12874 |
| 191 | Ga0163163_10007553 | 3300014325 | Bacteria | 9597 |
| 192 | Ga0163163_10607263 | 3300014325 | Bacteria | 1157 |
| 193 | Ga0157380_10019544 | 3300014326 | Bacteria | 5050 |
| 194 | Ga0157380_10334323 | 3300014326 | Bacteria | 1410 |
| 195 | Ga0157377_10369375 | 3300014745 | Bacteria | 968 |
| 196 | Ga0157379_10385425 | 3300014968 | Bacteria | 1286 |
| 197 | Ga0157376_10017469 | 3300014969 | Bacteria | 5473 |
| 198 | Ga0157376_10645767 | 3300014969 | Bacteria | 1058 |
| 199 | Ga0163161_10021099 | 3300017792 | Bacteria | 4578 |
| 200 | Ga0213874_10049416 | 3300021377 | Unclassified | 1286 |
| 201 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 202 | Ga0209758_1001532 | 3300025297 | Bacteria | 26653 |
| 203 | Ga0209758_1003142 | 3300025297 | Bacteria | 15539 |
| 204 | Ga0209758_1045817 | 3300025297 | Bacteria | 1584 |
| 205 | Ga0207642_10248740 | 3300025899 | Bacteria | 1008 |
| 206 | Ga0207688_10104915 | 3300025901 | Bacteria | 1635 |
| 207 | Ga0207680_10609889 | 3300025903 | Bacteria | 781 |
| 208 | Ga0207647_10161105 | 3300025904 | Bacteria | 1309 |
| 209 | Ga0207685_10367371 | 3300025905 | Bacteria | 730 |
| 210 | Ga0207699_10464097 | 3300025906 | Bacteria | 910 |
| 211 | Ga0207645_10087751 | 3300025907 | Bacteria | 1999 |
| 212 | Ga0207645_10401305 | 3300025907 | Bacteria | 922 |
| 213 | Ga0207643_10033308 | 3300025908 | Bacteria | 2882 |
| 214 | Ga0207705_10057990 | 3300025909 | Bacteria | 2794 |
| 215 | Ga0207705_10138765 | 3300025909 | Bacteria | 1814 |
| 216 | Ga0207684_10670595 | 3300025910 | Bacteria | 883 |
| 217 | Ga0207695_10137206 | 3300025913 | Bacteria | 2398 |
| 218 | Ga0207671_10192869 | 3300025914 | Bacteria | 1589 |
| 219 | Ga0207693_10050481 | 3300025915 | Bacteria | 3267 |
| 220 | Ga0207693_10066564 | 3300025915 | Bacteria | 2821 |
| 221 | Ga0207660_10163892 | 3300025917 | Bacteria | 1717 |
| 222 | Ga0207662_10115102 | 3300025918 | Bacteria | 1680 |
| 223 | Ga0207657_10036254 | 3300025919 | Bacteria | 4416 |
| 224 | Ga0207657_10240292 | 3300025919 | Bacteria | 1446 |
| 225 | Ga0207657_10321342 | 3300025919 | Bacteria | 1224 |
| 226 | Ga0207652_10068496 | 3300025921 | Bacteria | 3080 |
| 227 | Ga0207652_10156528 | 3300025921 | Bacteria | 2042 |
| 228 | Ga0207652_11039463 | 3300025921 | Bacteria | 718 |
| 229 | Ga0207694_10326021 | 3300025924 | Bacteria | 1268 |
| 230 | Ga0207694_10789944 | 3300025924 | Bacteria | 802 |
| 231 | Ga0207687_10075061 | 3300025927 | Bacteria | 2425 |
| 232 | Ga0207687_10358550 | 3300025927 | Bacteria | 1189 |
| 233 | Ga0207700_11515884 | 3300025928 | Bacteria | 595 |
| 234 | Ga0207644_10119591 | 3300025931 | Bacteria | 2004 |
| 235 | Ga0207644_10496015 | 3300025931 | Bacteria | 1007 |
| 236 | Ga0207644_10837271 | 3300025931 | Bacteria | 770 |
| 237 | Ga0207690_10034215 | 3300025932 | Bacteria | 3273 |
| 238 | Ga0207690_10247079 | 3300025932 | Bacteria | 1377 |
| 239 | Ga0207690_10357911 | 3300025932 | Bacteria | 1155 |
| 240 | Ga0207706_10060448 | 3300025933 | Bacteria | 3337 |
| 241 | Ga0207706_10360749 | 3300025933 | Bacteria | 1262 |
| 242 | Ga0207686_10062197 | 3300025934 | Bacteria | 2370 |
| 243 | Ga0207686_10251825 | 3300025934 | Bacteria | 1291 |
| 244 | Ga0207709_10028413 | 3300025935 | Bacteria | 3233 |
| 245 | Ga0207709_10041029 | 3300025935 | Bacteria | 2775 |
| 246 | Ga0207709_10067476 | 3300025935 | Bacteria | 2257 |
| 247 | Ga0207669_10012350 | 3300025937 | Bacteria | 4196 |
| 248 | Ga0207669_10042118 | 3300025937 | Bacteria | 2663 |
| 249 | Ga0207704_10340194 | 3300025938 | Bacteria | 1164 |
| 250 | Ga0207704_10369105 | 3300025938 | Bacteria | 1123 |
| 251 | Ga0207665_10225069 | 3300025939 | Bacteria | 1376 |
| 252 | Ga0207691_10059924 | 3300025940 | Bacteria | 3460 |
| 253 | Ga0207691_10469567 | 3300025940 | Bacteria | 1070 |
| 254 | Ga0207711_10518245 | 3300025941 | Bacteria | 1112 |
| 255 | Ga0207689_10075529 | 3300025942 | Bacteria | 2770 |
| 256 | Ga0207689_10091812 | 3300025942 | Bacteria | 2494 |
| 257 | Ga0207661_10028832 | 3300025944 | Bacteria | 4255 |
| 258 | Ga0207661_10615357 | 3300025944 | Bacteria | 997 |
| 259 | Ga0207679_10048953 | 3300025945 | Bacteria | 3080 |
| 260 | Ga0207679_10206649 | 3300025945 | Bacteria | 1644 |
| 261 | Ga0207679_10781411 | 3300025945 | Bacteria | 870 |
| 262 | Ga0207667_10010756 | 3300025949 | Bacteria | 10672 |
| 263 | Ga0207667_10015015 | 3300025949 | Bacteria | 8810 |
| 264 | Ga0207667_10074694 | 3300025949 | Bacteria | 3521 |
| 265 | Ga0207667_10596978 | 3300025949 | Bacteria | 1114 |
| 266 | Ga0207667_10810644 | 3300025949 | Bacteria | 932 |
| 267 | Ga0207651_10091652 | 3300025960 | Bacteria | 2226 |
| 268 | Ga0207712_10124192 | 3300025961 | Bacteria | 1957 |
| 269 | Ga0207712_10446352 | 3300025961 | Bacteria | 1096 |
| 270 | Ga0207668_10019967 | 3300025972 | Bacteria | 4248 |
| 271 | Ga0207668_10036022 | 3300025972 | Bacteria | 3300 |
| 272 | Ga0207640_10041183 | 3300025981 | Bacteria | 2936 |
| 273 | Ga0207640_10284821 | 3300025981 | Bacteria | 1300 |
| 274 | Ga0207640_11158955 | 3300025981 | Bacteria | 686 |
| 275 | Ga0207658_10317607 | 3300025986 | Bacteria | 1347 |
| 276 | Ga0207658_10632690 | 3300025986 | Bacteria | 963 |
| 277 | Ga0207677_10011044 | 3300026023 | Bacteria | 5132 |
| 278 | Ga0207677_10091669 | 3300026023 | Bacteria | 2211 |
| 279 | Ga0207703_10400935 | 3300026035 | Bacteria | 1273 |
| 280 | Ga0207639_10085807 | 3300026041 | Bacteria | 2505 |
| 281 | Ga0207639_10127272 | 3300026041 | Bacteria | 2103 |
| 282 | Ga0207639_10203783 | 3300026041 | Bacteria | 1698 |
| 283 | Ga0207678_10010552 | 3300026067 | Bacteria | 8114 |
| 284 | Ga0207678_10022770 | 3300026067 | Bacteria | 5486 |
| 285 | Ga0207678_10130148 | 3300026067 | Bacteria | 2146 |
| 286 | Ga0207678_10162237 | 3300026067 | Bacteria | 1909 |
| 287 | Ga0207678_10203891 | 3300026067 | Bacteria | 1691 |
| 288 | Ga0207678_10585696 | 3300026067 | Bacteria | 977 |
| 289 | Ga0207678_10943429 | 3300026067 | Bacteria | 763 |
| 290 | Ga0207708_10184300 | 3300026075 | Bacteria | 1658 |
| 291 | Ga0207702_10167160 | 3300026078 | Bacteria | 2013 |
| 292 | Ga0207702_10628896 | 3300026078 | Bacteria | 1055 |
| 293 | Ga0207702_11400893 | 3300026078 | Bacteria | 693 |
| 294 | Ga0207641_10062468 | 3300026088 | Bacteria | 3179 |
| 295 | Ga0207641_10630022 | 3300026088 | Bacteria | 1052 |
| 296 | Ga0207648_10197558 | 3300026089 | Bacteria | 1784 |
| 297 | Ga0207676_10388555 | 3300026095 | Bacteria | 1301 |
| 298 | Ga0207674_10048154 | 3300026116 | Bacteria | 4364 |
| 299 | Ga0207674_10111119 | 3300026116 | Bacteria | 2715 |
| 300 | Ga0207675_100101117 | 3300026118 | Bacteria | 2716 |
| 301 | Ga0207675_100111822 | 3300026118 | Bacteria | 2577 |
| 302 | Ga0207675_100199723 | 3300026118 | Bacteria | 1920 |
| 303 | Ga0207683_10014660 | 3300026121 | Bacteria | 6675 |
| 304 | Ga0207683_10044880 | 3300026121 | Bacteria | 3864 |
| 305 | Ga0207683_10055468 | 3300026121 | Bacteria | 3474 |
| 306 | Ga0207683_10872965 | 3300026121 | Unclassified | 835 |
| 307 | Ga0207698_10021492 | 3300026142 | Bacteria | 4464 |
| 308 | Ga0207698_11146487 | 3300026142 | Bacteria | 791 |
| 309 | Ga0268266_10016992 | 3300028379 | Bacteria | 6215 |
| 310 | Ga0268266_10019219 | 3300028379 | Bacteria | 5818 |
| 311 | Ga0268266_10088956 | 3300028379 | Bacteria | 2703 |
| 312 | Ga0268265_10735162 | 3300028380 | Bacteria | 956 |
| 313 | Ga0268264_10917113 | 3300028381 | Bacteria | 880 |
| 314 | Ga0268264_11060705 | 3300028381 | Bacteria | 818 |
| 315 | Ga0265328_10029964 | 3300031239 | Bacteria | 2030 |
| 316 | Ga0265316_10753675 | 3300031344 | Bacteria | 684 |
| 317 | Ga0307513_10193775 | 3300031456 | Bacteria | 1881 |
| 318 | Ga0265342_10079738 | 3300031712 | Bacteria | 1893 |
| 319 | Ga0307516_10213055 | 3300031730 | Bacteria | 1645 |
| 320 | Ga0307405_10229563 | 3300031731 | Bacteria | 1367 |
| 321 | Ga0307405_10389791 | 3300031731 | Bacteria | 1087 |
| 322 | Ga0307406_10067061 | 3300031901 | Bacteria | 2338 |
| 323 | Ga0307407_10874170 | 3300031903 | Bacteria | 688 |
| 324 | Ga0307411_10015152 | 3300032005 | Bacteria | 4320 |
| 325 | Ga0307411_10332095 | 3300032005 | Bacteria | 1232 |
| 326 | Ga0307415_100020263 | 3300032126 | Bacteria | 4058 |
| 327 | Ga0307415_100058419 | 3300032126 | Bacteria | 2656 |
| 328 | Ga0307415_100067328 | 3300032126 | Bacteria | 2502 |
| 329 | Ga0307510_10009746 | 3300033180 | Bacteria | 11432 |
| 330 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 331 | Ga0373926_0069057 | 3300035083 | Bacteria | 1296 |
| 332 | Ga0373929_0064173 | 3300035085 | Bacteria | 866 |
| 333 | Ga0373940_0120457 | 3300035088 | Bacteria | 814 |
| 334 | Ga0373923_0000827 | 3300035111 | Bacteria | 8121 |
| 335 | Ga0373923_0017518 | 3300035111 | Bacteria | 2742 |
| 336 | Ga0373932_0105103 | 3300035112 | Bacteria | 924 |
| 337 | Ga0373954_0000634 | 3300035118 | Bacteria | 13429 |
| 338 | Ga0373954_0108046 | 3300035118 | Bacteria | 1345 |
| 339 | Ga0373957_0000200 | 3300035120 | Bacteria | 15408 |
| 340 | Ga0373943_0082196 | 3300035170 | Bacteria | 1654 |
| 341 | Ga0373943_0230692 | 3300035170 | Bacteria | 1034 |
| 342 | Ga0373946_0005979 | 3300035171 | Bacteria | 4412 |
| 343 | Ga0373946_0007758 | 3300035171 | Bacteria | 3937 |
| 344 | Ga0373946_0078970 | 3300035171 | Bacteria | 1437 |
| 345 | Ga0373955_0014279 | 3300035172 | Bacteria | 3860 |
| 346 | Ga0373961_0122618 | 3300035241 | Bacteria | 863 |
| 347 | Ga0373962_0114226 | 3300035242 | Bacteria | 855 |
| 348 | Ga0373924_0047567 | 3300035410 | Bacteria | 1770 |
| 349 | Ga0373924_0052392 | 3300035410 | Bacteria | 1694 |
| 350 | Ga0373931_0050522 | 3300035691 | Bacteria | 2212 |
| 351 | Ga0373935_0021939 | 3300035692 | Bacteria | 3910 |
| 352 | Ga0373935_0103925 | 3300035692 | Bacteria | 1877 |
| 353 | Ga0373927_0001513 | 3300035695 | Bacteria | 17491 |
| 354 | Ga0373927_0023260 | 3300035695 | Bacteria | 4059 |
| 355 | Ga0373927_0026102 | 3300035695 | Bacteria | 3817 |
| 356 | Ga0373927_0044399 | 3300035695 | Bacteria | 2876 |
| 357 | Ga0373927_0054881 | 3300035695 | Bacteria | 2577 |
| 358 | Ga0373933_0002159 | 3300035724 | Bacteria | 11266 |
| 359 | Ga0373933_0055833 | 3300035724 | Bacteria | 2370 |
| 360 | Ga0373947_0014848 | 3300035725 | Bacteria | 4469 |
| 361 | Ga0373947_0019002 | 3300035725 | Bacteria | 3960 |
| 362 | Ga0373947_0137638 | 3300035725 | Bacteria | 1564 |
| 363 | Ga0373937_0014785 | 3300036401 | Bacteria | 6891 |
| 364 | Ga0373937_0035531 | 3300036401 | Bacteria | 4537 |
| 365 | Ga0372808_001672 | 3300036459 | Bacteria | 2374 |
| 366 | Ga0373925_0006671 | 3300037068 | Bacteria | 8469 |
| 367 | Ga0373925_0069441 | 3300037068 | Bacteria | 2662 |
| 368 | Ga0395899_0013951 | 3300037312 | Bacteria | 6137 |
| 369 | Ga0395899_0153576 | 3300037312 | Bacteria | 1630 |
| 370 | Ga0395899_0362797 | 3300037312 | Bacteria | 966 |
| 371 | Ga0395900_0000513 | 3300037418 | Bacteria | 54785 |
| 372 | Ga0395900_0035219 | 3300037418 | Bacteria | 5156 |
| 373 | Ga0395900_0061053 | 3300037418 | Bacteria | 3877 |
| 374 | Ga0395900_0387966 | 3300037418 | Bacteria | 1363 |
| 375 | Ga0395900_0656086 | 3300037418 | Bacteria | 985 |
| 376 | Ga0395900_1109174 | 3300037418 | Bacteria | 708 |
| 377 | Ga0395898_0081232 | 3300037466 | Bacteria | 3126 |
| 378 | Ga0395898_0175025 | 3300037466 | Bacteria | 2051 |
| 379 | Ga0395898_0178184 | 3300037466 | Bacteria | 2031 |
| 380 | Ga0395905_0189218 | 3300037471 | Bacteria | 1931 |
| 381 | Ga0395905_0754576 | 3300037471 | Bacteria | 875 |
| 382 | Ga0395901_0000019 | 3300038443 | Bacteria | 317063 |
| 383 | Ga0395901_0248570 | 3300038443 | Bacteria | 1853 |
| 384 | Ga0395901_0822174 | 3300038443 | Bacteria | 916 |
| 385 | Ga0395901_0835613 | 3300038443 | Bacteria | 907 |
| 386 | Ga0436365_0172063 | 3300039437 | Bacteria | 12419 |
| 387 | Ga0436365_1338213 | 3300039437 | Bacteria | 1945 |
| 388 | Ga0436360_0861292 | 3300039438 | Bacteria | 2289 |
| 389 | Ga0436360_0985690 | 3300039438 | Bacteria | 1153 |
| 390 | Ga0436361_0809888 | 3300039447 | Bacteria | 947 |
| 391 | Ga0436361_1180484 | 3300039447 | Bacteria | 2496 |
| 392 | Ga0436363_0288172 | 3300039450 | Bacteria | 2165 |
| 393 | Ga0436362_0350328 | 3300039453 | Bacteria | 2056 |
| 394 | Ga0451802_1429738 | 3300041460 | Bacteria | 762 |
| 395 | Ga0451853_1746509 | 3300041512 | Bacteria | 1980 |
| 396 | Ga0439449_0006107 | 3300042007 | Bacteria | 4604 |
| 397 | Ga0439458_0099349 | 3300042157 | Bacteria | 754 |
| 398 | Ga0466963_0132864 | 3300044694 | Bacteria | 1720 |
| 399 | Ga0453684_0275687 | 3300044712 | Bacteria | 1920 |
| 400 | Ga0466970_0247224 | 3300044765 | Bacteria | 999 |
| 401 | Ga0466967_0530472 | 3300045976 | Bacteria | 1157 |
| 402 | Ga0495617_000034 | 3300046452 | Bacteria | 147232 |
| 403 | Ga0495617_000099 | 3300046452 | Bacteria | 62284 |
| 404 | Ga0495617_019330 | 3300046452 | Bacteria | 2303 |
| 405 | Ga0495617_067182 | 3300046452 | Bacteria | 1181 |
| 406 | Ga0495627_000208 | 3300046453 | Bacteria | 63467 |
| 407 | Ga0495627_041161 | 3300046453 | Bacteria | 1420 |
| 408 | Ga0495627_052601 | 3300046453 | Bacteria | 1221 |
| 409 | Ga0495627_090729 | 3300046453 | Bacteria | 879 |
| 410 | Ga0495592_0002897 | 3300046454 | Bacteria | 12205 |
| 411 | Ga0495603_0013589 | 3300046455 | Bacteria | 4925 |
| 412 | Ga0495603_0017151 | 3300046455 | Bacteria | 4384 |
| 413 | Ga0495603_0022018 | 3300046455 | Bacteria | 3859 |
| 414 | Ga0495603_0034420 | 3300046455 | Bacteria | 3045 |
| 415 | Ga0495603_0238001 | 3300046455 | Bacteria | 1049 |
| 416 | Ga0495590_0000087 | 3300046457 | Bacteria | 60113 |
| 417 | Ga0495590_0000195 | 3300046457 | Bacteria | 34306 |
| 418 | Ga0495591_000272 | 3300046458 | Bacteria | 48725 |
| 419 | Ga0495629_0002158 | 3300046459 | Bacteria | 15190 |
| 420 | Ga0495629_0004330 | 3300046459 | Bacteria | 10642 |
| 421 | Ga0495629_0012878 | 3300046459 | Bacteria | 6049 |
| 422 | Ga0495629_0051582 | 3300046459 | Bacteria | 2879 |
| 423 | Ga0495629_0368919 | 3300046459 | Bacteria | 978 |
| 424 | Ga0495629_0420767 | 3300046459 | Bacteria | 907 |
| 425 | Ga0495638_0007685 | 3300046460 | Bacteria | 7705 |
| 426 | Ga0495638_0054741 | 3300046460 | Bacteria | 2479 |
| 427 | Ga0495638_0065792 | 3300046460 | Bacteria | 2230 |
| 428 | Ga0495638_0442641 | 3300046460 | Bacteria | 665 |
| 429 | Ga0495641_0019593 | 3300046461 | Bacteria | 3455 |
| 430 | Ga0495653_0017446 | 3300046463 | Bacteria | 5838 |
| 431 | Ga0495653_0029478 | 3300046463 | Bacteria | 4380 |
| 432 | Ga0495650_0008607 | 3300046471 | Bacteria | 5922 |
| 433 | Ga0495580_0006344 | 3300046472 | Bacteria | 9647 |
| 434 | Ga0495580_0011640 | 3300046472 | Bacteria | 6803 |
| 435 | Ga0495580_0210368 | 3300046472 | Bacteria | 1338 |
| 436 | Ga0495582_0005475 | 3300046473 | Bacteria | 7075 |
| 437 | Ga0495582_0201669 | 3300046473 | Bacteria | 1136 |
| 438 | Ga0495605_0000151 | 3300046474 | Bacteria | 89442 |
| 439 | Ga0495605_0016177 | 3300046474 | Bacteria | 4041 |
| 440 | Ga0495605_0044051 | 3300046474 | Bacteria | 2208 |
| 441 | Ga0495605_0064313 | 3300046474 | Bacteria | 1747 |
| 442 | Ga0495639_0000750 | 3300046475 | Bacteria | 14821 |
| 443 | Ga0495639_0047445 | 3300046475 | Bacteria | 1946 |
| 444 | Ga0495639_0076527 | 3300046475 | Bacteria | 1552 |
| 445 | Ga0495639_0189724 | 3300046475 | Bacteria | 1003 |
| 446 | Ga0495662_0002275 | 3300046476 | Bacteria | 9684 |
| 447 | Ga0495664_0136401 | 3300046477 | Bacteria | 1487 |
| 448 | Ga0495584_0000011 | 3300046491 | Bacteria | 208322 |
| 449 | Ga0495584_0000122 | 3300046491 | Bacteria | 53611 |
| 450 | Ga0495584_0000253 | 3300046491 | Bacteria | 38533 |
| 451 | Ga0495584_0001524 | 3300046491 | Bacteria | 13773 |
| 452 | Ga0495584_0031573 | 3300046491 | Bacteria | 2681 |
| 453 | Ga0495584_0062179 | 3300046491 | Bacteria | 1876 |
| 454 | Ga0495584_0096553 | 3300046491 | Bacteria | 1492 |
| 455 | Ga0495584_0266080 | 3300046491 | Bacteria | 871 |
| 456 | Ga0495585_0000106 | 3300046492 | Bacteria | 89096 |
| 457 | Ga0495585_0000970 | 3300046492 | Bacteria | 24102 |
| 458 | Ga0495585_0001684 | 3300046492 | Bacteria | 16886 |
| 459 | Ga0495585_0004203 | 3300046492 | Bacteria | 9401 |
| 460 | Ga0495585_0005123 | 3300046492 | Bacteria | 8339 |
| 461 | Ga0495585_0017233 | 3300046492 | Bacteria | 4176 |
| 462 | Ga0495585_0018938 | 3300046492 | Bacteria | 3971 |
| 463 | Ga0495585_0019025 | 3300046492 | Bacteria | 3963 |
| 464 | Ga0495585_0019036 | 3300046492 | Bacteria | 3961 |
| 465 | Ga0495585_0029478 | 3300046492 | Bacteria | 3123 |
| 466 | Ga0495585_0031323 | 3300046492 | Bacteria | 3019 |
| 467 | Ga0495585_0066304 | 3300046492 | Bacteria | 1976 |
| 468 | Ga0495585_0078345 | 3300046492 | Bacteria | 1793 |
| 469 | Ga0495585_0185981 | 3300046492 | Bacteria | 1065 |
| 470 | Ga0495585_0255932 | 3300046492 | Bacteria | 872 |
| 471 | Ga0495594_0001313 | 3300046499 | Bacteria | 12946 |
| 472 | Ga0495594_0003799 | 3300046499 | Bacteria | 7747 |
| 473 | Ga0495594_0005644 | 3300046499 | Bacteria | 6435 |
| 474 | Ga0495594_0017845 | 3300046499 | Bacteria | 3754 |
| 475 | Ga0495594_0375214 | 3300046499 | Bacteria | 809 |
| 476 | Ga0495594_0424400 | 3300046499 | Bacteria | 756 |
| 477 | Ga0495596_0004070 | 3300046500 | Bacteria | 7199 |
| 478 | Ga0495596_0007869 | 3300046500 | Bacteria | 4775 |
| 479 | Ga0495596_0008479 | 3300046500 | Bacteria | 4574 |
| 480 | Ga0495596_0015995 | 3300046500 | Bacteria | 3123 |
| 481 | Ga0495596_0036879 | 3300046500 | Bacteria | 1935 |
| 482 | Ga0495596_0041152 | 3300046500 | Bacteria | 1822 |
| 483 | Ga0495596_0098748 | 3300046500 | Bacteria | 1133 |
| 484 | Ga0495607_0002166 | 3300046501 | Bacteria | 16351 |
| 485 | Ga0495607_0002563 | 3300046501 | Bacteria | 14677 |
| 486 | Ga0495607_0003376 | 3300046501 | Bacteria | 12245 |
| 487 | Ga0495607_0012182 | 3300046501 | Bacteria | 5685 |
| 488 | Ga0495607_0019414 | 3300046501 | Bacteria | 4319 |
| 489 | Ga0495607_0030467 | 3300046501 | Bacteria | 3312 |
| 490 | Ga0495607_0072805 | 3300046501 | Bacteria | 1912 |
| 491 | Ga0495607_0156498 | 3300046501 | Bacteria | 1161 |
| 492 | Ga0495607_0314709 | 3300046501 | Bacteria | 732 |
| 493 | Ga0495583_0000204 | 3300046506 | Bacteria | 99749 |
| 494 | Ga0495583_0001947 | 3300046506 | Bacteria | 19036 |
| 495 | Ga0495583_0003375 | 3300046506 | Bacteria | 12257 |
| 496 | Ga0495583_0011654 | 3300046506 | Bacteria | 5037 |
| 497 | Ga0495583_0012646 | 3300046506 | Bacteria | 4757 |
| 498 | Ga0495583_0015773 | 3300046506 | Bacteria | 4091 |
| 499 | Ga0495583_0033630 | 3300046506 | Bacteria | 2464 |
| 500 | Ga0495583_0087005 | 3300046506 | Bacteria | 1351 |
| 501 | Ga0495583_0093991 | 3300046506 | Bacteria | 1287 |
| 502 | Ga0495583_0101745 | 3300046506 | Bacteria | 1225 |
| 503 | Ga0495583_0245142 | 3300046506 | Bacteria | 719 |
| 504 | Ga0495606_0003022 | 3300046507 | Bacteria | 18402 |
| 505 | Ga0495606_0009057 | 3300046507 | Bacteria | 8493 |
| 506 | Ga0495606_0037190 | 3300046507 | Bacteria | 3307 |
| 507 | Ga0495606_0042285 | 3300046507 | Bacteria | 3048 |
| 508 | Ga0495606_0061305 | 3300046507 | Bacteria | 2406 |
| 509 | Ga0495606_0070449 | 3300046507 | Bacteria | 2205 |
| 510 | Ga0495606_0073789 | 3300046507 | Bacteria | 2139 |
| 511 | Ga0495606_0078340 | 3300046507 | Bacteria | 2061 |
| 512 | Ga0495606_0089486 | 3300046507 | Bacteria | 1896 |
| 513 | Ga0495606_0104556 | 3300046507 | Bacteria | 1718 |
| 514 | Ga0495606_0189315 | 3300046507 | Bacteria | 1180 |
| 515 | Ga0495608_0002218 | 3300046511 | Bacteria | 14020 |
| 516 | Ga0495608_0364113 | 3300046511 | Bacteria | 888 |
| 517 | Ga0495610_0000010 | 3300046512 | Bacteria | 538821 |
| 518 | Ga0495610_0001106 | 3300046512 | Bacteria | 24542 |
| 519 | Ga0495616_0000557 | 3300046513 | Bacteria | 28204 |
| 520 | Ga0495616_0001082 | 3300046513 | Bacteria | 19353 |
| 521 | Ga0495616_0001767 | 3300046513 | Bacteria | 14710 |
| 522 | Ga0495616_0004439 | 3300046513 | Bacteria | 8833 |
| 523 | Ga0495616_0004788 | 3300046513 | Bacteria | 8477 |
| 524 | Ga0495616_0008025 | 3300046513 | Bacteria | 6287 |
| 525 | Ga0495616_0029968 | 3300046513 | Bacteria | 2865 |
| 526 | Ga0495616_0091184 | 3300046513 | Bacteria | 1442 |
| 527 | Ga0495616_0106768 | 3300046513 | Bacteria | 1305 |
| 528 | Ga0495616_0124937 | 3300046513 | Bacteria | 1184 |
| 529 | Ga0495618_0153370 | 3300046514 | Bacteria | 1471 |
| 530 | Ga0495618_0373451 | 3300046514 | Bacteria | 876 |
| 531 | Ga0495620_0003033 | 3300046515 | Bacteria | 9658 |
| 532 | Ga0495620_0070690 | 3300046515 | Bacteria | 1429 |
| 533 | Ga0495628_0038487 | 3300046516 | Bacteria | 3828 |
| 534 | Ga0495628_0296188 | 3300046516 | Bacteria | 1198 |
| 535 | Ga0495630_0046427 | 3300046517 | Bacteria | 3247 |
| 536 | Ga0495630_0403815 | 3300046517 | Bacteria | 1047 |
| 537 | Ga0495631_0000551 | 3300046518 | Bacteria | 25209 |
| 538 | Ga0495631_0000979 | 3300046518 | Bacteria | 17733 |
| 539 | Ga0495631_0001182 | 3300046518 | Bacteria | 16125 |
| 540 | Ga0495631_0002486 | 3300046518 | Bacteria | 10374 |
| 541 | Ga0495631_0014266 | 3300046518 | Bacteria | 3838 |
| 542 | Ga0495631_0015202 | 3300046518 | Bacteria | 3695 |
| 543 | Ga0495631_0020921 | 3300046518 | Bacteria | 3051 |
| 544 | Ga0495631_0041332 | 3300046518 | Bacteria | 2040 |
| 545 | Ga0495631_0054873 | 3300046518 | Bacteria | 1736 |
| 546 | Ga0495631_0060127 | 3300046518 | Bacteria | 1649 |
| 547 | Ga0495631_0130590 | 3300046518 | Bacteria | 1079 |
| 548 | Ga0495631_0225107 | 3300046518 | Bacteria | 800 |
| 549 | Ga0495632_0000592 | 3300046519 | Bacteria | 33698 |
| 550 | Ga0495632_0001130 | 3300046519 | Bacteria | 22838 |
| 551 | Ga0495632_0002839 | 3300046519 | Bacteria | 12805 |
| 552 | Ga0495632_0005473 | 3300046519 | Bacteria | 8388 |
| 553 | Ga0495637_0000013 | 3300046520 | Bacteria | 244837 |
| 554 | Ga0495637_0000071 | 3300046520 | Bacteria | 82633 |
| 555 | Ga0495637_0032837 | 3300046520 | Bacteria | 2284 |
| 556 | Ga0495637_0149804 | 3300046520 | Bacteria | 881 |
| 557 | Ga0495643_0009062 | 3300046522 | Bacteria | 6239 |
| 558 | Ga0495643_0016864 | 3300046522 | Bacteria | 4284 |
| 559 | Ga0495643_0082769 | 3300046522 | Bacteria | 1667 |
| 560 | Ga0495643_0171529 | 3300046522 | Bacteria | 1060 |
| 561 | Ga0495643_0173629 | 3300046522 | Bacteria | 1052 |
| 562 | Ga0495644_0007520 | 3300046523 | Bacteria | 4199 |
| 563 | Ga0495644_0011332 | 3300046523 | Bacteria | 3433 |
| 564 | Ga0495644_0014082 | 3300046523 | Bacteria | 3064 |
| 565 | Ga0495644_0029663 | 3300046523 | Bacteria | 2066 |
| 566 | Ga0495644_0029840 | 3300046523 | Bacteria | 2060 |
| 567 | Ga0495648_0000410 | 3300046524 | Bacteria | 47244 |
| 568 | Ga0495648_0001182 | 3300046524 | Bacteria | 26250 |
| 569 | Ga0495648_0010568 | 3300046524 | Bacteria | 7018 |
| 570 | Ga0495648_0012573 | 3300046524 | Bacteria | 6302 |
| 571 | Ga0495648_0021834 | 3300046524 | Bacteria | 4422 |
| 572 | Ga0495648_0200071 | 3300046524 | Bacteria | 1001 |
| 573 | Ga0495663_0084016 | 3300046525 | Bacteria | 1029 |
| 574 | Ga0495666_0004146 | 3300046526 | Bacteria | 7309 |
| 575 | Ga0495666_0020165 | 3300046526 | Bacteria | 3305 |
| 576 | Ga0495642_0000127 | 3300046528 | Bacteria | 43547 |
| 577 | Ga0495642_0000327 | 3300046528 | Bacteria | 25996 |
| 578 | Ga0495642_0004101 | 3300046528 | Bacteria | 5683 |
| 579 | Ga0495642_0009709 | 3300046528 | Bacteria | 3683 |
| 580 | Ga0495642_0011532 | 3300046528 | Bacteria | 3397 |
| 581 | Ga0495642_0020857 | 3300046528 | Bacteria | 2577 |
| 582 | Ga0495642_0024380 | 3300046528 | Bacteria | 2392 |
| 583 | Ga0495642_0045565 | 3300046528 | Bacteria | 1792 |
| 584 | Ga0495642_0052619 | 3300046528 | Bacteria | 1677 |
| 585 | Ga0495642_0088070 | 3300046528 | Bacteria | 1312 |
| 586 | Ga0495642_0134778 | 3300046528 | Bacteria | 1064 |
| 587 | Ga0495652_0008518 | 3300046529 | Bacteria | 9354 |
| 588 | Ga0495652_0034244 | 3300046529 | Bacteria | 4428 |
| 589 | Ga0495652_0038809 | 3300046529 | Bacteria | 4122 |
| 590 | Ga0495652_0245712 | 3300046529 | Bacteria | 1329 |
| 591 | Ga0495654_0000002 | 3300046530 | Bacteria | 1021205 |
| 592 | Ga0495654_0017562 | 3300046530 | Bacteria | 3758 |
| 593 | Ga0495654_0022822 | 3300046530 | Bacteria | 3245 |
| 594 | Ga0495654_0277367 | 3300046530 | Bacteria | 690 |
| 595 | Ga0495665_0007507 | 3300046531 | Bacteria | 5902 |
| 596 | Ga0495665_0157783 | 3300046531 | Bacteria | 1183 |
| 597 | Ga0495665_0171516 | 3300046531 | Bacteria | 1129 |
| 598 | Ga0495640_0005616 | 3300046533 | Bacteria | 9978 |
| 599 | Ga0495640_0007861 | 3300046533 | Bacteria | 8385 |
| 600 | Ga0495586_0001930 | 3300046535 | Bacteria | 11298 |
| 601 | Ga0495586_0015457 | 3300046535 | Bacteria | 4060 |
| 602 | Ga0495587_0009572 | 3300046536 | Bacteria | 6202 |
| 603 | Ga0495587_0025519 | 3300046536 | Bacteria | 3611 |
| 604 | Ga0495609_0003245 | 3300046538 | Bacteria | 9411 |
| 605 | Ga0495609_0010758 | 3300046538 | Bacteria | 4377 |
| 606 | Ga0495609_0013376 | 3300046538 | Bacteria | 3877 |
| 607 | Ga0495609_0029965 | 3300046538 | Bacteria | 2476 |
| 608 | Ga0495609_0043776 | 3300046538 | Bacteria | 2009 |
| 609 | Ga0495609_0049508 | 3300046538 | Bacteria | 1875 |
| 610 | Ga0495609_0080498 | 3300046538 | Bacteria | 1424 |
| 611 | Ga0495609_0114220 | 3300046538 | Bacteria | 1164 |
| 612 | Ga0495597_0001550 | 3300046542 | Bacteria | 16266 |
| 613 | Ga0495597_0013576 | 3300046542 | Bacteria | 3897 |
| 614 | Ga0495597_0016559 | 3300046542 | Bacteria | 3480 |
| 615 | Ga0495597_0050686 | 3300046542 | Bacteria | 1831 |
| 616 | Ga0495645_0061188 | 3300046543 | Bacteria | 2728 |
| 617 | Ga0495645_0188451 | 3300046543 | Bacteria | 1408 |
| 618 | Ga0495622_0002234 | 3300046557 | Bacteria | 9417 |
| 619 | Ga0495622_0005946 | 3300046557 | Bacteria | 5670 |
| 620 | Ga0495622_0029071 | 3300046557 | Bacteria | 2582 |
| 621 | Ga0495622_0285102 | 3300046557 | Bacteria | 722 |
| 622 | Ga0495633_0001530 | 3300046558 | Bacteria | 17765 |
| 623 | Ga0495633_0003058 | 3300046558 | Bacteria | 11383 |
| 624 | Ga0495633_0003182 | 3300046558 | Bacteria | 11089 |
| 625 | Ga0495633_0007143 | 3300046558 | Bacteria | 6480 |
| 626 | Ga0495633_0034047 | 3300046558 | Bacteria | 2452 |
| 627 | Ga0495633_0063176 | 3300046558 | Bacteria | 1733 |
| 628 | Ga0495633_0088896 | 3300046558 | Bacteria | 1436 |
| 629 | Ga0495633_0117606 | 3300046558 | Bacteria | 1231 |
| 630 | Ga0495667_0009980 | 3300046559 | Bacteria | 6430 |
| 631 | Ga0495667_0024798 | 3300046559 | Bacteria | 4040 |
| 632 | Ga0495667_0027230 | 3300046559 | Bacteria | 3853 |
| 633 | Ga0495656_0008900 | 3300046615 | Bacteria | 3601 |
| 634 | Ga0495656_0056582 | 3300046615 | Bacteria | 1695 |
| 635 | Ga0495656_0059870 | 3300046615 | Bacteria | 1658 |
| 636 | Ga0495656_0124220 | 3300046615 | Bacteria | 1222 |
| 637 | Ga0495656_0125502 | 3300046615 | Bacteria | 1216 |
| 638 | Ga0495656_0179770 | 3300046615 | Bacteria | 1039 |
| 639 | Ga0495656_0532226 | 3300046615 | Bacteria | 625 |
| 640 | Ga0495668_0000964 | 3300046616 | Bacteria | 31929 |
| 641 | Ga0495668_0001840 | 3300046616 | Bacteria | 19132 |
| 642 | Ga0495668_0006662 | 3300046616 | Bacteria | 7523 |
| 643 | Ga0495668_0009969 | 3300046616 | Bacteria | 5787 |
| 644 | Ga0495668_0022516 | 3300046616 | Bacteria | 3601 |
| 645 | Ga0495668_0032092 | 3300046616 | Bacteria | 2957 |
| 646 | Ga0495668_0036234 | 3300046616 | Bacteria | 2764 |
| 647 | Ga0495668_0076125 | 3300046616 | Bacteria | 1843 |
| 648 | Ga0495668_0167715 | 3300046616 | Bacteria | 1203 |
| 649 | Ga0495668_0203139 | 3300046616 | Bacteria | 1085 |
| 650 | Ga0495668_0334710 | 3300046616 | Bacteria | 830 |
| 651 | Ga0495634_0001188 | 3300046642 | Bacteria | 24100 |
| 652 | Ga0495634_0004312 | 3300046642 | Bacteria | 11213 |
| 653 | Ga0495611_0003108 | 3300046648 | Bacteria | 7372 |
| 654 | Ga0495611_0003333 | 3300046648 | Bacteria | 7094 |
| 655 | Ga0495611_0013929 | 3300046648 | Bacteria | 3431 |
| 656 | Ga0495611_0036925 | 3300046648 | Bacteria | 2170 |
| 657 | Ga0495611_0042537 | 3300046648 | Bacteria | 2028 |
| 658 | Ga0495611_0042733 | 3300046648 | Bacteria | 2024 |
| 659 | Ga0495611_0065509 | 3300046648 | Bacteria | 1655 |
| 660 | Ga0495611_0147430 | 3300046648 | Bacteria | 1098 |
| 661 | Ga0495611_0229269 | 3300046648 | Bacteria | 863 |
| 662 | Ga0495625_0032978 | 3300046660 | Bacteria | 3834 |
| 663 | Ga0495625_0116766 | 3300046660 | Bacteria | 1820 |
| 664 | Ga0495625_0161287 | 3300046660 | Bacteria | 1502 |
| 665 | Ga0495625_0302718 | 3300046660 | Bacteria | 1022 |
| 666 | Ga0495625_0390691 | 3300046660 | Bacteria | 871 |
| 667 | Ga0495635_0001058 | 3300046663 | Bacteria | 18230 |
| 668 | Ga0495635_0034215 | 3300046663 | Bacteria | 3524 |
| 669 | Ga0495661_0000109 | 3300046665 | Bacteria | 97921 |
| 670 | Ga0495661_0000756 | 3300046665 | Bacteria | 31283 |
| 671 | Ga0495661_0003435 | 3300046665 | Bacteria | 11691 |
| 672 | Ga0495661_0009524 | 3300046665 | Bacteria | 6664 |
| 673 | Ga0495661_0012343 | 3300046665 | Bacteria | 5768 |
| 674 | Ga0495661_0029379 | 3300046665 | Bacteria | 3509 |
| 675 | Ga0495661_0065401 | 3300046665 | Bacteria | 2142 |
| 676 | Ga0495661_0130086 | 3300046665 | Bacteria | 1380 |
| 677 | Ga0495661_0132154 | 3300046665 | Bacteria | 1366 |
| 678 | Ga0495661_0366347 | 3300046665 | Bacteria | 706 |
| 679 | Ga0495588_0001308 | 3300046674 | Bacteria | 10654 |
| 680 | Ga0495588_0004018 | 3300046674 | Bacteria | 6470 |
| 681 | Ga0495588_0008498 | 3300046674 | Bacteria | 4717 |
| 682 | Ga0495588_0029430 | 3300046674 | Bacteria | 2755 |
| 683 | Ga0495588_0046506 | 3300046674 | Bacteria | 2226 |
| 684 | Ga0495588_0082244 | 3300046674 | Bacteria | 1681 |
| 685 | Ga0495588_0199455 | 3300046674 | Bacteria | 1057 |
| 686 | Ga0495588_0452624 | 3300046674 | Bacteria | 673 |
| 687 | Ga0495657_0011523 | 3300046675 | Bacteria | 6606 |
| 688 | Ga0495599_0003523 | 3300046678 | Bacteria | 9167 |
| 689 | Ga0495623_0003821 | 3300046679 | Bacteria | 9925 |
| 690 | Ga0495623_0006259 | 3300046679 | Bacteria | 7742 |
| 691 | Ga0495646_0000934 | 3300046680 | Bacteria | 16609 |
| 692 | Ga0495646_0040703 | 3300046680 | Bacteria | 2860 |
| 693 | Ga0495647_0033716 | 3300046681 | Bacteria | 1914 |
| 694 | Ga0495658_0005872 | 3300046683 | Bacteria | 6026 |
| 695 | Ga0495669_0000428 | 3300046684 | Bacteria | 19954 |
| 696 | Ga0495669_0003196 | 3300046684 | Bacteria | 6745 |
| 697 | Ga0495669_0005017 | 3300046684 | Bacteria | 5504 |
| 698 | Ga0495669_0007731 | 3300046684 | Bacteria | 4512 |
| 699 | Ga0495669_0026347 | 3300046684 | Bacteria | 2540 |
| 700 | Ga0495669_0028325 | 3300046684 | Bacteria | 2453 |
| 701 | Ga0495669_0280629 | 3300046684 | Bacteria | 801 |
| 702 | Ga0495613_0023353 | 3300046689 | Bacteria | 4607 |
| 703 | Ga0495613_0048777 | 3300046689 | Bacteria | 3127 |
| 704 | Ga0495624_0025521 | 3300046690 | Bacteria | 3878 |
| 705 | Ga0495670_0000682 | 3300046691 | Bacteria | 16132 |
| 706 | Ga0495670_0002820 | 3300046691 | Bacteria | 8599 |
| 707 | Ga0495670_0004362 | 3300046691 | Bacteria | 6938 |
| 708 | Ga0495670_0049045 | 3300046691 | Bacteria | 2112 |
| 709 | Ga0495670_0052263 | 3300046691 | Bacteria | 2045 |
| 710 | Ga0495670_0092600 | 3300046691 | Bacteria | 1548 |
| 711 | Ga0495670_0095577 | 3300046691 | Bacteria | 1524 |
| 712 | Ga0495670_0175008 | 3300046691 | Bacteria | 1131 |
| 713 | Ga0495670_0194324 | 3300046691 | Bacteria | 1073 |
| 714 | Ga0495670_0211159 | 3300046691 | Bacteria | 1029 |
| 715 | Ga0495671_0000002 | 3300046692 | Bacteria | 1136189 |
| 716 | Ga0495671_0000188 | 3300046692 | Bacteria | 54628 |
| 717 | Ga0495671_0007556 | 3300046692 | Bacteria | 6183 |
| 718 | Ga0495671_0011166 | 3300046692 | Bacteria | 4954 |
| 719 | Ga0495671_0023503 | 3300046692 | Bacteria | 3220 |
| 720 | Ga0495671_0139708 | 3300046692 | Bacteria | 1180 |
| 721 | Ga0495649_0000592 | 3300046694 | Bacteria | 30307 |
| 722 | Ga0495649_0001690 | 3300046694 | Bacteria | 16347 |
| 723 | Ga0495649_0109066 | 3300046694 | Bacteria | 1468 |
| 724 | Ga0495589_0000270 | 3300046794 | Bacteria | 42191 |
| 725 | Ga0495589_0000896 | 3300046794 | Bacteria | 18450 |
| 726 | Ga0495589_0008749 | 3300046794 | Bacteria | 5270 |
| 727 | Ga0495589_0014272 | 3300046794 | Bacteria | 4093 |
| 728 | Ga0495589_0025680 | 3300046794 | Bacteria | 2988 |
| 729 | Ga0495589_0063815 | 3300046794 | Bacteria | 1806 |
| 730 | Ga0495589_0087135 | 3300046794 | Bacteria | 1516 |
| 731 | Ga0495589_0122986 | 3300046794 | Bacteria | 1249 |
| 732 | Ga0495589_0173172 | 3300046794 | Bacteria | 1025 |
| 733 | Ga0495600_0001795 | 3300046809 | Bacteria | 11997 |
| 734 | Ga0495600_0227149 | 3300046809 | Bacteria | 1193 |
| 735 | Ga0495600_0296256 | 3300046809 | Bacteria | 1021 |
| 736 | Ga0495660_0004522 | 3300046810 | Bacteria | 8403 |
| 737 | Ga0495660_0009360 | 3300046810 | Bacteria | 5713 |
| 738 | Ga0495660_0014959 | 3300046810 | Bacteria | 4487 |
| 739 | Ga0495660_0015117 | 3300046810 | Bacteria | 4463 |
| 740 | Ga0495660_0029577 | 3300046810 | Bacteria | 3089 |
| 741 | Ga0495581_0000567 | 3300047315 | Bacteria | 19221 |
| 742 | Ga0495581_0085193 | 3300047315 | Bacteria | 1831 |
| 743 | Ga0495604_0013094 | 3300047317 | Bacteria | 6606 |
| 744 | Ga0495604_0056371 | 3300047317 | Bacteria | 3025 |
| 745 | Ga0495604_0091763 | 3300047317 | Bacteria | 2251 |
| 746 | Ga0495674_0003114 | 3300047319 | Bacteria | 16114 |
| 747 | Ga0495674_0007182 | 3300047319 | Bacteria | 10654 |
| 748 | Ga0495674_0015961 | 3300047319 | Bacteria | 7010 |
| 749 | Ga0495674_0269727 | 3300047319 | Bacteria | 1397 |
| 750 | Ga0495672_0000067 | 3300047320 | Bacteria | 190335 |
| 751 | Ga0495672_0017620 | 3300047320 | Bacteria | 4774 |
| 752 | Ga0495672_0046495 | 3300047320 | Bacteria | 2588 |
| 753 | Ga0495676_0000133 | 3300047321 | Bacteria | 56165 |
| 754 | Ga0495676_0011969 | 3300047321 | Bacteria | 7828 |
| 755 | Ga0495676_0088630 | 3300047321 | Bacteria | 2320 |
| 756 | Ga0495676_0104552 | 3300047321 | Bacteria | 2089 |
| 757 | Ga0495680_0029493 | 3300047322 | Bacteria | 4492 |
| 758 | Ga0495680_0233868 | 3300047322 | Bacteria | 1307 |
| 759 | Ga0495683_0000088 | 3300047323 | Bacteria | 92118 |
| 760 | Ga0495683_0000348 | 3300047323 | Bacteria | 38313 |
| 761 | Ga0495683_0017183 | 3300047323 | Bacteria | 3751 |
| 762 | Ga0495683_0018228 | 3300047323 | Bacteria | 3631 |
| 763 | Ga0495683_0033505 | 3300047323 | Bacteria | 2614 |
| 764 | Ga0495683_0089908 | 3300047323 | Bacteria | 1489 |
| 765 | Ga0495683_0104787 | 3300047323 | Bacteria | 1356 |
| 766 | Ga0495687_000007 | 3300047443 | Bacteria | 552679 |
| 767 | Ga0495687_001998 | 3300047443 | Bacteria | 17300 |
| 768 | Ga0495687_036483 | 3300047443 | Bacteria | 2200 |
| 769 | Ga0495687_045422 | 3300047443 | Bacteria | 1902 |
| 770 | Ga0495675_0001019 | 3300047444 | Bacteria | 17022 |
| 771 | Ga0495675_0002644 | 3300047444 | Bacteria | 10732 |
| 772 | Ga0495675_0026954 | 3300047444 | Bacteria | 3663 |
| 773 | Ga0495677_0000524 | 3300047445 | Bacteria | 16031 |
| 774 | Ga0495677_0005313 | 3300047445 | Bacteria | 4885 |
| 775 | Ga0495677_0007899 | 3300047445 | Bacteria | 3956 |
| 776 | Ga0495677_0012584 | 3300047445 | Bacteria | 3085 |
| 777 | Ga0495677_0018227 | 3300047445 | Bacteria | 2544 |
| 778 | Ga0495677_0023029 | 3300047445 | Bacteria | 2260 |
| 779 | Ga0495677_0028180 | 3300047445 | Bacteria | 2039 |
| 780 | Ga0495677_0054320 | 3300047445 | Bacteria | 1477 |
| 781 | Ga0495677_0138986 | 3300047445 | Bacteria | 932 |
| 782 | Ga0495677_0142559 | 3300047445 | Bacteria | 920 |
| 783 | Ga0495677_0171467 | 3300047445 | Bacteria | 839 |
| 784 | Ga0495677_0303752 | 3300047445 | Bacteria | 628 |
| 785 | Ga0495679_003371 | 3300047446 | Bacteria | 7700 |
| 786 | Ga0495679_005786 | 3300047446 | Bacteria | 5441 |
| 787 | Ga0495679_008614 | 3300047446 | Bacteria | 4132 |
| 788 | Ga0495685_002234 | 3300047447 | Bacteria | 6032 |
| 789 | Ga0495685_010013 | 3300047447 | Bacteria | 3174 |
| 790 | Ga0495685_064187 | 3300047447 | Bacteria | 1235 |
| 791 | Ga0495673_0000005 | 3300047469 | Bacteria | 943364 |
| 792 | Ga0495673_0098160 | 3300047469 | Bacteria | 1188 |
| 793 | Ga0495681_0001742 | 3300047470 | Bacteria | 16087 |
| 794 | Ga0495681_0019307 | 3300047470 | Bacteria | 3726 |
| 795 | Ga0495681_0023218 | 3300047470 | Bacteria | 3300 |
| 796 | Ga0495681_0023251 | 3300047470 | Bacteria | 3297 |
| 797 | Ga0495681_0033497 | 3300047470 | Bacteria | 2572 |
| 798 | Ga0495681_0047331 | 3300047470 | Bacteria | 2046 |
| 799 | Ga0495681_0086936 | 3300047470 | Bacteria | 1386 |
| 800 | Ga0495681_0139715 | 3300047470 | Bacteria | 1024 |
| 801 | Ga0495681_0176531 | 3300047470 | Bacteria | 880 |
| 802 | Ga0495684_0172025 | 3300047471 | Bacteria | 1610 |
| 803 | Ga0495686_0043573 | 3300047472 | Bacteria | 2844 |
| 804 | Ga0495686_0065615 | 3300047472 | Bacteria | 2244 |
| 805 | Ga0495686_0122044 | 3300047472 | Bacteria | 1552 |
| 806 | Ga0495686_0197996 | 3300047472 | Bacteria | 1154 |
| 807 | Ga0495593_0001714 | 3300047673 | Bacteria | 12977 |
| 808 | Ga0495593_0002295 | 3300047673 | Bacteria | 11465 |
| 809 | Ga0495593_0007370 | 3300047673 | Bacteria | 6445 |
| 810 | Ga0495602_0004790 | 3300048088 | Bacteria | 14144 |
| 811 | Ga0495602_0048110 | 3300048088 | Bacteria | 3836 |
| 812 | Ga0495614_0008411 | 3300048089 | Bacteria | 4588 |
| 813 | Ga0495614_0306796 | 3300048089 | Bacteria | 734 |
| 814 | Ga0495615_0018636 | 3300048090 | Bacteria | 1531 |
| 815 | Ga0495615_0062105 | 3300048090 | Bacteria | 988 |
| 816 | Ga0495626_0004702 | 3300048091 | Bacteria | 8272 |
| 817 | Ga0495626_0021843 | 3300048091 | Bacteria | 3169 |
| 818 | Ga0495626_0022616 | 3300048091 | Bacteria | 3103 |
| 819 | Ga0495626_0022823 | 3300048091 | Bacteria | 3088 |
| 820 | Ga0495626_0025279 | 3300048091 | Bacteria | 2906 |
| 821 | Ga0495626_0064476 | 3300048091 | Bacteria | 1659 |
| 822 | Ga0495626_0087048 | 3300048091 | Bacteria | 1379 |
| 823 | Ga0496100_0000756 | 3300048903 | Bacteria | 15379 |
| 824 | Ga0496100_0013579 | 3300048903 | Bacteria | 4703 |
| 825 | Ga0496100_0035542 | 3300048903 | Bacteria | 3135 |
| 826 | Ga0496100_0130104 | 3300048903 | Bacteria | 1772 |
| 827 | Ga0496101_0000383 | 3300048904 | Bacteria | 29305 |
| 828 | Ga0496101_0000875 | 3300048904 | Bacteria | 17763 |
| 829 | Ga0496101_0227712 | 3300048904 | Bacteria | 1448 |
| 830 | Ga0496102_0000200 | 3300048905 | Bacteria | 81231 |
| 831 | Ga0496102_0000313 | 3300048905 | Bacteria | 61085 |
| 832 | Ga0496102_0009695 | 3300048905 | Bacteria | 8280 |
| 833 | Ga0496102_0037392 | 3300048905 | Bacteria | 4379 |
| 834 | Ga0496102_0103898 | 3300048905 | Bacteria | 2642 |
| 835 | Ga0496102_0144879 | 3300048905 | Bacteria | 2229 |
| 836 | Ga0496102_0248458 | 3300048905 | Bacteria | 1677 |
| 837 | Ga0496102_0260370 | 3300048905 | Bacteria | 1635 |
| 838 | Ga0496102_0826319 | 3300048905 | Bacteria | 849 |
| 839 | Ga0496103_0006163 | 3300048906 | Bacteria | 7164 |
| 840 | Ga0496103_0045139 | 3300048906 | Bacteria | 2719 |
| 841 | Ga0496103_0065961 | 3300048906 | Bacteria | 2259 |
| 842 | Ga0496104_0036083 | 3300048907 | Bacteria | 4618 |
| 843 | Ga0496104_0208598 | 3300048907 | Bacteria | 1866 |
| 844 | Ga0496104_0259806 | 3300048907 | Bacteria | 1649 |
| 845 | Ga0496105_0015561 | 3300048908 | Bacteria | 6065 |
| 846 | Ga0496105_0017743 | 3300048908 | Bacteria | 5710 |
| 847 | Ga0496105_0101037 | 3300048908 | Bacteria | 2382 |
| 848 | Ga0496105_0101141 | 3300048908 | Bacteria | 2380 |
| 849 | Ga0496105_0406946 | 3300048908 | Bacteria | 1079 |
| 850 | Ga0496105_0607796 | 3300048908 | Bacteria | 848 |
| 851 | Ga0496106_0016638 | 3300048909 | Bacteria | 5441 |
| 852 | Ga0496106_0132381 | 3300048909 | Bacteria | 1956 |
| 853 | Ga0496106_0375713 | 3300048909 | Bacteria | 1142 |
| 854 | Ga0496106_0520999 | 3300048909 | Bacteria | 955 |
| 855 | Ga0496107_0015387 | 3300048910 | Bacteria | 5360 |
| 856 | Ga0496107_0112310 | 3300048910 | Bacteria | 2003 |
| 857 | Ga0496107_0149477 | 3300048910 | Bacteria | 1727 |
| 858 | Ga0496107_0289462 | 3300048910 | Bacteria | 1219 |
| 859 | Ga0496107_0406021 | 3300048910 | Bacteria | 1013 |
| 860 | Ga0496108_0002192 | 3300048911 | Bacteria | 15654 |
| 861 | Ga0496108_0059917 | 3300048911 | Bacteria | 3201 |
| 862 | Ga0496108_0330641 | 3300048911 | Bacteria | 1329 |
| 863 | Ga0496108_0542880 | 3300048911 | Bacteria | 1014 |
| 864 | Ga0496109_0008485 | 3300048912 | Bacteria | 8735 |
| 865 | Ga0496109_0010462 | 3300048912 | Bacteria | 7926 |
| 866 | Ga0496109_0079860 | 3300048912 | Bacteria | 3014 |
| 867 | Ga0496109_0189821 | 3300048912 | Bacteria | 1931 |
| 868 | Ga0496110_0000024 | 3300048913 | Bacteria | 74685 |
| 869 | Ga0496110_0026863 | 3300048913 | Bacteria | 4929 |
| 870 | Ga0496110_0077327 | 3300048913 | Bacteria | 2960 |
| 871 | Ga0496110_0172316 | 3300048913 | Bacteria | 1963 |
| 872 | Ga0496111_0008455 | 3300048914 | Bacteria | 6815 |
| 873 | Ga0496111_0018238 | 3300048914 | Bacteria | 4860 |
| 874 | Ga0496111_0037599 | 3300048914 | Bacteria | 3464 |
| 875 | Ga0496111_0083541 | 3300048914 | Bacteria | 2334 |
| 876 | Ga0496111_0202373 | 3300048914 | Bacteria | 1476 |
| 877 | Ga0496111_0211959 | 3300048914 | Bacteria | 1439 |
| 878 | Ga0496112_0016391 | 3300048915 | Bacteria | 6941 |
| 879 | Ga0496112_0109577 | 3300048915 | Bacteria | 2731 |
| 880 | Ga0496113_0001312 | 3300048916 | Bacteria | 13745 |
| 881 | Ga0496113_0004620 | 3300048916 | Bacteria | 8486 |
| 882 | Ga0496113_0082648 | 3300048916 | Bacteria | 2463 |
| 883 | Ga0496114_0004461 | 3300048917 | Bacteria | 10865 |
| 884 | Ga0496114_0108754 | 3300048917 | Bacteria | 2373 |
| 885 | Ga0496114_0222284 | 3300048917 | Bacteria | 1658 |
| 886 | Ga0496114_0227293 | 3300048917 | Bacteria | 1639 |
| 887 | Ga0496115_0009478 | 3300048918 | Bacteria | 7232 |
| 888 | Ga0496115_0039849 | 3300048918 | Bacteria | 3733 |
| 889 | Ga0496115_0042842 | 3300048918 | Bacteria | 3608 |
| 890 | Ga0496115_0044759 | 3300048918 | Bacteria | 3533 |
| 891 | Ga0496115_0083769 | 3300048918 | Bacteria | 2599 |
| 892 | Ga0496115_0096445 | 3300048918 | Bacteria | 2421 |
| 893 | Ga0496115_0196427 | 3300048918 | Bacteria | 1667 |
| 894 | Ga0496116_0108802 | 3300048919 | Bacteria | 1636 |
| 895 | Ga0496118_0045574 | 3300048921 | Bacteria | 3421 |
| 896 | Ga0496119_0308491 | 3300048922 | Bacteria | 778 |
| 897 | Ga0496120_0289418 | 3300048923 | Bacteria | 754 |
| 898 | Ga0496121_0000330 | 3300048924 | Bacteria | 98687 |
| 899 | Ga0496121_0118895 | 3300048924 | Bacteria | 1999 |
| 900 | Ga0496121_0143226 | 3300048924 | Bacteria | 1770 |
| 901 | Ga0496121_0228466 | 3300048924 | Bacteria | 1305 |
| 902 | Ga0496121_0236094 | 3300048924 | Bacteria | 1277 |
| 903 | Ga0496122_0001042 | 3300048925 | Bacteria | 48555 |
| 904 | Ga0496122_0011608 | 3300048925 | Bacteria | 8893 |
| 905 | Ga0496123_0113149 | 3300048926 | Bacteria | 1546 |
| 906 | Ga0496123_0115403 | 3300048926 | Bacteria | 1524 |
| 907 | Ga0496124_0011638 | 3300048927 | Bacteria | 8780 |
| 908 | Ga0496124_0300059 | 3300048927 | Bacteria | 1161 |
| 909 | Ga0496125_0159825 | 3300048928 | Bacteria | 1532 |
| 910 | Ga0496126_0003590 | 3300048929 | Bacteria | 19439 |
| 911 | Ga0496126_0004961 | 3300048929 | Bacteria | 15521 |
| 912 | Ga0496126_0011183 | 3300048929 | Bacteria | 9314 |
| 913 | Ga0496126_0014351 | 3300048929 | Bacteria | 8012 |
| 914 | Ga0496126_0038390 | 3300048929 | Bacteria | 4457 |
| 915 | Ga0496126_0066220 | 3300048929 | Bacteria | 3230 |
| 916 | Ga0496126_0141728 | 3300048929 | Bacteria | 2068 |
| 917 | Ga0496126_0221290 | 3300048929 | Bacteria | 1590 |
| 918 | Ga0496126_0421703 | 3300048929 | Bacteria | 1079 |
| 919 | Ga0496126_0508953 | 3300048929 | Bacteria | 961 |
| 920 | Ga0495678_000161 | 3300049459 | Bacteria | 79941 |
| 921 | Ga0495678_000355 | 3300049459 | Bacteria | 47179 |
| 922 | Ga0495678_001988 | 3300049459 | Bacteria | 14725 |
| 923 | Ga0495682_0000875 | 3300049460 | Bacteria | 18708 |
| 924 | Ga0495682_0005708 | 3300049460 | Bacteria | 5138 |
| 925 | Ga0495682_0016993 | 3300049460 | Bacteria | 2751 |
| 926 | Ga0495682_0032460 | 3300049460 | Bacteria | 1928 |
| 927 | Ga0495682_0068855 | 3300049460 | Bacteria | 1274 |
| 928 | Ga0495682_0099785 | 3300049460 | Bacteria | 1041 |
| 929 | Ga0501034_0000624 | 3300049571 | Bacteria | 55267 |
| 930 | Ga0501037_0001018 | 3300049573 | Bacteria | 20737 |
| 931 | Ga0501038_0024748 | 3300049574 | Bacteria | 5352 |
| 932 | Ga0501039_0002397 | 3300049575 | Bacteria | 13940 |
| 933 | Ga0501039_1186841 | 3300049575 | Bacteria | 590 |
| 934 | Ga0501047_0004540 | 3300049581 | Bacteria | 13050 |
| 935 | Ga0501067_0002495 | 3300049583 | Bacteria | 10169 |
| 936 | Ga0501073_0031098 | 3300049589 | Bacteria | 3810 |
| 937 | Ga0501080_0000032 | 3300049742 | Bacteria | 86373 |
| 938 | Ga0501035_0000334 | 3300049822 | Bacteria | 54970 |
| 939 | Ga0501035_0000676 | 3300049822 | Bacteria | 37272 |
| 940 | Ga0501044_0000006 | 3300049823 | Bacteria | 291413 |
| 941 | Ga0501044_0375652 | 3300049823 | Bacteria | 1337 |
| 942 | Ga0501045_0069454 | 3300049824 | Bacteria | 2590 |
| 943 | nmdc:mga03n38_12701_c1 | 3300050490 | Bacteria | 3178 |
| 944 | nmdc:mga03n38_35358_c1 | 3300050490 | Bacteria | 2139 |
| 945 | nmdc:mga00v17_355964_c1 | 3300050491 | Bacteria | 952 |
| 946 | nmdc:mga0yw44_148399_c1 | 3300050492 | Bacteria | 1528 |
| 947 | nmdc:mga0yw44_162553_c1 | 3300050492 | Bacteria | 1462 |
| 948 | nmdc:mga0yw44_259422_c1 | 3300050492 | Bacteria | 1158 |
| 949 | nmdc:mga0k408_107657_c1 | 3300050493 | Bacteria | 1646 |
| 950 | nmdc:mga06z11_160840_c1 | 3300050494 | Bacteria | 1283 |
| 951 | nmdc:mga06z11_5269_c1 | 3300050494 | Bacteria | 5174 |
| 952 | nmdc:mga06z11_531070_c1 | 3300050494 | Bacteria | 714 |
| 953 | nmdc:mga04h51_216655_c1 | 3300050495 | Bacteria | 757 |
| 954 | nmdc:mga07m45_283840_c1 | 3300050496 | Bacteria | 963 |
| 955 | nmdc:mga07m45_53498_c1 | 3300050496 | Bacteria | 2281 |
| 956 | nmdc:mga05p37_58216_c1 | 3300050507 | Bacteria | 4759 |
| 957 | nmdc:mga0n895_76791_c1 | 3300050512 | Bacteria | 3321 |
| 958 | nmdc:mga0rr50_497561_c1 | 3300050513 | Bacteria | 1036 |
| 959 | nmdc:mga0sz30_248060_c1 | 3300050516 | Bacteria | 792 |
| 960 | Ga0495601_0016288 | 3300053077 | Bacteria | 4504 |
| 961 | Ga0495601_0177990 | 3300053077 | Bacteria | 1391 |
| 962 | Ga0500635_0027844 | 3300053080 | Bacteria | 1800 |
| 963 | Ga0495655_0004786 | 3300053083 | Bacteria | 2344 |
| 964 | Ga0495655_0095203 | 3300053083 | Bacteria | 874 |
| 965 | Ga0495595_0000335 | 3300053084 | Bacteria | 18133 |
| 966 | Ga0495619_0001292 | 3300053085 | Bacteria | 16456 |
| 967 | Ga0500647_0014839 | 3300053091 | Bacteria | 3551 |
| 968 | Ga0500583_0068458 | 3300053092 | Bacteria | 1693 |
| 969 | Ga0500651_0004019 | 3300053093 | Bacteria | 8166 |
| 970 | Ga0500566_0011427 | 3300053094 | Bacteria | 5229 |
| 971 | Ga0500641_0076732 | 3300053096 | Bacteria | 1413 |
| 972 | Ga0500650_0131221 | 3300053098 | Bacteria | 1165 |
| 973 | Ga0500554_018197 | 3300053102 | Bacteria | 1892 |
| 974 | Ga0500554_131659 | 3300053102 | Bacteria | 845 |
| 975 | Ga0500556_0047237 | 3300053104 | Bacteria | 1544 |
| 976 | Ga0500562_063611 | 3300053108 | Bacteria | 992 |
| 977 | Ga0500592_027325 | 3300053116 | Bacteria | 920 |
| 978 | Ga0500595_000468 | 3300053119 | Bacteria | 24982 |
| 979 | Ga0500595_005272 | 3300053119 | Bacteria | 5666 |
| 980 | Ga0500595_013495 | 3300053119 | Bacteria | 3128 |
| 981 | Ga0500595_025974 | 3300053119 | Bacteria | 2023 |
| 982 | Ga0500595_035010 | 3300053119 | Bacteria | 1657 |
| 983 | Ga0500597_205653 | 3300053120 | Bacteria | 825 |
| 984 | Ga0500618_000419 | 3300053125 | Bacteria | 28610 |
| 985 | Ga0500658_0130238 | 3300053134 | Bacteria | 1121 |
| 986 | Ga0500568_0003017 | 3300053139 | Bacteria | 9628 |
| 987 | Ga0500579_190500 | 3300053143 | Bacteria | 783 |
| 988 | Ga0500589_111338 | 3300053147 | Bacteria | 1173 |
| 989 | Ga0500604_0056262 | 3300053151 | Bacteria | 1225 |
| 990 | Ga0500604_0105218 | 3300053151 | Bacteria | 933 |
| 991 | Ga0500622_0041926 | 3300053156 | Bacteria | 2380 |
| 992 | Ga0500622_0217827 | 3300053156 | Bacteria | 858 |
| 993 | Ga0500633_0094403 | 3300053160 | Bacteria | 1096 |
| 994 | Ga0500638_002107 | 3300053162 | Bacteria | 6750 |
| 995 | Ga0500638_068294 | 3300053162 | Bacteria | 1702 |
| 996 | Ga0500637_0000546 | 3300053178 | Bacteria | 14728 |
| 997 | Ga0500661_000782 | 3300055283 | Bacteria | 5933 |
| 998 | 2513659354 | 2513237096 | Bacteria | 8722461 |
| 999 | 2513672836 | 2513237098 | Bacteria | 9902361 |
| 1000 | 2513861725 | 2513237137 | Bacteria | 9558895 |
| 1001 | 2513921384 | 2513237145 | Bacteria | 8979722 |
| 1002 | 2517893702 | 2517572143 | Bacteria | 9484767 |
| 1003 | 2524469935 | 2524023210 | Bacteria | 9029266 |
| 1004 | 2524535897 | 2524023228 | Bacteria | 10118060 |
| 1005 | 2643801567 | 2643221556 | Bacteria | 7251154 |
| 1006 | 2644471372 | 2643221684 | Bacteria | 7145183 |
| 1007 | 2671693986 | 2671180139 | Bacteria | 4196045 |
| 1008 | 2728752844 | 2728368998 | Bacteria | 8720350 |
| 1009 | 2857568876 | 2857564685 | Bacteria | 6290584 |
| 1010 | 2885389614 | 2885383462 | Bacteria | 9473874 |
| 1011 | 2902409270 | 2902405164 | Bacteria | 6784948 |
| 1012 | 2903756283 | 2903748898 | Bacteria | 9972761 |
| 1013 | 2903756677 | 2903748898 | Bacteria | 9972761 |
| 1014 | 2903774319 | 2903768456 | Bacteria | 9749579 |
| 1015 | 2904701399 | |||
| 1016 | 2906641898 | 2906635258 | Bacteria | 8601019 |
| 1017 | 2906666089 | 2906660503 | Bacteria | 8595048 |
| 1018 | 3005478882 | 3005474847 | Bacteria | 9259049 |
| 1019 | 643592634 | 643348564 | Bacteria | 8839022 |
| 1020 | 8056687755 | 8056681323 | Bacteria | 8472857 |
| 1021 | Ga0395905_0392592 | |||
| 1022 | JGI25165J46597_1000006 | |||
| 1023 | JGI25404J52841_10000254 | |||
| 1024 | Ga0065165_1010810 | |||
| 1025 | Ga0070658_10068107 | |||
| 1026 | Ga0070658_10547925 | |||
| 1027 | Ga0070658_10852956 | |||
| 1028 | Ga0070676_10950368 | |||
| 1029 | Ga0070683_100020118 | |||
| 1030 | Ga0070683_100387791 | |||
| 1031 | Ga0070690_100629919 | |||
| 1032 | Ga0068869_100017200 | |||
| 1033 | Ga0070680_100043042 | |||
| 1034 | Ga0070682_100042469 | |||
| 1035 | Ga0070682_100157416 | |||
| 1036 | Ga0068868_100006547 | |||
| 1037 | Ga0068868_100069042 | |||
| 1038 | Ga0068868_100203216 | |||
| 1039 | Ga0070660_100228899 | |||
| 1040 | Ga0070660_100386908 | |||
| 1041 | Ga0070660_100824176 | |||
| 1042 | Ga0070660_101232277 | |||
| 1043 | Ga0070689_100230654 | |||
| 1044 | Ga0070689_100574766 | |||
| 1045 | Ga0070691_10111683 | |||
| 1046 | Ga0070661_100149234 | |||
| 1047 | Ga0070661_100189925 | |||
| 1048 | Ga0070668_100045256 | |||
| 1049 | Ga0070668_100104644 | |||
| 1050 | Ga0070668_100182551 | |||
| 1051 | Ga0070668_100409293 | |||
| 1052 | Ga0070668_101059470 | |||
| 1053 | Ga0070675_101180122 | |||
| 1054 | Ga0070671_100267604 | |||
| 1055 | Ga0070671_101078679 | |||
| 1056 | Ga0070674_100021173 | |||
| 1057 | Ga0070674_100142087 | |||
| 1058 | Ga0070688_100518703 | |||
| 1059 | Ga0070659_100285174 | |||
| 1060 | Ga0070659_100483469 | |||
| 1061 | Ga0070667_100244921 | |||
| 1062 | Ga0070667_100830546 | |||
| 1063 | Ga0070701_10104741 | |||
| 1064 | Ga0070701_10150986 | |||
| 1065 | Ga0070694_100626303 | |||
| 1066 | Ga0070663_100016240 | |||
| 1067 | Ga0070663_100020052 | |||
| 1068 | Ga0070663_100020229 | |||
| 1069 | Ga0070663_100123056 | |||
| 1070 | Ga0070678_100003659 | |||
| 1071 | Ga0070678_100017610 | |||
| 1072 | Ga0070678_100037277 | |||
| 1073 | Ga0070678_100067668 | |||
| 1074 | Ga0070678_100596432 | |||
| 1075 | Ga0070678_101004192 | |||
| 1076 | Ga0070681_10058589 | |||
| 1077 | Ga0068867_100049914 | |||
| 1078 | Ga0070699_100857343 | |||
| 1079 | Ga0070679_100021982 | |||
| 1080 | Ga0070679_100897741 | |||
| 1081 | Ga0070684_100032764 | |||
| 1082 | Ga0070684_100132369 | |||
| 1083 | Ga0070684_101162130 | |||
| 1084 | Ga0068853_100014537 | |||
| 1085 | Ga0068853_100205235 | |||
| 1086 | Ga0068853_100391277 | |||
| 1087 | Ga0068853_100981262 | |||
| 1088 | Ga0070672_100215342 | |||
| 1089 | Ga0070672_100670484 | |||
| 1090 | Ga0070686_100643605 | |||
| 1091 | Ga0070693_100091362 | |||
| 1092 | Ga0070693_100715250 | |||
| 1093 | Ga0070665_100044315 | |||
| 1094 | Ga0070665_100075092 | |||
| 1095 | Ga0070665_100356918 | |||
| 1096 | Ga0070704_100137670 | |||
| 1097 | Ga0068855_100014574 | |||
| 1098 | Ga0068855_100066675 | |||
| 1099 | Ga0068855_100511759 | |||
| 1100 | Ga0070664_100010213 | |||
| 1101 | Ga0070664_100021262 | |||
| 1102 | Ga0070664_100338419 | |||
| 1103 | Ga0070664_100360249 | |||
| 1104 | Ga0070664_100603872 | |||
| 1105 | Ga0070664_100656011 | |||
| 1106 | Ga0070664_101165996 | |||
| 1107 | Ga0068857_100066317 | |||
| 1108 | Ga0068856_100107887 | |||
| 1109 | Ga0068856_100448795 | |||
| 1110 | Ga0070702_100061421 | |||
| 1111 | Ga0068852_100022692 | |||
| 1112 | Ga0068859_100237233 | |||
| 1113 | Ga0068864_100029384 | |||
| 1114 | Ga0068864_100073671 | |||
| 1115 | Ga0068864_100484821 | |||
| 1116 | Ga0068861_100052716 | |||
| 1117 | Ga0068861_100259325 | |||
| 1118 | Ga0068863_100133864 | |||
| 1119 | Ga0068863_100554868 | |||
| 1120 | Ga0068858_100023425 | |||
| 1121 | Ga0068858_100060057 | |||
| 1122 | Ga0068858_100512257 | |||
| 1123 | Ga0068860_100292362 | |||
| 1124 | Ga0068860_101064641 | |||
| 1125 | Ga0068862_100744702 | |||
| 1126 | Ga0081455_10027227 | |||
| 1127 | Ga0081540_1002053 | |||
| 1128 | Ga0081540_1003838 | |||
| 1129 | Ga0081540_1005208 | |||
| 1130 | Ga0081540_1007807 | |||
| 1131 | Ga0081540_1011448 | |||
| 1132 | Ga0081540_1053737 | |||
| 1133 | Ga0081540_1088971 | |||
| 1134 | Ga0070717_10268386 | |||
| 1135 | Ga0075365_10114109 | |||
| 1136 | Ga0075365_10199133 | |||
| 1137 | Ga0075365_10543491 | |||
| 1138 | Ga0075368_10002535 | |||
| 1139 | Ga0075368_10194609 | |||
| 1140 | Ga0075363_100070718 | |||
| 1141 | Ga0075363_100084189 | |||
| 1142 | Ga0075364_10180614 | |||
| 1143 | Ga0070716_100286611 | |||
| 1144 | Ga0070716_100564558 | |||
| 1145 | Ga0070712_100098016 | |||
| 1146 | Ga0070712_100194272 | |||
| 1147 | Ga0075362_10062304 | |||
| 1148 | Ga0075362_10191086 | |||
| 1149 | Ga0075367_10165209 | |||
| 1150 | Ga0075367_10264097 | |||
| 1151 | Ga0075369_10073823 | |||
| 1152 | Ga0075369_10083370 | |||
| 1153 | Ga0075369_10340680 | |||
| 1154 | Ga0075366_10173916 | |||
| 1155 | Ga0075366_10460445 | |||
| 1156 | Ga0097621_100045438 | |||
| 1157 | Ga0097621_100097225 | |||
| 1158 | Ga0068871_100031318 | |||
| 1159 | Ga0068871_100925971 | |||
| 1160 | Ga0068865_100039829 | |||
| 1161 | Ga0068865_100442397 | |||
| 1162 | Ga0097620_100237229 | |||
| 1163 | Ga0075435_100040178 | |||
| 1164 | Ga0099794_10029377 | |||
| 1165 | Ga0099795_10001567 | |||
| 1166 | Ga0105251_10099205 | |||
| 1167 | Ga0105250_10227237 | |||
| 1168 | Ga0105240_10245861 | |||
| 1169 | Ga0105245_10027787 | |||
| 1170 | Ga0105245_10186930 | |||
| 1171 | Ga0105245_10266547 | |||
| 1172 | Ga0105245_10642134 | |||
| 1173 | Ga0105247_10160166 | |||
| 1174 | Ga0105243_10011026 | |||
| 1175 | Ga0105243_10194224 | |||
| 1176 | Ga0105241_10022807 | |||
| 1177 | Ga0105242_10056727 | |||
| 1178 | Ga0105242_10214044 | |||
| 1179 | Ga0105248_10034971 | |||
| 1180 | Ga0105248_10578130 | |||
| 1181 | Ga0105248_11586612 | |||
| 1182 | Ga0105237_10043449 | |||
| 1183 | Ga0105237_10167236 | |||
| 1184 | Ga0105237_10726337 | |||
| 1185 | Ga0105238_10152073 | |||
| 1186 | Ga0105238_10193575 | |||
| 1187 | Ga0105238_10441350 | |||
| 1188 | Ga0105249_10071994 | |||
| 1189 | Ga0099796_10004654 | |||
| 1190 | Ga0105239_10010954 | |||
| 1191 | Ga0105239_10058369 | |||
| 1192 | Ga0105239_10120429 | |||
| 1193 | Ga0105239_10503863 | |||
| 1194 | Ga0105239_11076959 | |||
| 1195 | Ga0105246_10020290 | |||
| 1196 | Ga0105246_10068823 | |||
| 1197 | Ga0157370_10034059 | |||
| 1198 | Ga0157369_10002265 | |||
| 1199 | Ga0157369_10016093 | |||
| 1200 | Ga0157369_10975869 | |||
| 1201 | Ga0157374_10003326 | |||
| 1202 | Ga0157378_10260553 | |||
| 1203 | Ga0163162_10015168 | |||
| 1204 | Ga0163162_10055092 | |||
| 1205 | Ga0163162_10116218 | |||
| 1206 | Ga0157372_10041023 | |||
| 1207 | Ga0157372_11140579 | |||
| 1208 | Ga0157375_10008539 | |||
| 1209 | Ga0157375_10309505 | |||
| 1210 | Ga0163163_10003792 | |||
| 1211 | Ga0163163_10007553 | |||
| 1212 | Ga0163163_10607263 | |||
| 1213 | Ga0157380_10019544 | |||
| 1214 | Ga0157380_10334323 | |||
| 1215 | Ga0157377_10369375 | |||
| 1216 | Ga0157379_10385425 | |||
| 1217 | Ga0157376_10017469 | |||
| 1218 | Ga0157376_10645767 | |||
| 1219 | Ga0163161_10021099 | |||
| 1220 | Ga0213874_10049416 | |||
| 1221 | Ga0209233_1000010 | |||
| 1222 | Ga0209758_1001532 | |||
| 1223 | Ga0209758_1003142 | |||
| 1224 | Ga0209758_1045817 | |||
| 1225 | Ga0207642_10248740 | |||
| 1226 | Ga0207688_10104915 | |||
| 1227 | Ga0207680_10609889 | |||
| 1228 | Ga0207647_10161105 | |||
| 1229 | Ga0207685_10367371 | |||
| 1230 | Ga0207699_10464097 | |||
| 1231 | Ga0207645_10087751 | |||
| 1232 | Ga0207645_10401305 | |||
| 1233 | Ga0207643_10033308 | |||
| 1234 | Ga0207705_10057990 | |||
| 1235 | Ga0207705_10138765 | |||
| 1236 | Ga0207684_10670595 | |||
| 1237 | Ga0207695_10137206 | |||
| 1238 | Ga0207671_10192869 | |||
| 1239 | Ga0207693_10050481 | |||
| 1240 | Ga0207693_10066564 | |||
| 1241 | Ga0207660_10163892 | |||
| 1242 | Ga0207662_10115102 | |||
| 1243 | Ga0207657_10036254 | |||
| 1244 | Ga0207657_10240292 | |||
| 1245 | Ga0207657_10321342 | |||
| 1246 | Ga0207652_10068496 | |||
| 1247 | Ga0207652_10156528 | |||
| 1248 | Ga0207652_11039463 | |||
| 1249 | Ga0207694_10326021 | |||
| 1250 | Ga0207694_10789944 | |||
| 1251 | Ga0207687_10075061 | |||
| 1252 | Ga0207687_10358550 | |||
| 1253 | Ga0207700_11515884 | |||
| 1254 | Ga0207644_10119591 | |||
| 1255 | Ga0207644_10496015 | |||
| 1256 | Ga0207644_10837271 | |||
| 1257 | Ga0207690_10034215 | |||
| 1258 | Ga0207690_10247079 | |||
| 1259 | Ga0207690_10357911 | |||
| 1260 | Ga0207706_10060448 | |||
| 1261 | Ga0207706_10360749 | |||
| 1262 | Ga0207686_10062197 | |||
| 1263 | Ga0207686_10251825 | |||
| 1264 | Ga0207709_10028413 | |||
| 1265 | Ga0207709_10041029 | |||
| 1266 | Ga0207709_10067476 | |||
| 1267 | Ga0207669_10012350 | |||
| 1268 | Ga0207669_10042118 | |||
| 1269 | Ga0207704_10340194 | |||
| 1270 | Ga0207704_10369105 | |||
| 1271 | Ga0207665_10225069 | |||
| 1272 | Ga0207691_10059924 | |||
| 1273 | Ga0207691_10469567 | |||
| 1274 | Ga0207711_10518245 | |||
| 1275 | Ga0207689_10075529 | |||
| 1276 | Ga0207689_10091812 | |||
| 1277 | Ga0207661_10028832 | |||
| 1278 | Ga0207661_10615357 | |||
| 1279 | Ga0207679_10048953 | |||
| 1280 | Ga0207679_10206649 | |||
| 1281 | Ga0207679_10781411 | |||
| 1282 | Ga0207667_10010756 | |||
| 1283 | Ga0207667_10015015 | |||
| 1284 | Ga0207667_10074694 | |||
| 1285 | Ga0207667_10596978 | |||
| 1286 | Ga0207667_10810644 | |||
| 1287 | Ga0207651_10091652 | |||
| 1288 | Ga0207712_10124192 | |||
| 1289 | Ga0207712_10446352 | |||
| 1290 | Ga0207668_10019967 | |||
| 1291 | Ga0207668_10036022 | |||
| 1292 | Ga0207640_10041183 | |||
| 1293 | Ga0207640_10284821 | |||
| 1294 | Ga0207640_11158955 | |||
| 1295 | Ga0207658_10317607 | |||
| 1296 | Ga0207658_10632690 | |||
| 1297 | Ga0207677_10011044 | |||
| 1298 | Ga0207677_10091669 | |||
| 1299 | Ga0207703_10400935 | |||
| 1300 | Ga0207639_10085807 | |||
| 1301 | Ga0207639_10127272 | |||
| 1302 | Ga0207639_10203783 | |||
| 1303 | Ga0207678_10010552 | |||
| 1304 | Ga0207678_10022770 | |||
| 1305 | Ga0207678_10130148 | |||
| 1306 | Ga0207678_10162237 | |||
| 1307 | Ga0207678_10203891 | |||
| 1308 | Ga0207678_10585696 | |||
| 1309 | Ga0207678_10943429 | |||
| 1310 | Ga0207708_10184300 | |||
| 1311 | Ga0207702_10167160 | |||
| 1312 | Ga0207702_10628896 | |||
| 1313 | Ga0207702_11400893 | |||
| 1314 | Ga0207641_10062468 | |||
| 1315 | Ga0207641_10630022 | |||
| 1316 | Ga0207648_10197558 | |||
| 1317 | Ga0207676_10388555 | |||
| 1318 | Ga0207674_10048154 | |||
| 1319 | Ga0207674_10111119 | |||
| 1320 | Ga0207675_100101117 | |||
| 1321 | Ga0207675_100111822 | |||
| 1322 | Ga0207675_100199723 | |||
| 1323 | Ga0207683_10014660 | |||
| 1324 | Ga0207683_10044880 | |||
| 1325 | Ga0207683_10055468 | |||
| 1326 | Ga0207683_10872965 | |||
| 1327 | Ga0207698_10021492 | |||
| 1328 | Ga0207698_11146487 | |||
| 1329 | Ga0268266_10016992 | |||
| 1330 | Ga0268266_10019219 | |||
| 1331 | Ga0268266_10088956 | |||
| 1332 | Ga0268265_10735162 | |||
| 1333 | Ga0268264_10917113 | |||
| 1334 | Ga0268264_11060705 | |||
| 1335 | Ga0265328_10029964 | |||
| 1336 | Ga0265316_10753675 | |||
| 1337 | Ga0307513_10193775 | |||
| 1338 | Ga0265342_10079738 | |||
| 1339 | Ga0307516_10213055 | |||
| 1340 | Ga0307405_10229563 | |||
| 1341 | Ga0307405_10389791 | |||
| 1342 | Ga0307406_10067061 | |||
| 1343 | Ga0307407_10874170 | |||
| 1344 | Ga0307411_10015152 | |||
| 1345 | Ga0307411_10332095 | |||
| 1346 | Ga0307415_100020263 | |||
| 1347 | Ga0307415_100058419 | |||
| 1348 | Ga0307415_100067328 | |||
| 1349 | Ga0307510_10009746 | |||
| 1350 | Ga0315911_1000009 | |||
| 1351 | Ga0373926_0069057 | |||
| 1352 | Ga0373929_0064173 | |||
| 1353 | Ga0373940_0120457 | |||
| 1354 | Ga0373923_0000827 | |||
| 1355 | Ga0373923_0017518 | |||
| 1356 | Ga0373932_0105103 | |||
| 1357 | Ga0373954_0000634 | |||
| 1358 | Ga0373954_0108046 | |||
| 1359 | Ga0373957_0000200 | |||
| 1360 | Ga0373943_0082196 | |||
| 1361 | Ga0373943_0230692 | |||
| 1362 | Ga0373946_0005979 | |||
| 1363 | Ga0373946_0007758 | |||
| 1364 | Ga0373946_0078970 | |||
| 1365 | Ga0373955_0014279 | |||
| 1366 | Ga0373961_0122618 | |||
| 1367 | Ga0373962_0114226 | |||
| 1368 | Ga0373924_0047567 | |||
| 1369 | Ga0373924_0052392 | |||
| 1370 | Ga0373931_0050522 | |||
| 1371 | Ga0373935_0021939 | |||
| 1372 | Ga0373935_0103925 | |||
| 1373 | Ga0373927_0001513 | |||
| 1374 | Ga0373927_0023260 | |||
| 1375 | Ga0373927_0026102 | |||
| 1376 | Ga0373927_0044399 | |||
| 1377 | Ga0373927_0054881 | |||
| 1378 | Ga0373933_0002159 | |||
| 1379 | Ga0373933_0055833 | |||
| 1380 | Ga0373947_0014848 | |||
| 1381 | Ga0373947_0019002 | |||
| 1382 | Ga0373947_0137638 | |||
| 1383 | Ga0373937_0014785 | |||
| 1384 | Ga0373937_0035531 | |||
| 1385 | Ga0372808_001672 | |||
| 1386 | Ga0373925_0006671 | |||
| 1387 | Ga0373925_0069441 | |||
| 1388 | Ga0395899_0013951 | |||
| 1389 | Ga0395899_0153576 | |||
| 1390 | Ga0395899_0362797 | |||
| 1391 | Ga0395900_0000513 | |||
| 1392 | Ga0395900_0035219 | |||
| 1393 | Ga0395900_0061053 | |||
| 1394 | Ga0395900_0387966 | |||
| 1395 | Ga0395900_0656086 | |||
| 1396 | Ga0395900_1109174 | |||
| 1397 | Ga0395898_0081232 | |||
| 1398 | Ga0395898_0175025 | |||
| 1399 | Ga0395898_0178184 | |||
| 1400 | Ga0395905_0189218 | |||
| 1401 | Ga0395905_0754576 | |||
| 1402 | Ga0395901_0000019 | |||
| 1403 | Ga0395901_0248570 | |||
| 1404 | Ga0395901_0822174 | |||
| 1405 | Ga0395901_0835613 | |||
| 1406 | Ga0436365_0172063 | |||
| 1407 | Ga0436365_1338213 | |||
| 1408 | Ga0436360_0861292 | |||
| 1409 | Ga0436360_0985690 | |||
| 1410 | Ga0436361_0809888 | |||
| 1411 | Ga0436361_1180484 | |||
| 1412 | Ga0436363_0288172 | |||
| 1413 | Ga0436362_0350328 | |||
| 1414 | Ga0451802_1429738 | |||
| 1415 | Ga0451853_1746509 | |||
| 1416 | Ga0439449_0006107 | |||
| 1417 | Ga0439458_0099349 | |||
| 1418 | Ga0466963_0132864 | |||
| 1419 | Ga0453684_0275687 | |||
| 1420 | Ga0466970_0247224 | |||
| 1421 | Ga0466967_0530472 | |||
| 1422 | Ga0495617_000034 | |||
| 1423 | Ga0495617_000099 | |||
| 1424 | Ga0495617_019330 | |||
| 1425 | Ga0495617_067182 | |||
| 1426 | Ga0495627_000208 | |||
| 1427 | Ga0495627_041161 | |||
| 1428 | Ga0495627_052601 | |||
| 1429 | Ga0495627_090729 | |||
| 1430 | Ga0495592_0002897 | |||
| 1431 | Ga0495603_0013589 | |||
| 1432 | Ga0495603_0017151 | |||
| 1433 | Ga0495603_0022018 | |||
| 1434 | Ga0495603_0034420 | |||
| 1435 | Ga0495603_0238001 | |||
| 1436 | Ga0495590_0000087 | |||
| 1437 | Ga0495590_0000195 | |||
| 1438 | Ga0495591_000272 | |||
| 1439 | Ga0495629_0002158 | |||
| 1440 | Ga0495629_0004330 | |||
| 1441 | Ga0495629_0012878 | |||
| 1442 | Ga0495629_0051582 | |||
| 1443 | Ga0495629_0368919 | |||
| 1444 | Ga0495629_0420767 | |||
| 1445 | Ga0495638_0007685 | |||
| 1446 | Ga0495638_0054741 | |||
| 1447 | Ga0495638_0065792 | |||
| 1448 | Ga0495638_0442641 | |||
| 1449 | Ga0495641_0019593 | |||
| 1450 | Ga0495653_0017446 | |||
| 1451 | Ga0495653_0029478 | |||
| 1452 | Ga0495650_0008607 | |||
| 1453 | Ga0495580_0006344 | |||
| 1454 | Ga0495580_0011640 | |||
| 1455 | Ga0495580_0210368 | |||
| 1456 | Ga0495582_0005475 | |||
| 1457 | Ga0495582_0201669 | |||
| 1458 | Ga0495605_0000151 | |||
| 1459 | Ga0495605_0016177 | |||
| 1460 | Ga0495605_0044051 | |||
| 1461 | Ga0495605_0064313 | |||
| 1462 | Ga0495639_0000750 | |||
| 1463 | Ga0495639_0047445 | |||
| 1464 | Ga0495639_0076527 | |||
| 1465 | Ga0495639_0189724 | |||
| 1466 | Ga0495662_0002275 | |||
| 1467 | Ga0495664_0136401 | |||
| 1468 | Ga0495584_0000011 | |||
| 1469 | Ga0495584_0000122 | |||
| 1470 | Ga0495584_0000253 | |||
| 1471 | Ga0495584_0001524 | |||
| 1472 | Ga0495584_0031573 | |||
| 1473 | Ga0495584_0062179 | |||
| 1474 | Ga0495584_0096553 | |||
| 1475 | Ga0495584_0266080 | |||
| 1476 | Ga0495585_0000106 | |||
| 1477 | Ga0495585_0000970 | |||
| 1478 | Ga0495585_0001684 | |||
| 1479 | Ga0495585_0004203 | |||
| 1480 | Ga0495585_0005123 | |||
| 1481 | Ga0495585_0017233 | |||
| 1482 | Ga0495585_0018938 | |||
| 1483 | Ga0495585_0019025 | |||
| 1484 | Ga0495585_0019036 | |||
| 1485 | Ga0495585_0029478 | |||
| 1486 | Ga0495585_0031323 | |||
| 1487 | Ga0495585_0066304 | |||
| 1488 | Ga0495585_0078345 | |||
| 1489 | Ga0495585_0185981 | |||
| 1490 | Ga0495585_0255932 | |||
| 1491 | Ga0495594_0001313 | |||
| 1492 | Ga0495594_0003799 | |||
| 1493 | Ga0495594_0005644 | |||
| 1494 | Ga0495594_0017845 | |||
| 1495 | Ga0495594_0375214 | |||
| 1496 | Ga0495594_0424400 | |||
| 1497 | Ga0495596_0004070 | |||
| 1498 | Ga0495596_0007869 | |||
| 1499 | Ga0495596_0008479 | |||
| 1500 | Ga0495596_0015995 | |||
| 1501 | Ga0495596_0036879 | |||
| 1502 | Ga0495596_0041152 | |||
| 1503 | Ga0495596_0098748 | |||
| 1504 | Ga0495607_0002166 | |||
| 1505 | Ga0495607_0002563 | |||
| 1506 | Ga0495607_0003376 | |||
| 1507 | Ga0495607_0012182 | |||
| 1508 | Ga0495607_0019414 | |||
| 1509 | Ga0495607_0030467 | |||
| 1510 | Ga0495607_0072805 | |||
| 1511 | Ga0495607_0156498 | |||
| 1512 | Ga0495607_0314709 | |||
| 1513 | Ga0495583_0000204 | |||
| 1514 | Ga0495583_0001947 | |||
| 1515 | Ga0495583_0003375 | |||
| 1516 | Ga0495583_0011654 | |||
| 1517 | Ga0495583_0012646 | |||
| 1518 | Ga0495583_0015773 | |||
| 1519 | Ga0495583_0033630 | |||
| 1520 | Ga0495583_0087005 | |||
| 1521 | Ga0495583_0093991 | |||
| 1522 | Ga0495583_0101745 | |||
| 1523 | Ga0495583_0245142 | |||
| 1524 | Ga0495606_0003022 | |||
| 1525 | Ga0495606_0009057 | |||
| 1526 | Ga0495606_0037190 | |||
| 1527 | Ga0495606_0042285 | |||
| 1528 | Ga0495606_0061305 | |||
| 1529 | Ga0495606_0070449 | |||
| 1530 | Ga0495606_0073789 | |||
| 1531 | Ga0495606_0078340 | |||
| 1532 | Ga0495606_0089486 | |||
| 1533 | Ga0495606_0104556 | |||
| 1534 | Ga0495606_0189315 | |||
| 1535 | Ga0495608_0002218 | |||
| 1536 | Ga0495608_0364113 | |||
| 1537 | Ga0495610_0000010 | |||
| 1538 | Ga0495610_0001106 | |||
| 1539 | Ga0495616_0000557 | |||
| 1540 | Ga0495616_0001082 | |||
| 1541 | Ga0495616_0001767 | |||
| 1542 | Ga0495616_0004439 | |||
| 1543 | Ga0495616_0004788 | |||
| 1544 | Ga0495616_0008025 | |||
| 1545 | Ga0495616_0029968 | |||
| 1546 | Ga0495616_0091184 | |||
| 1547 | Ga0495616_0106768 | |||
| 1548 | Ga0495616_0124937 | |||
| 1549 | Ga0495618_0153370 | |||
| 1550 | Ga0495618_0373451 | |||
| 1551 | Ga0495620_0003033 | |||
| 1552 | Ga0495620_0070690 | |||
| 1553 | Ga0495628_0038487 | |||
| 1554 | Ga0495628_0296188 | |||
| 1555 | Ga0495630_0046427 | |||
| 1556 | Ga0495630_0403815 | |||
| 1557 | Ga0495631_0000551 | |||
| 1558 | Ga0495631_0000979 | |||
| 1559 | Ga0495631_0001182 | |||
| 1560 | Ga0495631_0002486 | |||
| 1561 | Ga0495631_0014266 | |||
| 1562 | Ga0495631_0015202 | |||
| 1563 | Ga0495631_0020921 | |||
| 1564 | Ga0495631_0041332 | |||
| 1565 | Ga0495631_0054873 | |||
| 1566 | Ga0495631_0060127 | |||
| 1567 | Ga0495631_0130590 | |||
| 1568 | Ga0495631_0225107 | |||
| 1569 | Ga0495632_0000592 | |||
| 1570 | Ga0495632_0001130 | |||
| 1571 | Ga0495632_0002839 | |||
| 1572 | Ga0495632_0005473 | |||
| 1573 | Ga0495637_0000013 | |||
| 1574 | Ga0495637_0000071 | |||
| 1575 | Ga0495637_0032837 | |||
| 1576 | Ga0495637_0149804 | |||
| 1577 | Ga0495643_0009062 | |||
| 1578 | Ga0495643_0016864 | |||
| 1579 | Ga0495643_0082769 | |||
| 1580 | Ga0495643_0171529 | |||
| 1581 | Ga0495643_0173629 | |||
| 1582 | Ga0495644_0007520 | |||
| 1583 | Ga0495644_0011332 | |||
| 1584 | Ga0495644_0014082 | |||
| 1585 | Ga0495644_0029663 | |||
| 1586 | Ga0495644_0029840 | |||
| 1587 | Ga0495648_0000410 | |||
| 1588 | Ga0495648_0001182 | |||
| 1589 | Ga0495648_0010568 | |||
| 1590 | Ga0495648_0012573 | |||
| 1591 | Ga0495648_0021834 | |||
| 1592 | Ga0495648_0200071 | |||
| 1593 | Ga0495663_0084016 | |||
| 1594 | Ga0495666_0004146 | |||
| 1595 | Ga0495666_0020165 | |||
| 1596 | Ga0495642_0000127 | |||
| 1597 | Ga0495642_0000327 | |||
| 1598 | Ga0495642_0004101 | |||
| 1599 | Ga0495642_0009709 | |||
| 1600 | Ga0495642_0011532 | |||
| 1601 | Ga0495642_0020857 | |||
| 1602 | Ga0495642_0024380 | |||
| 1603 | Ga0495642_0045565 | |||
| 1604 | Ga0495642_0052619 | |||
| 1605 | Ga0495642_0088070 | |||
| 1606 | Ga0495642_0134778 | |||
| 1607 | Ga0495652_0008518 | |||
| 1608 | Ga0495652_0034244 | |||
| 1609 | Ga0495652_0038809 | |||
| 1610 | Ga0495652_0245712 | |||
| 1611 | Ga0495654_0000002 | |||
| 1612 | Ga0495654_0017562 | |||
| 1613 | Ga0495654_0022822 | |||
| 1614 | Ga0495654_0277367 | |||
| 1615 | Ga0495665_0007507 | |||
| 1616 | Ga0495665_0157783 | |||
| 1617 | Ga0495665_0171516 | |||
| 1618 | Ga0495640_0005616 | |||
| 1619 | Ga0495640_0007861 | |||
| 1620 | Ga0495586_0001930 | |||
| 1621 | Ga0495586_0015457 | |||
| 1622 | Ga0495587_0009572 | |||
| 1623 | Ga0495587_0025519 | |||
| 1624 | Ga0495609_0003245 | |||
| 1625 | Ga0495609_0010758 | |||
| 1626 | Ga0495609_0013376 | |||
| 1627 | Ga0495609_0029965 | |||
| 1628 | Ga0495609_0043776 | |||
| 1629 | Ga0495609_0049508 | |||
| 1630 | Ga0495609_0080498 | |||
| 1631 | Ga0495609_0114220 | |||
| 1632 | Ga0495597_0001550 | |||
| 1633 | Ga0495597_0013576 | |||
| 1634 | Ga0495597_0016559 | |||
| 1635 | Ga0495597_0050686 | |||
| 1636 | Ga0495645_0061188 | |||
| 1637 | Ga0495645_0188451 | |||
| 1638 | Ga0495622_0002234 | |||
| 1639 | Ga0495622_0005946 | |||
| 1640 | Ga0495622_0029071 | |||
| 1641 | Ga0495622_0285102 | |||
| 1642 | Ga0495633_0001530 | |||
| 1643 | Ga0495633_0003058 | |||
| 1644 | Ga0495633_0003182 | |||
| 1645 | Ga0495633_0007143 | |||
| 1646 | Ga0495633_0034047 | |||
| 1647 | Ga0495633_0063176 | |||
| 1648 | Ga0495633_0088896 | |||
| 1649 | Ga0495633_0117606 | |||
| 1650 | Ga0495667_0009980 | |||
| 1651 | Ga0495667_0024798 | |||
| 1652 | Ga0495667_0027230 | |||
| 1653 | Ga0495656_0008900 | |||
| 1654 | Ga0495656_0056582 | |||
| 1655 | Ga0495656_0059870 | |||
| 1656 | Ga0495656_0124220 | |||
| 1657 | Ga0495656_0125502 | |||
| 1658 | Ga0495656_0179770 | |||
| 1659 | Ga0495656_0532226 | |||
| 1660 | Ga0495668_0000964 | |||
| 1661 | Ga0495668_0001840 | |||
| 1662 | Ga0495668_0006662 | |||
| 1663 | Ga0495668_0009969 | |||
| 1664 | Ga0495668_0022516 | |||
| 1665 | Ga0495668_0032092 | |||
| 1666 | Ga0495668_0036234 | |||
| 1667 | Ga0495668_0076125 | |||
| 1668 | Ga0495668_0167715 | |||
| 1669 | Ga0495668_0203139 | |||
| 1670 | Ga0495668_0334710 | |||
| 1671 | Ga0495634_0001188 | |||
| 1672 | Ga0495634_0004312 | |||
| 1673 | Ga0495611_0003108 | |||
| 1674 | Ga0495611_0003333 | |||
| 1675 | Ga0495611_0013929 | |||
| 1676 | Ga0495611_0036925 | |||
| 1677 | Ga0495611_0042537 | |||
| 1678 | Ga0495611_0042733 | |||
| 1679 | Ga0495611_0065509 | |||
| 1680 | Ga0495611_0147430 | |||
| 1681 | Ga0495611_0229269 | |||
| 1682 | Ga0495625_0032978 | |||
| 1683 | Ga0495625_0116766 | |||
| 1684 | Ga0495625_0161287 | |||
| 1685 | Ga0495625_0302718 | |||
| 1686 | Ga0495625_0390691 | |||
| 1687 | Ga0495635_0001058 | |||
| 1688 | Ga0495635_0034215 | |||
| 1689 | Ga0495661_0000109 | |||
| 1690 | Ga0495661_0000756 | |||
| 1691 | Ga0495661_0003435 | |||
| 1692 | Ga0495661_0009524 | |||
| 1693 | Ga0495661_0012343 | |||
| 1694 | Ga0495661_0029379 | |||
| 1695 | Ga0495661_0065401 | |||
| 1696 | Ga0495661_0130086 | |||
| 1697 | Ga0495661_0132154 | |||
| 1698 | Ga0495661_0366347 | |||
| 1699 | Ga0495588_0001308 | |||
| 1700 | Ga0495588_0004018 | |||
| 1701 | Ga0495588_0008498 | |||
| 1702 | Ga0495588_0029430 | |||
| 1703 | Ga0495588_0046506 | |||
| 1704 | Ga0495588_0082244 | |||
| 1705 | Ga0495588_0199455 | |||
| 1706 | Ga0495588_0452624 | |||
| 1707 | Ga0495657_0011523 | |||
| 1708 | Ga0495599_0003523 | |||
| 1709 | Ga0495623_0003821 | |||
| 1710 | Ga0495623_0006259 | |||
| 1711 | Ga0495646_0000934 | |||
| 1712 | Ga0495646_0040703 | |||
| 1713 | Ga0495647_0033716 | |||
| 1714 | Ga0495658_0005872 | |||
| 1715 | Ga0495669_0000428 | |||
| 1716 | Ga0495669_0003196 | |||
| 1717 | Ga0495669_0005017 | |||
| 1718 | Ga0495669_0007731 | |||
| 1719 | Ga0495669_0026347 | |||
| 1720 | Ga0495669_0028325 | |||
| 1721 | Ga0495669_0280629 | |||
| 1722 | Ga0495613_0023353 | |||
| 1723 | Ga0495613_0048777 | |||
| 1724 | Ga0495624_0025521 | |||
| 1725 | Ga0495670_0000682 | |||
| 1726 | Ga0495670_0002820 | |||
| 1727 | Ga0495670_0004362 | |||
| 1728 | Ga0495670_0049045 | |||
| 1729 | Ga0495670_0052263 | |||
| 1730 | Ga0495670_0092600 | |||
| 1731 | Ga0495670_0095577 | |||
| 1732 | Ga0495670_0175008 | |||
| 1733 | Ga0495670_0194324 | |||
| 1734 | Ga0495670_0211159 | |||
| 1735 | Ga0495671_0000002 | |||
| 1736 | Ga0495671_0000188 | |||
| 1737 | Ga0495671_0007556 | |||
| 1738 | Ga0495671_0011166 | |||
| 1739 | Ga0495671_0023503 | |||
| 1740 | Ga0495671_0139708 | |||
| 1741 | Ga0495649_0000592 | |||
| 1742 | Ga0495649_0001690 | |||
| 1743 | Ga0495649_0109066 | |||
| 1744 | Ga0495589_0000270 | |||
| 1745 | Ga0495589_0000896 | |||
| 1746 | Ga0495589_0008749 | |||
| 1747 | Ga0495589_0014272 | |||
| 1748 | Ga0495589_0025680 | |||
| 1749 | Ga0495589_0063815 | |||
| 1750 | Ga0495589_0087135 | |||
| 1751 | Ga0495589_0122986 | |||
| 1752 | Ga0495589_0173172 | |||
| 1753 | Ga0495600_0001795 | |||
| 1754 | Ga0495600_0227149 | |||
| 1755 | Ga0495600_0296256 | |||
| 1756 | Ga0495660_0004522 | |||
| 1757 | Ga0495660_0009360 | |||
| 1758 | Ga0495660_0014959 | |||
| 1759 | Ga0495660_0015117 | |||
| 1760 | Ga0495660_0029577 | |||
| 1761 | Ga0495581_0000567 | |||
| 1762 | Ga0495581_0085193 | |||
| 1763 | Ga0495604_0013094 | |||
| 1764 | Ga0495604_0056371 | |||
| 1765 | Ga0495604_0091763 | |||
| 1766 | Ga0495674_0003114 | |||
| 1767 | Ga0495674_0007182 | |||
| 1768 | Ga0495674_0015961 | |||
| 1769 | Ga0495674_0269727 | |||
| 1770 | Ga0495672_0000067 | |||
| 1771 | Ga0495672_0017620 | |||
| 1772 | Ga0495672_0046495 | |||
| 1773 | Ga0495676_0000133 | |||
| 1774 | Ga0495676_0011969 | |||
| 1775 | Ga0495676_0088630 | |||
| 1776 | Ga0495676_0104552 | |||
| 1777 | Ga0495680_0029493 | |||
| 1778 | Ga0495680_0233868 | |||
| 1779 | Ga0495683_0000088 | |||
| 1780 | Ga0495683_0000348 | |||
| 1781 | Ga0495683_0017183 | |||
| 1782 | Ga0495683_0018228 | |||
| 1783 | Ga0495683_0033505 | |||
| 1784 | Ga0495683_0089908 | |||
| 1785 | Ga0495683_0104787 | |||
| 1786 | Ga0495687_000007 | |||
| 1787 | Ga0495687_001998 | |||
| 1788 | Ga0495687_036483 | |||
| 1789 | Ga0495687_045422 | |||
| 1790 | Ga0495675_0001019 | |||
| 1791 | Ga0495675_0002644 | |||
| 1792 | Ga0495675_0026954 | |||
| 1793 | Ga0495677_0000524 | |||
| 1794 | Ga0495677_0005313 | |||
| 1795 | Ga0495677_0007899 | |||
| 1796 | Ga0495677_0012584 | |||
| 1797 | Ga0495677_0018227 | |||
| 1798 | Ga0495677_0023029 | |||
| 1799 | Ga0495677_0028180 | |||
| 1800 | Ga0495677_0054320 | |||
| 1801 | Ga0495677_0138986 | |||
| 1802 | Ga0495677_0142559 | |||
| 1803 | Ga0495677_0171467 | |||
| 1804 | Ga0495677_0303752 | |||
| 1805 | Ga0495679_003371 | |||
| 1806 | Ga0495679_005786 | |||
| 1807 | Ga0495679_008614 | |||
| 1808 | Ga0495685_002234 | |||
| 1809 | Ga0495685_010013 | |||
| 1810 | Ga0495685_064187 | |||
| 1811 | Ga0495673_0000005 | |||
| 1812 | Ga0495673_0098160 | |||
| 1813 | Ga0495681_0001742 | |||
| 1814 | Ga0495681_0019307 | |||
| 1815 | Ga0495681_0023218 | |||
| 1816 | Ga0495681_0023251 | |||
| 1817 | Ga0495681_0033497 | |||
| 1818 | Ga0495681_0047331 | |||
| 1819 | Ga0495681_0086936 | |||
| 1820 | Ga0495681_0139715 | |||
| 1821 | Ga0495681_0176531 | |||
| 1822 | Ga0495684_0172025 | |||
| 1823 | Ga0495686_0043573 | |||
| 1824 | Ga0495686_0065615 | |||
| 1825 | Ga0495686_0122044 | |||
| 1826 | Ga0495686_0197996 | |||
| 1827 | Ga0495593_0001714 | |||
| 1828 | Ga0495593_0002295 | |||
| 1829 | Ga0495593_0007370 | |||
| 1830 | Ga0495602_0004790 | |||
| 1831 | Ga0495602_0048110 | |||
| 1832 | Ga0495614_0008411 | |||
| 1833 | Ga0495614_0306796 | |||
| 1834 | Ga0495615_0018636 | |||
| 1835 | Ga0495615_0062105 | |||
| 1836 | Ga0495626_0004702 | |||
| 1837 | Ga0495626_0021843 | |||
| 1838 | Ga0495626_0022616 | |||
| 1839 | Ga0495626_0022823 | |||
| 1840 | Ga0495626_0025279 | |||
| 1841 | Ga0495626_0064476 | |||
| 1842 | Ga0495626_0087048 | |||
| 1843 | Ga0496100_0000756 | |||
| 1844 | Ga0496100_0013579 | |||
| 1845 | Ga0496100_0035542 | |||
| 1846 | Ga0496100_0130104 | |||
| 1847 | Ga0496101_0000383 | |||
| 1848 | Ga0496101_0000875 | |||
| 1849 | Ga0496101_0227712 | |||
| 1850 | Ga0496102_0000200 | |||
| 1851 | Ga0496102_0000313 | |||
| 1852 | Ga0496102_0009695 | |||
| 1853 | Ga0496102_0037392 | |||
| 1854 | Ga0496102_0103898 | |||
| 1855 | Ga0496102_0144879 | |||
| 1856 | Ga0496102_0248458 | |||
| 1857 | Ga0496102_0260370 | |||
| 1858 | Ga0496102_0826319 | |||
| 1859 | Ga0496103_0006163 | |||
| 1860 | Ga0496103_0045139 | |||
| 1861 | Ga0496103_0065961 | |||
| 1862 | Ga0496104_0036083 | |||
| 1863 | Ga0496104_0208598 | |||
| 1864 | Ga0496104_0259806 | |||
| 1865 | Ga0496105_0015561 | |||
| 1866 | Ga0496105_0017743 | |||
| 1867 | Ga0496105_0101037 | |||
| 1868 | Ga0496105_0101141 | |||
| 1869 | Ga0496105_0406946 | |||
| 1870 | Ga0496105_0607796 | |||
| 1871 | Ga0496106_0016638 | |||
| 1872 | Ga0496106_0132381 | |||
| 1873 | Ga0496106_0375713 | |||
| 1874 | Ga0496106_0520999 | |||
| 1875 | Ga0496107_0015387 | |||
| 1876 | Ga0496107_0112310 | |||
| 1877 | Ga0496107_0149477 | |||
| 1878 | Ga0496107_0289462 | |||
| 1879 | Ga0496107_0406021 | |||
| 1880 | Ga0496108_0002192 | |||
| 1881 | Ga0496108_0059917 | |||
| 1882 | Ga0496108_0330641 | |||
| 1883 | Ga0496108_0542880 | |||
| 1884 | Ga0496109_0008485 | |||
| 1885 | Ga0496109_0010462 | |||
| 1886 | Ga0496109_0079860 | |||
| 1887 | Ga0496109_0189821 | |||
| 1888 | Ga0496110_0000024 | |||
| 1889 | Ga0496110_0026863 | |||
| 1890 | Ga0496110_0077327 | |||
| 1891 | Ga0496110_0172316 | |||
| 1892 | Ga0496111_0008455 | |||
| 1893 | Ga0496111_0018238 | |||
| 1894 | Ga0496111_0037599 | |||
| 1895 | Ga0496111_0083541 | |||
| 1896 | Ga0496111_0202373 | |||
| 1897 | Ga0496111_0211959 | |||
| 1898 | Ga0496112_0016391 | |||
| 1899 | Ga0496112_0109577 | |||
| 1900 | Ga0496113_0001312 | |||
| 1901 | Ga0496113_0004620 | |||
| 1902 | Ga0496113_0082648 | |||
| 1903 | Ga0496114_0004461 | |||
| 1904 | Ga0496114_0108754 | |||
| 1905 | Ga0496114_0222284 | |||
| 1906 | Ga0496114_0227293 | |||
| 1907 | Ga0496115_0009478 | |||
| 1908 | Ga0496115_0039849 | |||
| 1909 | Ga0496115_0042842 | |||
| 1910 | Ga0496115_0044759 | |||
| 1911 | Ga0496115_0083769 | |||
| 1912 | Ga0496115_0096445 | |||
| 1913 | Ga0496115_0196427 | |||
| 1914 | Ga0496116_0108802 | |||
| 1915 | Ga0496118_0045574 | |||
| 1916 | Ga0496119_0308491 | |||
| 1917 | Ga0496120_0289418 | |||
| 1918 | Ga0496121_0000330 | |||
| 1919 | Ga0496121_0118895 | |||
| 1920 | Ga0496121_0143226 | |||
| 1921 | Ga0496121_0228466 | |||
| 1922 | Ga0496121_0236094 | |||
| 1923 | Ga0496122_0001042 | |||
| 1924 | Ga0496122_0011608 | |||
| 1925 | Ga0496123_0113149 | |||
| 1926 | Ga0496123_0115403 | |||
| 1927 | Ga0496124_0011638 | |||
| 1928 | Ga0496124_0300059 | |||
| 1929 | Ga0496125_0159825 | |||
| 1930 | Ga0496126_0003590 | |||
| 1931 | Ga0496126_0004961 | |||
| 1932 | Ga0496126_0011183 | |||
| 1933 | Ga0496126_0014351 | |||
| 1934 | Ga0496126_0038390 | |||
| 1935 | Ga0496126_0066220 | |||
| 1936 | Ga0496126_0141728 | |||
| 1937 | Ga0496126_0221290 | |||
| 1938 | Ga0496126_0421703 | |||
| 1939 | Ga0496126_0508953 | |||
| 1940 | Ga0495678_000161 | |||
| 1941 | Ga0495678_000355 | |||
| 1942 | Ga0495678_001988 | |||
| 1943 | Ga0495682_0000875 | |||
| 1944 | Ga0495682_0005708 | |||
| 1945 | Ga0495682_0016993 | |||
| 1946 | Ga0495682_0032460 | |||
| 1947 | Ga0495682_0068855 | |||
| 1948 | Ga0495682_0099785 | |||
| 1949 | Ga0501034_0000624 | |||
| 1950 | Ga0501037_0001018 | |||
| 1951 | Ga0501038_0024748 | |||
| 1952 | Ga0501039_0002397 | |||
| 1953 | Ga0501039_1186841 | |||
| 1954 | Ga0501047_0004540 | |||
| 1955 | Ga0501067_0002495 | |||
| 1956 | Ga0501073_0031098 | |||
| 1957 | Ga0501080_0000032 | |||
| 1958 | Ga0501035_0000334 | |||
| 1959 | Ga0501035_0000676 | |||
| 1960 | Ga0501044_0000006 | |||
| 1961 | Ga0501044_0375652 | |||
| 1962 | Ga0501045_0069454 | |||
| 1963 | nmdc:mga03n38_12701_c1 | |||
| 1964 | nmdc:mga03n38_35358_c1 | |||
| 1965 | nmdc:mga00v17_355964_c1 | |||
| 1966 | nmdc:mga0yw44_148399_c1 | |||
| 1967 | nmdc:mga0yw44_162553_c1 | |||
| 1968 | nmdc:mga0yw44_259422_c1 | |||
| 1969 | nmdc:mga0k408_107657_c1 | |||
| 1970 | nmdc:mga06z11_160840_c1 | |||
| 1971 | nmdc:mga06z11_5269_c1 | |||
| 1972 | nmdc:mga06z11_531070_c1 | |||
| 1973 | nmdc:mga04h51_216655_c1 | |||
| 1974 | nmdc:mga07m45_283840_c1 | |||
| 1975 | nmdc:mga07m45_53498_c1 | |||
| 1976 | nmdc:mga05p37_58216_c1 | |||
| 1977 | nmdc:mga0n895_76791_c1 | |||
| 1978 | nmdc:mga0rr50_497561_c1 | |||
| 1979 | nmdc:mga0sz30_248060_c1 | |||
| 1980 | Ga0495601_0016288 | |||
| 1981 | Ga0495601_0177990 | |||
| 1982 | Ga0500635_0027844 | |||
| 1983 | Ga0495655_0004786 | |||
| 1984 | Ga0495655_0095203 | |||
| 1985 | Ga0495595_0000335 | |||
| 1986 | Ga0495619_0001292 | |||
| 1987 | Ga0500647_0014839 | |||
| 1988 | Ga0500583_0068458 | |||
| 1989 | Ga0500651_0004019 | |||
| 1990 | Ga0500566_0011427 | |||
| 1991 | Ga0500641_0076732 | |||
| 1992 | Ga0500650_0131221 | |||
| 1993 | Ga0500554_018197 | |||
| 1994 | Ga0500554_131659 | |||
| 1995 | Ga0500556_0047237 | |||
| 1996 | Ga0500562_063611 | |||
| 1997 | Ga0500592_027325 | |||
| 1998 | Ga0500595_000468 | |||
| 1999 | Ga0500595_005272 | |||
| 2000 | Ga0500595_013495 | |||
| 2001 | Ga0500595_025974 | |||
| 2002 | Ga0500595_035010 | |||
| 2003 | Ga0500597_205653 | |||
| 2004 | Ga0500618_000419 | |||
| 2005 | Ga0500658_0130238 | |||
| 2006 | Ga0500568_0003017 | |||
| 2007 | Ga0500579_190500 | |||
| 2008 | Ga0500589_111338 | |||
| 2009 | Ga0500604_0056262 | |||
| 2010 | Ga0500604_0105218 | |||
| 2011 | Ga0500622_0041926 | |||
| 2012 | Ga0500622_0217827 | |||
| 2013 | Ga0500633_0094403 | |||
| 2014 | Ga0500638_002107 | |||
| 2015 | Ga0500638_068294 | |||
| 2016 | Ga0500637_0000546 | |||
| 2017 | Ga0500661_000782 | |||
| 2018 | 2513659354 | |||
| 2019 | 2513672836 | |||
| 2020 | 2513861725 | |||
| 2021 | 2513921384 | |||
| 2022 | 2517893702 | |||
| 2023 | 2524469935 | |||
| 2024 | 2524535897 | |||
| 2025 | 2643801567 | |||
| 2026 | 2644471372 | |||
| 2027 | 2671693986 | |||
| 2028 | 2728752844 | |||
| 2029 | 2857568876 | |||
| 2030 | 2885389614 | |||
| 2031 | 2902409270 | |||
| 2032 | 2903756283 | |||
| 2033 | 2903756677 | |||
| 2034 | 2903774319 | |||
| 2035 | 2904701399 | |||
| 2036 | 2906641898 | |||
| 2037 | 2906666089 | |||
| 2038 | 3005478882 | |||
| 2039 | 643592634 | |||
| 2040 | 8056687755 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tk2-assembly3.cif.gz_C | crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis | 0.9021 | 79 | 166 |
| 4hcf-assembly2.cif.gz_B | crystal structure of uncharacterized cupredoxin-like domain protein cupredoxin_1 with copper bound from bacillus anthracis | 0.8931 | 79 | 166 |
| 5tk2-assembly3.cif.gz_C | crystal structure of uncharacterized cupredoxin-like domain protein from bacillus anthracis | 0.8731 | 79 | 166 |
| 4w9z-assembly1.cif.gz_A | crystal structure of the periplasmic domain of subunit ii of cytochrome oxidase (coxb) of bradyrhizobium japonicum | 0.8643 | 79 | 177 |
| 5u7n-assembly7.cif.gz_G | crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop | 0.863 | 53 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8I6V2_60_165_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.9022 | 95 | 173 | 2.60.40.420 |
| af_A0A1D6ED90_406_498_2.60.40.420 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8956 | 93 | 174 | 2.60.40.420 |
| 4hcfA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8801 | 79 | 166 | 2.60.40.420 |
| 5wehH02 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8764 | 93 | 178 | 2.60.40.420 |
| 5u7nF00 | Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - | 0.8729 | 54 | 167 | 2.60.40.420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A658J8J6-F1-model_v4 | deleted | 0.9405 | 82 | 167 |
|
| AF-A0A1G1JPU9-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9379 | 79 | 167 |
GO:0004129
GO:0005507 GO:0005886 |
| AF-A0A838V9E3-F1-model_v4 | Cupredoxin domain-containing protein | 0.9338 | 79 | 167 |
GO:0004129
GO:0005507 GO:0016020 GO:0030313 |
| AF-A0A4R1LBV1-F1-model_v4 | Cytochrome c oxidase subunit 2 | 0.9316 | 79 | 167 |
GO:0004129
GO:0005507 GO:0016020 GO:0042773 |
| AF-A0A6I7WQ91-F1-model_v4 | Cytochrome oxidase subunit II copper A binding domain-containing protein | 0.9308 | 81 | 177 |
GO:0004129
GO:0005507 GO:0016020 GO:0030313 |